2Q7CA

Crystal structure of iqn17
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibiting HIV Entry: Discovery of D-Peptide Inhibitors that Target the Gp41 Coiled-Coil Pocket
pubmed doi rcsb
molecule tags Viral protein
molecule keywords fusion protein between yeast variant GCN4 and HIVgp41
total genus 20
structure length 45
sequence length 45
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2q7cA00
5AVTB 2R32A 1H88A 3L37A 1S9KD 3M91A 1J2JB 1GTWA 3VMXA 1NWQA 1CI6A 3TNUA 5AVZB 2W27A 5APXA 5CMZA 5APQA 2E43A 3A3YB 2WPSA 2Q3IA 2BASA 3L35A 2WTYA 3P7KA 1HUCA 3NMDA 4C46A 3MD0A 1FOSF 3A7OA 3B8EB 4JYBA 1HWTC 2P67A 2YO2A 1JUNA 1YYCA 5AW9B 2P2UA 2Z5HA 4GT1A 3TNUB 3MGNA 2N9BA 4AQRD 1MUUA 3A2AA 2R3CA 1H8AA 1H89A 1DH3A 1IO4A 2Q7CA 3M0AA 5APSA 4EOTA 3NTNA 1CZQA 3UIAA 3VTPC 4C7NA 4I2LC 2W6AA 3HE5A 5AVQB 2XV5A 4M3LA 5AVSB 4AYCA 1A02J 2WWWA 2R5DA 3HE5B 1GK4A 4DZOA 5AVUB 2E42A 4JYCA 5AW2B 3M06A 1GK6A 3P32A 1MV8A 3TK1A 4XE5B 3HE4A 5AVWB 3VYIA 3P8MC 3TYYA 2YO3A 4KHXA 2KP8A 2WT7A 1X8YA 2Z5IA 3L36A 5AW7B 3M0DA 5AW3B 3A5TA 2VRSA 1OXZA 4HYTB 3VN0A 4B86A 2H7HA 2R5BA 5AW8B 3T97A 3V5BA 3V4QA 2WT7B 2IPPA 1T2KC 3LIDA 5AVXB 4I6MC 4AUWA 1SLQA 5AVRB 5APTA 3KDPB 5APYA 2ZFCA 1GD2E 1HBWA 1T2KD 2WPRA 2JJLA 2XU6A 5AW6B 1G2CB 1OWAA 2QM8A 2Q5UA 4GKGA 2C9LY 3O8ZA 5AVVB 3VMYA 1CI6B 2ZXEB 3HE4B 2P7JA 5AW4B 1JNMA 5APUA 3HTKA 3VMZA 4C7NB 2QM7A 2WPQA 5AW5B 1CSBA 1KQLA 2YNYA 2XZRA 5AW1B 1GU4A 5AVYB 5APWA 3NXSA 5AW0B 4RESB 1NAFA 3IR9A 3KQGA 4LC1A 1FAVA 3M9HA 1FOSE 1GU5A 1A02F 3SWFA 3M9BA 1MFZA 3NFQA 5APVA 2C9NY 3I5CA 3LIEA 3OAKA 3V4WA 1S9KE 1SP4A 1HJBA 1GZLA
chains in the Genus database with same CATH superfamily
1QX8A 5AVTB 2B9BA 2E5YA 2R32A 3MP7B 5CCGA 2ZYDA 3L37A 5KTBA 3GLMA 1LT1A 1BCCJ 3BRVB 2PFXA 5L8RJ 2FXOA 3VMXA 5KJ7A 1M90Q 1SQVE 1BE3D 1LP1B 1LTGC 2M3EA 3TGUE 2A45G 5AVZB 1YITP 2IBZD 5CMZA 4K35A 2E43A 1NTZE 2DW3A 2WPSA 1T6AA 4PD4D 3WUTA 1OW7A 2FXPA 3L71D 2BEZF 1S3JA 1FZEA 2HODB 3HD7A 1NU1E 1HTLC 2KLUA 4OGQC 1KYOD 1HUCA 2I8DA 4QMAA 1RQVA 4H44D 4K3AA 3TF5A 1Y47A 1QEXA 1AQTA 1P84H 4JYBA 3K5BA 1JM0A 3WU2E 2YO2A 1VQ9P 1FDMA 1GMJA 1YYCA 3Q1MA 2Z5HA 3CX5I 1HVVA 2NPSC 3H1JJ 4TT3H 3IF4A 1MUUA 3H1HG 3GF3A 2Y9ZA 2JR8A 3AE4C 2XDJA 4L76A 4Y99C 1QGKB 5APSA 4EOTA 3H6PA 1CZQA 3UIAA 2WMMA 2O1JA 3V2NA 1DH3A 3KZIH 2KB7P 2JWAA 1SFCC 2QJPC 2WSFJ 1KILD 2FY8A 2PGDA 1Q81Q 2RMZA 1KN7A 1FZCC 1BDDA 3ITKA 3E1IA 1M8OB 3RL0D 1A02J 2KI7B 3Q5SA 1FZBA 2KZJA 4JF7A 1RE4C 1RF0C 3HE5B 1NTKG 3H1KD 1GK4A 2L5GB 3IN6A 4DZOA 3F89A 1Q7YQ 4U3FG 2AXTH 2C0XA 4L75A 4EYYQ 1PP9D 2KXPB 1LTSC 3N7NA 4JYCA 1NTKD 4EIJA 3CCMP 2E74B 1Q90D 1JY3O 2JP3A 2ZT9B 3HE4A 3EFFK 1PP9G 2YMYA 5AVWB 1Q86Q 1JEKA 1IO4A 3CWBD 3BCCE 4KHXA 4EDFA 3V2QA 1SQQE 1X8YA 3L36A 1VQ5P 1LT9A 5AW3B 1DIPA 3KZIE 3M9QA 2K9JB 3EFGA 1M57D 3L75G 2R5BA 5AW8B 3RL0C 4W80A 2P58A 1PFIA 5KAIH 1P84I 3RGUA 1N7SC 1N7LA 2IFMA 3RK2C 1OVVA 4WBAA 3I56P 1FZFA 1OX3A 5M1BA 2Y0CA 3CXHD 2YXQB 4MN4C 4NPFX 2FYNB 2FYZA 2ZFCA 1SQPD 3HD7B 1GD2E 3C1LA 3RL0g 3MUDA 1RE3C 1VQ6P 3P8CD 1SQXG 2IZ1A 2M8RA 1FZCA 2BEQD 3D70A 1USEA 5E79H 4IOIH 3H1JE 4H0LC 2PRRA 1JTHB 4DT0A 3L74E 1G2CB 1KYOE 2D2CC 2IFNA 1OWAA 3JC22 3P8CE 4GODA 3L71E 4HH2A 3SSUA 4OGQD 3AE2C 3LW5H 1ZR2A 3I55P 3BASA 2QA4P 2IYOA 3L70D 2ZVNB 1IJDB 1NH4A 2CPBA 4H0LB 1LTJB 2QSIA 3CXHI 5APUA 4C7NB 2QM7A 2FFDC 4L74A 4IL6E 5KLIC 2A06E 1KQLA 4D6TJ 2YNYA 1GL2C 4Y99B 2E5TA 3CWBG 1JMBA 1D7MA 1JMMA 1L0LE 2WSEH 2SPZA 1RY3A 2JKVA 3JSVC 2NPSB 4RESB 3CC4P 3KYQA 2OTJP 1EZVE 1NOHA 1XTGB 3D6YA 1G1JA 1VF5B 1GW3A 2W83C 3FXEA 1WT6A 3CCJP 1KORA 1IFDA 4I7ZB 3NFQA 5APVA 1RF0A 1RE4A 1SQQJ 2YXRB 3H1LD 5C39A 5TISE 1X79B 4PJ0H 5EFWB 2WSSH 1OVRA 4EI2A 4WY4C 4H0LD 1NTZD 2WVRA 2OGUA 2E76C 1EQ7A 3V6IA 2FYUD 4IFMA 4W7ZA 3H25A 1W2EA 4HB1A 2E74D 4LGDE 4BRYB 1NTZG 2KK7A 2H43A 2K9YA 5KAFE 1FC2C 1AV1A 2ZT9C 3CXHH 2HFED 4GOFA 4H44C 4BXLA 1S9KD 3B4SA 1CI6A 1LTJC 1YTZI 1LT9C 1PZQA 2OYOA 1KYOH 3TNUA 2CPSA 1N8RQ 3S1KA 3C9IA 4OH8B 2Q3IA 2R3SA 3CD6P 1G1IA 1N86A 2BCCE 2Q6QA 3GG2A 3H32A 2RH0A 1PPJE 3L35A 3NMDA 4WVZA 2WTYA 5KJ7D 1YQ4C 1IK7A 1FOSF 1NAYA 1ZMEC 3GHGB 4LLHA 2KS1A 3CCLP 3L73D 1JUNA 1K04A 1QLED 2K88A 1HJ0A 1NU1J 1LP1A 1LTTC 1S5LE 3PLNA 1J1EB 1L4AD 3W67A 1YBKA 3L73G 1NTMJ 3A2AA 3L73J 1SQPE 3L4FA 4ZKUA 5B5EH 1VQKP 1YIJP 1FE6A 1URQD 1NYHA 1JY3P 1SQVJ 1KB9H 1WMKA 2PAJA 1Q82Q 4C7NA 1KQGB 1N7SB 1NTKE 4I2LC 1H0TA 3RBXA 3PH0A 1AJYA 2W6AA 1ZRTD 5AVQB 3SWYA 1L0ND 1NU1K 5KLVG 1LNQA 3H1ID 4OGQB 1L2PA 4DCKA 1RF1A 2WZ7A 3OJAB 2AEMA 2R5DA 1IZNB 3MIWA 1SQBK 3PJSK 4N3YB 1JTHA 3BRTB 1SFCD 1U7JA 2K9JA 1SQVK 3KXDA 1KMIZ 5CCHA 2B87B 1SQXJ 1NKNA 2YIUC 1NJIQ 5AW2B 1UIIA 3TK1A 1MV8A 1PIXA 1E5WA 3AE8C 1NHLA 2HODA 3LW5J 3L75E 5KKZC 2FFDB 1EZVD 1PGJA 2OARA 3U59A 2P1JA 2KP8A 2O01N 4IL6H 5AW7B 2KLVA 3ABVC 1N73B 3CMEP 1SQXD 2P10A 2AXTE 1OXZA 2JDIH 3G3ZA 1FZCB 4PD4I 5CCGD 1VQPP 1TU3F 1Y9BA 2IPPA 1T2KC 1JY2P 3LIDA 2JWDA 4WY4A 5AVXB 5TJHA 1USDA 1S72P 2N1TA 2KOGA 4YXDC 2BCCJ 2KYVA 3IFMA 5AVRB 1BDCA 3FGAD 1JY2N 4N78D 5APTA 4A7PA 3Q5PA 3CCEP 1GL2D 1CW5A 5APYA 3L74G 2IBZG 1VL2A 1OMIA 3L74J 2C0WA 5B66E 3TGUJ 1A02F 1URQC 1JY2O 1KB9E 2Y0DA 4O9BA 3CCQP 4IFDK 2WSEJ 2GM4A 1ZP0C 3HD7D 2JEEA 2B89A 2ZYGA 2LR2A 3HUSB 1BE3E 4TLFA 2GUSA 1M7LA 3TGUD 3H1HD 3CPWO 3D71A 5GTIH 2M3BA 1PPJD 1JO5A 1BSNA 2Q5UA 1KFMA 2RKLA 3FXDA 2QVAA 1CI6B 2ZXEB 2FYUK 3HE4B 2M5AA 3MHVA 4OWFA 1FBMA 3FX0A 1L0LD 3H1HE 1OFCX 1JNMA 2CK3H 3VMZA 1UIXA 4H13D 3TSIA 4PD4H 1EZVG 1CSBA 1EDIA 1YTZT 1JY3N 3H32B 5AW1B 5AW5B 5AVYB 1PV3A 1EXIA 3JCUH 1IFIA 5APWA 5H2FE 1HGZA 1K73Q 3VOPA 5AW0B 1VQOP 2OTLP 1LTIC 1KFNA 2LXCB 3IR9A 2KNCB 3CCUP 2KSEA 1FAVA 2WSFH 4HKZH 1KZUB 3H1LG 3GHGC 5DJTB 3SFEC 4ASVA 4D6TE 1ZN5A 1FZGA 4I7ZC 1KILE 3M9BA 4PV1C 3B71A 4U3FE 4OVNF 1XTCC 1PGQA 5H2FH 3OW2O 3LIEA 3OAKA 1JB0J 1SQQK 1S9KE 1PP9E 1HJBA 2QG4A 1HF9A 1QVFO 3H1IG 1YJNP 2K3RA 3H1IJ 3H1KE 1BCCD 1LT9B 3BCCG 3L72E 3QWOC 1E79H 1BGYG 2Y9YA 1BCCG 1IK9A 3S9OA 5CBOA 3F5HA 1M1KQ 1AVOA 2IDBA 3AEAC 5KLIB 1PPJG 3W68A 1BGYD 1IC2A 2YIUB 3MZWB 1LWUC 2W27A 5APXA 1NTMD 3ZDMA 2L91A 5APQA 1KD1Q 3A3YB 3HTKB 4U7JA 1KTMA 2BASA 3PP5A 2B88A 2D2CB 2J59M 3P7KA 4C46A 2N9YB 5GTHE 1NTKK 3A7OA 3B8EB 4N78E 2JO1A 2Q1KA 3AECC 1YI2P 3GMAA 1HWTC 2H7HA 1U57A 3S4RA 4DJGA 3CC2P 1BSHA 4H44B 2P2UA 3N4XA 4GT1A 1KB9D 1S5LH 3TNUB 3H1JG 3H1HJ 3MGNA 1YHQP 3CLQA 4PD4E 3GHGA 4AQRD 1N7SA 1SVFA 2R3CA 3AEDC 5KLVE 1H89A 1L0NE 1P84E 2FXMA 1LWUA 2J58A 3L71J 2YKQA 3Q3DA 2OYHC 2RN0A 3L71G 2IZ0A 3NTNA 2FYUJ 4NPEA 3VTPC 1SQPJ 4ASWA 4NPDA 3RBZA 4ZMDA 2E75D 3U1AA 1AVYA 1L4AA 1EC5A 3B5NA 2XV5A 4L73A 4UB6E 4ZNCA 1N7SD 1OZHA 3EWKA 2WWWA 3WUUA 1JOCA 3HUSA 2QE7H 1EXJA 2WSCH 4UB8E 3V2PA 2NPSA 2NRGA 1ZOYC 2O01H 1KILA 2J5UA 3T97B 4RKUJ 2V4HA 3Q5RA 1X0TA 1RF1C 4JPZB 5CJ4A 2K1AA 4JQ0D 1DD3A 3VYIA 3E7KA 4I1LA 2FKWB 4GIFA 3TYYA 2YO3A 4DOJA 2IBZI 3HD7C 2V7QJ 1SFCA 3MUDC 4D6TD 1KV4A 1DX7A 1FDIA 3CXHE 2WT7A 1OW6A 2O1KA 3M0DA 2E75B 1YJWP 2KS1B 1OVUA 2MKVA 2VRSA 1M1JA 1LGHB 2W6BA 2WITA 4HYTB 2W90A 5CJ0A 2HYNA 3HRNA 1SQVG 2Y0EA 3L75J 4PV1B 3V5BA 3V4QA 1FJPA 3TDKA 1T3JA 4I6MC 5KLVJ 2H8PD 3CX5D 4AUWA 2E75C 1R8EA 1HH0A 5TISH 2ZJSE 1SQQD 3Q2YA 1NKZB 1L0LK 2ITAA 3A0HE 3CCVP 2FYUE 1HBWA 1H0TB 1NO4A 5K5GB 5KKZB 1X22A 1N73A 1GL2B 3CCSP 1RQUA 1FZAA 2HLOA 1NTMK 1DEEG 1SQBG 1VQNP 2G8YA 2N1TD 4WWIA 1PGOA 1L0LJ 2JJLA 2XU6A 3AE3C 3KPEA 5B5EE 3G4SP 2QEXP 1W2BO 2HPCB 4UB6H 1AFOA 2AEFA 1S1CX 2KIKA 5GTIE 1KB9I 1URQA 4GKGA 1VQ7P 1IFPA 1K05A 2ZVOB 1JCDA 3RK3C 1NTMG 3R2PA 5AVVB 5AW4B 2P7JA 3L73E 1T3UA 1BGYJ 1SQPG 3WMM0 2NZ2A 2O3JA 3HTKA 4RO0A 2A45H 4IL6X 1MKMA 3CWBJ 2M5AB 1GU4A 4HJGH 2OYHB 3H1LE 3QH9A 4D6TG 4R4MA 2GUVA 3OA7A 3NXSA 1DEBA 1W5CE 3BCCD 3WU2H 1KC8Q 5CCHD 1EDKA 3O6QA 1K9MQ 1SQXK 4WY4B 4U3FJ 1NAFA 2IYPA 2R44A 4LC1A 3M9HA 2I1KA 2B87A 2H89C 3H1IE 3H1KJ 1GU5A 1K8AQ 1JCCA 1U7MA 2XKMA 3H1KG 2A06D 3L70G 1PP9J 4JBZA 2D2CD 5CCGC 3L72G 3RK3D 1VQMP 1BGYE 3I5CA 2GA1A 1SQQG 1X9VA 3JCUE 2FFDA 1DD4A 2YKOA 1ZR4A 1N73C 1SP4A 2V7QH 5KJ7C 3D6ZA 1PL5A 3G6EP 1GZLA 2QIWA 4N6JA 2YMKA 2I1JA 1FU1A 2N1TC 2UWJE 3B5NB 3RK3E 1H88A 1NVOA 1FJKA 3GW6A 3II6A 1SQBD 2KNCA 5DJUB 4Z1MH 3AE5C 1KQSO 3M91A 1J2JB 1KQFB 1WRGA 1GTWA 1NWQA 2ZAEB 4XA4A 2WSCJ 1S4XA 3H1JD 1R5SA 4R4LA 3RK2D 4BWNA 2N1TB 1M1JC 2H88C 5KLVK 2OYIB 1J1DC 1N2DC 1M56D 1QL2A 1SQXE 3KHUA 3C8VA 1P84D 1NTKJ 3PHLA 1GL2A 4W7YA 3MD0A 3TGUG 2IBZE 1L0NG 1MZ9A 1VQ4P 1L0NJ 1SQVD 2P67A 1EZVI 3SFDC 1GDTA 2HPCA 2O01J 1RH5B 5AW9B 1G2CA 1ZLLA 1BE3J 1NU1G 1URQB 4IFFA 3AE1C 1BE3G 2YKPA 2N9BA 2QJKC 3CL3D 3G9RA 5CBNA 1H8AA 5E79E 3B5NC 2BCCD 2POHA 1L0NK 1NU1D 1MFTA 4Y28J 1L4AB 1YJ9P 1KILB 3M0AA 2Q7CA 1AQ5A 2PP6A 1LTBC 1OW8A 1VPCA 2LKMA 3RK2B 4CPGA 4YXWH 3CX5H 5B66H 2HG5D 3R4YA 3AEGC 3A0HH 2AXCA 4C7RA 3AE7C 2A45I 3HE5A 3BATA 1EDJA 1VF5C 3IAOA 4M3LA 5AVSB 4AYCA 3CC7P 3CCRP 3A0BE 2M0BA 3AE6C 1FS0E 1Q2NA 1RHZB 3PTZA 2KUBA 1M1JB 3AEBC 4YPCA 3VP9A 1LWUB 5AVUB 1EDLA 1NTZK 5CHXA 2E42A 3CI9A 3E1RA 2ZYAA 3M06A 1GK6A 3P32A 3VP8A 4ZKPA 3CMAP 1ZV8A 2E74C 4XE5B 2Q9IA 4KJMA 3P8MC 2Q3EA 2IX7C 2FYNC 4WY4D 2LXBA 2E76B 1LJ2A 3AEEC 2Z5IA 1GW4A 3A5TA 3CX5E 1NTZJ 2XNXA 3BCCJ 3VN0A 4KT0J 4B86A 4GOEA 3T97A 1Y8AA 3FWNA 2FYUG 4U3FD 2WT7B 1QL1A 3O6QB 4UB8H 3RL0B 3BVHA 5CCHC 1VF5D 3A0BH 1BCCE 2G3AA 3V2RA 1S2EA 1SLQA 2OTKE 3L72D 2OYIA 1SQBE 2QJYC 2BCCG 2W8ZA 4H13B 4WB4A 5KAFH 3KDPB 1ZXGA 2WQYC 1IFMA 1ZW0A 3U1CA 2QJKB 1KYOI 1Z56A 1J1EC 3EQ2A 3MTUE 1LTJA 2OQQA 1T2KD 3B5ND 1NTME 1OIPA 2WPRA 1IFNA 3L70J 1T8ZA 5AW6B 2HR3A 2OYHA 1ZRTE 3L72J 3WUVA 3USSA 2Z4EA 1RE3A 1PGPA 2QM8A 3AE9C 3RK3B 1NGMB 2W6JH 2FBWC 2C9LY 3O8ZA 3GF7A 3VMYA 4PV1D 5GTHH 1SQPK 2OYIC 2XNDH 2K37A 2QRXA 3L74D 2MJZA 3HUSC 1SFCB 3SWKA 2WPQA 1R5LA 1YQ3C 2XZRA 1KILC 3PRJA 1S5LX 3AEFC 5BU8B 1RF1B 2ZT9D 4PJ0E 5BU5A 3L70E 3G71P 4XFJA 1IFJA 5KLVD 5BVZA 1VQLP 2ZXXA 5KAIE 1FDOA 2QJYB 2E76D 3L75D 2A06G 3KQGA 3FWLA 3H1LJ 4H13C 4BRYA 4RJTA 3CWBE 1QVGO 1VDFA 2KZIA 3SWFA 1FOSE 2NPSD 1L0LG 3M0DC 2WPVB 1LTAC 2KSJA 1MFZA 1SQBJ 4YTPC 3VMAA 2QJPB 2C9NY 1HGVA 2AEJA 1SS1A 3V4WA 4GDOA 1J1DB 1L4AC 1AA0A 1VQ8P
chains in the Genus database with same CATH topology
5AVTB 5CCGA 2R32A 3L37A 5KTBA 3BRVB 5KJ7A 3VMXA 1LTGC 2A45G 5AVZB 5CMZA 2E43A 2WPSA 1FZEA 2HODB 3HD7A 1AFOA 1HTLC 1HUCA 4JYBA 2YO2A 1FDMA 1YYCA 2Z5HA 1HVVA 2NPSC 1MUUA 2XDJA 4Y99C 5APSA 4EOTA 3H6PA 1CZQA 3UIAA 3V2NA 2O1JA 2KB7P 1SFCC 1KILD 1FZCC 3E1IA 3RL0D 1A02J 1FZBA 4JF7A 1RE4C 1RF0C 3HE5B 1GK4A 2L5GB 4DZOA 2C0XA 4JYCA 1LTSC 3N7NA 4EIJA 1FZGA 1JY3O 5AVWB 3HE4A 2YMYA 4KHXA 3V2QA 1X8YA 3L36A 1LT9A 5AW3B 3M9QA 3EFGA 2R5BA 5AW8B 3RL0C 4W80A 1PFIA 1N7SC 1N7LA 2IFMA 3RK2C 4WBAA 1FZFA 2ZFCA 2FYZA 1GD2E 3HD7B 3MUDA 1RE3C 3P8CD 1FZCA 2M8RA 1JTHB 1G2CB 2IFNA 1OWAA 3P8CE 4HH2A 3LW5H 1ZR2A 3BASA 1IJDB 1NH4A 2CPBA 1LTJB 5APUA 4C7NB 2FFDC 2QM7A 1KQLA 2YNYA 1GL2C 4Y99B 1JMMA 2WSEH 1RY3A 2NPSB 4RESB 3KYQA 1NOHA 1XTGB 1G1JA 1GW3A 1WT6A 1IFDA 3NFQA 5APVA 1RF0A 1RE4A 1X79B 4WY4C 1EQ7A 4IFMA 4W7ZA 1W2EA 4LGDE 2H43A 1S9KD 2HFED 1CI6A 1LTJC 1YTZI 1LT9C 3TNUA 2CPSA 3C9IA 4OH8B 2Q3IA 1G1IA 1N86A 3H32A 3L35A 2WTYA 3NMDA 5KJ7D 1FOSF 3GHGB 4LLHA 1JUNA 1LTTC 1J1EB 1L4AD 4ZKUA 3A2AA 3L4FA 1URQD 1JY3P 2PAJA 4C7NA 1N7SB 4I2LC 2W6AA 5AVQB 3SWYA 1NU1K 1RF1A 2WZ7A 3OJAB 2R5DA 3MIWA 1SQBK 4N3YB 1JTHA 3BRTB 1SFCD 1SQVK 5CCHA 1NKNA 5AW2B 3TK1A 1MV8A 1E5WA 1NHLA 2HODA 2FFDB 2OARA 3U59A 2P1JA 2KP8A 5AW7B 2KLVA 1N73B 1OXZA 3G3ZA 1FZCB 5CCGD 2IPPA 1T2KC 1JY2P 3LIDA 4WY4A 5AVXB 2N1TA 2KOGA 2KYVA 3IFMA 5AVRB 4N78D 1JY2N 5APTA 1CW5A 1GL2D 5APYA 2C0WA 1URQC 1JY2O 4IFDK 4O9BA 2GM4A 3HD7D 2JEEA 3HUSB 2GUSA 1M7LA 2M3BA 1JO5A 2Q5UA 1KFMA 1CI6B 2ZXEB 2FYUK 3HE4B 1FBMA 1JNMA 3VMZA 3TSIA 5AW5B 1CSBA 1YTZT 3H32B 1JY3N 5AW1B 5AVYB 1IFIA 5APWA 1HGZA 3VOPA 5AW0B 1LTIC 1KFNA 3IR9A 1AQ5A 1FAVA 2WSFH 1KZUB 3GHGC 1ZN5A 3M9BA 1XTCC 3LIEA 3OAKA 1SQQK 1S9KE 1HJBA 1LT9B 1IK9A 1IC2A 1LWUC 2W27A 5APXA 5APQA 3A3YB 3HTKB 2BASA 3PP5A 2J59M 3P7KA 4C46A 1NTKK 3A7OA 3B8EB 4N78E 1HWTC 2P2UA 3N4XA 4GT1A 3TNUB 3MGNA 3CLQA 4AQRD 3GHGA 1H89A 1N7SA 1SVFA 2R3CA 1DH3A 1IO4A 2FXMA 1LWUA 2J58A 2YKQA 2OYHC 3NTNA 3VTPC 3U1AA 1L4AA 3B5NA 2XV5A 1N7SD 2WWWA 1JOCA 3HUSA 2WSCH 3V2PA 2NPSA 2O01H 1KILA 1RF1C 5CJ4A 3VYIA 4I1LA 2FKWB 4GIFA 3TYYA 2YO3A 4DOJA 3HD7C 1SFCA 1DX7A 2WT7A 2O1KA 3M0DA 2VRSA 1M1JA 1LGHB 2W6BA 2WITA 4HYTB 5CJ0A 2HYNA 3HRNA 3V5BA 3V4QA 1FJPA 1T3JA 4I6MC 2H8PD 4AUWA 1HH0A 1NKZB 1L0LK 1HBWA 1NO4A 1N73A 1GL2B 1FZAA 2HLOA 1NTMK 2N1TD 2JJLA 2XU6A 3KPEA 2HPCB 1URQA 4GKGA 1JCDA 3RK3C 3R2PA 5AVVB 5AW4B 2P7JA 1T3UA 3WMM0 3HTKA 2A45H 1GU4A 2OYHB 2GUVA 3OA7A 3NXSA 1DEBA 5CCHD 1SQXK 4WY4B 1NAFA 4LC1A 3M9HA 2I1KA 1GU5A 1A02F 1JCCA 2XKMA 5CCGC 3RK3D 3I5CA 1X9VA 2FFDA 2YKOA 1N73C 1ZR4A 1SP4A 5KJ7C 1GZLA 4N6JA 2I1JA 1FU1A 2N1TC 3B5NB 1H88A 1FJKA 3II6A 3M91A 1J2JB 1WRGA 1GTWA 1NWQA 4XA4A 3RK2D 2N1TB 1M1JC 5KLVK 2OYIB 1J1DC 1N2DC 1QL2A 1GL2A 4W7YA 3MD0A 1MZ9A 2P67A 1GDTA 2HPCA 5AW9B 1G2CA 1ZLLA 1URQB 4IFFA 2YKPA 2N9BA 3CL3D 1H8AA 3B5NC 2POHA 1L0NK 1L4AB 1KILB 3M0AA 2Q7CA 2PP6A 1LTBC 1VPCA 2LKMA 3RK2B 2HG5D 4C7RA 2A45I 3HE5A 3BATA 4M3LA 5AVSB 4AYCA 3VP9A 1M1JB 1LWUB 5AVUB 1NTZK 5CHXA 2E42A 3CI9A 3M06A 1GK6A 3P32A 3VP8A 4ZKPA 1ZV8A 4XE5B 2Q9IA 3P8MC 2IX7C 4WY4D 2Z5IA 1GW4A 3A5TA 2XNXA 3VN0A 4B86A 2H7HA 3T97A 2WT7B 1QL1A 3RL0B 3BVHA 5CCHC 3V2RA 1SLQA 2OYIA 4WB4A 3KDPB 1IFMA 3U1CA 1Z56A 1J1EC 3EQ2A 3MTUE 1LTJA 1T2KD 3B5ND 2WPRA 1IFNA 1T8ZA 5AW6B 2OYHA 2Z4EA 1RE3A 2QM8A 2C9LY 3RK3B 3O8ZA 3VMYA 1SQPK 2OYIC 2MJZA 3HUSC 1SFCB 2WPQA 2XZRA 1KILC 5BU8B 1RF1B 5BU5A 1IFJA 5BVZA 3KQGA 1FOSE 1VDFA 3SWFA 2NPSD 3M0DC 1LTAC 2KSJA 1MFZA 2C9NY 1HGVA 3V4WA 1J1DB 1L4AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVT B;  2R32 A;  1H88 A;  3L37 A;  1S9K D;  3M91 A;  1J2J B;  1GTW A;  3VMX A;  1NWQ A;  1CI6 A;  3TNU A;  5AVZ B;  2W27 A;  5APX A;  5CMZ A;  5APQ A;  2E43 A;  3A3Y B;  2WPS A;  2Q3I A;  2BAS A;  3L35 A;  2WTY A;  3P7K A;  1HUC A;  3NMD A;  4C46 A;  3MD0 A;  1FOS F;  3A7O A;  3B8E B;  4JYB A;  1HWT C;  2P67 A;  2YO2 A;  1JUN A;  1YYC A;  5AW9 B;  2P2U A;  2Z5H A;  4GT1 A;  3TNU B;  3MGN A;  2N9B A;  4AQR D;  1MUU A;  3A2A A;  2R3C A;  1H8A A;  1H89 A;  1DH3 A;  1IO4 A;  2Q7C A;  3M0A A;  5APS A;  4EOT A;  3NTN A;  1CZQ A;  3UIA A;  3VTP C;  4C7N A;  4I2L C;  2W6A A;  3HE5 A;  5AVQ B;  2XV5 A;  4M3L A;  5AVS B;  4AYC A;  1A02 J;  2WWW A;  2R5D A;  3HE5 B;  1GK4 A;  4DZO A;  5AVU B;  2E42 A;  4JYC A;  5AW2 B;  3M06 A;  1GK6 A;  3P32 A;  1MV8 A;  3TK1 A;  4XE5 B;  3HE4 A;  5AVW B;  3VYI A;  3P8M C;  3TYY A;  2YO3 A;  4KHX A;  2KP8 A;  2WT7 A;  1X8Y A;  2Z5I A;  3L36 A;  5AW7 B;  3M0D A;  5AW3 B;  3A5T A;  2VRS A;  1OXZ A;  4HYT B;  3VN0 A;  4B86 A;  2H7H A;  2R5B A;  5AW8 B;  3T97 A;  3V5B A;  3V4Q A;  2WT7 B;  2IPP A;  1T2K C;  3LID A;  5AVX B;  4I6M C;  4AUW A;  1SLQ A;  5AVR B;  5APT A;  3KDP B;  5APY A;  2ZFC A;  1GD2 E;  1HBW A;  1T2K D;  2WPR A;  2JJL A;  2XU6 A;  5AW6 B;  1G2C B;  1OWA A;  2QM8 A;  2Q5U A;  4GKG A;  2C9L Y;  3O8Z A;  5AVV B;  3VMY A;  1CI6 B;  2ZXE B;  3HE4 B;  2P7J A;  5AW4 B;  1JNM A;  5APU A;  3HTK A;  3VMZ A;  4C7N B;  2QM7 A;  2WPQ A;  5AW5 B;  1CSB A;  1KQL A;  2YNY A;  2XZR A;  5AW1 B;  1GU4 A;  5AVY B;  5APW A;  3NXS A;  5AW0 B;  4RES B;  1NAF A;  3IR9 A;  3KQG A;  4LC1 A;  1FAV A;  3M9H A;  1FOS E;  1GU5 A;  1A02 F;  3SWF A;  3M9B A;  1MFZ A;  3NFQ A;  5APV A;  2C9N Y;  3I5C A;  3LIE A;  3OAK A;  3V4W A;  1S9K E;  1SP4 A;  1HJB A;  1GZL A; 
#chains in the Genus database with same CATH topology
 1QX8 A;  5AVT B;  2B9B A;  2E5Y A;  2R32 A;  3MP7 B;  5CCG A;  2ZYD A;  3L37 A;  5KTB A;  3GLM A;  1LT1 A;  1BCC J;  3BRV B;  2PFX A;  5L8R J;  2FXO A;  3VMX A;  5KJ7 A;  1M90 Q;  1SQV E;  1BE3 D;  1LP1 B;  1LTG C;  2M3E A;  3TGU E;  2A45 G;  5AVZ B;  1YIT P;  2IBZ D;  5CMZ A;  4K35 A;  2E43 A;  1NTZ E;  2DW3 A;  2WPS A;  1T6A A;  4PD4 D;  3WUT A;  1OW7 A;  2FXP A;  3L71 D;  2BEZ F;  1S3J A;  1FZE A;  2HOD B;  3HD7 A;  1NU1 E;  1HTL C;  2KLU A;  4OGQ C;  1KYO D;  1HUC A;  2I8D A;  4QMA A;  1RQV A;  4H44 D;  4K3A A;  3TF5 A;  1Y47 A;  1QEX A;  1AQT A;  1P84 H;  4JYB A;  3K5B A;  1JM0 A;  3WU2 E;  2YO2 A;  1VQ9 P;  1FDM A;  1GMJ A;  1YYC A;  3Q1M A;  2Z5H A;  3CX5 I;  1HVV A;  2NPS C;  3H1J J;  4TT3 H;  3IF4 A;  1MUU A;  3H1H G;  3GF3 A;  2Y9Z A;  2JR8 A;  3AE4 C;  2XDJ A;  4L76 A;  4Y99 C;  1QGK B;  5APS A;  4EOT A;  3H6P A;  1CZQ A;  3UIA A;  2WMM A;  2O1J A;  3V2N A;  1DH3 A;  3KZI H;  2KB7 P;  2JWA A;  1SFC C;  2QJP C;  2WSF J;  1KIL D;  2FY8 A;  2PGD A;  1Q81 Q;  2RMZ A;  1KN7 A;  1FZC C;  1BDD A;  3ITK A;  3E1I A;  1M8O B;  3RL0 D;  1A02 J;  2KI7 B;  3Q5S A;  1FZB A;  2KZJ A;  4JF7 A;  1RE4 C;  1RF0 C;  3HE5 B;  1NTK G;  3H1K D;  1GK4 A;  2L5G B;  3IN6 A;  4DZO A;  3F89 A;  1Q7Y Q;  4U3F G;  2AXT H;  2C0X A;  4L75 A;  4EYY Q;  1PP9 D;  2KXP B;  1LTS C;  3N7N A;  4JYC A;  1NTK D;  4EIJ A;  3CCM P;  2E74 B;  1Q90 D;  1JY3 O;  2JP3 A;  2ZT9 B;  3HE4 A;  3EFF K;  1PP9 G;  2YMY A;  5AVW B;  1Q86 Q;  1JEK A;  1IO4 A;  3CWB D;  3BCC E;  4KHX A;  4EDF A;  3V2Q A;  1SQQ E;  1X8Y A;  3L36 A;  1VQ5 P;  1LT9 A;  5AW3 B;  1DIP A;  3KZI E;  3M9Q A;  2K9J B;  3EFG A;  1M57 D;  3L75 G;  2R5B A;  5AW8 B;  3RL0 C;  4W80 A;  2P58 A;  1PFI A;  5KAI H;  1P84 I;  3RGU A;  1N7S C;  1N7L A;  2IFM A;  3RK2 C;  1OVV A;  4WBA A;  3I56 P;  1FZF A;  1OX3 A;  5M1B A;  2Y0C A;  3CXH D;  2YXQ B;  4MN4 C;  4NPF X;  2FYN B;  2FYZ A;  2ZFC A;  1SQP D;  3HD7 B;  1GD2 E;  3C1L A;  3RL0 g;  3MUD A;  1RE3 C;  1VQ6 P;  3P8C D;  1SQX G;  2IZ1 A;  2M8R A;  1FZC A;  2BEQ D;  3D70 A;  1USE A;  5E79 H;  4IOI H;  3H1J E;  4H0L C;  2PRR A;  1JTH B;  4DT0 A;  3L74 E;  1G2C B;  1KYO E;  2D2C C;  2IFN A;  1OWA A;  3JC2 2;  3P8C E;  4GOD A;  3L71 E;  4HH2 A;  3SSU A;  4OGQ D;  3AE2 C;  3LW5 H;  1ZR2 A;  3I55 P;  3BAS A;  2QA4 P;  2IYO A;  3L70 D;  2ZVN B;  1IJD B;  1NH4 A;  2CPB A;  4H0L B;  1LTJ B;  2QSI A;  3CXH I;  5APU A;  4C7N B;  2QM7 A;  2FFD C;  4L74 A;  4IL6 E;  5KLI C;  2A06 E;  1KQL A;  4D6T J;  2YNY A;  1GL2 C;  4Y99 B;  2E5T A;  3CWB G;  1JMB A;  1D7M A;  1JMM A;  1L0L E;  2WSE H;  2SPZ A;  1RY3 A;  2JKV A;  3JSV C;  2NPS B;  4RES B;  3CC4 P;  3KYQ A;  2OTJ P;  1EZV E;  1NOH A;  1XTG B;  3D6Y A;  1G1J A;  1VF5 B;  1GW3 A;  2W83 C;  3FXE A;  1WT6 A;  3CCJ P;  1KOR A;  1IFD A;  4I7Z B;  3NFQ A;  5APV A;  1RF0 A;  1RE4 A;  1SQQ J;  2YXR B;  3H1L D;  5C39 A;  5TIS E;  1X79 B;  4PJ0 H;  5EFW B;  2WSS H;  1OVR A;  4EI2 A;  4WY4 C;  4H0L D;  1NTZ D;  2WVR A;  2OGU A;  2E76 C;  1EQ7 A;  3V6I A;  2FYU D;  4IFM A;  4W7Z A;  3H25 A;  1W2E A;  4HB1 A;  2E74 D;  4LGD E;  4BRY B;  1NTZ G;  2KK7 A;  2H43 A;  2K9Y A;  5KAF E;  1FC2 C;  1AV1 A;  2ZT9 C;  3CXH H;  2HFE D;  4GOF A;  4H44 C;  4BXL A;  1S9K D;  3B4S A;  1CI6 A;  1LTJ C;  1YTZ I;  1LT9 C;  1PZQ A;  2OYO A;  1KYO H;  3TNU A;  2CPS A;  1N8R Q;  3S1K A;  3C9I A;  4OH8 B;  2Q3I A;  2R3S A;  3CD6 P;  1G1I A;  1N86 A;  2BCC E;  2Q6Q A;  3GG2 A;  3H32 A;  2RH0 A;  1PPJ E;  3L35 A;  3NMD A;  4WVZ A;  2WTY A;  5KJ7 D;  1YQ4 C;  1IK7 A;  1FOS F;  1NAY A;  1ZME C;  3GHG B;  4LLH A;  2KS1 A;  3CCL P;  3L73 D;  1JUN A;  1K04 A;  1QLE D;  2K88 A;  1HJ0 A;  1NU1 J;  1LP1 A;  1LTT C;  1S5L E;  3PLN A;  1J1E B;  1L4A D;  3W67 A;  1YBK A;  3L73 G;  1NTM J;  3A2A A;  3L73 J;  1SQP E;  3L4F A;  4ZKU A;  5B5E H;  1VQK P;  1YIJ P;  1FE6 A;  1URQ D;  1NYH A;  1JY3 P;  1SQV J;  1KB9 H;  1WMK A;  2PAJ A;  1Q82 Q;  4C7N A;  1KQG B;  1N7S B;  1NTK E;  4I2L C;  1H0T A;  3RBX A;  3PH0 A;  1AJY A;  2W6A A;  1ZRT D;  5AVQ B;  3SWY A;  1L0N D;  1NU1 K;  5KLV G;  1LNQ A;  3H1I D;  4OGQ B;  1L2P A;  4DCK A;  1RF1 A;  2WZ7 A;  3OJA B;  2AEM A;  2R5D A;  1IZN B;  3MIW A;  1SQB K;  3PJS K;  4N3Y B;  1JTH A;  3BRT B;  1SFC D;  1U7J A;  2K9J A;  1SQV K;  3KXD A;  1KMI Z;  5CCH A;  2B87 B;  1SQX J;  1NKN A;  2YIU C;  1NJI Q;  5AW2 B;  1UII A;  3TK1 A;  1MV8 A;  1PIX A;  1E5W A;  3AE8 C;  1NHL A;  2HOD A;  3LW5 J;  3L75 E;  5KKZ C;  2FFD B;  1EZV D;  1PGJ A;  2OAR A;  3U59 A;  2P1J A;  2KP8 A;  2O01 N;  4IL6 H;  5AW7 B;  2KLV A;  3ABV C;  1N73 B;  3CME P;  1SQX D;  2P10 A;  2AXT E;  1OXZ A;  2JDI H;  3G3Z A;  1FZC B;  4PD4 I;  5CCG D;  1VQP P;  1TU3 F;  1Y9B A;  2IPP A;  1T2K C;  1JY2 P;  3LID A;  2JWD A;  4WY4 A;  5AVX B;  5TJH A;  1USD A;  1S72 P;  2N1T A;  2KOG A;  4YXD C;  2BCC J;  2KYV A;  3IFM A;  5AVR B;  1BDC A;  3FGA D;  1JY2 N;  4N78 D;  5APT A;  4A7P A;  3Q5P A;  3CCE P;  1GL2 D;  1CW5 A;  5APY A;  3L74 G;  2IBZ G;  1VL2 A;  1OMI A;  3L74 J;  2C0W A;  5B66 E;  3TGU J;  1A02 F;  1URQ C;  1JY2 O;  1KB9 E;  2Y0D A;  4O9B A;  3CCQ P;  4IFD K;  2WSE J;  2GM4 A;  1ZP0 C;  3HD7 D;  2JEE A;  2B89 A;  2ZYG A;  2LR2 A;  3HUS B;  1BE3 E;  4TLF A;  2GUS A;  1M7L A;  3TGU D;  3H1H D;  3CPW O;  3D71 A;  5GTI H;  2M3B A;  1PPJ D;  1JO5 A;  1BSN A;  2Q5U A;  1KFM A;  2RKL A;  3FXD A;  2QVA A;  1CI6 B;  2ZXE B;  2FYU K;  3HE4 B;  2M5A A;  3MHV A;  4OWF A;  1FBM A;  3FX0 A;  1L0L D;  3H1H E;  1OFC X;  1JNM A;  2CK3 H;  3VMZ A;  1UIX A;  4H13 D;  3TSI A;  4PD4 H;  1EZV G;  1CSB A;  1EDI A;  1YTZ T;  1JY3 N;  3H32 B;  5AW1 B;  5AW5 B;  5AVY B;  1PV3 A;  1EXI A;  3JCU H;  1IFI A;  5APW A;  5H2F E;  1HGZ A;  1K73 Q;  3VOP A;  5AW0 B;  1VQO P;  2OTL P;  1LTI C;  1KFN A;  2LXC B;  3IR9 A;  2KNC B;  3CCU P;  2KSE A;  1FAV A;  2WSF H;  4HKZ H;  1KZU B;  3H1L G;  3GHG C;  5DJT B;  3SFE C;  4ASV A;  4D6T E;  1ZN5 A;  1FZG A;  4I7Z C;  1KIL E;  3M9B A;  4PV1 C;  3B71 A;  4U3F E;  4OVN F;  1XTC C;  1PGQ A;  5H2F H;  3OW2 O;  3LIE A;  3OAK A;  1JB0 J;  1SQQ K;  1S9K E;  1PP9 E;  1HJB A;  2QG4 A;  1HF9 A;  1QVF O;  3H1I G;  1YJN P;  2K3R A;  3H1I J;  3H1K E;  1BCC D;  1LT9 B;  3BCC G;  3L72 E;  3QWO C;  1E79 H;  1BGY G;  2Y9Y A;  1BCC G;  1IK9 A;  3S9O A;  5CBO A;  3F5H A;  1M1K Q;  1AVO A;  2IDB A;  3AEA C;  5KLI B;  1PPJ G;  3W68 A;  1BGY D;  1IC2 A;  2YIU B;  3MZW B;  1LWU C;  2W27 A;  5APX A;  1NTM D;  3ZDM A;  2L91 A;  5APQ A;  1KD1 Q;  3A3Y B;  3HTK B;  4U7J A;  1KTM A;  2BAS A;  3PP5 A;  2B88 A;  2D2C B;  2J59 M;  3P7K A;  4C46 A;  2N9Y B;  5GTH E;  1NTK K;  3A7O A;  3B8E B;  4N78 E;  2JO1 A;  2Q1K A;  3AEC C;  1YI2 P;  3GMA A;  1HWT C;  2H7H A;  1U57 A;  3S4R A;  4DJG A;  3CC2 P;  1BSH A;  4H44 B;  2P2U A;  3N4X A;  4GT1 A;  1KB9 D;  1S5L H;  3TNU B;  3H1J G;  3H1H J;  3MGN A;  1YHQ P;  3CLQ A;  4PD4 E;  3GHG A;  4AQR D;  1N7S A;  1SVF A;  2R3C A;  3AED C;  5KLV E;  1H89 A;  1L0N E;  1P84 E;  2FXM A;  1LWU A;  2J58 A;  3L71 J;  2YKQ A;  3Q3D A;  2OYH C;  2RN0 A;  3L71 G;  2IZ0 A;  3NTN A;  2FYU J;  4NPE A;  3VTP C;  1SQP J;  4ASW A;  4NPD A;  3RBZ A;  4ZMD A;  2E75 D;  3U1A A;  1AVY A;  1L4A A;  1EC5 A;  3B5N A;  2XV5 A;  4L73 A;  4UB6 E;  4ZNC A;  1N7S D;  1OZH A;  3EWK A;  2WWW A;  3WUU A;  1JOC A;  3HUS A;  2QE7 H;  1EXJ A;  2WSC H;  4UB8 E;  3V2P A;  2NPS A;  2NRG A;  1ZOY C;  2O01 H;  1KIL A;  2J5U A;  3T97 B;  4RKU J;  2V4H A;  3Q5R A;  1X0T A;  1RF1 C;  4JPZ B;  5CJ4 A;  2K1A A;  4JQ0 D;  1DD3 A;  3VYI A;  3E7K A;  4I1L A;  2FKW B;  4GIF A;  3TYY A;  2YO3 A;  4DOJ A;  2IBZ I;  3HD7 C;  2V7Q J;  1SFC A;  3MUD C;  4D6T D;  1KV4 A;  1DX7 A;  1FDI A;  3CXH E;  2WT7 A;  1OW6 A;  2O1K A;  3M0D A;  2E75 B;  1YJW P;  2KS1 B;  1OVU A;  2MKV A;  2VRS A;  1M1J A;  1LGH B;  2W6B A;  2WIT A;  4HYT B;  2W90 A;  5CJ0 A;  2HYN A;  3HRN A;  1SQV G;  2Y0E A;  3L75 J;  4PV1 B;  3V5B A;  3V4Q A;  1FJP A;  3TDK A;  1T3J A;  4I6M C;  5KLV J;  2H8P D;  3CX5 D;  4AUW A;  2E75 C;  1R8E A;  1HH0 A;  5TIS H;  2ZJS E;  1SQQ D;  3Q2Y A;  1NKZ B;  1L0L K;  2ITA A;  3A0H E;  3CCV P;  2FYU E;  1HBW A;  1H0T B;  1NO4 A;  5K5G B;  5KKZ B;  1X22 A;  1N73 A;  1GL2 B;  3CCS P;  1RQU A;  1FZA A;  2HLO A;  1NTM K;  1DEE G;  1SQB G;  1VQN P;  2G8Y A;  2N1T D;  4WWI A;  1PGO A;  1L0L J;  2JJL A;  2XU6 A;  3AE3 C;  3KPE A;  5B5E E;  3G4S P;  2QEX P;  1W2B O;  2HPC B;  4UB6 H;  1AFO A;  2AEF A;  1S1C X;  2KIK A;  5GTI E;  1KB9 I;  1URQ A;  4GKG A;  1VQ7 P;  1IFP A;  1K05 A;  2ZVO B;  1JCD A;  3RK3 C;  1NTM G;  3R2P A;  5AVV B;  5AW4 B;  2P7J A;  3L73 E;  1T3U A;  1BGY J;  1SQP G;  3WMM 0;  2NZ2 A;  2O3J A;  3HTK A;  4RO0 A;  2A45 H;  4IL6 X;  1MKM A;  3CWB J;  2M5A B;  1GU4 A;  4HJG H;  2OYH B;  3H1L E;  3QH9 A;  4D6T G;  4R4M A;  2GUV A;  3OA7 A;  3NXS A;  1DEB A;  1W5C E;  3BCC D;  3WU2 H;  1KC8 Q;  5CCH D;  1EDK A;  3O6Q A;  1K9M Q;  1SQX K;  4WY4 B;  4U3F J;  1NAF A;  2IYP A;  2R44 A;  4LC1 A;  3M9H A;  2I1K A;  2B87 A;  2H89 C;  3H1I E;  3H1K J;  1GU5 A;  1K8A Q;  1JCC A;  1U7M A;  2XKM A;  3H1K G;  2A06 D;  3L70 G;  1PP9 J;  4JBZ A;  2D2C D;  5CCG C;  3L72 G;  3RK3 D;  1VQM P;  1BGY E;  3I5C A;  2GA1 A;  1SQQ G;  1X9V A;  3JCU E;  2FFD A;  1DD4 A;  2YKO A;  1ZR4 A;  1N73 C;  1SP4 A;  2V7Q H;  5KJ7 C;  3D6Z A;  1PL5 A;  3G6E P;  1GZL A;  2QIW A;  4N6J A;  2YMK A;  2I1J A;  1FU1 A;  2N1T C;  2UWJ E;  3B5N B;  3RK3 E;  1H88 A;  1NVO A;  1FJK A;  3GW6 A;  3II6 A;  1SQB D;  2KNC A;  5DJU B;  4Z1M H;  3AE5 C;  1KQS O;  3M91 A;  1J2J B;  1KQF B;  1WRG A;  1GTW A;  1NWQ A;  2ZAE B;  4XA4 A;  2WSC J;  1S4X A;  3H1J D;  1R5S A;  4R4L A;  3RK2 D;  4BWN A;  2N1T B;  1M1J C;  2H88 C;  5KLV K;  2OYI B;  1J1D C;  1N2D C;  1M56 D;  1QL2 A;  1SQX E;  3KHU A;  3C8V A;  1P84 D;  1NTK J;  3PHL A;  1GL2 A;  4W7Y A;  3MD0 A;  3TGU G;  2IBZ E;  1L0N G;  1MZ9 A;  1VQ4 P;  1L0N J;  1SQV D;  2P67 A;  1EZV I;  3SFD C;  1GDT A;  2HPC A;  2O01 J;  1RH5 B;  5AW9 B;  1G2C A;  1ZLL A;  1BE3 J;  1NU1 G;  1URQ B;  4IFF A;  3AE1 C;  1BE3 G;  2YKP A;  2N9B A;  2QJK C;  3CL3 D;  3G9R A;  5CBN A;  1H8A A;  5E79 E;  3B5N C;  2BCC D;  2POH A;  1L0N K;  1NU1 D;  1MFT A;  4Y28 J;  1L4A B;  1YJ9 P;  1KIL B;  3M0A A;  2Q7C A;  1AQ5 A;  2PP6 A;  1LTB C;  1OW8 A;  1VPC A;  2LKM A;  3RK2 B;  4CPG A;  4YXW H;  3CX5 H;  5B66 H;  2HG5 D;  3R4Y A;  3AEG C;  3A0H H;  2AXC A;  4C7R A;  3AE7 C;  2A45 I;  3HE5 A;  3BAT A;  1EDJ A;  1VF5 C;  3IAO A;  4M3L A;  5AVS B;  4AYC A;  3CC7 P;  3CCR P;  3A0B E;  2M0B A;  3AE6 C;  1FS0 E;  1Q2N A;  1RHZ B;  3PTZ A;  2KUB A;  1M1J B;  3AEB C;  4YPC A;  3VP9 A;  1LWU B;  5AVU B;  1EDL A;  1NTZ K;  5CHX A;  2E42 A;  3CI9 A;  3E1R A;  2ZYA A;  3M06 A;  1GK6 A;  3P32 A;  3VP8 A;  4ZKP A;  3CMA P;  1ZV8 A;  2E74 C;  4XE5 B;  2Q9I A;  4KJM A;  3P8M C;  2Q3E A;  2IX7 C;  2FYN C;  4WY4 D;  2LXB A;  2E76 B;  1LJ2 A;  3AEE C;  2Z5I A;  1GW4 A;  3A5T A;  3CX5 E;  1NTZ J;  2XNX A;  3BCC J;  3VN0 A;  4KT0 J;  4B86 A;  4GOE A;  3T97 A;  1Y8A A;  3FWN A;  2FYU G;  4U3F D;  2WT7 B;  1QL1 A;  3O6Q B;  4UB8 H;  3RL0 B;  3BVH A;  5CCH C;  1VF5 D;  3A0B H;  1BCC E;  2G3A A;  3V2R A;  1S2E A;  1SLQ A;  2OTK E;  3L72 D;  2OYI A;  1SQB E;  2QJY C;  2BCC G;  2W8Z A;  4H13 B;  4WB4 A;  5KAF H;  3KDP B;  1ZXG A;  2WQY C;  1IFM A;  1ZW0 A;  3U1C A;  2QJK B;  1KYO I;  1Z56 A;  1J1E C;  3EQ2 A;  3MTU E;  1LTJ A;  2OQQ A;  1T2K D;  3B5N D;  1NTM E;  1OIP A;  2WPR A;  1IFN A;  3L70 J;  1T8Z A;  5AW6 B;  2HR3 A;  2OYH A;  1ZRT E;  3L72 J;  3WUV A;  3USS A;  2Z4E A;  1RE3 A;  1PGP A;  2QM8 A;  3AE9 C;  3RK3 B;  1NGM B;  2W6J H;  2FBW C;  2C9L Y;  3O8Z A;  3GF7 A;  3VMY A;  4PV1 D;  5GTH H;  1SQP K;  2OYI C;  2XND H;  2K37 A;  2QRX A;  3L74 D;  2MJZ A;  3HUS C;  1SFC B;  3SWK A;  2WPQ A;  1R5L A;  1YQ3 C;  2XZR A;  1KIL C;  3PRJ A;  1S5L X;  3AEF C;  5BU8 B;  1RF1 B;  2ZT9 D;  4PJ0 E;  5BU5 A;  3L70 E;  3G71 P;  4XFJ A;  1IFJ A;  5KLV D;  5BVZ A;  1VQL P;  2ZXX A;  5KAI E;  1FDO A;  2QJY B;  2E76 D;  3L75 D;  2A06 G;  3KQG A;  3FWL A;  3H1L J;  4H13 C;  4BRY A;  4RJT A;  3CWB E;  1QVG O;  1VDF A;  2KZI A;  3SWF A;  1FOS E;  2NPS D;  1L0L G;  3M0D C;  2WPV B;  1LTA C;  2KSJ A;  1MFZ A;  1SQB J;  4YTP C;  3VMA A;  2QJP B;  2C9N Y;  1HGV A;  2AEJ A;  1SS1 A;  3V4W A;  4GDO A;  1J1D B;  1L4A C;  1AA0 A;  1VQ8 P; 
#chains in the Genus database with same CATH homology
 5AVT B;  5CCG A;  2R32 A;  3L37 A;  5KTB A;  3BRV B;  5KJ7 A;  3VMX A;  1LTG C;  2A45 G;  5AVZ B;  5CMZ A;  2E43 A;  2WPS A;  1FZE A;  2HOD B;  3HD7 A;  1AFO A;  1HTL C;  1HUC A;  4JYB A;  2YO2 A;  1FDM A;  1YYC A;  2Z5H A;  1HVV A;  2NPS C;  1MUU A;  2XDJ A;  4Y99 C;  5APS A;  4EOT A;  3H6P A;  1CZQ A;  3UIA A;  3V2N A;  2O1J A;  2KB7 P;  1SFC C;  1KIL D;  1FZC C;  3E1I A;  3RL0 D;  1A02 J;  1FZB A;  4JF7 A;  1RE4 C;  1RF0 C;  3HE5 B;  1GK4 A;  2L5G B;  4DZO A;  2C0X A;  4JYC A;  1LTS C;  3N7N A;  4EIJ A;  1FZG A;  1JY3 O;  5AVW B;  3HE4 A;  2YMY A;  4KHX A;  3V2Q A;  1X8Y A;  3L36 A;  1LT9 A;  5AW3 B;  3M9Q A;  3EFG A;  2R5B A;  5AW8 B;  3RL0 C;  4W80 A;  1PFI A;  1N7S C;  1N7L A;  2IFM A;  3RK2 C;  4WBA A;  1FZF A;  2ZFC A;  2FYZ A;  1GD2 E;  3HD7 B;  3MUD A;  1RE3 C;  3P8C D;  1FZC A;  2M8R A;  1JTH B;  1G2C B;  2IFN A;  1OWA A;  3P8C E;  4HH2 A;  3LW5 H;  1ZR2 A;  3BAS A;  1IJD B;  1NH4 A;  2CPB A;  1LTJ B;  5APU A;  4C7N B;  2FFD C;  2QM7 A;  1KQL A;  2YNY A;  1GL2 C;  4Y99 B;  1JMM A;  2WSE H;  1RY3 A;  2NPS B;  4RES B;  3KYQ A;  1NOH A;  1XTG B;  1G1J A;  1GW3 A;  1WT6 A;  1IFD A;  3NFQ A;  5APV A;  1RF0 A;  1RE4 A;  1X79 B;  4WY4 C;  1EQ7 A;  4IFM A;  4W7Z A;  1W2E A;  4LGD E;  2H43 A;  1S9K D;  2HFE D;  1CI6 A;  1LTJ C;  1YTZ I;  1LT9 C;  3TNU A;  2CPS A;  3C9I A;  4OH8 B;  2Q3I A;  1G1I A;  1N86 A;  3H32 A;  3L35 A;  2WTY A;  3NMD A;  5KJ7 D;  1FOS F;  3GHG B;  4LLH A;  1JUN A;  1LTT C;  1J1E B;  1L4A D;  4ZKU A;  3A2A A;  3L4F A;  1URQ D;  1JY3 P;  2PAJ A;  4C7N A;  1N7S B;  4I2L C;  2W6A A;  5AVQ B;  3SWY A;  1NU1 K;  1RF1 A;  2WZ7 A;  3OJA B;  2R5D A;  3MIW A;  1SQB K;  4N3Y B;  1JTH A;  3BRT B;  1SFC D;  1SQV K;  5CCH A;  1NKN A;  5AW2 B;  3TK1 A;  1MV8 A;  1E5W A;  1NHL A;  2HOD A;  2FFD B;  2OAR A;  3U59 A;  2P1J A;  2KP8 A;  5AW7 B;  2KLV A;  1N73 B;  1OXZ A;  3G3Z A;  1FZC B;  5CCG D;  2IPP A;  1T2K C;  1JY2 P;  3LID A;  4WY4 A;  5AVX B;  2N1T A;  2KOG A;  2KYV A;  3IFM A;  5AVR B;  4N78 D;  1JY2 N;  5APT A;  1CW5 A;  1GL2 D;  5APY A;  2C0W A;  1URQ C;  1JY2 O;  4IFD K;  4O9B A;  2GM4 A;  3HD7 D;  2JEE A;  3HUS B;  2GUS A;  1M7L A;  2M3B A;  1JO5 A;  2Q5U A;  1KFM A;  1CI6 B;  2ZXE B;  2FYU K;  3HE4 B;  1FBM A;  1JNM A;  3VMZ A;  3TSI A;  5AW5 B;  1CSB A;  1YTZ T;  3H32 B;  1JY3 N;  5AW1 B;  5AVY B;  1IFI A;  5APW A;  1HGZ A;  3VOP A;  5AW0 B;  1LTI C;  1KFN A;  3IR9 A;  1AQ5 A;  1FAV A;  2WSF H;  1KZU B;  3GHG C;  1ZN5 A;  3M9B A;  1XTC C;  3LIE A;  3OAK A;  1SQQ K;  1S9K E;  1HJB A;  1LT9 B;  1IK9 A;  1IC2 A;  1LWU C;  2W27 A;  5APX A;  5APQ A;  3A3Y B;  3HTK B;  2BAS A;  3PP5 A;  2J59 M;  3P7K A;  4C46 A;  1NTK K;  3A7O A;  3B8E B;  4N78 E;  1HWT C;  2P2U A;  3N4X A;  4GT1 A;  3TNU B;  3MGN A;  3CLQ A;  4AQR D;  3GHG A;  1H89 A;  1N7S A;  1SVF A;  2R3C A;  1DH3 A;  1IO4 A;  2FXM A;  1LWU A;  2J58 A;  2YKQ A;  2OYH C;  3NTN A;  3VTP C;  3U1A A;  1L4A A;  3B5N A;  2XV5 A;  1N7S D;  2WWW A;  1JOC A;  3HUS A;  2WSC H;  3V2P A;  2NPS A;  2O01 H;  1KIL A;  1RF1 C;  5CJ4 A;  3VYI A;  4I1L A;  2FKW B;  4GIF A;  3TYY A;  2YO3 A;  4DOJ A;  3HD7 C;  1SFC A;  1DX7 A;  2WT7 A;  2O1K A;  3M0D A;  2VRS A;  1M1J A;  1LGH B;  2W6B A;  2WIT A;  4HYT B;  5CJ0 A;  2HYN A;  3HRN A;  3V5B A;  3V4Q A;  1FJP A;  1T3J A;  4I6M C;  2H8P D;  4AUW A;  1HH0 A;  1NKZ B;  1L0L K;  1HBW A;  1NO4 A;  1N73 A;  1GL2 B;  1FZA A;  2HLO A;  1NTM K;  2N1T D;  2JJL A;  2XU6 A;  3KPE A;  2HPC B;  1URQ A;  4GKG A;  1JCD A;  3RK3 C;  3R2P A;  5AVV B;  5AW4 B;  2P7J A;  1T3U A;  3WMM 0;  3HTK A;  2A45 H;  1GU4 A;  2OYH B;  2GUV A;  3OA7 A;  3NXS A;  1DEB A;  5CCH D;  1SQX K;  4WY4 B;  1NAF A;  4LC1 A;  3M9H A;  2I1K A;  1GU5 A;  1A02 F;  1JCC A;  2XKM A;  5CCG C;  3RK3 D;  3I5C A;  1X9V A;  2FFD A;  2YKO A;  1N73 C;  1ZR4 A;  1SP4 A;  5KJ7 C;  1GZL A;  4N6J A;  2I1J A;  1FU1 A;  2N1T C;  3B5N B;  1H88 A;  1FJK A;  3II6 A;  3M91 A;  1J2J B;  1WRG A;  1GTW A;  1NWQ A;  4XA4 A;  3RK2 D;  2N1T B;  1M1J C;  5KLV K;  2OYI B;  1J1D C;  1N2D C;  1QL2 A;  1GL2 A;  4W7Y A;  3MD0 A;  1MZ9 A;  2P67 A;  1GDT A;  2HPC A;  5AW9 B;  1G2C A;  1ZLL A;  1URQ B;  4IFF A;  2YKP A;  2N9B A;  3CL3 D;  1H8A A;  3B5N C;  2POH A;  1L0N K;  1L4A B;  1KIL B;  3M0A A;  2Q7C A;  2PP6 A;  1LTB C;  1VPC A;  2LKM A;  3RK2 B;  2HG5 D;  4C7R A;  2A45 I;  3HE5 A;  3BAT A;  4M3L A;  5AVS B;  4AYC A;  3VP9 A;  1M1J B;  1LWU B;  5AVU B;  1NTZ K;  5CHX A;  2E42 A;  3CI9 A;  3M06 A;  1GK6 A;  3P32 A;  3VP8 A;  4ZKP A;  1ZV8 A;  4XE5 B;  2Q9I A;  3P8M C;  2IX7 C;  4WY4 D;  2Z5I A;  1GW4 A;  3A5T A;  2XNX A;  3VN0 A;  4B86 A;  2H7H A;  3T97 A;  2WT7 B;  1QL1 A;  3RL0 B;  3BVH A;  5CCH C;  3V2R A;  1SLQ A;  2OYI A;  4WB4 A;  3KDP B;  1IFM A;  3U1C A;  1Z56 A;  1J1E C;  3EQ2 A;  3MTU E;  1LTJ A;  1T2K D;  3B5N D;  2WPR A;  1IFN A;  1T8Z A;  5AW6 B;  2OYH A;  2Z4E A;  1RE3 A;  2QM8 A;  2C9L Y;  3RK3 B;  3O8Z A;  3VMY A;  1SQP K;  2OYI C;  2MJZ A;  3HUS C;  1SFC B;  2WPQ A;  2XZR A;  1KIL C;  5BU8 B;  1RF1 B;  5BU5 A;  1IFJ A;  5BVZ A;  3KQG A;  1FOS E;  1VDF A;  3SWF A;  2NPS D;  3M0D C;  1LTA C;  2KSJ A;  1MFZ A;  2C9N Y;  1HGV A;  3V4W A;  1J1D B;  1L4A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...