2Q7CA

Crystal structure of iqn17
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fusion protein between yeast variant GCN4 and HIVgp41
publication title Inhibiting HIV Entry: Discovery of D-Peptide Inhibitors that Target the Gp41 Coiled-Coil Pocket
pubmed doi rcsb
molecule tags Viral protein
total genus 20
structure length 45
sequence length 45
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2q7cA00
5AW2B 3P32A 2W6AA 2Z5HA 3HTKA 2N9BA 1GTWA 1SP4A 3M06A 3T97A 3V4QA 2P67A 2WT7A 3VMZA 2WPSA 5APTA 3TNUB 2E42A 4GKGA 5APSA 1NAFA 1FOSF 5APUA 1GZLA 5AW7B 1SLQA 5APWA 5AVTB 3UIAA 5AVYB 1JNMA 2Q5UA 1GU5A 2XZRA 5AW1B 3NXSA 2XU6A 5AW3B 2QM7A 5AVXB 2Z5IA 2YO3A 3LIEA 1CSBA 3A5TA 1YYCA 3VYIA 4I6MC 2BASA 1OWAA 4JYCA 2Q3IA 4DZOA 5AW9B 5AVQB 2Q7CA 3HE4B 3V4WA 1CI6B 2R3CA 5APYA 3TNUA 4AYCA 2ZXEB 1X8YA 5APXA 1A02F 1CZQA 1T2KC 3A7OA 5APQA 3LIDA 2VRSA 4C46A 5CMZA 1H8AA 1IO4A 3VMXA 1GK4A 1MV8A 3M91A 3MD0A 3M0DA 5AW6B 3TYYA 1H89A 2W27A 5AVUB 4AQRD 3M9HA 1J2JB 1GK6A 4AUWA 3HE4A 3P8MC 1CI6A 2R5DA 4GT1A 5AW5B 3VTPC 3P7KA 3NFQA 3HE5B 4JYBA 2WWWA 4RESB 1GD2E 5AVVB 1H88A 4KHXA 3KQGA 4EOTA 1HBWA 3KDPB 5APVA 1FAVA 2H7HA 2P7JA 3NTNA 2WPRA 1OXZA 3O8ZA 5AW4B 2P2UA 3L37A 2WPQA 3TK1A 1FOSE 1DH3A 3A3YB 2R5BA 1JUNA 2IPPA 4LC1A 2JJLA 3M0AA 3L36A 4C7NB 1MUUA 2YO2A 5AW8B 2E43A 5AVWB 4HYTB 3IR9A 1NWQA 4I2LC 2C9NY 1MFZA 3I5CA 3M9BA 3HE5A 2C9LY 4B86A 3OAKA 1A02J 4M3LA 3SWFA 5AVZB 1KQLA 3NMDA 3VMYA 1S9KD 2WT7B 2WTYA 1GU4A 2XV5A 1HUCA 4XE5B 3V5BA 3B8EB 3L35A 1G2CB 3MGNA 2QM8A 5AVSB 5AW0B 3VN0A 1HJBA 1T2KD 1S9KE 3A2AA 4C7NA 2ZFCA 1HWTC 2KP8A 5AVRB 2YNYA 2R32A
chains in the Genus database with same CATH superfamily
3II6A 1PV3A 1M7LA 5KLIB 2Z5HA 1FDOA 1PPJG 2BEZF 2GUVA 1Q82Q 4PV1D 2IBZE 2KSEA 5APTA 5B5EH 3CCLP 1SFCB 2JDIH 2LR2A 2NRGA 1KYOI 1W2EA 2KNCB 1NTZD 4U3FE 3A5TA 1YYCA 1IFPA 4I6MC 3PHLA 2Q7CA 1OW6A 1ZMEC 3TF5A 2QJKB 2HG5D 3C9IA 1BDCA 1RE4A 1NKZB 1JY2N 1FZCB 1NU1G 1OVUA 1RE3C 3BCCD 1Y8AA 1GD2E 2PAJA 1EXIA 4UB6E 2OTKE 1Q90D 1M57D 2Y0CA 1T6AA 4XFJA 1JUNA 2FXPA 2I1JA 2KS1A 1T8ZA 1BE3J 1OFCX 1S5LX 1N8RQ 3KXDA 4WY4D 5M1BA 1RF0C 1QEXA 3NMDA 3T97B 1L0LE 3L73E 2Q3EA 5GTIH 1KILD 1NTKJ 2CPSA 1KQSO 2Q9IA 3TGUJ 3CMAP 3CCQP 2OTJP 1G1JA 3CX5E 2JWAA 1X22A 2M5AA 1SQQE 4WY4A 3PH0A 3HD7D 3CCVP 2OYIC 2FBWC 4LLHA 3WMM0 3BATA 3VMAA 2QE7H 2XZRA 2XDJA 3CC4P 2QM7A 2POHA 4H44D 4PJ0H 1OWAA 3KPEA 5AW9B 4HH2A 1NU1D 1NYHA 4H13D 3HD7A 1M1JB 2O01H 1SQPG 1LJ2A 1JY3O 3H1IJ 4UB8E 3GMAA 2UWJE 2ZYGA 2WSFH 1DIPA 2K88A 4EDFA 2G8YA 2GA1A 4W7YA 2WPRA 1SQBG 1KYOD 2WQYC 4LC1A 2KOGA 1MUUA 4D6TD 1BCCG 4WVZA 1NWQA 2L5GB 1Z56A 2E5YA 4ASWA 1GU4A 2FKWB 3MHVA 1NJIQ 3H1HE 2N1TD 5GTHE 1SQXE 2WSEH 3AE7C 3KZIH 1JMMA 1AJYA 1NTMD 2YNYA 1GL2A 3AEAC 4IL6E 2IZ1A 4EI2A 3G6EP 4GKGA 3H32B 1IFJA 4DCKA 5DJUB 1SQPD 1JNMA 2Q5UA 1GU5A 2Q6QA 3MUDC 2L91A 3VYIA 3L70J 4PV1C 1HF9A 1PP9J 3TNUA 3LW5J 4OGQD 2E75D 3TSIA 2FXOA 1AQ5A 2ZAEB 4C46A 1BGYE 1HGVA 1K8AQ 2QSIA 3L71E 3M0DA 5AW6B 1SQBD 3TGUG 3USSA 1PGPA 2FXMA 1X79B 3F89A 1BCCD 1TU3F 4LGDE 1EZVE 3PTZA 1FAVA 4WBAA 5CCGD 3D6ZA 3H1JG 4OVNF 1IC2A 4RKUJ 2OYIB 1VPCA 2WSCJ 1CW5A 5AW8B 1FDMA 3RBXA 1NKNA 2C9NY 1RQVA 3P8CE 4C7RA 5TISE 2E5TA 4IFFA 1P84E 1G2CB 5AVSB 5CCHD 3WUUA 3CWBE 2W6BA 1FDIA 1M8OB 3TDKA 1NGMB 5BU5A 1QVFO 4JBZA 3CCUP 1LT9C 2CK3H 1KILC 1N73C 2OTLP 3OW2O 5KAIE 2FYNC 1VQ8P 1NTZJ 1L0NE 3A0HH 3H1IE 1KZUB 3LIEA 3L74E 3CCRP 2BASA 1GW3A 3L72G 5H2FE 1M1JA 1ZR4A 3B5ND 1XTCC 1MV8A 2WPVB 3PJSK 3H1JD 4H44C 5B5EE 1NTZK 1MKMA 1U7JA 1OW7A 5AVUB 4AQRD 1GK6A 3BCCJ 4H13C 3QWOC 3HE4A 1H88A 1NO4A 1JTHB 4L74A 2H89C 1HBWA 3IN6A 5APVA 2P10A 1WMKA 3RBZA 2P2UA 3U1CA 2RH0A 2YO2A 2E43A 1JOCA 3AE2C 4I2LC 3EFFK 3Q3DA 3OAKA 3SFEC 1NVOA 3GHGC 1URQD 4PV1B 3BASA 1OZHA 3HUSA 1JY2O 1SQVG 1AA0A 4IOIH 1J1DC 1N2DC 2N9BA 3L72D 3RK3D 3CC2P 2N1TC 4WWIA 2E76D 2WPSA 1D7MA 1Q81Q 1SLQA 1L4AD 3GW6A 1SVFA 4L73A 5GTIE 1BDDA 1NU1J 3WU2H 2HODB 2A06G 1T2KC 4N78E 3CXHD 2MJZA 2RKLA 1N7SD 4KJMA 3H1LD 4Y99C 2KLVA 2MKVA 1ZRTD 4K35A 4PD4H 4OGQC 2E75C 1NU1K 5AVVB 3IFMA 2A45H 4PJ0E 1VQ9P 3JC22 4DJGA 1SQVD 5KJ7D 1LT9B 2K9JB 1KILB 1N73B 4D6TJ 1KN7A 5AVWB 3IF4A 1LTGC 1LWUC 5CCGC 2D2CD 2NPSA 1ZOYC 3A0BE 1SQQK 1NTMJ 1Q2NA 5E79H 2R32A 5KLVG 1VDFA 3WUTA 4H13B 2PRRA 5CCHC 1SQPJ 5AW7B 5AVTB 3RL0C 1KB9H 3S4RA 4Z1MH 3ABVC 4BWNA 1L2PA 5AW1B 1NTMK 4HB1A 2IBZG 4JYCA 4DZOA 1FU1A 3GG2A 3KZIE 3AE8C 5CBOA 1CI6B 1AQTA 1VQ5P 1S1CX 1HJ0A 2FYUE 1G1IA 1SQPK 2K1AA 1SQBJ 3GHGB 3TYYA 3CX5I 1JO5A 1FZFA 2W27A 1WT6A 1BCCJ 2YIUC 2YKOA 4KT0J 4AUWA 3B5NC 3P8MC 3SWKA 3VP9A 3L75E 2IFMA 2ZYAA 1J1DB 1USEA 1PPJE 2J59M 2N1TB 1FOSE 1SQBK 4I1LA 2FFDC 4W80A 4C7NB 2BCCD 1ZXGA 3IR9A 1U57A 3HE5A 2OYHA 1JCDA 2J58A 4MN4C 1A02J 5KLVD 1KQLA 5KTBA 3CXHH 2KLUA 3E7KA 4OH8B 1RF1A 4ZMDA 2ZYDA 1YJNP 2IBZD 1URQC 3EFGA 2H43A 3LW5H 3H1KG 2IZ0A 1FOSF 2E75B 2PFXA 1Y9BA 1GZLA 2K3RA 4U3FD 2WZ7A 2YXQB 1SQQG 4D6TG 3D70A 3RK3C 1VQPP 3I56P 2E76C 2HODA 1YJWP 4IFDK 1E5WA 2HPCB 5APXA 1L4AC 3G3ZA 2JO1A 1Y47A 1QL1A 2PP6A 3A7OA 1Q86Q 3H1JJ 3MD0A 2LXBA 2WSCH 1IJDB 1NTMG 2ZT9D 1EDJA 2M3EA 1LP1A 1R5LA 1FZEA 2Z4EA 3A0HE 2WWWA 2DW3A 1N7SC 3AE9C 3NTNA 1OXZA 4TLFA 3S1KA 1H0TB 1VF5D 3H25A 2Y9ZA 3RL0B 3SFDC 1LTJA 3M9QA 2IYPA 2C9LY 1L0LD 3HTKB 5DJTB 3FWLA 3L73D 4M3LA 3SWFA 3AE6C 3H1KD 5KJ7C 5CJ4A 3VN0A 3O6QB 2AEMA 5C39A 3CX5D 4K3AA 3R4YA 3PLNA 1SQQD 2G3AA 1GL2D 2WSSH 1EZVI 2D2CC 3L72J 1IFDA 3V4QA 2V4HA 5BU8B 2YIUB 2E42A 1SQXG 1QL2A 3IAOA 3N7NA 5KKZC 3B5NB 2W83C 3ZDMA 1J1EC 1FE6A 3UIAA 2JKVA 4EIJA 2W6JH 3AEDC 4IL6X 3NXSA 5AVXB 3CC7P 5AVQB 1P84I 2FFDB 3S9OA 2B87B 3B4SA 1SFCA 4TT3H 2KNCA 3G71P 3H1LJ 1AVYA 2XKMA 5EFWB 3L71G 2QJYC 1DX7A 1RE4C 3KDPB 2P7JA 3WU2E 2W90A 1SQVJ 3L37A 1KC8Q 3MTUE 2R5BA 1FZBA 3L36A 3AEGC 1FZCA 4HYTB 1EZVG 1JMBA 3H1HD 3AEBC 3RK3B 3W68A 3G4SP 1BE3E 2E76B 1SQXD 4PD4E 2WT7B 2R3SA 1HUCA 1SQVK 3MIWA 1OMIA 4CPGA 1NTKE 1EC5A 3TGUE 3T97A 2WVRA 1FC2C 5APSA 3FWNA 3CWBG 4Y28J 1JEKA 3FX0A 2KSJA 2KB7P 4WY4C 1T3UA 2N9YB 1S5LH 1FJKA 1LTSC 3BRVB 2R3CA 1K05A 1BGYD 3L71D 1DEEG 2VRSA 1GK4A 1KYOH 3M91A 3CLQA 2K37A 1KB9E 1QLED 1EZVD 3HD7C 2E74D 2AXCA 3U1AA 1YBKA 2D2CB 4QMAA 2K9YA 2WPQA 2KI7B 1T3JA 2ZT9C 3A3YB 5KKZB 3P8CD 3SSUA 4NPFX 1J1EB 2BCCJ 1FZGA 1LTAC 3I5CA 1NHLA 2RN0A 1P84D 1JCCA 3C1LA 5KLVJ 2QIWA 1VQKP 2PGDA 3O6QA 3CWBD 4ZKPA 1VF5C 2QG4A 4I7ZC 3H1LG 1VQMP 5B66H 3KYQA 1KQFB 4HKZH 2SPZA 3RGUA 3Q1MA 2YMKA 5KLVK 2IDBA 1U7MA 3CI9A 3E1IA 1L0ND 4U3FJ 3PRJA 1N7LA 2WMMA 2YKPA 3ITKA 2QJYB 3L74D 3HRNA 1GL2C 3CXHE 1YIJP 1PZQA 5AW3B 2B87A 2Q3IA 3RK2D 2FYUK 4YXDC 5KAFH 3H32A 1RE3A 3L70E 2LKMA 1CZQA 3LIDA 1PP9E 2Y9YA 4ASVA 1PL5A 1M90Q 1J2JB 4GT1A 1YQ3C 3NFQA 3I55P 1W5CE 4KHXA 3CD6P 3M0DC 2AXTH 3O8ZA 2HYNA 1RF0A 3CCJP 1R5SA 1HGZA 2O1JA 3D6YA 1W2BO 1YQ4C 2J5UA 3C8VA 2IX7C 1L0LJ 2QEXP 1KD1Q 3L73J 4WY4B 3H1KJ 2NPSD 1OIPA 2OYIA 1S9KE 3AEEC 2A06E 1SQQJ 2P58A 5AW2B 4A7PA 2FYNB 2HR3A 2HLOA 1VQOP 1L0LK 3M06A 1PGOA 3WUVA 2V7QJ 1Q7YQ 3HD7B 1G2CA 1YTZI 2B88A 1LTBC 2YMYA 1X9VA 2YKQA 2BCCG 2ZT9B 4H44B 1NTZE 1S2EA 4N78D 5APYA 2ZXEB 3GLMA 2FYZA 2XNDH 4JQ0D 1EDLA 1JM0A 2C0WA 1GW4A 1IO4A 3FXDA 1M1KQ 1OX3A 1GMJA 1VF5B 4I7ZB 2AEFA 1M1JC 1VQ6P 4JF7A 2FYUG 4EOTA 1RHZB 3BCCE 2KIKA 4U3FG 3TK1A 1K04A 4U7JA 2JJLA 3AE3C 4RO0A 3QH9A 3CPWO 2E74C 1KFNA 4GODA 1MFZA 1GL2B 3H1HJ 2RMZA 5BVZA 4B86A 3JSVC 1JTHA 1SQXJ 2H8PD 3F5HA 3VMYA 2ZVOB 4OWFA 1JY3P 3JCUH 2I1KA 3Q5PA 1HJBA 1LT1A 5AVRB 1UIIA 1KILE 3MUDA 2ZVNB 4BRYB 1YITP 3HUSC 3AE5C 4EYYQ 3TNUB 1SQXK 1VL2A 2FY8A 3W67A 2O1KA 2I8DA 1ZW0A 1PGJA 3VOPA 2YO3A 1FJPA 1BGYJ 4Y99B 2FYUD 1L0LG 3V4WA 3L71J 1E79H 3L73G 1VQLP 1X8YA 3B71A 4OGQB 3H6PA 1NU1E 1UIXA 2KK7A 1H8AA 5CMZA 1KFMA 2R44A 3V2QA 3RK2C 3L75D 3CCEP 1KQGB 2ITAA 1EDKA 3E1RA 1PPJD 4JYBA 5CBNA 2OQQA 1S5LE 5CJ0A 4H0LD 5AW4B 1YHQP 1LWUB 3H1KE 1NH4A 1AFOA 1R8EA 3PP5A 1VQ4P 1KYOE 1YTZT 3M9BA 2QJPC 4D6TE 3MZWB 3CWBJ 3OJAB 2JR8A 1LT9A 2K9JA 2ZJSE 1KILA 4GOEA 1N73A 1NTKK 2AEJA 3A2AA 1OVVA 2GM4A 2ZFCA 3CCSP 2Y0DA 2KP8A 3AE1C 2NPSC 2HFED 1NTME 1FS0E 2P67A 3VMZA 4XA4A 1L0NJ 5APUA 3CCMP 3L74J 5AVYB 2KUBA 4ZKUA 3N4XA 4O9BA 1SQPE 1AV1A 2KYVA 3GF7A 1CSBA 2LXCB 2CPBA 4PD4I 1KTMA 2Y0EA 3H1HG 3HE4B 5K5GB 3A0BH 2KXPB 2E74B 5B66E 1VQNP 2A45I 1L0NK 1SFCD 1MZ9A 2B89A 5CHXA 3VMXA 3BVHA 1ZV8A 2BEQD 3CMEP 4R4LA 1SQBE 4GDOA 2QA4P 1CI6A 3CL3D 1IK9A 1BCCE 1OW8A 4DT0A 3Q5SA 3GHGA 3HUSB 1MFTA 5KAFE 1KORA 2IPPA 1FZAA 1BGYG 5AVZB 2WTYA 1SS1A 1URQB 2N1TA 1YI2P 3V5BA 3EQ2A 3L35A 3EWKA 1T2KD 1KB9I 4C7NA 2AXTE 2NZ2A 2OARA 3V2NA 2OYHC 2WITA 4BRYA 1BE3G 3RK2B 2YXRB 4L75A 4N6JA 2M3BA 2A45G 1RF1C 3GF3A 4YXWH 1NTKG 1L4AB 1HVVA 1K9MQ 3AE4C 1YJ9P 1ZN5A 4UB6H 1DD3A 1JY2P 1A02F 2QJPB 1IZNB 2KZIA 4NPDA 1N7SB 3V2RA 1S3JA 1KMIZ 1ZP0C 3H1JE 3M9HA 1RH5B 1PFIA 2HPCA 2XNXA 5E79E 1BSHA 1LWUA 5CCGA 3CXHI 2NPSB 1L0NG 1USDA 2O01J 2W8ZA 3H1IG 3CX5H 3L74G 1DH3A 3RL0D 3FGAD 2JWDA 2WSFJ 2C0XA 4PD4D 1BE3D 4BXLA 3R2PA 4H0LC 2M0BA 1IK7A 1JB0J 2V7QH 2XV5A 3B8EB 4IFMA 1H0TA 5CCHA 3G9RA 1HTLC 1ZLLA 1NTKD 1LTJC 4HJGH 4RJTA 3TGUD 1RY3A 3AEFC 1XTGB 1EXJA 3V2PA 1JY3N 1AVOA 3HTKA 2H88C 1GTWA 4ZNCA 1SP4A 4W7ZA 4UB8H 1M56D 3L72E 3RK3E 4GIFA 2JP3A 1LNQA 2WSEJ 4YPCA 3JCUE 1DEBA 4DOJA 3Q5RA 2FYUJ 2QVAA 1NAYA 2O01N 5TJHA 4AYCA 3B5NA 2M8RA 3KHUA 1PGQA 2JEEA 1LGHB 3H1ID 1H89A 1KB9D 1EQ7A 5KLIC 3BRTB 3L75J 2Q1KA 3L70G 2FFDA 3H1LE 2R5DA 3VTPC 1PP9G 3HE5B 2OYHB 1SFCC 5GTHH 3U59A 1ZRTE 4L76A 3KQGA 1NOHA 2H7HA 3SWYA 2P1JA 1IFMA 1RF1B 4IL6H 3M0AA 3L4FA 1GDTA 1DD4A 2QJKC 1SQVE 4YTPC 2IYOA 2KS1B 2OYOA 1URQA 1RQUA 4JPZB 4XE5B 3MGNA 2QM8A 5AW0B 5L8RJ 1FZCC 3K5BA 1HWTC 1LTIC 3RL0g 1QX8A 2GUSA 3P32A 2ZXXA 2W6AA 2IFNA 3FXEA 2WT7A 2M5AB 1K73Q 1VQ7P 1NAFA 5APWA 1L4AA 3D71A 2XU6A 2Z5IA 2IBZI 3L70D 1LP1B 3OA7A 1PP9D 2O3JA 1KV4A 5APQA 4H0LB 1N7SA 1FBMA 1WRGA 1NTZG 3VP8A 5TISH 1IFNA 1P84H 2B9BA 5AW5B 3P7KA 1LTJB 4RESB 3V6IA 1OVRA 4GOFA 4R4MA 3Q2YA 1BSNA 3AECC 5KJ7A 4NPEA 2KZJA 4N3YB 1HH0A 3MP7B 1QVGO 1N86A 1EDIA 1ZR2A 1PIXA 3BCCG 2QRXA 4WB4A 1S4XA 2BCCE 5KAIH 1LTTC 1IFIA 1S9KD 2A06D 2OGUA 5KLVE 1X0TA 5H2FH 1S72P 3L75G 1QGKB
chains in the Genus database with same CATH topology
3II6A 1M7LA 1N2DC 2Z5HA 2N9BA 2NPSC 2HFED 3RK3D 2GUVA 3T97A 2P67A 2N1TC 3VMZA 2WPSA 5APTA 4XA4A 5APSA 5APUA 1SLQA 1SFCB 5AVYB 1L4AD 4ZKUA 1W2EA 2KSJA 3N4XA 4O9BA 2KB7P 1SVFA 2KYVA 1CSBA 1T3UA 4WY4C 1YYCA 3A5TA 4I6MC 2CPBA 1FJKA 1LTSC 2Q7CA 3HE4B 3BRVB 2R3CA 2HODB 2HG5D 3C9IA 2A45I 1L0NK 1MZ9A 1SFCD 4N78E 1T2KC 2MJZA 2VRSA 1RE4A 1N7SD 1NKZB 5CHXA 3VMXA 1GK4A 3M91A 3CLQA 3BVHA 1ZV8A 4Y99C 2KLVA 1JY2N 1FZCB 1CI6A 1NU1K 1IK9A 1RE3C 3CL3D 3HD7C 1GD2E 2PAJA 5AVVB 3U1AA 3IFMA 2A45H 3GHGA 3HUSB 2WPQA 1T3JA 3A3YB 5KJ7D 1LT9B 1JUNA 2IPPA 1KILB 3P8CD 1N73B 1J1EB 2I1JA 1FZAA 1FZGA 1LTAC 5AVWB 1T8ZA 3I5CA 1NHLA 1LTGC 4WY4D 1LWUC 1JCCA 5CCGC 5AVZB 1RF0C 3NMDA 2NPSA 2WTYA 1URQB 2N1TA 4ZKPA 3V5BA 3EQ2A 3L35A 1KILD 1T2KD 2CPSA 4C7NA 1SQQK 2Q9IA 2OARA 3V2NA 2OYHC 2WITA 2R32A 3KYQA 1G1JA 3RK2B 4WY4A 5KLVK 1VDFA 3HD7D 4N6JA 2M3BA 2A45G 1RF1C 3CI9A 3E1IA 2OYIC 4LLHA 3WMM0 5CCHC 3BATA 5AW7B 1N7LA 5AVTB 2YKPA 3RL0C 3HRNA 2XZRA 1GL2C 1L4AB 2XDJA 5AW1B 5AW3B 1NTMK 1HVVA 2QM7A 2POHA 1OWAA 4JYCA 2Q3IA 1FU1A 3KPEA 3RK2D 5AW9B 4DZOA 1ZN5A 4HH2A 2FYUK 1CI6B 3H32A 3HD7A 1RE3A 1JY2P 1M1JB 1A02F 2LKMA 1CZQA 2O01H 3LIDA 1G1IA 1JY3O 1SQPK 3GHGB 3TYYA 1N7SB 3V2RA 1JO5A 1FZFA 2W27A 2WSFH 1WT6A 2YKOA 3M9HA 1J2JB 4AUWA 3B5NC 3P8MC 4GT1A 3VP9A 1PFIA 3NFQA 2IFMA 2HPCA 1J1DB 4KHXA 2XNXA 1LWUA 5CCGA 3M0DC 2NPSB 4W7YA 2WPRA 3O8ZA 2HYNA 1RF0A 2J59M 2N1TB 1FOSE 1SQBK 1DH3A 4I1LA 4LC1A 2FFDC 3RL0D 2KOGA 4W80A 4C7NB 1HGZA 1MUUA 2O1JA 3IR9A 1NWQA 2C0XA 2IX7C 3HE5A 2OYHA 2L5GB 1JCDA 3R2PA 2J58A 1Z56A 1A02J 4WY4B 1KQLA 5KTBA 2NPSD 1GU4A 2FKWB 4OH8B 2XV5A 2N1TD 3B8EB 1RF1A 2OYIA 4IFMA 1S9KE 2WSEH 5CCHA 1HTLC 1ZLLA 1JMMA 1LTJC 2YNYA 1RY3A 1GL2A 5AW2B 1XTGB 1URQC 3EFGA 1JY3N 3V2PA 2H43A 3HTKA 2HLOA 1L0LK 1GTWA 1SP4A 4W7ZA 3M06A 3LW5H 4GKGA 3H32B 1IFJA 1FOSF 3HD7B 1G2CA 1GZLA 1YTZI 4GIFA 1JNMA 1LTBC 2Q5UA 1GU5A 2YMYA 1X9VA 2YKQA 2WZ7A 1DEBA 3RK3C 3VYIA 4DOJA 2HODA 4N78D 3TNUA 5APYA 4IFDK 1E5WA 4AYCA 2ZXEB 3B5NA 2HPCB 5APXA 1L4AC 3G3ZA 2M8RA 2FYZA 3TSIA 1AQ5A 1QL1A 2JEEA 2PP6A 1LGHB 3A7OA 2C0WA 4C46A 1GW4A 1HGVA 1IO4A 3MD0A 3M0DA 5AW6B 1H89A 1EQ7A 3BRTB 2WSCH 1IJDB 2FXMA 1X79B 2FFDA 1M1JC 4JF7A 2R5DA 3VTPC 1FZEA 2Z4EA 3HE5B 2OYHB 1SFCC 2WWWA 3U59A 4LGDE 1N7SC 3KQGA 4EOTA 1NOHA 1FAVA 4WBAA 5CCGD 2H7HA 3NTNA 3SWYA 2P1JA 1OXZA 1IFMA 3TK1A 1IC2A 1RF1B 2OYIB 2JJLA 3M0AA 1VPCA 3L4FA 1CW5A 5AW8B 1GDTA 1FDMA 3RL0B 1KFNA 1NKNA 2C9NY 1MFZA 1GL2B 3P8CE 1LTJA 4C7RA 3M9QA 5BVZA 2C9LY 4B86A 3HTKB 1JTHA 4M3LA 3SWFA 1URQA 4IFFA 2H8PD 3VMYA 5KJ7C 5CJ4A 1JY3P 2I1KA 4XE5B 1G2CB 3MGNA 2QM8A 5AVSB 5AW0B 3VN0A 1HJBA 1FZCC 5CCHD 1HWTC 1LTIC 5AVRB 1GL2D 2GUSA 3MUDA 3P32A 2W6BA 2W6AA 5BU5A 1IFDA 3HUSC 2IFNA 3V4QA 5BU8B 2WT7A 2E42A 3TNUB 1LT9C 1QL2A 1SQXK 3N7NA 1NAFA 1KILC 3B5NB 1N73C 2O1KA 1J1EC 5APWA 3UIAA 1L4AA 4EIJA 3NXSA 2XU6A 3VOPA 1KZUB 2YO3A 2Z5IA 3LIEA 5AVXB 2BASA 1GW3A 5AVQB 1FJPA 2FFDB 4Y99B 3OA7A 3V4WA 1M1JA 1X8YA 1ZR4A 3B5ND 1XTCC 1SFCA 3H6PA 5APQA 1H8AA 5CMZA 1KFMA 1N7SA 1MV8A 1FBMA 1WRGA 3V2QA 3RK2C 1NTZK 3VP8A 2XKMA 1IFNA 5AVUB 4AQRD 1GK6A 3HE4A 5AW5B 3P7KA 4JYBA 1LTJB 4RESB 1DX7A 1H88A 1NO4A 1RE4C 5CJ0A 1JTHB 1HBWA 3KDPB 5APVA 2P7JA 5AW4B 1LWUB 2P2UA 3L37A 3MTUE 1NH4A 5KJ7A 2R5BA 1FZBA 4N3YB 1HH0A 3U1CA 3L36A 1AFOA 2YO2A 2E43A 1FZCA 4HYTB 1JOCA 1N86A 3PP5A 4I2LC 1ZR2A 1YTZT 3M9BA 3OAKA 4WB4A 1LTTC 1IFIA 3RK3B 3GHGC 1URQD 1S9KD 3BASA 2WT7B 3HUSA 1JY2O 3OJAB 1HUCA 1LT9A 1SQVK 3MIWA 1KILA 1N73A 1NTKK 3A2AA 2GM4A 2ZFCA 2KP8A 1J1DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AW2 B;  3P32 A;  2W6A A;  2Z5H A;  3HTK A;  2N9B A;  1GTW A;  1SP4 A;  3M06 A;  3T97 A;  3V4Q A;  2P67 A;  2WT7 A;  3VMZ A;  2WPS A;  5APT A;  3TNU B;  2E42 A;  4GKG A;  5APS A;  1NAF A;  1FOS F;  5APU A;  1GZL A;  5AW7 B;  1SLQ A;  5APW A;  5AVT B;  3UIA A;  5AVY B;  1JNM A;  2Q5U A;  1GU5 A;  2XZR A;  5AW1 B;  3NXS A;  2XU6 A;  5AW3 B;  2QM7 A;  5AVX B;  2Z5I A;  2YO3 A;  3LIE A;  1CSB A;  3A5T A;  1YYC A;  3VYI A;  4I6M C;  2BAS A;  1OWA A;  4JYC A;  2Q3I A;  4DZO A;  5AW9 B;  5AVQ B;  2Q7C A;  3HE4 B;  3V4W A;  1CI6 B;  2R3C A;  5APY A;  3TNU A;  4AYC A;  2ZXE B;  1X8Y A;  5APX A;  1A02 F;  1CZQ A;  1T2K C;  3A7O A;  5APQ A;  3LID A;  2VRS A;  4C46 A;  5CMZ A;  1H8A A;  1IO4 A;  3VMX A;  1GK4 A;  1MV8 A;  3M91 A;  3MD0 A;  3M0D A;  5AW6 B;  3TYY A;  1H89 A;  2W27 A;  5AVU B;  4AQR D;  3M9H A;  1J2J B;  1GK6 A;  4AUW A;  3HE4 A;  3P8M C;  1CI6 A;  2R5D A;  4GT1 A;  5AW5 B;  3VTP C;  3P7K A;  3NFQ A;  3HE5 B;  4JYB A;  2WWW A;  4RES B;  1GD2 E;  5AVV B;  1H88 A;  4KHX A;  3KQG A;  4EOT A;  1HBW A;  3KDP B;  5APV A;  1FAV A;  2H7H A;  2P7J A;  3NTN A;  2WPR A;  1OXZ A;  3O8Z A;  5AW4 B;  2P2U A;  3L37 A;  2WPQ A;  3TK1 A;  1FOS E;  1DH3 A;  3A3Y B;  2R5B A;  1JUN A;  2IPP A;  4LC1 A;  2JJL A;  3M0A A;  3L36 A;  4C7N B;  1MUU A;  2YO2 A;  5AW8 B;  2E43 A;  5AVW B;  4HYT B;  3IR9 A;  1NWQ A;  4I2L C;  2C9N Y;  1MFZ A;  3I5C A;  3M9B A;  3HE5 A;  2C9L Y;  4B86 A;  3OAK A;  1A02 J;  4M3L A;  3SWF A;  5AVZ B;  1KQL A;  3NMD A;  3VMY A;  1S9K D;  2WT7 B;  2WTY A;  1GU4 A;  2XV5 A;  1HUC A;  4XE5 B;  3V5B A;  3B8E B;  3L35 A;  1G2C B;  3MGN A;  2QM8 A;  5AVS B;  5AW0 B;  3VN0 A;  1HJB A;  1T2K D;  1S9K E;  3A2A A;  4C7N A;  2ZFC A;  1HWT C;  2KP8 A;  5AVR B;  2YNY A;  2R32 A; 
#chains in the Genus database with same CATH topology
 3II6 A;  1PV3 A;  1M7L A;  5KLI B;  2Z5H A;  1FDO A;  1PPJ G;  2BEZ F;  2GUV A;  1Q82 Q;  4PV1 D;  2IBZ E;  2KSE A;  5APT A;  5B5E H;  3CCL P;  1SFC B;  2JDI H;  2LR2 A;  2NRG A;  1KYO I;  1W2E A;  2KNC B;  1NTZ D;  4U3F E;  3A5T A;  1YYC A;  1IFP A;  4I6M C;  3PHL A;  2Q7C A;  1OW6 A;  1ZME C;  3TF5 A;  2QJK B;  2HG5 D;  3C9I A;  1BDC A;  1RE4 A;  1NKZ B;  1JY2 N;  1FZC B;  1NU1 G;  1OVU A;  1RE3 C;  3BCC D;  1Y8A A;  1GD2 E;  2PAJ A;  1EXI A;  4UB6 E;  2OTK E;  1Q90 D;  1M57 D;  2Y0C A;  1T6A A;  4XFJ A;  1JUN A;  2FXP A;  2I1J A;  2KS1 A;  1T8Z A;  1BE3 J;  1OFC X;  1S5L X;  1N8R Q;  3KXD A;  4WY4 D;  5M1B A;  1RF0 C;  1QEX A;  3NMD A;  3T97 B;  1L0L E;  3L73 E;  2Q3E A;  5GTI H;  1KIL D;  1NTK J;  2CPS A;  1KQS O;  2Q9I A;  3TGU J;  3CMA P;  3CCQ P;  2OTJ P;  1G1J A;  3CX5 E;  2JWA A;  1X22 A;  2M5A A;  1SQQ E;  4WY4 A;  3PH0 A;  3HD7 D;  3CCV P;  2OYI C;  2FBW C;  4LLH A;  3WMM 0;  3BAT A;  3VMA A;  2QE7 H;  2XZR A;  2XDJ A;  3CC4 P;  2QM7 A;  2POH A;  4H44 D;  4PJ0 H;  1OWA A;  3KPE A;  5AW9 B;  4HH2 A;  1NU1 D;  1NYH A;  4H13 D;  3HD7 A;  1M1J B;  2O01 H;  1SQP G;  1LJ2 A;  1JY3 O;  3H1I J;  4UB8 E;  3GMA A;  2UWJ E;  2ZYG A;  2WSF H;  1DIP A;  2K88 A;  4EDF A;  2G8Y A;  2GA1 A;  4W7Y A;  2WPR A;  1SQB G;  1KYO D;  2WQY C;  4LC1 A;  2KOG A;  1MUU A;  4D6T D;  1BCC G;  4WVZ A;  1NWQ A;  2L5G B;  1Z56 A;  2E5Y A;  4ASW A;  1GU4 A;  2FKW B;  3MHV A;  1NJI Q;  3H1H E;  2N1T D;  5GTH E;  1SQX E;  2WSE H;  3AE7 C;  3KZI H;  1JMM A;  1AJY A;  1NTM D;  2YNY A;  1GL2 A;  3AEA C;  4IL6 E;  2IZ1 A;  4EI2 A;  3G6E P;  4GKG A;  3H32 B;  1IFJ A;  4DCK A;  5DJU B;  1SQP D;  1JNM A;  2Q5U A;  1GU5 A;  2Q6Q A;  3MUD C;  2L91 A;  3VYI A;  3L70 J;  4PV1 C;  1HF9 A;  1PP9 J;  3TNU A;  3LW5 J;  4OGQ D;  2E75 D;  3TSI A;  2FXO A;  1AQ5 A;  2ZAE B;  4C46 A;  1BGY E;  1HGV A;  1K8A Q;  2QSI A;  3L71 E;  3M0D A;  5AW6 B;  1SQB D;  3TGU G;  3USS A;  1PGP A;  2FXM A;  1X79 B;  3F89 A;  1BCC D;  1TU3 F;  4LGD E;  1EZV E;  3PTZ A;  1FAV A;  4WBA A;  5CCG D;  3D6Z A;  3H1J G;  4OVN F;  1IC2 A;  4RKU J;  2OYI B;  1VPC A;  2WSC J;  1CW5 A;  5AW8 B;  1FDM A;  3RBX A;  1NKN A;  2C9N Y;  1RQV A;  3P8C E;  4C7R A;  5TIS E;  2E5T A;  4IFF A;  1P84 E;  1G2C B;  5AVS B;  5CCH D;  3WUU A;  3CWB E;  2W6B A;  1FDI A;  1M8O B;  3TDK A;  1NGM B;  5BU5 A;  1QVF O;  4JBZ A;  3CCU P;  1LT9 C;  2CK3 H;  1KIL C;  1N73 C;  2OTL P;  3OW2 O;  5KAI E;  2FYN C;  1VQ8 P;  1NTZ J;  1L0N E;  3A0H H;  3H1I E;  1KZU B;  3LIE A;  3L74 E;  3CCR P;  2BAS A;  1GW3 A;  3L72 G;  5H2F E;  1M1J A;  1ZR4 A;  3B5N D;  1XTC C;  1MV8 A;  2WPV B;  3PJS K;  3H1J D;  4H44 C;  5B5E E;  1NTZ K;  1MKM A;  1U7J A;  1OW7 A;  5AVU B;  4AQR D;  1GK6 A;  3BCC J;  4H13 C;  3QWO C;  3HE4 A;  1H88 A;  1NO4 A;  1JTH B;  4L74 A;  2H89 C;  1HBW A;  3IN6 A;  5APV A;  2P10 A;  1WMK A;  3RBZ A;  2P2U A;  3U1C A;  2RH0 A;  2YO2 A;  2E43 A;  1JOC A;  3AE2 C;  4I2L C;  3EFF K;  3Q3D A;  3OAK A;  3SFE C;  1NVO A;  3GHG C;  1URQ D;  4PV1 B;  3BAS A;  1OZH A;  3HUS A;  1JY2 O;  1SQV G;  1AA0 A;  4IOI H;  1J1D C;  1N2D C;  2N9B A;  3L72 D;  3RK3 D;  3CC2 P;  2N1T C;  4WWI A;  2E76 D;  2WPS A;  1D7M A;  1Q81 Q;  1SLQ A;  1L4A D;  3GW6 A;  1SVF A;  4L73 A;  5GTI E;  1BDD A;  1NU1 J;  3WU2 H;  2HOD B;  2A06 G;  1T2K C;  4N78 E;  3CXH D;  2MJZ A;  2RKL A;  1N7S D;  4KJM A;  3H1L D;  4Y99 C;  2KLV A;  2MKV A;  1ZRT D;  4K35 A;  4PD4 H;  4OGQ C;  2E75 C;  1NU1 K;  5AVV B;  3IFM A;  2A45 H;  4PJ0 E;  1VQ9 P;  3JC2 2;  4DJG A;  1SQV D;  5KJ7 D;  1LT9 B;  2K9J B;  1KIL B;  1N73 B;  4D6T J;  1KN7 A;  5AVW B;  3IF4 A;  1LTG C;  1LWU C;  5CCG C;  2D2C D;  2NPS A;  1ZOY C;  3A0B E;  1SQQ K;  1NTM J;  1Q2N A;  5E79 H;  2R32 A;  5KLV G;  1VDF A;  3WUT A;  4H13 B;  2PRR A;  5CCH C;  1SQP J;  5AW7 B;  5AVT B;  3RL0 C;  1KB9 H;  3S4R A;  4Z1M H;  3ABV C;  4BWN A;  1L2P A;  5AW1 B;  1NTM K;  4HB1 A;  2IBZ G;  4JYC A;  4DZO A;  1FU1 A;  3GG2 A;  3KZI E;  3AE8 C;  5CBO A;  1CI6 B;  1AQT A;  1VQ5 P;  1S1C X;  1HJ0 A;  2FYU E;  1G1I A;  1SQP K;  2K1A A;  1SQB J;  3GHG B;  3TYY A;  3CX5 I;  1JO5 A;  1FZF A;  2W27 A;  1WT6 A;  1BCC J;  2YIU C;  2YKO A;  4KT0 J;  4AUW A;  3B5N C;  3P8M C;  3SWK A;  3VP9 A;  3L75 E;  2IFM A;  2ZYA A;  1J1D B;  1USE A;  1PPJ E;  2J59 M;  2N1T B;  1FOS E;  1SQB K;  4I1L A;  2FFD C;  4W80 A;  4C7N B;  2BCC D;  1ZXG A;  3IR9 A;  1U57 A;  3HE5 A;  2OYH A;  1JCD A;  2J58 A;  4MN4 C;  1A02 J;  5KLV D;  1KQL A;  5KTB A;  3CXH H;  2KLU A;  3E7K A;  4OH8 B;  1RF1 A;  4ZMD A;  2ZYD A;  1YJN P;  2IBZ D;  1URQ C;  3EFG A;  2H43 A;  3LW5 H;  3H1K G;  2IZ0 A;  1FOS F;  2E75 B;  2PFX A;  1Y9B A;  1GZL A;  2K3R A;  4U3F D;  2WZ7 A;  2YXQ B;  1SQQ G;  4D6T G;  3D70 A;  3RK3 C;  1VQP P;  3I56 P;  2E76 C;  2HOD A;  1YJW P;  4IFD K;  1E5W A;  2HPC B;  5APX A;  1L4A C;  3G3Z A;  2JO1 A;  1Y47 A;  1QL1 A;  2PP6 A;  3A7O A;  1Q86 Q;  3H1J J;  3MD0 A;  2LXB A;  2WSC H;  1IJD B;  1NTM G;  2ZT9 D;  1EDJ A;  2M3E A;  1LP1 A;  1R5L A;  1FZE A;  2Z4E A;  3A0H E;  2WWW A;  2DW3 A;  1N7S C;  3AE9 C;  3NTN A;  1OXZ A;  4TLF A;  3S1K A;  1H0T B;  1VF5 D;  3H25 A;  2Y9Z A;  3RL0 B;  3SFD C;  1LTJ A;  3M9Q A;  2IYP A;  2C9L Y;  1L0L D;  3HTK B;  5DJT B;  3FWL A;  3L73 D;  4M3L A;  3SWF A;  3AE6 C;  3H1K D;  5KJ7 C;  5CJ4 A;  3VN0 A;  3O6Q B;  2AEM A;  5C39 A;  3CX5 D;  4K3A A;  3R4Y A;  3PLN A;  1SQQ D;  2G3A A;  1GL2 D;  2WSS H;  1EZV I;  2D2C C;  3L72 J;  1IFD A;  3V4Q A;  2V4H A;  5BU8 B;  2YIU B;  2E42 A;  1SQX G;  1QL2 A;  3IAO A;  3N7N A;  5KKZ C;  3B5N B;  2W83 C;  3ZDM A;  1J1E C;  1FE6 A;  3UIA A;  2JKV A;  4EIJ A;  2W6J H;  3AED C;  4IL6 X;  3NXS A;  5AVX B;  3CC7 P;  5AVQ B;  1P84 I;  2FFD B;  3S9O A;  2B87 B;  3B4S A;  1SFC A;  4TT3 H;  2KNC A;  3G71 P;  3H1L J;  1AVY A;  2XKM A;  5EFW B;  3L71 G;  2QJY C;  1DX7 A;  1RE4 C;  3KDP B;  2P7J A;  3WU2 E;  2W90 A;  1SQV J;  3L37 A;  1KC8 Q;  3MTU E;  2R5B A;  1FZB A;  3L36 A;  3AEG C;  1FZC A;  4HYT B;  1EZV G;  1JMB A;  3H1H D;  3AEB C;  3RK3 B;  3W68 A;  3G4S P;  1BE3 E;  2E76 B;  1SQX D;  4PD4 E;  2WT7 B;  2R3S A;  1HUC A;  1SQV K;  3MIW A;  1OMI A;  4CPG A;  1NTK E;  1EC5 A;  3TGU E;  3T97 A;  2WVR A;  1FC2 C;  5APS A;  3FWN A;  3CWB G;  4Y28 J;  1JEK A;  3FX0 A;  2KSJ A;  2KB7 P;  4WY4 C;  1T3U A;  2N9Y B;  1S5L H;  1FJK A;  1LTS C;  3BRV B;  2R3C A;  1K05 A;  1BGY D;  3L71 D;  1DEE G;  2VRS A;  1GK4 A;  1KYO H;  3M91 A;  3CLQ A;  2K37 A;  1KB9 E;  1QLE D;  1EZV D;  3HD7 C;  2E74 D;  2AXC A;  3U1A A;  1YBK A;  2D2C B;  4QMA A;  2K9Y A;  2WPQ A;  2KI7 B;  1T3J A;  2ZT9 C;  3A3Y B;  5KKZ B;  3P8C D;  3SSU A;  4NPF X;  1J1E B;  2BCC J;  1FZG A;  1LTA C;  3I5C A;  1NHL A;  2RN0 A;  1P84 D;  1JCC A;  3C1L A;  5KLV J;  2QIW A;  1VQK P;  2PGD A;  3O6Q A;  3CWB D;  4ZKP A;  1VF5 C;  2QG4 A;  4I7Z C;  3H1L G;  1VQM P;  5B66 H;  3KYQ A;  1KQF B;  4HKZ H;  2SPZ A;  3RGU A;  3Q1M A;  2YMK A;  5KLV K;  2IDB A;  1U7M A;  3CI9 A;  3E1I A;  1L0N D;  4U3F J;  3PRJ A;  1N7L A;  2WMM A;  2YKP A;  3ITK A;  2QJY B;  3L74 D;  3HRN A;  1GL2 C;  3CXH E;  1YIJ P;  1PZQ A;  5AW3 B;  2B87 A;  2Q3I A;  3RK2 D;  2FYU K;  4YXD C;  5KAF H;  3H32 A;  1RE3 A;  3L70 E;  2LKM A;  1CZQ A;  3LID A;  1PP9 E;  2Y9Y A;  4ASV A;  1PL5 A;  1M90 Q;  1J2J B;  4GT1 A;  1YQ3 C;  3NFQ A;  3I55 P;  1W5C E;  4KHX A;  3CD6 P;  3M0D C;  2AXT H;  3O8Z A;  2HYN A;  1RF0 A;  3CCJ P;  1R5S A;  1HGZ A;  2O1J A;  3D6Y A;  1W2B O;  1YQ4 C;  2J5U A;  3C8V A;  2IX7 C;  1L0L J;  2QEX P;  1KD1 Q;  3L73 J;  4WY4 B;  3H1K J;  2NPS D;  1OIP A;  2OYI A;  1S9K E;  3AEE C;  2A06 E;  1SQQ J;  2P58 A;  5AW2 B;  4A7P A;  2FYN B;  2HR3 A;  2HLO A;  1VQO P;  1L0L K;  3M06 A;  1PGO A;  3WUV A;  2V7Q J;  1Q7Y Q;  3HD7 B;  1G2C A;  1YTZ I;  2B88 A;  1LTB C;  2YMY A;  1X9V A;  2YKQ A;  2BCC G;  2ZT9 B;  4H44 B;  1NTZ E;  1S2E A;  4N78 D;  5APY A;  2ZXE B;  3GLM A;  2FYZ A;  2XND H;  4JQ0 D;  1EDL A;  1JM0 A;  2C0W A;  1GW4 A;  1IO4 A;  3FXD A;  1M1K Q;  1OX3 A;  1GMJ A;  1VF5 B;  4I7Z B;  2AEF A;  1M1J C;  1VQ6 P;  4JF7 A;  2FYU G;  4EOT A;  1RHZ B;  3BCC E;  2KIK A;  4U3F G;  3TK1 A;  1K04 A;  4U7J A;  2JJL A;  3AE3 C;  4RO0 A;  3QH9 A;  3CPW O;  2E74 C;  1KFN A;  4GOD A;  1MFZ A;  1GL2 B;  3H1H J;  2RMZ A;  5BVZ A;  4B86 A;  3JSV C;  1JTH A;  1SQX J;  2H8P D;  3F5H A;  3VMY A;  2ZVO B;  4OWF A;  1JY3 P;  3JCU H;  2I1K A;  3Q5P A;  1HJB A;  1LT1 A;  5AVR B;  1UII A;  1KIL E;  3MUD A;  2ZVN B;  4BRY B;  1YIT P;  3HUS C;  3AE5 C;  4EYY Q;  3TNU B;  1SQX K;  1VL2 A;  2FY8 A;  3W67 A;  2O1K A;  2I8D A;  1ZW0 A;  1PGJ A;  3VOP A;  2YO3 A;  1FJP A;  1BGY J;  4Y99 B;  2FYU D;  1L0L G;  3V4W A;  3L71 J;  1E79 H;  3L73 G;  1VQL P;  1X8Y A;  3B71 A;  4OGQ B;  3H6P A;  1NU1 E;  1UIX A;  2KK7 A;  1H8A A;  5CMZ A;  1KFM A;  2R44 A;  3V2Q A;  3RK2 C;  3L75 D;  3CCE P;  1KQG B;  2ITA A;  1EDK A;  3E1R A;  1PPJ D;  4JYB A;  5CBN A;  2OQQ A;  1S5L E;  5CJ0 A;  4H0L D;  5AW4 B;  1YHQ P;  1LWU B;  3H1K E;  1NH4 A;  1AFO A;  1R8E A;  3PP5 A;  1VQ4 P;  1KYO E;  1YTZ T;  3M9B A;  2QJP C;  4D6T E;  3MZW B;  3CWB J;  3OJA B;  2JR8 A;  1LT9 A;  2K9J A;  2ZJS E;  1KIL A;  4GOE A;  1N73 A;  1NTK K;  2AEJ A;  3A2A A;  1OVV A;  2GM4 A;  2ZFC A;  3CCS P;  2Y0D A;  2KP8 A;  3AE1 C;  2NPS C;  2HFE D;  1NTM E;  1FS0 E;  2P67 A;  3VMZ A;  4XA4 A;  1L0N J;  5APU A;  3CCM P;  3L74 J;  5AVY B;  2KUB A;  4ZKU A;  3N4X A;  4O9B A;  1SQP E;  1AV1 A;  2KYV A;  3GF7 A;  1CSB A;  2LXC B;  2CPB A;  4PD4 I;  1KTM A;  2Y0E A;  3H1H G;  3HE4 B;  5K5G B;  3A0B H;  2KXP B;  2E74 B;  5B66 E;  1VQN P;  2A45 I;  1L0N K;  1SFC D;  1MZ9 A;  2B89 A;  5CHX A;  3VMX A;  3BVH A;  1ZV8 A;  2BEQ D;  3CME P;  4R4L A;  1SQB E;  4GDO A;  2QA4 P;  1CI6 A;  3CL3 D;  1IK9 A;  1BCC E;  1OW8 A;  4DT0 A;  3Q5S A;  3GHG A;  3HUS B;  1MFT A;  5KAF E;  1KOR A;  2IPP A;  1FZA A;  1BGY G;  5AVZ B;  2WTY A;  1SS1 A;  1URQ B;  2N1T A;  1YI2 P;  3V5B A;  3EQ2 A;  3L35 A;  3EWK A;  1T2K D;  1KB9 I;  4C7N A;  2AXT E;  2NZ2 A;  2OAR A;  3V2N A;  2OYH C;  2WIT A;  4BRY A;  1BE3 G;  3RK2 B;  2YXR B;  4L75 A;  4N6J A;  2M3B A;  2A45 G;  1RF1 C;  3GF3 A;  4YXW H;  1NTK G;  1L4A B;  1HVV A;  1K9M Q;  3AE4 C;  1YJ9 P;  1ZN5 A;  4UB6 H;  1DD3 A;  1JY2 P;  1A02 F;  2QJP B;  1IZN B;  2KZI A;  4NPD A;  1N7S B;  3V2R A;  1S3J A;  1KMI Z;  1ZP0 C;  3H1J E;  3M9H A;  1RH5 B;  1PFI A;  2HPC A;  2XNX A;  5E79 E;  1BSH A;  1LWU A;  5CCG A;  3CXH I;  2NPS B;  1L0N G;  1USD A;  2O01 J;  2W8Z A;  3H1I G;  3CX5 H;  3L74 G;  1DH3 A;  3RL0 D;  3FGA D;  2JWD A;  2WSF J;  2C0X A;  4PD4 D;  1BE3 D;  4BXL A;  3R2P A;  4H0L C;  2M0B A;  1IK7 A;  1JB0 J;  2V7Q H;  2XV5 A;  3B8E B;  4IFM A;  1H0T A;  5CCH A;  3G9R A;  1HTL C;  1ZLL A;  1NTK D;  1LTJ C;  4HJG H;  4RJT A;  3TGU D;  1RY3 A;  3AEF C;  1XTG B;  1EXJ A;  3V2P A;  1JY3 N;  1AVO A;  3HTK A;  2H88 C;  1GTW A;  4ZNC A;  1SP4 A;  4W7Z A;  4UB8 H;  1M56 D;  3L72 E;  3RK3 E;  4GIF A;  2JP3 A;  1LNQ A;  2WSE J;  4YPC A;  3JCU E;  1DEB A;  4DOJ A;  3Q5R A;  2FYU J;  2QVA A;  1NAY A;  2O01 N;  5TJH A;  4AYC A;  3B5N A;  2M8R A;  3KHU A;  1PGQ A;  2JEE A;  1LGH B;  3H1I D;  1H89 A;  1KB9 D;  1EQ7 A;  5KLI C;  3BRT B;  3L75 J;  2Q1K A;  3L70 G;  2FFD A;  3H1L E;  2R5D A;  3VTP C;  1PP9 G;  3HE5 B;  2OYH B;  1SFC C;  5GTH H;  3U59 A;  1ZRT E;  4L76 A;  3KQG A;  1NOH A;  2H7H A;  3SWY A;  2P1J A;  1IFM A;  1RF1 B;  4IL6 H;  3M0A A;  3L4F A;  1GDT A;  1DD4 A;  2QJK C;  1SQV E;  4YTP C;  2IYO A;  2KS1 B;  2OYO A;  1URQ A;  1RQU A;  4JPZ B;  4XE5 B;  3MGN A;  2QM8 A;  5AW0 B;  5L8R J;  1FZC C;  3K5B A;  1HWT C;  1LTI C;  3RL0 g;  1QX8 A;  2GUS A;  3P32 A;  2ZXX A;  2W6A A;  2IFN A;  3FXE A;  2WT7 A;  2M5A B;  1K73 Q;  1VQ7 P;  1NAF A;  5APW A;  1L4A A;  3D71 A;  2XU6 A;  2Z5I A;  2IBZ I;  3L70 D;  1LP1 B;  3OA7 A;  1PP9 D;  2O3J A;  1KV4 A;  5APQ A;  4H0L B;  1N7S A;  1FBM A;  1WRG A;  1NTZ G;  3VP8 A;  5TIS H;  1IFN A;  1P84 H;  2B9B A;  5AW5 B;  3P7K A;  1LTJ B;  4RES B;  3V6I A;  1OVR A;  4GOF A;  4R4M A;  3Q2Y A;  1BSN A;  3AEC C;  5KJ7 A;  4NPE A;  2KZJ A;  4N3Y B;  1HH0 A;  3MP7 B;  1QVG O;  1N86 A;  1EDI A;  1ZR2 A;  1PIX A;  3BCC G;  2QRX A;  4WB4 A;  1S4X A;  2BCC E;  5KAI H;  1LTT C;  1IFI A;  1S9K D;  2A06 D;  2OGU A;  5KLV E;  1X0T A;  5H2F H;  1S72 P;  3L75 G;  1QGK B; 
#chains in the Genus database with same CATH homology
 3II6 A;  1M7L A;  1N2D C;  2Z5H A;  2N9B A;  2NPS C;  2HFE D;  3RK3 D;  2GUV A;  3T97 A;  2P67 A;  2N1T C;  3VMZ A;  2WPS A;  5APT A;  4XA4 A;  5APS A;  5APU A;  1SLQ A;  1SFC B;  5AVY B;  1L4A D;  4ZKU A;  1W2E A;  2KSJ A;  3N4X A;  4O9B A;  2KB7 P;  1SVF A;  2KYV A;  1CSB A;  1T3U A;  4WY4 C;  1YYC A;  3A5T A;  4I6M C;  2CPB A;  1FJK A;  1LTS C;  2Q7C A;  3HE4 B;  3BRV B;  2R3C A;  2HOD B;  2HG5 D;  3C9I A;  2A45 I;  1L0N K;  1MZ9 A;  1SFC D;  4N78 E;  1T2K C;  2MJZ A;  2VRS A;  1RE4 A;  1N7S D;  1NKZ B;  5CHX A;  3VMX A;  1GK4 A;  3M91 A;  3CLQ A;  3BVH A;  1ZV8 A;  4Y99 C;  2KLV A;  1JY2 N;  1FZC B;  1CI6 A;  1NU1 K;  1IK9 A;  1RE3 C;  3CL3 D;  3HD7 C;  1GD2 E;  2PAJ A;  5AVV B;  3U1A A;  3IFM A;  2A45 H;  3GHG A;  3HUS B;  2WPQ A;  1T3J A;  3A3Y B;  5KJ7 D;  1LT9 B;  1JUN A;  2IPP A;  1KIL B;  3P8C D;  1N73 B;  1J1E B;  2I1J A;  1FZA A;  1FZG A;  1LTA C;  5AVW B;  1T8Z A;  3I5C A;  1NHL A;  1LTG C;  4WY4 D;  1LWU C;  1JCC A;  5CCG C;  5AVZ B;  1RF0 C;  3NMD A;  2NPS A;  2WTY A;  1URQ B;  2N1T A;  4ZKP A;  3V5B A;  3EQ2 A;  3L35 A;  1KIL D;  1T2K D;  2CPS A;  4C7N A;  1SQQ K;  2Q9I A;  2OAR A;  3V2N A;  2OYH C;  2WIT A;  2R32 A;  3KYQ A;  1G1J A;  3RK2 B;  4WY4 A;  5KLV K;  1VDF A;  3HD7 D;  4N6J A;  2M3B A;  2A45 G;  1RF1 C;  3CI9 A;  3E1I A;  2OYI C;  4LLH A;  3WMM 0;  5CCH C;  3BAT A;  5AW7 B;  1N7L A;  5AVT B;  2YKP A;  3RL0 C;  3HRN A;  2XZR A;  1GL2 C;  1L4A B;  2XDJ A;  5AW1 B;  5AW3 B;  1NTM K;  1HVV A;  2QM7 A;  2POH A;  1OWA A;  4JYC A;  2Q3I A;  1FU1 A;  3KPE A;  3RK2 D;  5AW9 B;  4DZO A;  1ZN5 A;  4HH2 A;  2FYU K;  1CI6 B;  3H32 A;  3HD7 A;  1RE3 A;  1JY2 P;  1M1J B;  1A02 F;  2LKM A;  1CZQ A;  2O01 H;  3LID A;  1G1I A;  1JY3 O;  1SQP K;  3GHG B;  3TYY A;  1N7S B;  3V2R A;  1JO5 A;  1FZF A;  2W27 A;  2WSF H;  1WT6 A;  2YKO A;  3M9H A;  1J2J B;  4AUW A;  3B5N C;  3P8M C;  4GT1 A;  3VP9 A;  1PFI A;  3NFQ A;  2IFM A;  2HPC A;  1J1D B;  4KHX A;  2XNX A;  1LWU A;  5CCG A;  3M0D C;  2NPS B;  4W7Y A;  2WPR A;  3O8Z A;  2HYN A;  1RF0 A;  2J59 M;  2N1T B;  1FOS E;  1SQB K;  1DH3 A;  4I1L A;  4LC1 A;  2FFD C;  3RL0 D;  2KOG A;  4W80 A;  4C7N B;  1HGZ A;  1MUU A;  2O1J A;  3IR9 A;  1NWQ A;  2C0X A;  2IX7 C;  3HE5 A;  2OYH A;  2L5G B;  1JCD A;  3R2P A;  2J58 A;  1Z56 A;  1A02 J;  4WY4 B;  1KQL A;  5KTB A;  2NPS D;  1GU4 A;  2FKW B;  4OH8 B;  2XV5 A;  2N1T D;  3B8E B;  1RF1 A;  2OYI A;  4IFM A;  1S9K E;  2WSE H;  5CCH A;  1HTL C;  1ZLL A;  1JMM A;  1LTJ C;  2YNY A;  1RY3 A;  1GL2 A;  5AW2 B;  1XTG B;  1URQ C;  3EFG A;  1JY3 N;  3V2P A;  2H43 A;  3HTK A;  2HLO A;  1L0L K;  1GTW A;  1SP4 A;  4W7Z A;  3M06 A;  3LW5 H;  4GKG A;  3H32 B;  1IFJ A;  1FOS F;  3HD7 B;  1G2C A;  1GZL A;  1YTZ I;  4GIF A;  1JNM A;  1LTB C;  2Q5U A;  1GU5 A;  2YMY A;  1X9V A;  2YKQ A;  2WZ7 A;  1DEB A;  3RK3 C;  3VYI A;  4DOJ A;  2HOD A;  4N78 D;  3TNU A;  5APY A;  4IFD K;  1E5W A;  4AYC A;  2ZXE B;  3B5N A;  2HPC B;  5APX A;  1L4A C;  3G3Z A;  2M8R A;  2FYZ A;  3TSI A;  1AQ5 A;  1QL1 A;  2JEE A;  2PP6 A;  1LGH B;  3A7O A;  2C0W A;  4C46 A;  1GW4 A;  1HGV A;  1IO4 A;  3MD0 A;  3M0D A;  5AW6 B;  1H89 A;  1EQ7 A;  3BRT B;  2WSC H;  1IJD B;  2FXM A;  1X79 B;  2FFD A;  1M1J C;  4JF7 A;  2R5D A;  3VTP C;  1FZE A;  2Z4E A;  3HE5 B;  2OYH B;  1SFC C;  2WWW A;  3U59 A;  4LGD E;  1N7S C;  3KQG A;  4EOT A;  1NOH A;  1FAV A;  4WBA A;  5CCG D;  2H7H A;  3NTN A;  3SWY A;  2P1J A;  1OXZ A;  1IFM A;  3TK1 A;  1IC2 A;  1RF1 B;  2OYI B;  2JJL A;  3M0A A;  1VPC A;  3L4F A;  1CW5 A;  5AW8 B;  1GDT A;  1FDM A;  3RL0 B;  1KFN A;  1NKN A;  2C9N Y;  1MFZ A;  1GL2 B;  3P8C E;  1LTJ A;  4C7R A;  3M9Q A;  5BVZ A;  2C9L Y;  4B86 A;  3HTK B;  1JTH A;  4M3L A;  3SWF A;  1URQ A;  4IFF A;  2H8P D;  3VMY A;  5KJ7 C;  5CJ4 A;  1JY3 P;  2I1K A;  4XE5 B;  1G2C B;  3MGN A;  2QM8 A;  5AVS B;  5AW0 B;  3VN0 A;  1HJB A;  1FZC C;  5CCH D;  1HWT C;  1LTI C;  5AVR B;  1GL2 D;  2GUS A;  3MUD A;  3P32 A;  2W6B A;  2W6A A;  5BU5 A;  1IFD A;  3HUS C;  2IFN A;  3V4Q A;  5BU8 B;  2WT7 A;  2E42 A;  3TNU B;  1LT9 C;  1QL2 A;  1SQX K;  3N7N A;  1NAF A;  1KIL C;  3B5N B;  1N73 C;  2O1K A;  1J1E C;  5APW A;  3UIA A;  1L4A A;  4EIJ A;  3NXS A;  2XU6 A;  3VOP A;  1KZU B;  2YO3 A;  2Z5I A;  3LIE A;  5AVX B;  2BAS A;  1GW3 A;  5AVQ B;  1FJP A;  2FFD B;  4Y99 B;  3OA7 A;  3V4W A;  1M1J A;  1X8Y A;  1ZR4 A;  3B5N D;  1XTC C;  1SFC A;  3H6P A;  5APQ A;  1H8A A;  5CMZ A;  1KFM A;  1N7S A;  1MV8 A;  1FBM A;  1WRG A;  3V2Q A;  3RK2 C;  1NTZ K;  3VP8 A;  2XKM A;  1IFN A;  5AVU B;  4AQR D;  1GK6 A;  3HE4 A;  5AW5 B;  3P7K A;  4JYB A;  1LTJ B;  4RES B;  1DX7 A;  1H88 A;  1NO4 A;  1RE4 C;  5CJ0 A;  1JTH B;  1HBW A;  3KDP B;  5APV A;  2P7J A;  5AW4 B;  1LWU B;  2P2U A;  3L37 A;  3MTU E;  1NH4 A;  5KJ7 A;  2R5B A;  1FZB A;  4N3Y B;  1HH0 A;  3U1C A;  3L36 A;  1AFO A;  2YO2 A;  2E43 A;  1FZC A;  4HYT B;  1JOC A;  1N86 A;  3PP5 A;  4I2L C;  1ZR2 A;  1YTZ T;  3M9B A;  3OAK A;  4WB4 A;  1LTT C;  1IFI A;  3RK3 B;  3GHG C;  1URQ D;  1S9K D;  3BAS A;  2WT7 B;  3HUS A;  1JY2 O;  3OJA B;  1HUC A;  1LT9 A;  1SQV K;  3MIW A;  1KIL A;  1N73 A;  1NTK K;  3A2A A;  2GM4 A;  2ZFC A;  2KP8 A;  1J1D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...