2Q7CA

Crystal structure of iqn17
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords fusion protein between yeast variant GCN4 and HIVgp41
publication title Inhibiting HIV Entry: Discovery of D-Peptide Inhibitors that Target the Gp41 Coiled-Coil Pocket
pubmed doi rcsb
total genus 20
structure length 45
sequence length 45
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2q7cA00
5CMZA 5AW8B 5APQA 3TNUA 3M0AA 1JNMA 4I2LC 2Z5HA 3HE4A 5AW1B 4C7NA 1IO4A 4DZOA 1GK4A 2YO2A 5APVA 2Q3IA 2E43A 1HBWA 1CI6A 4GT1A 2W27A 3B8EB 1JUNA 3L37A 5AW4B 3VMZA 4EOTA 1GTWA 3A7OA 4B86A 1YYCA 5AVUB 5AW6B 3A3YB 1CZQA 1FOSE 1X8YA 2QM7A 3KDPB 2Q7CA 1NAFA 2ZFCA 5AVYB 1CSBA 4GKGA 5AW7B 2QM8A 3V4WA 1CI6B 3VMYA 1T2KC 4AUWA 5AVVB 1GZLA 3SWFA 1HWTC 5AW9B 2WT7A 4JYCA 1A02F 1J2JB 3VMXA 2P2UA 4C46A 3UIAA 4HYTB 3VTPC 5AW3B 3OAKA 3NFQA 2VRSA 1H89A 3A2AA 3LIDA 2XV5A 3I5CA 2N9BA 4XE5B 2YNYA 5AVZB 1HUCA 4AYCA 1A02J 2C9LY 5AVRB 5AW0B 1SP4A 2WWWA 2R5BA 5APUA 3M9BA 4LC1A 5AVTB 2WT7B 1MFZA 2R3CA 3T97A 1FOSF 2W6AA 2BASA 3VN0A 3KQGA 3TK1A 5APWA 3TYYA 3LIEA 1H8AA 2Z5IA 1KQLA 1GK6A 3P32A 5AW5B 1S9KD 1GD2E 5AVQB 3MGNA 3HE5B 5AVWB 2IPPA 2Q5UA 4AQRD 3IR9A 3V4QA 2P7JA 1MV8A 3VYIA 2H7HA 3L35A 1MUUA 3M9HA 2WTYA 4I6MC 2ZXEB 2KP8A 3V5BA 3HE5A 2XZRA 1GU4A 5APXA 2WPSA 5AVXB 4KHXA 3NTNA 2YO3A 1DH3A 3L36A 3MD0A 1T2KD 3M91A 2R5DA 2WPRA 1H88A 3NXSA 2WPQA 5APYA 4M3LA 3O8ZA 2JJLA 2C9NY 4JYBA 5APTA 4RESB 3P7KA 5AW2B 1OWAA 2XU6A 3HTKA 1S9KE 3TNUB 2E42A 1FAVA 3NMDA 1NWQA 3M06A 2P67A 3P8MC 1OXZA 3HE4B 1SLQA 4C7NB 2R32A 1HJBA 5APSA 1G2CB 5AVSB 3A5TA 3M0DA 1GU5A
chains in the Genus database with same CATH superfamily
2W8ZA 2P58A 3GLMA 3AE8C 3B5ND 4PD4I 2ZT9D 1M7LA 3JCUE 4JQ0D 1JMBA 2W27A 2OTJP 2WSSH 5TISE 3L37A 3RBXA 1YYCA 2N1TA 3H1IJ 3A3YB 2WSCJ 1FDMA 2QM7A 2ZT9C 1CSBA 2FYNB 1X0TA 1GZLA 3E1IA 2FXMA 4GIFA 3B5NA 3MZWB 1SQXK 2KNCA 5DJUB 1QL1A 1YJWP 4WY4C 2C9LY 1S3JA 5AVRB 4IFFA 4NPEA 2POHA 3IF4A 2FY8A 2J5UA 3K5BA 4EDFA 3TK1A 2WVRA 3H1IE 3GHGB 3LW5H 3RK3D 2E76B 1T3JA 4HKZH 2FYUG 1KN7A 1JY2O 2QIWA 3HD7D 4JF7A 1MUUA 1QLED 1U7JA 2YO3A 1VQNP 3MD0A 3M91A 1H88A 5APYA 5KLVJ 1XTCC 5B5EH 1HGZA 1SQVK 5AW2B 2O01H 2O1KA 2XU6A 1KILB 3NMDA 3P8MC 3HE4B 4I7ZC 1HJBA 1T8ZA 4D6TD 3HD7A 3A5TA 4I1LA 4IL6E 2E74B 3TNUA 1USDA 4I2LC 3VMAA 5H2FH 1IO4A 2H89C 1FJKA 2M5AB 2I1JA 2OYHB 1CI6A 1SFCB 1K9MQ 2NPSC 5AW4B 1PP9G 1PGOA 1IZNB 5KLVE 1NU1G 1M90Q 4H13B 1ZP0C 2FYUD 1J1EB 1JY3O 1LT9C 3KDPB 1NO4A 3G3ZA 1T2KC 1AA0A 2A06E 1FZCA 3G9RA 3VTPC 3KHUA 3LIDA 3L75J 1SVFA 4A7PA 3T97B 3CCEP 4H44C 4W80A 5APUA 1Q2NA 4GODA 1VQ8P 1KZUB 2OYOA 3MHVA 3WUVA 3KQGA 2OGUA 3CWBJ 3AE6C 1VQPP 3GMAA 1AVYA 2Z5IA 1YTZI 3AEEC 1IFJA 1DIPA 3HE5B 1GW3A 1MZ9A 3IR9A 3V4QA 3FXDA 1S5LH 1KORA 3MUDC 3L75E 5E79H 1VQ6P 1PP9D 1KYOD 4NPFX 2K9YA 2IBZD 4R4LA 3O8ZA 2JJLA 1RF1C 3CWBE 2JKVA 4PD4E 3S9OA 2FFDA 4DOJA 4C7NB 1SS1A 4WVZA 2RKLA 1QL2A 2YMYA 5GTHH 3RK3B 4PV1D 3GW6A 3L4FA 4UB6H 2LR2A 1JMMA 1NTKG 2V7QJ 3M0DC 3HD7B 4PJ0E 2JEEA 5AVUB 3PH0A 3PP5A 5KAIH 1Z56A 1PIXA 4EIJA 3VMYA 1CI6B 2KSEA 2WQYC 3CXHD 3UIAA 4HYTB 5AW3B 1S2EA 1KC8Q 1SQPD 1OX3A 1S72P 2MKVA 4DJGA 4WWIA 1FZCB 3RBZA 1FOSF 5APWA 1SQXG 3KPEA 3H1KJ 2QRXA 3QWOC 3O6QA 3TGUG 2OYIB 2Q5UA 2AEFA 1BSHA 1YHQP 4I6MC 4WB4A 1GL2C 2WSCH 2K3RA 3AE7C 1BSNA 3RL0D 1DH3A 2R5DA 3CX5D 4RESB 1DX7A 1K73Q 3C8VA 3H1KE 1M1JC 1JOCA 3V2QA 2E75D 1Q81Q 1IJDB 2R3SA 4DZOA 2YO2A 2HODB 3USSA 2JP3A 1EXJA 1HJ0A 1IFDA 3VMZA 3GF7A 3CC7P 1RE4A 2I1KA 4WBAA 2HLOA 1CZQA 3TGUD 1X8YA 3H1LG 1NJIQ 2ZFCA 3SWFA 3LW5J 2W90A 1N73C 1P84D 2WZ7A 3FWLA 4IOIH 1BDDA 2K9JA 3L72G 1L0NK 5AW0B 1SP4A 4JPZB 2R5BA 4IFMA 2FKWB 3R4YA 2R3CA 3L74J 2BASA 1LTJA 2D2CC 3LIEA 1QVGO 1GK6A 5KTBA 5KLIB 2GA1A 4PV1B 2YKQA 2LKMA 2O01J 2PAJA 1VF5D 2KB7P 2O01N 1BGYD 3WU2H 2FYUK 1KV4A 3EWKA 2M0BA 3BRTB 3CCUP 5AVXB 4YPCA 2ZXXA 3VOPA 3L73D 4Z1MH 3TDKA 1LTAC 3H1LD 2QJKC 3L74E 5L8RJ 3TF5A 5KKZB 5B5EE 3PRJA 3Q5PA 3AEGC 3CCLP 2PGDA 5AW8B 3L72D 1M56D 2L91A 3II6A 3WMM0 1RE3A 3CCQP 2E43A 3CI9A 3OA7A 5H2FE 1OZHA 4LLHA 1PPJG 1OW8A 3SWYA 2E5YA 3L71G 2RMZA 2FYNC 4K35A 2WT7A 2C0WA 3VMXA 3BCCJ 3CD6P 1BCCG 3R2PA 4XE5B 1YJNP 1ZR2A 1J1DB 1L4AB 1PV3A 3H6PA 1FE6A 1NU1J 4LC1A 5KJ7D 1T3UA 1NTMD 1LGHB 2YKPA 3GHGC 2E76C 2K9JB 5CJ0A 2FXPA 3CMAP 2LXCB 1RF0A 5K5GB 1VQ7P 4UB8H 2IDBA 3BCCE 5KJ7C 2KP8A 5CBOA 2BCCD 2Y9ZA 1S5LE 1PPJD 2E74D 5CJ4A 5KJ7A 1NU1E 5E79E 4JYBA 1YTZT 5CCHD 5APTA 1EZVI 1SQPK 1KB9D 1KILC 1S9KE 3H1HD 1L0LG 4H13D 1GU5A 5CMZA 3M0AA 3HE4A 1ZV8A 5CCHC 1QX8A 1SFCC 1VF5B 5GTHE 2M5AA 5CCHA 2M3EA 1AV1A 4H0LC 2OYHA 4BRYA 1J1EC 4UB6E 2CPBA 4N3YB 3HUSB 3V4WA 3L70J 2B88A 5KAIE 1W2BO 4JYCA 2QJYB 1J2JB 1ZR4A 2N1TC 1NTZD 3OAKA 1IC2A 2AXTH 2XV5A 3AEDC 1X79B 1HUCA 4HJGH 1NTKJ 3S1KA 2KLVA 2WT7B 3B5NC 3T97A 2W6AA 1LP1A 1ZRTD 2KLUA 1L0LD 1EDJA 2Y9YA 3CPWO 2QA4P 3L70E 3MGNA 4D6TG 1L0NG 1QGKB 3F89A 2H7HA 1N86A 1KQGB 4N78D 3HE5A 1JEKA 1FDOA 1RHZB 2WPSA 3WUTA 1NTKE 3L36A 1S1CX 1UIXA 2H43A 3CMEP 1SQXJ 1RQVA 1YI2P 3FXEA 3TGUJ 1NAYA 2R32A 3H32B 4OH8B 1BDCA 5APQA 2ITAA 1M8OB 4OGQB 2XNDH 1JY2P 1URQB 3H1JG 4C7NA 3RK3C 5KLVK 1KMIZ 4XFJA 1R8EA 1KFNA 3QH9A 3RGUA 2WSEJ 3HD7C 1K04A 3FGAD 1LTGC 1LTBC 4B86A 1SQXE 2QEXP 2GUVA 2Q7CA 1L0ND 5AW9B 5BU5A 4QMAA 3P8CD 1SQVJ 1Y9BA 4BRYB 5AVZB 1OW6A 4GOEA 1T6AA 1FZCC 2IBZG 1IK9A 3M9BA 2O3JA 1PL5A 3ABVC 3W67A 1BE3G 1NHLA 2R44A 1KQLA 1JY3P 4JBZA 2IZ1A 5AVWB 3H1JD 2IPPA 1N7SB 3L35A 3D6YA 1LP1B 2ZXEB 1SQVE 2QJPB 2OYIA 1EZVE 2FBWC 1KTMA 3WU2E 1NOHA 1FC2C 4YXWH 2B89A 3P7KA 2QSIA 1LJ2A 1SQBD 1OXZA 3U1CA 3OJAB 5CBNA 4L75A 1KYOH 2Y0EA 1NTMK 2Z5HA 1SQPG 1SQQD 2JO1A 2FFDC 2YIUC 4IL6X 1HBWA 1BE3D 5CCGD 2B87A 2HODA 1GTWA 3A7OA 2KXPB 4WY4B 4L73A 2GM4A 1WRGA 1NKNA 2H88C 2QM8A 1CW5A 4AUWA 1EQ7A 1IFPA 3GF3A 2HG5D 4ZMDA 1HWTC 1G1JA 2JDIH 4O9BA 2FYZA 1ZXGA 4U3FJ 4Y99C 5CCGA 1WMKA 3CLQA 1JY2N 3L71J 4N6JA 2WSFJ 1AQ5A 3CXHH 1H8AA 5KLIC 3EFGA 4PV1C 5DJTB 1VQ4P 2ZYGA 2W6BA 1BCCJ 4CPGA 4AQRD 3M9QA 3C1LA 3RK2D 2WTYA 4I7ZB 3V5BA 4NPDA 1KILE 4UB8E 5APXA 4U3FE 4KHXA 1R5SA 1PPJE 1NTZK 3HTKB 3N4XA 3AEFC 2G3AA 3L71E 2IFNA 1Y8AA 1K8AQ 2E42A 3WUUA 3Q1MA 1BCCE 1LT9B 4ZKUA 1L0LK 5APVA 1N7LA 3AECC 1JY3N 3CX5H 2KZJA 2ZYDA 1EDKA 2KS1A 3A0HH 1KYOI 1L4AD 5AW6B 3FX0A 1E79H 1FOSE 1MKMA 1YJ9P 3RL0C 4YXDC 2BEQD 5KLVG 5AVVB 1BGYG 2Q1KA 4C7RA 2B87B 4C46A 1DEBA 1VL2A 1RE4C 3NFQA 2VRSA 1VQMP 2A06G 2YNYA 1J1DC 1L4AC 4AYCA 1RQUA 2OTKE 2WWWA 3L73G 2AXTE 2E75C 4ASWA 2KZIA 1GMJA 2YKOA 1L4AA 3GG2A 2ZVOB 3A0BH 1AQTA 1P84H 2YXQB 2KIKA 3AE9C 1OVRA 1RF1B 2WSEH 2P10A 1RY3A 2J58A 1EDIA 1IK7A 1LTJC 3M9HA 3CXHI 1AVOA 3NXSA 2WPQA 4W7ZA 3L75G 2MJZA 2Y0DA 3RK3E 5KLVD 5B66H 2UWJE 4D6TJ 3B71A 3V6IA 1N2DC 5TJHA 1G2CB 2WMMA 1PGQA 2A06D 4GDOA 2NRGA 4HB1A 2HPCB 2KI7B 1LTSC 2DW3A 3B8EB 1ZMEC 1VF5C 2FYUJ 3RK2B 1FZAA 1NTMG 3CCRP 1MFTA 1OW7A 1RE3C 1NAFA 5AVYB 3CCMP 4D6TE 1A02F 1Q7YQ 1G1IA 1W2EA 4TLFA 2KS1B 3HUSA 1E5WA 1H89A 3A2AA 3VP8A 1SQBK 2HR3A 2BCCG 3AE2C 3U59A 1A02J 2I8DA 3L75D 4DCKA 3SSUA 2NZ2A 1VQ5P 1DD3A 2YXRB 4L76A 1VQOP 2FYUE 1SQQK 3TYYA 1Q90D 2C0XA 3H1HG 3CWBD 3CL3D 5AW5B 4PD4D 3Q3DA 2V4HA 2XKMA 2IZ0A 4EI2A 1M1JB 3CCSP 1HGVA 1PP9J 3N7NA 1AJYA 1P84I 1ZLLA 1X9VA 1RF0C 1ZN5A 4OGQD 1FZFA 1BE3J 1K05A 1URQD 1TU3F 3IAOA 2QG4A 3BATA 5APSA 2Q9IA 1M1KQ 2N9YB 3I56P 5GTIH 1NTZG 1PP9E 1KYOE 1YBKA 3H32A 4ZNCA 2WSFH 2XDJA 1N73B 2IBZE 4GT1A 1KB9H 1URQA 2OQQA 4EOTA 2HFED 2E74C 3AE5C 1NVOA 2D2CB 2OYHC 1SQPJ 3PTZA 1D7MA 1YIJP 1N7SD 4H13C 5M1BA 3BVHA 2A45G 1IFMA 5KAFH 3EQ2A 3CXHE 1W5CE 5AVQB 3BASA 1XTGB 3H1KD 4HH2A 1LTTC 1OVUA 3VYIA 1GDTA 1SQPE 2QJPC 1Q86Q 3Q2YA 1GU4A 1LT1A 1N7SA 2WPVB 3G6EP 2JWAA 1PZQA 3AE3C 3G4SP 1S5LX 3E1RA 4IFDK 4TT3H 1FS0E 3E7KA 4WY4D 1SLQA 3L74G 2B9BA 5AVSB 2M3BA 4Y28J 4ZKPA 4L74A 3Q5SA 2IX7C 1GK4A 1LWUB 3F5HA 3CC4P 2A45H 1JUNA 5CHXA 3CX5E 1FU1A 3KZIH 4GOFA 1NYHA 1PFIA 3A0HE 2IYPA 4GKGA 4WY4A 2YMKA 1L2PA 1KB9I 2HYNA 2M8RA 3VP9A 3IFMA 4W7YA 3AEAC 1ZOYC 1U57A 2ZJSE 1KFMA 3AEBC 1RH5B 1IFIA 3TGUE 2ZVNB 3VN0A 1KQSO 3L74D 1SQBG 1BGYJ 3A0BE 2E5TA 1P84E 2RH0A 2NPSD 1SQQG 1S4XA 3C9IA 3L73J 2BEZF 3BCCG 3H1LJ 1YQ3C 1T2KD 1LNQA 4M3LA 1FDIA 2OYIC 1OWAA 3HTKA 4H0LB 1PGPA 1BGYE 3MP7B 1KD1Q 1FBMA 3L72J 4H44D 4KJMA 5B66E 2NPSA 1KQFB 2KUBA 5AW1B 1LT9A 3CCVP 3L73E 2N1TB 2Z4EA 3H1LE 1U7MA 2JR8A 2CK3H 3BRVB 1N8RQ 3PLNA 3B5NB 2H8PD 3SFDC 2ZT9B 2A45I 2KNCB 1X22A 3L72E 2P2UA 3D71A 3BCCD 2Q6QA 1LTIC 1NTMJ 2LXBA 2IYOA 4OVNF 1FJPA 1Q82Q 1NU1D 2L5GB 5BU8B 2ZYAA 1WT6A 3MUDA 1S9KD 2P1JA 5CCGC 1QEXA 1JCCA 2BCCJ 1JB0J 3L70G 2XZRA 1RF1A 1GW4A 1NTME 2WITA 1FZBA 2K37A 3H1HJ 1VQKP 3H1IG 4OWFA 3TNUB 2K1AA 1NWQA 2Y0CA 3D70A 1JM0A 2AXCA 3M0DA 1VPCA 3JCUH 2BCCE 3FWNA 5TISH 1G2CA 4BWNA 5GTIE 3S4RA 2OARA 4BXLA 2HPCA 2KK7A 3RK2C 3PHLA 4RKUJ 2NPSB 1EXIA 3Q5RA 5KKZC 1KB9E 2AEMA 3H1HE 4KT0J 1GL2D 1VDFA 1NTZJ 1USEA 3L70D 1YQ4C 1HVVA 3I5CA 3H25A 1FZEA 3RL0g 1EC5A 4H44B 1NTKD 2IBZI 1L0LJ 3H1ID 1HF9A 1GL2A 2K88A 2ZAEB 1OMIA 1DD4A 5KAFE 1NKZB 1NTZE 1VQ9P 1UIIA 3V2NA 2Q3EA 1M1JA 2XNXA 3MTUE 1SQVG 3HRNA 2FFDB 1ZRTE 2YIUB 1EZVG 1DEEG 1L0LE 1JTHA 1R5LA 2PRRA 4RO0A 1SQXD 4IL6H 4ASVA 1QVFO 2KSJA 4N78E 2GUSA 2IFMA 2Q3IA 2D2CD 3OW2O 1JCDA 2G8YA 4Y99B 1N73A 1L0NJ 2PP6A 3W68A 1NGMB 5C39A 3CWBG 3KZIE 5AW7B 1JO5A 3EFFK 2SPZA 1HTLC 4RJTA 3G71P 1SQVD 1HH0A 4LGDE 2RN0A 2O1JA 3D6ZA 1EZVD 5AVTB 3HUSC 1FZGA 3O6QB 1L0NE 1OIPA 3CX5I 2QJYC 3AE1C 3KXDA 3H1JJ 5BVZA 1GD2E 3P8CE 1OVVA 3AE4C 1MV8A 4DT0A 1GL2B 3NTNA 1OFCX 3I55P 1H0TA 2WPRA 2J59M 1NH4A 4PD4H 4U3FG 1SQBJ 2KOGA 1Y47A 3H1JE 2P67A 4MN4C 3SWKA 1IFNA 3JC22 3V2RA 1NU1K 2CPSA 1SQQJ 3RL0B 1VQLP 1JNMA 1JTHB 1LWUC 4PJ0H 2AEJA 2E76D 4YTPC 1LWUA 3PJSK 2OTLP 3B4SA 1EDLA 1SQBE 2E75B 2QVAA 4OGQC 1URQC 3H1KG 2W83C 3TSIA 4U7JA 1SQQE 1PGJA 2N9BA 3GHGA 3IN6A 2V7QH 1BE3E 4XA4A 1KILD 1YITP 1LTJB 2W6JH 4U3FD 1MFZA 3L71D 2QE7H 3P32A 3KYQA 2PFXA 1SFCD 2P7JA 3CCJP 1BCCD 1ZW0A 3U1AA 3JSVC 4EYYQ 4H0LD 2FXOA 1KILA 3ITKA 3CC2P 2JWDA 2C9NY 3MIWA 2N1TD 2QJKB 3ZDMA 1N7SC 1M57D 3SFEC 2KYVA 4R4MA 4K3AA 1FAVA 5EFWB 3M06A 3V2PA 1NTKK 1SFCA 1AFOA 1H0TB
chains in the Genus database with same CATH topology
4ZKUA 5AW8B 3B5ND 1L0LK 5AW1B 1M7LA 1LT9A 5APVA 3II6A 3WMM0 1RE3A 1N7LA 1JY3N 2N1TB 2E43A 2W27A 3CI9A 3OA7A 2Z4EA 3L37A 4LLHA 3SWYA 1YYCA 2N1TA 3BRVB 1L4AD 5AW6B 3A3YB 1FOSE 1FDMA 2QM7A 3B5NB 2H8PD 3RL0C 1CSBA 5AVVB 1GZLA 2A45I 2WT7A 3E1IA 2FXMA 4GIFA 4C7RA 2C0WA 3VMXA 2P2UA 3B5NA 4C46A 1DEBA 3R2PA 1RE4C 3NFQA 2VRSA 1SQXK 4XE5B 2YNYA 1QL1A 1J1DC 1L4AC 4AYCA 1LTIC 1ZR2A 1J1DB 1L4AB 4WY4C 2C9LY 5AVRB 4IFFA 2WWWA 2POHA 3H6PA 4LC1A 1FJPA 5KJ7D 2YKOA 1L4AA 1T3UA 3TK1A 1LGHB 2L5GB 2YKPA 5BU8B 3GHGC 1WT6A 3MUDA 3GHGB 3LW5H 3RK3D 5CJ0A 1T3JA 1S9KD 2P1JA 5CCGC 1RF0A 1JY2O 1RF1B 3HD7D 2WSEH 1JCCA 1RY3A 2J58A 1LTJC 4JF7A 1MUUA 3M9HA 5KJ7C 2KP8A 2XZRA 1RF1A 1GW4A 2YO3A 3MD0A 3M91A 5CJ4A 5KJ7A 1H88A 3NXSA 2WITA 2WPQA 4W7ZA 5APYA 4JYBA 1XTCC 1YTZT 2MJZA 5CCHD 5APTA 1SQPK 1FZBA 1HGZA 1SQVK 5AW2B 2O01H 2O1KA 1KILC 2XU6A 1S9KE 1KILB 3TNUB 3NMDA 1NWQA 3P8MC 3HE4B 1HJBA 1T8ZA 1N2DC 3HD7A 1G2CB 3A5TA 4I1LA 3M0DA 1GU5A 1VPCA 5CMZA 3TNUA 3M0AA 4I2LC 3HE4A 1ZV8A 1IO4A 2HPCB 5CCHC 1FJKA 1G2CA 2I1JA 1LTSC 1CI6A 2OYHB 2OARA 3B8EB 1SFCC 1SFCB 2HPCA 2NPSC 5AW4B 3RK2C 2NPSB 5CCHA 3RK2B 1FZAA 2OYHA 1J1EC 1J1EB 1JY3O 1LT9C 2CPBA 3KDPB 1RE3C 4N3YB 1NAFA 3HUSB 1GL2D 5AVYB 1NO4A 3G3ZA 1T2KC 3V4WA 1FZCA 1VDFA 4JYCA 1A02F 1J2JB 1G1IA 1W2EA 3VTPC 2N1TC 3HUSA 1HVVA 1ZR4A 1E5WA 3OAKA 1H89A 1IC2A 3A2AA 3VP8A 1SQBK 3LIDA 1SVFA 2XV5A 3I5CA 1X79B 1FZEA 1HUCA 3U59A 1A02J 4W80A 5APUA 2KLVA 2WT7B 3B5NC 1KZUB 3T97A 1SQQK 2W6AA 3KQGA 3TYYA 2Z5IA 1YTZI 1GL2A 2C0XA 3CL3D 5AW5B 1IFJA 3MGNA 3HE5B 2XKMA 1GW3A 1MZ9A 1NKZB 3IR9A 3V4QA 2H7HA 1M1JB 1HGVA 1N86A 4N78D 3HE5A 3V2NA 3N7NA 2WPSA 1ZLLA 1M1JA 3L36A 2XNXA 3MTUE 1X9VA 1RF0C 1ZN5A 1FZFA 3HRNA 1URQD 2FFDB 2H43A 3O8ZA 2JJLA 1JTHA 1RF1C 2FFDA 4DOJA 3BATA 4C7NB 2R32A 5APSA 3H32B 4OH8B 2Q9IA 2KSJA 4N78E 5APQA 1QL2A 1JY2P 1URQB 2YMYA 4C7NA 3RK3C 3H32A 2GUSA 2IFMA 2WSFH 2Q3IA 3RK3B 2XDJA 5KLVK 1N73B 4GT1A 1JCDA 1KFNA 3L4FA 1URQA 3HD7C 1JMMA 1LTGC 3M0DC 3HD7B 1LTBC 4EOTA 4B86A 2JEEA 2HFED 4Y99B 5AVUB 1N73A 3PP5A 2PP6A 2GUVA 1Z56A 2Q7CA 4EIJA 5AW7B 3VMYA 1CI6B 1JO5A 5AW9B 5BU5A 3P8CD 1HTLC 4HYTB 3UIAA 2OYHC 5AW3B 5AVZB 4LGDE 1HH0A 2O1JA 1N7SD 1FZCC 1IK9A 3M9BA 1FZCB 5AVTB 3HUSC 1FZGA 1FOSF 3BVHA 1NHLA 5APWA 2A45G 1IFMA 1KQLA 3EQ2A 3KPEA 1JY3P 5BVZA 1GD2E 5AVQB 3P8CE 3BASA 5AVWB 2OYIB 1XTGB 4HH2A 2IPPA 2Q5UA 1LTTC 1N7SB 1MV8A 3VYIA 1GDTA 3L35A 4I6MC 2ZXEB 4WB4A 2OYIA 1GL2C 1GU4A 1GL2B 1N7SA 1NOHA 2WSCH 3NTNA 3RL0D 1DH3A 2R5DA 2WPRA 2J59M 1NH4A 4RESB 3P7KA 1DX7A 4IFDK 2KOGA 1M1JC 2P67A 1OXZA 1JOCA 4WY4D 1SLQA 3OJAB 3U1CA 3V2QA 1IFNA 5AVSB 3V2RA 1NU1K 1NTMK 2M3BA 2CPSA 3RL0B 1IJDB 4ZKPA 1JNMA 1JTHB 2Z5HA 1LWUC 2IX7C 4DZOA 1GK4A 2YO2A 1LWUB 2FFDC 2HODB 1HBWA 2A45H 1JUNA 1IFDA 5CHXA 5CCGD 1LWUA 3VMZA 1FU1A 2HODA 3A7OA 1GTWA 4WY4B 2GM4A 1RE4A 2I1KA 4WBAA 1WRGA 2HLOA 1CZQA 1X8YA 1PFIA 1NKNA 2ZFCA 4GKGA 4WY4A 2QM8A 1CW5A 4AUWA 1EQ7A 1URQC 2HG5D 3SWFA 1HWTC 3TSIA 2HYNA 1G1JA 1N73C 2M8RA 3VP9A 2WZ7A 3IFMA 4O9BA 4W7YA 2N9BA 3GHGA 2FYZA 4XA4A 1KILD 4Y99C 1LTJB 1L0NK 5AW0B 1SP4A 2R5BA 5CCGA 4IFMA 1KFMA 1MFZA 2FKWB 3CLQA 2R3CA 1IFIA 1JY2N 2BASA 4N6JA 1LTJA 3VN0A 1AQ5A 3LIEA 1H8AA 1GK6A 3P32A 3EFGA 5KTBA 2YKQA 2W6BA 3KYQA 2LKMA 1SFCD 2PAJA 2KB7P 4AQRD 3M9QA 2P7JA 2NPSD 3RK2D 2FYUK 3U1AA 2WTYA 3V5BA 3BRTB 1KILA 3C9IA 5APXA 5AVXB 4KHXA 3VOPA 1T2KD 1LTAC 1NTZK 3HTKB 3N4XA 4M3LA 2C9NY 3MIWA 2N1TD 2IFNA 2OYIC 1OWAA 1N7SC 3HTKA 2KYVA 2E42A 1FAVA 3V2PA 3M06A 1NTKK 1SFCA 1AFOA 1FBMA 1LT9B 2NPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMZ A;  5AW8 B;  5APQ A;  3TNU A;  3M0A A;  1JNM A;  4I2L C;  2Z5H A;  3HE4 A;  5AW1 B;  4C7N A;  1IO4 A;  4DZO A;  1GK4 A;  2YO2 A;  5APV A;  2Q3I A;  2E43 A;  1HBW A;  1CI6 A;  4GT1 A;  2W27 A;  3B8E B;  1JUN A;  3L37 A;  5AW4 B;  3VMZ A;  4EOT A;  1GTW A;  3A7O A;  4B86 A;  1YYC A;  5AVU B;  5AW6 B;  3A3Y B;  1CZQ A;  1FOS E;  1X8Y A;  2QM7 A;  3KDP B;  2Q7C A;  1NAF A;  2ZFC A;  5AVY B;  1CSB A;  4GKG A;  5AW7 B;  2QM8 A;  3V4W A;  1CI6 B;  3VMY A;  1T2K C;  4AUW A;  5AVV B;  1GZL A;  3SWF A;  1HWT C;  5AW9 B;  2WT7 A;  4JYC A;  1A02 F;  1J2J B;  3VMX A;  2P2U A;  4C46 A;  3UIA A;  4HYT B;  3VTP C;  5AW3 B;  3OAK A;  3NFQ A;  2VRS A;  1H89 A;  3A2A A;  3LID A;  2XV5 A;  3I5C A;  2N9B A;  4XE5 B;  2YNY A;  5AVZ B;  1HUC A;  4AYC A;  1A02 J;  2C9L Y;  5AVR B;  5AW0 B;  1SP4 A;  2WWW A;  2R5B A;  5APU A;  3M9B A;  4LC1 A;  5AVT B;  2WT7 B;  1MFZ A;  2R3C A;  3T97 A;  1FOS F;  2W6A A;  2BAS A;  3VN0 A;  3KQG A;  3TK1 A;  5APW A;  3TYY A;  3LIE A;  1H8A A;  2Z5I A;  1KQL A;  1GK6 A;  3P32 A;  5AW5 B;  1S9K D;  1GD2 E;  5AVQ B;  3MGN A;  3HE5 B;  5AVW B;  2IPP A;  2Q5U A;  4AQR D;  3IR9 A;  3V4Q A;  2P7J A;  1MV8 A;  3VYI A;  2H7H A;  3L35 A;  1MUU A;  3M9H A;  2WTY A;  4I6M C;  2ZXE B;  2KP8 A;  3V5B A;  3HE5 A;  2XZR A;  1GU4 A;  5APX A;  2WPS A;  5AVX B;  4KHX A;  3NTN A;  2YO3 A;  1DH3 A;  3L36 A;  3MD0 A;  1T2K D;  3M91 A;  2R5D A;  2WPR A;  1H88 A;  3NXS A;  2WPQ A;  5APY A;  4M3L A;  3O8Z A;  2JJL A;  2C9N Y;  4JYB A;  5APT A;  4RES B;  3P7K A;  5AW2 B;  1OWA A;  2XU6 A;  3HTK A;  1S9K E;  3TNU B;  2E42 A;  1FAV A;  3NMD A;  1NWQ A;  3M06 A;  2P67 A;  3P8M C;  1OXZ A;  3HE4 B;  1SLQ A;  4C7N B;  2R32 A;  1HJB A;  5APS A;  1G2C B;  5AVS B;  3A5T A;  3M0D A;  1GU5 A; 
#chains in the Genus database with same CATH topology
 2W8Z A;  2P58 A;  3GLM A;  3AE8 C;  3B5N D;  4PD4 I;  2ZT9 D;  1M7L A;  3JCU E;  4JQ0 D;  1JMB A;  2W27 A;  2OTJ P;  2WSS H;  5TIS E;  3L37 A;  3RBX A;  1YYC A;  2N1T A;  3H1I J;  3A3Y B;  2WSC J;  1FDM A;  2QM7 A;  2ZT9 C;  1CSB A;  2FYN B;  1X0T A;  1GZL A;  3E1I A;  2FXM A;  4GIF A;  3B5N A;  3MZW B;  1SQX K;  2KNC A;  5DJU B;  1QL1 A;  1YJW P;  4WY4 C;  2C9L Y;  1S3J A;  5AVR B;  4IFF A;  4NPE A;  2POH A;  3IF4 A;  2FY8 A;  2J5U A;  3K5B A;  4EDF A;  3TK1 A;  2WVR A;  3H1I E;  3GHG B;  3LW5 H;  3RK3 D;  2E76 B;  1T3J A;  4HKZ H;  2FYU G;  1KN7 A;  1JY2 O;  2QIW A;  3HD7 D;  4JF7 A;  1MUU A;  1QLE D;  1U7J A;  2YO3 A;  1VQN P;  3MD0 A;  3M91 A;  1H88 A;  5APY A;  5KLV J;  1XTC C;  5B5E H;  1HGZ A;  1SQV K;  5AW2 B;  2O01 H;  2O1K A;  2XU6 A;  1KIL B;  3NMD A;  3P8M C;  3HE4 B;  4I7Z C;  1HJB A;  1T8Z A;  4D6T D;  3HD7 A;  3A5T A;  4I1L A;  4IL6 E;  2E74 B;  3TNU A;  1USD A;  4I2L C;  3VMA A;  5H2F H;  1IO4 A;  2H89 C;  1FJK A;  2M5A B;  2I1J A;  2OYH B;  1CI6 A;  1SFC B;  1K9M Q;  2NPS C;  5AW4 B;  1PP9 G;  1PGO A;  1IZN B;  5KLV E;  1NU1 G;  1M90 Q;  4H13 B;  1ZP0 C;  2FYU D;  1J1E B;  1JY3 O;  1LT9 C;  3KDP B;  1NO4 A;  3G3Z A;  1T2K C;  1AA0 A;  2A06 E;  1FZC A;  3G9R A;  3VTP C;  3KHU A;  3LID A;  3L75 J;  1SVF A;  4A7P A;  3T97 B;  3CCE P;  4H44 C;  4W80 A;  5APU A;  1Q2N A;  4GOD A;  1VQ8 P;  1KZU B;  2OYO A;  3MHV A;  3WUV A;  3KQG A;  2OGU A;  3CWB J;  3AE6 C;  1VQP P;  3GMA A;  1AVY A;  2Z5I A;  1YTZ I;  3AEE C;  1IFJ A;  1DIP A;  3HE5 B;  1GW3 A;  1MZ9 A;  3IR9 A;  3V4Q A;  3FXD A;  1S5L H;  1KOR A;  3MUD C;  3L75 E;  5E79 H;  1VQ6 P;  1PP9 D;  1KYO D;  4NPF X;  2K9Y A;  2IBZ D;  4R4L A;  3O8Z A;  2JJL A;  1RF1 C;  3CWB E;  2JKV A;  4PD4 E;  3S9O A;  2FFD A;  4DOJ A;  4C7N B;  1SS1 A;  4WVZ A;  2RKL A;  1QL2 A;  2YMY A;  5GTH H;  3RK3 B;  4PV1 D;  3GW6 A;  3L4F A;  4UB6 H;  2LR2 A;  1JMM A;  1NTK G;  2V7Q J;  3M0D C;  3HD7 B;  4PJ0 E;  2JEE A;  5AVU B;  3PH0 A;  3PP5 A;  5KAI H;  1Z56 A;  1PIX A;  4EIJ A;  3VMY A;  1CI6 B;  2KSE A;  2WQY C;  3CXH D;  3UIA A;  4HYT B;  5AW3 B;  1S2E A;  1KC8 Q;  1SQP D;  1OX3 A;  1S72 P;  2MKV A;  4DJG A;  4WWI A;  1FZC B;  3RBZ A;  1FOS F;  5APW A;  1SQX G;  3KPE A;  3H1K J;  2QRX A;  3QWO C;  3O6Q A;  3TGU G;  2OYI B;  2Q5U A;  2AEF A;  1BSH A;  1YHQ P;  4I6M C;  4WB4 A;  1GL2 C;  2WSC H;  2K3R A;  3AE7 C;  1BSN A;  3RL0 D;  1DH3 A;  2R5D A;  3CX5 D;  4RES B;  1DX7 A;  1K73 Q;  3C8V A;  3H1K E;  1M1J C;  1JOC A;  3V2Q A;  2E75 D;  1Q81 Q;  1IJD B;  2R3S A;  4DZO A;  2YO2 A;  2HOD B;  3USS A;  2JP3 A;  1EXJ A;  1HJ0 A;  1IFD A;  3VMZ A;  3GF7 A;  3CC7 P;  1RE4 A;  2I1K A;  4WBA A;  2HLO A;  1CZQ A;  3TGU D;  1X8Y A;  3H1L G;  1NJI Q;  2ZFC A;  3SWF A;  3LW5 J;  2W90 A;  1N73 C;  1P84 D;  2WZ7 A;  3FWL A;  4IOI H;  1BDD A;  2K9J A;  3L72 G;  1L0N K;  5AW0 B;  1SP4 A;  4JPZ B;  2R5B A;  4IFM A;  2FKW B;  3R4Y A;  2R3C A;  3L74 J;  2BAS A;  1LTJ A;  2D2C C;  3LIE A;  1QVG O;  1GK6 A;  5KTB A;  5KLI B;  2GA1 A;  4PV1 B;  2YKQ A;  2LKM A;  2O01 J;  2PAJ A;  1VF5 D;  2KB7 P;  2O01 N;  1BGY D;  3WU2 H;  2FYU K;  1KV4 A;  3EWK A;  2M0B A;  3BRT B;  3CCU P;  5AVX B;  4YPC A;  2ZXX A;  3VOP A;  3L73 D;  4Z1M H;  3TDK A;  1LTA C;  3H1L D;  2QJK C;  3L74 E;  5L8R J;  3TF5 A;  5KKZ B;  5B5E E;  3PRJ A;  3Q5P A;  3AEG C;  3CCL P;  2PGD A;  5AW8 B;  3L72 D;  1M56 D;  2L91 A;  3II6 A;  3WMM 0;  1RE3 A;  3CCQ P;  2E43 A;  3CI9 A;  3OA7 A;  5H2F E;  1OZH A;  4LLH A;  1PPJ G;  1OW8 A;  3SWY A;  2E5Y A;  3L71 G;  2RMZ A;  2FYN C;  4K35 A;  2WT7 A;  2C0W A;  3VMX A;  3BCC J;  3CD6 P;  1BCC G;  3R2P A;  4XE5 B;  1YJN P;  1ZR2 A;  1J1D B;  1L4A B;  1PV3 A;  3H6P A;  1FE6 A;  1NU1 J;  4LC1 A;  5KJ7 D;  1T3U A;  1NTM D;  1LGH B;  2YKP A;  3GHG C;  2E76 C;  2K9J B;  5CJ0 A;  2FXP A;  3CMA P;  2LXC B;  1RF0 A;  5K5G B;  1VQ7 P;  4UB8 H;  2IDB A;  3BCC E;  5KJ7 C;  2KP8 A;  5CBO A;  2BCC D;  2Y9Z A;  1S5L E;  1PPJ D;  2E74 D;  5CJ4 A;  5KJ7 A;  1NU1 E;  5E79 E;  4JYB A;  1YTZ T;  5CCH D;  5APT A;  1EZV I;  1SQP K;  1KB9 D;  1KIL C;  1S9K E;  3H1H D;  1L0L G;  4H13 D;  1GU5 A;  5CMZ A;  3M0A A;  3HE4 A;  1ZV8 A;  5CCH C;  1QX8 A;  1SFC C;  1VF5 B;  5GTH E;  2M5A A;  5CCH A;  2M3E A;  1AV1 A;  4H0L C;  2OYH A;  4BRY A;  1J1E C;  4UB6 E;  2CPB A;  4N3Y B;  3HUS B;  3V4W A;  3L70 J;  2B88 A;  5KAI E;  1W2B O;  4JYC A;  2QJY B;  1J2J B;  1ZR4 A;  2N1T C;  1NTZ D;  3OAK A;  1IC2 A;  2AXT H;  2XV5 A;  3AED C;  1X79 B;  1HUC A;  4HJG H;  1NTK J;  3S1K A;  2KLV A;  2WT7 B;  3B5N C;  3T97 A;  2W6A A;  1LP1 A;  1ZRT D;  2KLU A;  1L0L D;  1EDJ A;  2Y9Y A;  3CPW O;  2QA4 P;  3L70 E;  3MGN A;  4D6T G;  1L0N G;  1QGK B;  3F89 A;  2H7H A;  1N86 A;  1KQG B;  4N78 D;  3HE5 A;  1JEK A;  1FDO A;  1RHZ B;  2WPS A;  3WUT A;  1NTK E;  3L36 A;  1S1C X;  1UIX A;  2H43 A;  3CME P;  1SQX J;  1RQV A;  1YI2 P;  3FXE A;  3TGU J;  1NAY A;  2R32 A;  3H32 B;  4OH8 B;  1BDC A;  5APQ A;  2ITA A;  1M8O B;  4OGQ B;  2XND H;  1JY2 P;  1URQ B;  3H1J G;  4C7N A;  3RK3 C;  5KLV K;  1KMI Z;  4XFJ A;  1R8E A;  1KFN A;  3QH9 A;  3RGU A;  2WSE J;  3HD7 C;  1K04 A;  3FGA D;  1LTG C;  1LTB C;  4B86 A;  1SQX E;  2QEX P;  2GUV A;  2Q7C A;  1L0N D;  5AW9 B;  5BU5 A;  4QMA A;  3P8C D;  1SQV J;  1Y9B A;  4BRY B;  5AVZ B;  1OW6 A;  4GOE A;  1T6A A;  1FZC C;  2IBZ G;  1IK9 A;  3M9B A;  2O3J A;  1PL5 A;  3ABV C;  3W67 A;  1BE3 G;  1NHL A;  2R44 A;  1KQL A;  1JY3 P;  4JBZ A;  2IZ1 A;  5AVW B;  3H1J D;  2IPP A;  1N7S B;  3L35 A;  3D6Y A;  1LP1 B;  2ZXE B;  1SQV E;  2QJP B;  2OYI A;  1EZV E;  2FBW C;  1KTM A;  3WU2 E;  1NOH A;  1FC2 C;  4YXW H;  2B89 A;  3P7K A;  2QSI A;  1LJ2 A;  1SQB D;  1OXZ A;  3U1C A;  3OJA B;  5CBN A;  4L75 A;  1KYO H;  2Y0E A;  1NTM K;  2Z5H A;  1SQP G;  1SQQ D;  2JO1 A;  2FFD C;  2YIU C;  4IL6 X;  1HBW A;  1BE3 D;  5CCG D;  2B87 A;  2HOD A;  1GTW A;  3A7O A;  2KXP B;  4WY4 B;  4L73 A;  2GM4 A;  1WRG A;  1NKN A;  2H88 C;  2QM8 A;  1CW5 A;  4AUW A;  1EQ7 A;  1IFP A;  3GF3 A;  2HG5 D;  4ZMD A;  1HWT C;  1G1J A;  2JDI H;  4O9B A;  2FYZ A;  1ZXG A;  4U3F J;  4Y99 C;  5CCG A;  1WMK A;  3CLQ A;  1JY2 N;  3L71 J;  4N6J A;  2WSF J;  1AQ5 A;  3CXH H;  1H8A A;  5KLI C;  3EFG A;  4PV1 C;  5DJT B;  1VQ4 P;  2ZYG A;  2W6B A;  1BCC J;  4CPG A;  4AQR D;  3M9Q A;  3C1L A;  3RK2 D;  2WTY A;  4I7Z B;  3V5B A;  4NPD A;  1KIL E;  4UB8 E;  5APX A;  4U3F E;  4KHX A;  1R5S A;  1PPJ E;  1NTZ K;  3HTK B;  3N4X A;  3AEF C;  2G3A A;  3L71 E;  2IFN A;  1Y8A A;  1K8A Q;  2E42 A;  3WUU A;  3Q1M A;  1BCC E;  1LT9 B;  4ZKU A;  1L0L K;  5APV A;  1N7L A;  3AEC C;  1JY3 N;  3CX5 H;  2KZJ A;  2ZYD A;  1EDK A;  2KS1 A;  3A0H H;  1KYO I;  1L4A D;  5AW6 B;  3FX0 A;  1E79 H;  1FOS E;  1MKM A;  1YJ9 P;  3RL0 C;  4YXD C;  2BEQ D;  5KLV G;  5AVV B;  1BGY G;  2Q1K A;  4C7R A;  2B87 B;  4C46 A;  1DEB A;  1VL2 A;  1RE4 C;  3NFQ A;  2VRS A;  1VQM P;  2A06 G;  2YNY A;  1J1D C;  1L4A C;  4AYC A;  1RQU A;  2OTK E;  2WWW A;  3L73 G;  2AXT E;  2E75 C;  4ASW A;  2KZI A;  1GMJ A;  2YKO A;  1L4A A;  3GG2 A;  2ZVO B;  3A0B H;  1AQT A;  1P84 H;  2YXQ B;  2KIK A;  3AE9 C;  1OVR A;  1RF1 B;  2WSE H;  2P10 A;  1RY3 A;  2J58 A;  1EDI A;  1IK7 A;  1LTJ C;  3M9H A;  3CXH I;  1AVO A;  3NXS A;  2WPQ A;  4W7Z A;  3L75 G;  2MJZ A;  2Y0D A;  3RK3 E;  5KLV D;  5B66 H;  2UWJ E;  4D6T J;  3B71 A;  3V6I A;  1N2D C;  5TJH A;  1G2C B;  2WMM A;  1PGQ A;  2A06 D;  4GDO A;  2NRG A;  4HB1 A;  2HPC B;  2KI7 B;  1LTS C;  2DW3 A;  3B8E B;  1ZME C;  1VF5 C;  2FYU J;  3RK2 B;  1FZA A;  1NTM G;  3CCR P;  1MFT A;  1OW7 A;  1RE3 C;  1NAF A;  5AVY B;  3CCM P;  4D6T E;  1A02 F;  1Q7Y Q;  1G1I A;  1W2E A;  4TLF A;  2KS1 B;  3HUS A;  1E5W A;  1H89 A;  3A2A A;  3VP8 A;  1SQB K;  2HR3 A;  2BCC G;  3AE2 C;  3U59 A;  1A02 J;  2I8D A;  3L75 D;  4DCK A;  3SSU A;  2NZ2 A;  1VQ5 P;  1DD3 A;  2YXR B;  4L76 A;  1VQO P;  2FYU E;  1SQQ K;  3TYY A;  1Q90 D;  2C0X A;  3H1H G;  3CWB D;  3CL3 D;  5AW5 B;  4PD4 D;  3Q3D A;  2V4H A;  2XKM A;  2IZ0 A;  4EI2 A;  1M1J B;  3CCS P;  1HGV A;  1PP9 J;  3N7N A;  1AJY A;  1P84 I;  1ZLL A;  1X9V A;  1RF0 C;  1ZN5 A;  4OGQ D;  1FZF A;  1BE3 J;  1K05 A;  1URQ D;  1TU3 F;  3IAO A;  2QG4 A;  3BAT A;  5APS A;  2Q9I A;  1M1K Q;  2N9Y B;  3I56 P;  5GTI H;  1NTZ G;  1PP9 E;  1KYO E;  1YBK A;  3H32 A;  4ZNC A;  2WSF H;  2XDJ A;  1N73 B;  2IBZ E;  4GT1 A;  1KB9 H;  1URQ A;  2OQQ A;  4EOT A;  2HFE D;  2E74 C;  3AE5 C;  1NVO A;  2D2C B;  2OYH C;  1SQP J;  3PTZ A;  1D7M A;  1YIJ P;  1N7S D;  4H13 C;  5M1B A;  3BVH A;  2A45 G;  1IFM A;  5KAF H;  3EQ2 A;  3CXH E;  1W5C E;  5AVQ B;  3BAS A;  1XTG B;  3H1K D;  4HH2 A;  1LTT C;  1OVU A;  3VYI A;  1GDT A;  1SQP E;  2QJP C;  1Q86 Q;  3Q2Y A;  1GU4 A;  1LT1 A;  1N7S A;  2WPV B;  3G6E P;  2JWA A;  1PZQ A;  3AE3 C;  3G4S P;  1S5L X;  3E1R A;  4IFD K;  4TT3 H;  1FS0 E;  3E7K A;  4WY4 D;  1SLQ A;  3L74 G;  2B9B A;  5AVS B;  2M3B A;  4Y28 J;  4ZKP A;  4L74 A;  3Q5S A;  2IX7 C;  1GK4 A;  1LWU B;  3F5H A;  3CC4 P;  2A45 H;  1JUN A;  5CHX A;  3CX5 E;  1FU1 A;  3KZI H;  4GOF A;  1NYH A;  1PFI A;  3A0H E;  2IYP A;  4GKG A;  4WY4 A;  2YMK A;  1L2P A;  1KB9 I;  2HYN A;  2M8R A;  3VP9 A;  3IFM A;  4W7Y A;  3AEA C;  1ZOY C;  1U57 A;  2ZJS E;  1KFM A;  3AEB C;  1RH5 B;  1IFI A;  3TGU E;  2ZVN B;  3VN0 A;  1KQS O;  3L74 D;  1SQB G;  1BGY J;  3A0B E;  2E5T A;  1P84 E;  2RH0 A;  2NPS D;  1SQQ G;  1S4X A;  3C9I A;  3L73 J;  2BEZ F;  3BCC G;  3H1L J;  1YQ3 C;  1T2K D;  1LNQ A;  4M3L A;  1FDI A;  2OYI C;  1OWA A;  3HTK A;  4H0L B;  1PGP A;  1BGY E;  3MP7 B;  1KD1 Q;  1FBM A;  3L72 J;  4H44 D;  4KJM A;  5B66 E;  2NPS A;  1KQF B;  2KUB A;  5AW1 B;  1LT9 A;  3CCV P;  3L73 E;  2N1T B;  2Z4E A;  3H1L E;  1U7M A;  2JR8 A;  2CK3 H;  3BRV B;  1N8R Q;  3PLN A;  3B5N B;  2H8P D;  3SFD C;  2ZT9 B;  2A45 I;  2KNC B;  1X22 A;  3L72 E;  2P2U A;  3D71 A;  3BCC D;  2Q6Q A;  1LTI C;  1NTM J;  2LXB A;  2IYO A;  4OVN F;  1FJP A;  1Q82 Q;  1NU1 D;  2L5G B;  5BU8 B;  2ZYA A;  1WT6 A;  3MUD A;  1S9K D;  2P1J A;  5CCG C;  1QEX A;  1JCC A;  2BCC J;  1JB0 J;  3L70 G;  2XZR A;  1RF1 A;  1GW4 A;  1NTM E;  2WIT A;  1FZB A;  2K37 A;  3H1H J;  1VQK P;  3H1I G;  4OWF A;  3TNU B;  2K1A A;  1NWQ A;  2Y0C A;  3D70 A;  1JM0 A;  2AXC A;  3M0D A;  1VPC A;  3JCU H;  2BCC E;  3FWN A;  5TIS H;  1G2C A;  4BWN A;  5GTI E;  3S4R A;  2OAR A;  4BXL A;  2HPC A;  2KK7 A;  3RK2 C;  3PHL A;  4RKU J;  2NPS B;  1EXI A;  3Q5R A;  5KKZ C;  1KB9 E;  2AEM A;  3H1H E;  4KT0 J;  1GL2 D;  1VDF A;  1NTZ J;  1USE A;  3L70 D;  1YQ4 C;  1HVV A;  3I5C A;  3H25 A;  1FZE A;  3RL0 g;  1EC5 A;  4H44 B;  1NTK D;  2IBZ I;  1L0L J;  3H1I D;  1HF9 A;  1GL2 A;  2K88 A;  2ZAE B;  1OMI A;  1DD4 A;  5KAF E;  1NKZ B;  1NTZ E;  1VQ9 P;  1UII A;  3V2N A;  2Q3E A;  1M1J A;  2XNX A;  3MTU E;  1SQV G;  3HRN A;  2FFD B;  1ZRT E;  2YIU B;  1EZV G;  1DEE G;  1L0L E;  1JTH A;  1R5L A;  2PRR A;  4RO0 A;  1SQX D;  4IL6 H;  4ASV A;  1QVF O;  2KSJ A;  4N78 E;  2GUS A;  2IFM A;  2Q3I A;  2D2C D;  3OW2 O;  1JCD A;  2G8Y A;  4Y99 B;  1N73 A;  1L0N J;  2PP6 A;  3W68 A;  1NGM B;  5C39 A;  3CWB G;  3KZI E;  5AW7 B;  1JO5 A;  3EFF K;  2SPZ A;  1HTL C;  4RJT A;  3G71 P;  1SQV D;  1HH0 A;  4LGD E;  2RN0 A;  2O1J A;  3D6Z A;  1EZV D;  5AVT B;  3HUS C;  1FZG A;  3O6Q B;  1L0N E;  1OIP A;  3CX5 I;  2QJY C;  3AE1 C;  3KXD A;  3H1J J;  5BVZ A;  1GD2 E;  3P8C E;  1OVV A;  3AE4 C;  1MV8 A;  4DT0 A;  1GL2 B;  3NTN A;  1OFC X;  3I55 P;  1H0T A;  2WPR A;  2J59 M;  1NH4 A;  4PD4 H;  4U3F G;  1SQB J;  2KOG A;  1Y47 A;  3H1J E;  2P67 A;  4MN4 C;  3SWK A;  1IFN A;  3JC2 2;  3V2R A;  1NU1 K;  2CPS A;  1SQQ J;  3RL0 B;  1VQL P;  1JNM A;  1JTH B;  1LWU C;  4PJ0 H;  2AEJ A;  2E76 D;  4YTP C;  1LWU A;  3PJS K;  2OTL P;  3B4S A;  1EDL A;  1SQB E;  2E75 B;  2QVA A;  4OGQ C;  1URQ C;  3H1K G;  2W83 C;  3TSI A;  4U7J A;  1SQQ E;  1PGJ A;  2N9B A;  3GHG A;  3IN6 A;  2V7Q H;  1BE3 E;  4XA4 A;  1KIL D;  1YIT P;  1LTJ B;  2W6J H;  4U3F D;  1MFZ A;  3L71 D;  2QE7 H;  3P32 A;  3KYQ A;  2PFX A;  1SFC D;  2P7J A;  3CCJ P;  1BCC D;  1ZW0 A;  3U1A A;  3JSV C;  4EYY Q;  4H0L D;  2FXO A;  1KIL A;  3ITK A;  3CC2 P;  2JWD A;  2C9N Y;  3MIW A;  2N1T D;  2QJK B;  3ZDM A;  1N7S C;  1M57 D;  3SFE C;  2KYV A;  4R4M A;  4K3A A;  1FAV A;  5EFW B;  3M06 A;  3V2P A;  1NTK K;  1SFC A;  1AFO A;  1H0T B; 
#chains in the Genus database with same CATH homology
 4ZKU A;  5AW8 B;  3B5N D;  1L0L K;  5AW1 B;  1M7L A;  1LT9 A;  5APV A;  3II6 A;  3WMM 0;  1RE3 A;  1N7L A;  1JY3 N;  2N1T B;  2E43 A;  2W27 A;  3CI9 A;  3OA7 A;  2Z4E A;  3L37 A;  4LLH A;  3SWY A;  1YYC A;  2N1T A;  3BRV B;  1L4A D;  5AW6 B;  3A3Y B;  1FOS E;  1FDM A;  2QM7 A;  3B5N B;  2H8P D;  3RL0 C;  1CSB A;  5AVV B;  1GZL A;  2A45 I;  2WT7 A;  3E1I A;  2FXM A;  4GIF A;  4C7R A;  2C0W A;  3VMX A;  2P2U A;  3B5N A;  4C46 A;  1DEB A;  3R2P A;  1RE4 C;  3NFQ A;  2VRS A;  1SQX K;  4XE5 B;  2YNY A;  1QL1 A;  1J1D C;  1L4A C;  4AYC A;  1LTI C;  1ZR2 A;  1J1D B;  1L4A B;  4WY4 C;  2C9L Y;  5AVR B;  4IFF A;  2WWW A;  2POH A;  3H6P A;  4LC1 A;  1FJP A;  5KJ7 D;  2YKO A;  1L4A A;  1T3U A;  3TK1 A;  1LGH B;  2L5G B;  2YKP A;  5BU8 B;  3GHG C;  1WT6 A;  3MUD A;  3GHG B;  3LW5 H;  3RK3 D;  5CJ0 A;  1T3J A;  1S9K D;  2P1J A;  5CCG C;  1RF0 A;  1JY2 O;  1RF1 B;  3HD7 D;  2WSE H;  1JCC A;  1RY3 A;  2J58 A;  1LTJ C;  4JF7 A;  1MUU A;  3M9H A;  5KJ7 C;  2KP8 A;  2XZR A;  1RF1 A;  1GW4 A;  2YO3 A;  3MD0 A;  3M91 A;  5CJ4 A;  5KJ7 A;  1H88 A;  3NXS A;  2WIT A;  2WPQ A;  4W7Z A;  5APY A;  4JYB A;  1XTC C;  1YTZ T;  2MJZ A;  5CCH D;  5APT A;  1SQP K;  1FZB A;  1HGZ A;  1SQV K;  5AW2 B;  2O01 H;  2O1K A;  1KIL C;  2XU6 A;  1S9K E;  1KIL B;  3TNU B;  3NMD A;  1NWQ A;  3P8M C;  3HE4 B;  1HJB A;  1T8Z A;  1N2D C;  3HD7 A;  1G2C B;  3A5T A;  4I1L A;  3M0D A;  1GU5 A;  1VPC A;  5CMZ A;  3TNU A;  3M0A A;  4I2L C;  3HE4 A;  1ZV8 A;  1IO4 A;  2HPC B;  5CCH C;  1FJK A;  1G2C A;  2I1J A;  1LTS C;  1CI6 A;  2OYH B;  2OAR A;  3B8E B;  1SFC C;  1SFC B;  2HPC A;  2NPS C;  5AW4 B;  3RK2 C;  2NPS B;  5CCH A;  3RK2 B;  1FZA A;  2OYH A;  1J1E C;  1J1E B;  1JY3 O;  1LT9 C;  2CPB A;  3KDP B;  1RE3 C;  4N3Y B;  1NAF A;  3HUS B;  1GL2 D;  5AVY B;  1NO4 A;  3G3Z A;  1T2K C;  3V4W A;  1FZC A;  1VDF A;  4JYC A;  1A02 F;  1J2J B;  1G1I A;  1W2E A;  3VTP C;  2N1T C;  3HUS A;  1HVV A;  1ZR4 A;  1E5W A;  3OAK A;  1H89 A;  1IC2 A;  3A2A A;  3VP8 A;  1SQB K;  3LID A;  1SVF A;  2XV5 A;  3I5C A;  1X79 B;  1FZE A;  1HUC A;  3U59 A;  1A02 J;  4W80 A;  5APU A;  2KLV A;  2WT7 B;  3B5N C;  1KZU B;  3T97 A;  1SQQ K;  2W6A A;  3KQG A;  3TYY A;  2Z5I A;  1YTZ I;  1GL2 A;  2C0X A;  3CL3 D;  5AW5 B;  1IFJ A;  3MGN A;  3HE5 B;  2XKM A;  1GW3 A;  1MZ9 A;  1NKZ B;  3IR9 A;  3V4Q A;  2H7H A;  1M1J B;  1HGV A;  1N86 A;  4N78 D;  3HE5 A;  3V2N A;  3N7N A;  2WPS A;  1ZLL A;  1M1J A;  3L36 A;  2XNX A;  3MTU E;  1X9V A;  1RF0 C;  1ZN5 A;  1FZF A;  3HRN A;  1URQ D;  2FFD B;  2H43 A;  3O8Z A;  2JJL A;  1JTH A;  1RF1 C;  2FFD A;  4DOJ A;  3BAT A;  4C7N B;  2R32 A;  5APS A;  3H32 B;  4OH8 B;  2Q9I A;  2KSJ A;  4N78 E;  5APQ A;  1QL2 A;  1JY2 P;  1URQ B;  2YMY A;  4C7N A;  3RK3 C;  3H32 A;  2GUS A;  2IFM A;  2WSF H;  2Q3I A;  3RK3 B;  2XDJ A;  5KLV K;  1N73 B;  4GT1 A;  1JCD A;  1KFN A;  3L4F A;  1URQ A;  3HD7 C;  1JMM A;  1LTG C;  3M0D C;  3HD7 B;  1LTB C;  4EOT A;  4B86 A;  2JEE A;  2HFE D;  4Y99 B;  5AVU B;  1N73 A;  3PP5 A;  2PP6 A;  2GUV A;  1Z56 A;  2Q7C A;  4EIJ A;  5AW7 B;  3VMY A;  1CI6 B;  1JO5 A;  5AW9 B;  5BU5 A;  3P8C D;  1HTL C;  4HYT B;  3UIA A;  2OYH C;  5AW3 B;  5AVZ B;  4LGD E;  1HH0 A;  2O1J A;  1N7S D;  1FZC C;  1IK9 A;  3M9B A;  1FZC B;  5AVT B;  3HUS C;  1FZG A;  1FOS F;  3BVH A;  1NHL A;  5APW A;  2A45 G;  1IFM A;  1KQL A;  3EQ2 A;  3KPE A;  1JY3 P;  5BVZ A;  1GD2 E;  5AVQ B;  3P8C E;  3BAS A;  5AVW B;  2OYI B;  1XTG B;  4HH2 A;  2IPP A;  2Q5U A;  1LTT C;  1N7S B;  1MV8 A;  3VYI A;  1GDT A;  3L35 A;  4I6M C;  2ZXE B;  4WB4 A;  2OYI A;  1GL2 C;  1GU4 A;  1GL2 B;  1N7S A;  1NOH A;  2WSC H;  3NTN A;  3RL0 D;  1DH3 A;  2R5D A;  2WPR A;  2J59 M;  1NH4 A;  4RES B;  3P7K A;  1DX7 A;  4IFD K;  2KOG A;  1M1J C;  2P67 A;  1OXZ A;  1JOC A;  4WY4 D;  1SLQ A;  3OJA B;  3U1C A;  3V2Q A;  1IFN A;  5AVS B;  3V2R A;  1NU1 K;  1NTM K;  2M3B A;  2CPS A;  3RL0 B;  1IJD B;  4ZKP A;  1JNM A;  1JTH B;  2Z5H A;  1LWU C;  2IX7 C;  4DZO A;  1GK4 A;  2YO2 A;  1LWU B;  2FFD C;  2HOD B;  1HBW A;  2A45 H;  1JUN A;  1IFD A;  5CHX A;  5CCG D;  1LWU A;  3VMZ A;  1FU1 A;  2HOD A;  3A7O A;  1GTW A;  4WY4 B;  2GM4 A;  1RE4 A;  2I1K A;  4WBA A;  1WRG A;  2HLO A;  1CZQ A;  1X8Y A;  1PFI A;  1NKN A;  2ZFC A;  4GKG A;  4WY4 A;  2QM8 A;  1CW5 A;  4AUW A;  1EQ7 A;  1URQ C;  2HG5 D;  3SWF A;  1HWT C;  3TSI A;  2HYN A;  1G1J A;  1N73 C;  2M8R A;  3VP9 A;  2WZ7 A;  3IFM A;  4O9B A;  4W7Y A;  2N9B A;  3GHG A;  2FYZ A;  4XA4 A;  1KIL D;  4Y99 C;  1LTJ B;  1L0N K;  5AW0 B;  1SP4 A;  2R5B A;  5CCG A;  4IFM A;  1KFM A;  1MFZ A;  2FKW B;  3CLQ A;  2R3C A;  1IFI A;  1JY2 N;  2BAS A;  4N6J A;  1LTJ A;  3VN0 A;  1AQ5 A;  3LIE A;  1H8A A;  1GK6 A;  3P32 A;  3EFG A;  5KTB A;  2YKQ A;  2W6B A;  3KYQ A;  2LKM A;  1SFC D;  2PAJ A;  2KB7 P;  4AQR D;  3M9Q A;  2P7J A;  2NPS D;  3RK2 D;  2FYU K;  3U1A A;  2WTY A;  3V5B A;  3BRT B;  1KIL A;  3C9I A;  5APX A;  5AVX B;  4KHX A;  3VOP A;  1T2K D;  1LTA C;  1NTZ K;  3HTK B;  3N4X A;  4M3L A;  2C9N Y;  3MIW A;  2N1T D;  2IFN A;  2OYI C;  1OWA A;  1N7S C;  3HTK A;  2KYV A;  2E42 A;  1FAV A;  3V2P A;  3M06 A;  1NTK K;  1SFC A;  1AFO A;  1FBM A;  1LT9 B;  2NPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...