2Q7CA

Crystal structure of iqn17
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibiting HIV Entry: Discovery of D-Peptide Inhibitors that Target the Gp41 Coiled-Coil Pocket
pubmed doi rcsb
molecule tags Viral protein
molecule keywords fusion protein between yeast variant GCN4 and HIVgp41
total genus 20
structure length 45
sequence length 45
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2q7cA00
3L36A 3P32A 2W6AA 3T97A 2N9BA 3VMXA 1GK6A 3NXSA 3MD0A 3HE4B 3L37A 4C7NB 4C7NA 1GD2E 2YNYA 2WPRA 4AQRD 5APYA 2ZFCA 4RESB 5APUA 1FAVA 2YO2A 2P67A 4KHXA 2WT7B 1NAFA 4LC1A 5AW5B 3M06A 4HYTB 3VYIA 3A2AA 2R32A 3V4WA 3P8MC 2Q5UA 5AW4B 1CI6B 3UIAA 5AW8B 1JNMA 3LIDA 1CSBA 1S9KE 2Z5IA 2JJLA 3IR9A 5AVTB 1MV8A 3TYYA 2WTYA 1A02J 3HE4A 4GT1A 3VMZA 5APVA 2YO3A 4JYBA 3V5BA 4EOTA 3HE5B 5APSA 4GKGA 2Q3IA 2XV5A 4JYCA 2WPSA 1X8YA 1HUCA 2ZXEB 5AVQB 3VMYA 1A02F 5AVZB 2P2UA 1H88A 2C9LY 1NWQA 3V4QA 5AVRB 2QM8A 4I6MC 1T2KD 2E42A 1GZLA 3TNUB 4DZOA 1H89A 3A7OA 1S9KD 3VN0A 2P7JA 3MGNA 3NFQA 2R3CA 2XU6A 1GU5A 3KDPB 3A3YB 1OWAA 5AW1B 1YYCA 3TK1A 3VTPC 2WPQA 1FOSF 5APXA 3M91A 2C9NY 1GTWA 2KP8A 2QM7A 1FOSE 2E43A 3L35A 2R5DA 3M0DA 2BASA 4I2LC 1SLQA 2W27A 5AVSB 3B8EB 3OAKA 5APTA 5AVWB 5AW2B 5AVVB 3M9BA 1T2KC 2R5BA 3I5CA 5AVUB 1H8AA 2WWWA 3A5TA 3O8ZA 1MFZA 1GK4A 1KQLA 5AW6B 3HTKA 3NTNA 5AVYB 5AW0B 1HWTC 4M3LA 1CI6A 4AYCA 5APWA 4AUWA 5AW9B 3SWFA 5CMZA 3M0AA 1MUUA 3LIEA 3P7KA 2WT7A 1SP4A 3KQGA 2Z5HA 1JUNA 1HBWA 4XE5B 5AW7B 1J2JB 3M9HA 2Q7CA 5AVXB 2IPPA 2VRSA 3NMDA 3TNUA 1GU4A 5APQA 4B86A 1CZQA 1HJBA 1DH3A 2XZRA 2H7HA 1OXZA 1IO4A 5AW3B 1G2CB 4C46A 3HE5A
chains in the Genus database with same CATH superfamily
3L36A 3P32A 4L74A 2XNXA 3T97A 4OVNF 4JF7A 1VQKP 2M5AA 2HG5D 2JWDA 3GMAA 1G2CA 1NTMD 2KB7P 3P8CD 4DJGA 3L72G 1DIPA 1S5LX 1GDTA 1HF9A 3HUSC 3G9RA 4C7NA 1NKNA 1NKZB 1PPJE 5BVZA 1M1KQ 4HB1A 1L0LD 3HD7C 2W8ZA 4H44D 1OW7A 5KLIB 1PGOA 1ZN5A 1YQ4C 3H32B 4O9BA 3L70E 1NJIQ 1SQPK 3RK3E 2KXPB 2K88A 2E74C 1BSHA 1QLED 2A06E 3K5BA 2P1JA 3PJSK 1KYOE 1YJNP 1Y47A 1U7JA 1VQ6P 2HPCA 4IL6E 1NAFA 4R4MA 3I56P 3PP5A 4NPFX 2CPSA 2V4HA 1LTIC 3L71J 5KAFE 3II6A 3VYIA 1N7SA 3AE3C 3V4WA 2H43A 5KLVK 1FZCA 2FYUK 2P58A 2W6BA 1CI6B 3H1KJ 2JO1A 3UIAA 3BCCD 3LIDA 1EXIA 1IFMA 1BE3J 1BGYJ 1QEXA 2JJLA 1FZCC 2O1JA 4DOJA 2WTYA 2WPVB 1J1DB 2JKVA 1A02J 1SQXG 1SQQG 4GT1A 1JY2P 1M57D 1QVFO 2AEMA 4U3FD 2ZAEB 1SQBE 2YO3A 5APVA 3CX5H 1S5LH 2Q3EA 3FX0A 4QMAA 5KLVJ 3Q2YA 2FFDB 1L0ND 1SQPJ 5APSA 3BRVB 2Q3IA 3RK3C 4JYCA 2E76D 1L0NE 1HUCA 1X8YA 1L0LG 2HR3A 2B89A 5AVQB 4PV1C 1YHQP 1RF1B 1H88A 1SQBD 1NWQA 3CCUP 5KAIH 1SQXJ 1LT9B 3H1LG 3TNUB 4PD4I 1BGYG 1J1EC 1LGHB 1W2EA 2O1KA 4IFFA 4EIJA 3L74E 2OTLP 4I7ZB 3PLNA 2XU6A 2RMZA 1S72P 1LTGC 1RE3A 1OWAA 2FYNB 2KLUA 2M8RA 3H1KE 4OGQD 1MZ9A 3TK1A 5KTBA 3VTPC 1QL1A 4JPZB 1M90Q 1NAYA 2JDIH 4YXDC 1PV3A 4RO0A 3H1IE 1N73C 2FXOA 3B4SA 1KYOD 3CX5I 2N1TA 3L72J 1SLQA 1RH5B 2R3SA 3WU2E 3IAOA 1GW4A 1K05A 2Y0DA 4IFMA 5AVSB 3VP9A 3CC4P 1M1JA 1N7SC 1SFCC 2B88A 1LT9C 2IBZG 2NPSC 2QJYB 3B8EB 5APTA 1SQXK 4HKZH 3V2QA 5EFWB 4ASWA 1BCCD 1USEA 2QSIA 1Q90D 4N78D 3S4RA 4R4LA 2R5BA 3MUDA 2E5YA 1K9MQ 3P8CE 5DJTB 1M1JB 1YQ3C 3RL0g 3JCUE 4UB8E 1P84H 3H1HJ 2W6JH 1FDOA 2FYUG 2KNCA 3MZWB 1AFOA 3AEFC 5AVYB 2KLVA 2KZJA 3Q3DA 2J58A 2WSFH 3H1ID 4M3LA 3PRJA 1SQQJ 4OH8B 1SQVJ 4AUWA 3FWNA 2K3RA 1VQOP 1KTMA 2QRXA 1BE3G 2NRGA 2FYZA 3P7KA 1FZFA 1IJDB 3H1KD 3WUTA 3M9QA 1BCCE 1RF0A 1JTHA 2O01H 3GG2A 3H1KG 3KQGA 1J1DC 1FZGA 3USSA 3KPEA 2I1KA 1J2JB 4XE5B 1NTZD 1UIXA 2E76B 2Q7CA 3VP8A 3L71G 3W67A 2UWJE 1LTJB 1NTKJ 1RE3C 5APQA 1JY3P 5BU5A 1GL2B 2KK7A 1GU4A 1HJBA 1DH3A 2XZRA 3KHUA 3SWYA 5GTHH 3H1JD 1JB0J 2QEXP 2YMYA 2OGUA 1AV1A 2KS1A 2W6AA 4GIFA 2QJYC 3V4QA 1GK6A 4UB8H 2E5TA 3MD0A 3OA7A 3SSUA 3U59A 1H0TA 1ZOYC 1EZVG 1LT1A 1NTZJ 2WITA 1M1JC 2AEFA 2E75C 2K1AA 3L73J 2ZJSE 3B71A 4RESB 5APUA 5KLIC 3G6EP 2B87B 3H25A 2PP6A 1KB9E 2K37A 3AEDC 1ZXGA 1USDA 2PAJA 1X79B 1BCCJ 4D6TG 1JY3N 2QVAA 1QVGO 4N78E 1VF5B 1L4AC 3AE4C 3TGUJ 4EYYQ 2P67A 3EQ2A 4KHXA 4PD4H 1D7MA 1X0TA 5AW5B 4H13B 5H2FE 2RH0A 5KKZC 1OVUA 3HD7D 3A2AA 3N7NA 3BVHA 2K9JB 4Y28J 5AW4B 2CPBA 3GHGC 2ZVOB 5AW8B 5B5EH 3F5HA 1P84I 2GUVA 2J59M 4TT3H 2ZXXA 3HTKB 3D71A 1L2PA 1S5LE 2Z5IA 4W7ZA 1DX7A 1U7MA 2LR2A 3IR9A 1N7LA 3KZIH 4PJ0H 1H0TB 1URQB 1S2EA 2POHA 3MP7B 4DCKA 5CCGA 1SQPE 3CPWO 1YI2P 1GL2A 3TGUD 1VQ8P 3V5BA 4EOTA 2BEQD 1NTKG 4I1LA 5KAIE 1ZR2A 3CWBG 1IC2A 5CCHD 2JEEA 4MN4C 2XV5A 1NTKD 5CCGC 3D70A 1OVRA 1HGVA 1ZW0A 3RBXA 4PV1B 2P2UA 5AVZB 2M0BA 3WUVA 3V2PA 2C9LY 2YXRB 4I6MC 3RL0B 3Q5SA 4IL6H 1H89A 3CCEP 3BCCJ 3BATA 4WY4D 2JP3A 2YKQA 1SFCA 2NPSA 4W7YA 1HJ0A 2P7JA 5KJ7D 3RK2B 3A0BE 1PL5A 3WU2H 2HFED 3A3YB 1NH4A 1VL2A 3KDPB 4YPCA 4BXLA 1NTME 4C7RA 1N2DC 1OFCX 2WPQA 3KYQA 1FOSF 3RGUA 1NTMK 4ZKPA 2IFNA 1KFMA 1EZVI 2FKWB 3H1HD 3M91A 2C9NY 3D6YA 3CCQP 4W80A 1NTZG 1P84D 3CL3D 2QM7A 1IFIA 3TGUG 4YXWH 3L74G 1FOSE 1WRGA 1X22A 4H0LC 1HTLC 1L0NJ 1SQPD 2KSEA 1JCDA 2L91A 2KYVA 2R44A 4WY4C 1EZVD 1NU1D 1SFCB 1T3JA 1T6AA 2NPSB 2WSEJ 3L73G 5AW2B 2WSEH 2NZ2A 5CHXA 3RBZA 1SQVK 1BDCA 3H1IG 1HH0A 3RK3B 4CPGA 2WWWA 2FYUD 1VF5D 1KZUB 1MFZA 5CCHC 2ZT9B 1PP9J 1YIJP 1SQVE 1L0LE 3A0HE 3O6QA 1AQ5A 5AW0B 1WMKA 1JO5A 1LTJC 5K5GB 1NTMJ 3RL0C 4EI2A 3E1IA 2Y9YA 2O3JA 2WSFJ 2QJPB 3AEEC 3FXDA 3FWLA 1PZQA 5APWA 3U1AA 1VQ5P 1YITP 1BE3E 2MKVA 1BGYE 1URQD 2PFXA 2J5UA 3AE7C 2IX7C 5H2FH 2IYOA 1OZHA 5CMZA 3QWOC 3Q5PA 1EDLA 3LIEA 5AW6B 1K8AQ 3G71P 1BSNA 1L0NK 2QJKB 3AE6C 1SP4A 1FC2C 3B5ND 3L72D 1NVOA 2W83C 1RF1A 3C9IA 1GW3A 1HBWA 1OW8A 1IK9A 1FZEA 1Q81Q 1FZCB 2E76C 1SQBK 2FBWC 2OARA 3H1HG 3EWKA 2QA4P 1DEEG 3C1LA 3NMDA 3SWKA 3TNUA 1ZR4A 4B86A 2HPCB 1CZQA 1L4AD 3L73D 1DEBA 1VQ4P 2OTJP 3ABVC 4U3FJ 1URQA 1OXZA 3BRTB 2H7HA 1BCCG 3CMAP 1PIXA 2BCCD 1HGZA 1Z56A 1NU1G 1PP9E 1Q2NA 1XTCC 1G1JA 1BGYD 1VPCA 2E75D 2N9BA 3GF7A 1ZV8A 3NXSA 1KILA 2K9JA 1HVVA 2WSCH 3CXHH 1DD3A 4C7NB 1Y9BA 1E79H 4KJMA 1KV4A 2WPRA 1FBMA 1LTJA 1EDJA 1RE4C 4I7ZC 1GU5A 1FAVA 1S3JA 3FXEA 3HUSB 1KILE 2AXTH 3JSVC 4DT0A 2YO2A 3CMEP 2H8PD 3TSIA 1L4AB 1ZRTE 1E5WA 1SQXD 2B87A 3H32A 4LLHA 4IOIH 1U57A 3OJAB 4LC1A 3M06A 3RK2D 3V2NA 5B66H 1KN7A 4HYTB 2SPZA 1FZBA 1JOCA 1IFJA 2QJKC 3P8MC 1Q82Q 1EC5A 3H1LD 2KUBA 1R8EA 1LWUB 1JTHB 2A06G 1J1EB 4JBZA 4WB4A 2ZYGA 1EDKA 3O6QB 4WVZA 1S9KE 1URQC 2KOGA 3H1HE 3CXHI 3JCUH 3L75G 1MKMA 5GTHE 1SQPG 5GTIH 1NO4A 1VDFA 1SQBG 3RL0D 3VMZA 1QL2A 5B5EE 5CBNA 1SQQE 4IL6X 4D6TD 3CCRP 1KFNA 2LXBA 3CI9A 4IFDK 1VQNP 1XTGB 3CCJP 1NU1E 3L75J 3MTUE 1QGKB 2WPSA 2ZXEB 5KKZB 2FY8A 1BDDA 1M8OB 1RE4A 2WVRA 1OX3A 1SQQD 3H1LE 2N1TB 4U7JA 4OWFA 1JY2N 1Q86Q 2E42A 2A45G 2KSJA 1RQVA 4TLFA 1Y8AA 3SFDC 2OYIB 4ZNCA 5TISH 2IDBA 4H0LB 3VN0A 3H1JG 1S9KD 1KILC 1KD1Q 1M7LA 4H0LD 1FE6A 1R5SA 2PGDA 4Y99C 5CJ4A 3CCMP 1W2BO 1YYCA 2GUSA 2KNCB 3ZDMA 5E79E 1SVFA 3L70D 3PHLA 5APXA 3CWBD 5TISE 2KIKA 4BWNA 2D2CB 2OQQA 3CXHD 5GTIE 1L0LK 1JM0A 1N86A 2IBZI 1OW6A 1LT9A 1FZAA 1AVYA 1NHLA 2R5DA 2YIUB 1IFPA 3AEBC 2BASA 3L35A 2W27A 3EFGA 2N1TD 2C0XA 1LP1B 1PGPA 3A0BH 1KQFB 2M3EA 1BE3D 2OYOA 4N3YB 1NU1J 3L75E 1LJ2A 1FJPA 1KB9H 1K04A 2B9BA 2N1TC 3AEAC 3M9BA 5AVWB 2E74B 1AA0A 1LTSC 3BCCE 3H1LJ 1VQPP 4L73A 1NGMB 4Z1MH 3PH0A 4PV1D 3AEGC 3Q1MA 1H8AA 5AVUB 2DW3A 1L0LJ 5KLVD 2MJZA 4ZKUA 3BASA 1PP9D 4L75A 1LP1A 1M56D 1T3UA 1UIIA 1NYHA 2YMKA 3WMM0 3HRNA 3HTKA 3NTNA 2GA1A 4PD4D 2IBZE 4RKUJ 5KLVG 1AJYA 1JMMA 3G3ZA 1HWTC 3E7KA 4AYCA 4H44B 1SQBJ 1FU1A 3S1KA 1RF0C 2WMMA 1EZVE 1KILD 1RHZB 4HJGH 4UB6E 5L8RJ 2JR8A 2H89C 4PJ0E 3SFEC 4BRYB 3W68A 1YJWP 4KT0J 1MFTA 4WY4A 1YBKA 3H1JE 3AECC 2OYIC 2V7QH 1DD4A 3IN6A 3AE2C 2Z5HA 2I8DA 1NTMG 1P84E 2LKMA 1NTKK 4ASVA 2YKOA 3Q5RA 1EDIA 5AW7B 1OIPA 2XDJA 3HD7A 3M9HA 2OYIA 1OVVA 5AVXB 1VQ9P 2IPPA 1KB9I 2XKMA 1X9VA 2BCCE 2HODA 3CCVP 1Q7YQ 4ZMDA 4WBAA 1IFDA 3C8VA 1KC8Q 2WSCJ 3GW6A 3CXHE 3V6IA 1PP9G 1IZNB 3CD6P 1EQ7A 3L71D 3T97B 3HE5A 3WUUA 1JEKA 2KS1B 4H44C 4D6TE 1N73A 3VMXA 2FYUE 2OYHC 3H1IJ 4A7PA 3AE5C 3HE4B 2IFMA 3AE1C 3L37A 4JQ0D 1N7SB 4GDOA 5M1BA 3L72E 2YNYA 2IBZD 3L74D 4AQRD 1GD2E 5APYA 2ZFCA 4GOFA 5CJ0A 2M5AB 2OYHA 3IFMA 3MIWA 3RK2C 2AXCA 2YXQB 1L0NG 5KLVE 1LWUA 3L70G 3QH9A 4XA4A 2I1JA 3R4YA 2D2CC 4U3FG 1YTZT 2D2CD 3L70J 1NU1K 1KMIZ 2ZT9D 2WQYC 3B5NB 3VMAA 2FYNC 1KORA 1SQVD 2WT7B 1SQXE 3L75D 1YJ9P 2BCCJ 2O01N 2L5GB 3E1RA 3JC22 2R32A 2V7QJ 4NPDA 3HD7B 1IK7A 3KZIE 4GODA 2Q5UA 1VQ7P 2QG4A 3HUSA 4HH2A 3R2PA 1JNMA 3KXDA 1PGJA 1CSBA 1TU3F 1R5LA 3VOPA 3CC7P 4K3AA 1VQMP 2OYHB 1CW5A 3FGAD 5AVTB 1MV8A 3TYYA 3TDKA 4BRYA 2FXMA 2ZVNB 1KQGB 3HE4A 4RJTA 1KILB 3CCSP 2Z4EA 1VQLP 4YTPC 2WZ7A 1GL2D 3GF3A 4JYBA 4LGDE 3OW2O 3AE8C 2OTKE 2FFDC 2RN0A 3HE5B 5C39A 4GKGA 1YTZI 2HYNA 3V2RA 3U1CA 2O01J 3VMYA 4H13C 1NTZK 2QIWA 2C0WA 2LXCB 1A02F 3G4SP 2A06D 1JMBA 1S1CX 1T8ZA 1ZLLA 2QJPC 2QM8A 3B5NC 5AVRB 3CX5E 1FJKA 1GZLA 2HODB 1IFNA 3GHGB 2JWAA 4WY4B 4DZOA 1SFCD 1N7SD 2NPSD 3PTZA 3CLQA 3A7OA 3CWBE 3MGNA 1SQVG 2HLOA 2R3CA 2CK3H 3MHVA 3NFQA 5KJ7A 5AW1B 1FDIA 2E75B 2Q1KA 3CX5D 2G8YA 4U3FE 3A0HH 1PGQA 2PRRA 2QE7H 3L74J 3TF5A 2BEZF 1AQTA 2KI7B 2ZYDA 2IYPA 3IF4A 3L73E 2GM4A 1K73Q 1VF5C 1FS0E 1LWUC 2Y0CA 1G1IA 3F89A 2KP8A 2N9YB 1ZP0C 3S9OA 3I55P 1T2KD 1GTWA 2E43A 2YIUC 3M0DA 4OGQC 3TGUE 1SS1A 4I2LC 4L76A 1LNQA 5TJHA 3D6ZA 1KYOH 1FDMA 4K35A 2Y0EA 1KB9D 3L4FA 2Y9ZA 2AXTE 1W5CE 3M0DC 3EFFK 3BCCG 2K9YA 3OAKA 1N8RQ 5AVVB 2FFDA 5CCHA 1T2KC 1LTAC 3GHGA 4WWIA 4PD4E 2YKPA 1QX8A 3AE9C 1PPJG 2A45H 3I5CA 4H13D 1ZMEC 3A5TA 4UB6H 2A45I 3RK3D 3ITKA 3LW5H 1LTTC 3O8ZA 1GK4A 1KQLA 1PFIA 3CCLP 3CWBJ 2G3AA 3CC2P 2Q6QA 3LW5J 2WSSH 4NPEA 1GL2C 4XFJA 5DJUB 1JCCA 1PPJD 2ITAA 5CBOA 2Q9IA 1CI6A 2IZ0A 3H1JJ 3N4XA 2P10A 5KJ7C 5AW9B 4Y99B 3SWFA 1RF1C 4GOEA 1S4XA 3H6PA 3M0AA 1MUUA 1RY3A 1NTZE 2FXPA 2ZYAA 4N6JA 3B5NA 5E79H 2WT7A 2AEJA 4EDFA 1JUNA 5BU8B 1AVOA 1ZRTD 2RKLA 1KYOI 2XNDH 3MUDC 1OMIA 3GLMA 2M3BA 2IZ1A 1JY3O 1SQQK 2BCCG 5CCGD 5KAFH 1JY2O 1EXJA 2VRSA 3L71E 1WT6A 2W90A 5B66E 2ZT9C 1LTBC 1GMJA 1L4AA 1IO4A 1NOHA 2E74D 4D6TJ 1NTKE 2FYUJ 1RQUA 5AW3B 1G2CB 2KZIA 4OGQB 1KQSO 2H88C 4C46A 1N73B
chains in the Genus database with same CATH topology
3L36A 3P32A 2XNXA 3T97A 4JF7A 2HG5D 1G2CA 2KB7P 3P8CD 1GDTA 3HUSC 4C7NA 1NKNA 1NKZB 5BVZA 3HD7C 1ZN5A 3H32B 4O9BA 1SQPK 2P1JA 2HPCA 1NAFA 3PP5A 2CPSA 1LTIC 3VYIA 2H43A 3II6A 1N7SA 3V4WA 5KLVK 1FZCA 2FYUK 2W6BA 1CI6B 3UIAA 3LIDA 1IFMA 1FZCC 2JJLA 2O1JA 4DOJA 2WTYA 1J1DB 1A02J 4GT1A 1JY2P 5APVA 2YO3A 2FFDB 5APSA 3BRVB 2Q3IA 3RK3C 4JYCA 5AVQB 1X8YA 1HUCA 3VP9A 1RF1B 1H88A 1NWQA 1LT9B 3TNUB 1J1EC 1LGHB 4IFFA 1W2EA 2O1KA 4EIJA 2XU6A 1LTGC 1RE3A 1OWAA 2M8RA 3TK1A 1MZ9A 5KTBA 3VTPC 1QL1A 1N73C 2N1TA 1SLQA 1GW4A 4IFMA 5AVSB 1M1JA 1N7SC 1SFCC 2NPSC 1LT9C 3B8EB 5APTA 1SQXK 3V2QA 4N78D 2R5BA 3MUDA 3P8CE 1M1JB 1AFOA 5AVYB 2KLVA 2J58A 2WSFH 4M3LA 4OH8B 4AUWA 2FYZA 3P7KA 1FZFA 1IJDB 3M9QA 1RF0A 1FZGA 1JTHA 2O01H 3KQGA 1J1DC 3KPEA 2I1KA 1J2JB 4XE5B 3VP8A 2Q7CA 1LTJB 1RE3C 5APQA 5BU5A 1JY3P 1GU4A 1GL2B 1HJBA 1DH3A 2XZRA 3SWYA 2YMYA 2W6AA 4GIFA 1GK6A 3MD0A 3OA7A 3U59A 2WITA 1M1JC 4RESB 5APUA 2PP6A 2PAJA 1X79B 1JY3N 4N78E 1L4AC 2P67A 3EQ2A 4KHXA 5AW5B 3HD7D 3A2AA 3N7NA 3BVHA 5AW4B 2CPBA 3GHGC 5AW8B 2J59M 2GUVA 3HTKB 2Z5IA 4W7ZA 1DX7A 3IR9A 1N7LA 1URQB 2POHA 5CCGA 1GL2A 3V5BA 4EOTA 4I1LA 1ZR2A 1IC2A 5CCHD 2JEEA 5CCGC 2XV5A 1HGVA 5AVZB 2P2UA 2C9LY 3V2PA 4I6MC 3RL0B 1H89A 3BATA 4WY4D 2YKQA 1SFCA 2NPSA 4W7YA 2P7JA 5KJ7D 3RK2B 4ZKUA 2HFED 3A3YB 1NH4A 3KDPB 1GU5A 4C7RA 1N2DC 2WPQA 3KYQA 1FOSF 1NTMK 4ZKPA 2IFNA 1KFMA 2FKWB 3M91A 2C9NY 4W80A 3CL3D 2QM7A 1IFIA 1FOSE 1WRGA 1HTLC 1JCDA 2KYVA 4WY4C 1SFCB 2NPSB 1T3JA 5AW2B 2WSEH 5CHXA 1SQVK 1HH0A 3RK3B 2WWWA 1KZUB 1MFZA 5CCHC 1AQ5A 5AW0B 1JO5A 1LTJC 3RL0C 3E1IA 5APWA 3U1AA 1URQD 2IX7C 5CMZA 3LIEA 1L0NK 1SP4A 3B5ND 1RF1A 3C9IA 1GW3A 1HBWA 1IK9A 1FZEA 1FZCB 1SQBK 2OARA 3NMDA 1ZR4A 3TNUA 4B86A 2HPCB 1CZQA 1L4AD 1DEBA 1URQA 1OXZA 3BRTB 2H7HA 1HGZA 1Z56A 1XTCC 1G1JA 1VPCA 2N9BA 1ZV8A 3NXSA 1KILA 1HVVA 2WSCH 4C7NB 2WPRA 1FBMA 1LTJA 1RE4C 1FAVA 3HUSB 2YO2A 2H8PD 3TSIA 1L4AB 1E5WA 3H32A 4LLHA 4LC1A 3OJAB 3RK2D 3M06A 3V2NA 4HYTB 1FZBA 1JOCA 1IFJA 3P8MC 1LWUB 1JTHB 1J1EB 4WB4A 1S9KE 1URQC 2KOGA 1NO4A 1VDFA 3RL0D 3VMZA 1QL2A 1KFNA 3CI9A 1XTGB 3MTUE 2WPSA 2ZXEB 1RE4A 2N1TB 1JY2N 2E42A 2A45G 2KSJA 2OYIB 1S9KD 3VN0A 1KILC 1M7LA 4Y99C 5CJ4A 1YYCA 2GUSA 1SVFA 5APXA 1L0LK 1N86A 1LT9A 1FZAA 1NHLA 2R5DA 3L35A 2BASA 2W27A 3EFGA 2N1TD 2C0XA 4N3YB 1FJPA 5AVWB 2N1TC 3M9BA 1LTSC 1H8AA 5AVUB 2MJZA 3BASA 1T3UA 3WMM0 3HRNA 3HTKA 3NTNA 1JMMA 3G3ZA 1HWTC 4AYCA 1FU1A 1RF0C 1KILD 4WY4A 2OYIC 2Z5HA 2LKMA 1NTKK 2YKOA 5AW7B 2XDJA 3HD7A 3M9HA 2OYIA 5AVXB 2IPPA 2XKMA 1X9VA 2HODA 4WBAA 1IFDA 1EQ7A 3HE5A 1N73A 3VMXA 2OYHC 3HE4B 2IFMA 3L37A 1GD2E 1N7SB 4IFDK 2YNYA 4AQRD 5APYA 2ZFCA 5CJ0A 2OYHA 3IFMA 3MIWA 3RK2C 1LWUA 4XA4A 2I1JA 1YTZT 1NU1K 3B5NB 2WT7B 2L5GB 2R32A 3HD7B 2Q5UA 3HUSA 4HH2A 3R2PA 1JNMA 1CSBA 3VOPA 2OYHB 1CW5A 5AVTB 1MV8A 3TYYA 2FXMA 3HE4A 2Z4EA 1KILB 2WZ7A 1GL2D 4JYBA 4LGDE 2FFDC 3HE5B 4GKGA 1YTZI 2HYNA 3V2RA 3U1CA 3VMYA 1NTZK 1A02F 2C0WA 1T8ZA 1ZLLA 3B5NC 5AVRB 3V4QA 2QM8A 1T2KD 1FJKA 1GZLA 2HODB 1IFNA 3GHGB 4WY4B 4DZOA 1SFCD 1N7SD 2NPSD 3CLQA 3A7OA 3MGNA 2HLOA 2R3CA 3NFQA 5KJ7A 5AW1B 2GM4A 1LWUC 1G1IA 1GTWA 2KP8A 2E43A 3M0DA 4I2LC 1FDMA 3L4FA 3OAKA 3M0DC 5AVVB 2FFDA 5CCHA 1T2KC 1LTAC 3GHGA 2YKPA 3I5CA 2A45H 3A5TA 2A45I 3RK3D 3LW5H 1LTTC 3O8ZA 1GK4A 1KQLA 1PFIA 5AW6B 1GL2C 1JCCA 2Q9IA 1CI6A 3N4XA 5KJ7C 5AW9B 4Y99B 3SWFA 1RF1C 3H6PA 3M0AA 1MUUA 1RY3A 4N6JA 2WT7A 3B5NA 1JUNA 5BU8B 2M3BA 1JY3O 1SQQK 5CCGD 1JY2O 2VRSA 1WT6A 1LTBC 1L4AA 1IO4A 1NOHA 5AW3B 1G2CB 4C46A 1N73B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L36 A;  3P32 A;  2W6A A;  3T97 A;  2N9B A;  3VMX A;  1GK6 A;  3NXS A;  3MD0 A;  3HE4 B;  3L37 A;  4C7N B;  4C7N A;  1GD2 E;  2YNY A;  2WPR A;  4AQR D;  5APY A;  2ZFC A;  4RES B;  5APU A;  1FAV A;  2YO2 A;  2P67 A;  4KHX A;  2WT7 B;  1NAF A;  4LC1 A;  5AW5 B;  3M06 A;  4HYT B;  3VYI A;  3A2A A;  2R32 A;  3V4W A;  3P8M C;  2Q5U A;  5AW4 B;  1CI6 B;  3UIA A;  5AW8 B;  1JNM A;  3LID A;  1CSB A;  1S9K E;  2Z5I A;  2JJL A;  3IR9 A;  5AVT B;  1MV8 A;  3TYY A;  2WTY A;  1A02 J;  3HE4 A;  4GT1 A;  3VMZ A;  5APV A;  2YO3 A;  4JYB A;  3V5B A;  4EOT A;  3HE5 B;  5APS A;  4GKG A;  2Q3I A;  2XV5 A;  4JYC A;  2WPS A;  1X8Y A;  1HUC A;  2ZXE B;  5AVQ B;  3VMY A;  1A02 F;  5AVZ B;  2P2U A;  1H88 A;  2C9L Y;  1NWQ A;  3V4Q A;  5AVR B;  2QM8 A;  4I6M C;  1T2K D;  2E42 A;  1GZL A;  3TNU B;  4DZO A;  1H89 A;  3A7O A;  1S9K D;  3VN0 A;  2P7J A;  3MGN A;  3NFQ A;  2R3C A;  2XU6 A;  1GU5 A;  3KDP B;  3A3Y B;  1OWA A;  5AW1 B;  1YYC A;  3TK1 A;  3VTP C;  2WPQ A;  1FOS F;  5APX A;  3M91 A;  2C9N Y;  1GTW A;  2KP8 A;  2QM7 A;  1FOS E;  2E43 A;  3L35 A;  2R5D A;  3M0D A;  2BAS A;  4I2L C;  1SLQ A;  2W27 A;  5AVS B;  3B8E B;  3OAK A;  5APT A;  5AVW B;  5AW2 B;  5AVV B;  3M9B A;  1T2K C;  2R5B A;  3I5C A;  5AVU B;  1H8A A;  2WWW A;  3A5T A;  3O8Z A;  1MFZ A;  1GK4 A;  1KQL A;  5AW6 B;  3HTK A;  3NTN A;  5AVY B;  5AW0 B;  1HWT C;  4M3L A;  1CI6 A;  4AYC A;  5APW A;  4AUW A;  5AW9 B;  3SWF A;  5CMZ A;  3M0A A;  1MUU A;  3LIE A;  3P7K A;  2WT7 A;  1SP4 A;  3KQG A;  2Z5H A;  1JUN A;  1HBW A;  4XE5 B;  5AW7 B;  1J2J B;  3M9H A;  2Q7C A;  5AVX B;  2IPP A;  2VRS A;  3NMD A;  3TNU A;  1GU4 A;  5APQ A;  4B86 A;  1CZQ A;  1HJB A;  1DH3 A;  2XZR A;  2H7H A;  1OXZ A;  1IO4 A;  5AW3 B;  1G2C B;  4C46 A;  3HE5 A; 
#chains in the Genus database with same CATH topology
 3L36 A;  3P32 A;  4L74 A;  2XNX A;  3T97 A;  4OVN F;  4JF7 A;  1VQK P;  2M5A A;  2HG5 D;  2JWD A;  3GMA A;  1G2C A;  1NTM D;  2KB7 P;  3P8C D;  4DJG A;  3L72 G;  1DIP A;  1S5L X;  1GDT A;  1HF9 A;  3HUS C;  3G9R A;  4C7N A;  1NKN A;  1NKZ B;  1PPJ E;  5BVZ A;  1M1K Q;  4HB1 A;  1L0L D;  3HD7 C;  2W8Z A;  4H44 D;  1OW7 A;  5KLI B;  1PGO A;  1ZN5 A;  1YQ4 C;  3H32 B;  4O9B A;  3L70 E;  1NJI Q;  1SQP K;  3RK3 E;  2KXP B;  2K88 A;  2E74 C;  1BSH A;  1QLE D;  2A06 E;  3K5B A;  2P1J A;  3PJS K;  1KYO E;  1YJN P;  1Y47 A;  1U7J A;  1VQ6 P;  2HPC A;  4IL6 E;  1NAF A;  4R4M A;  3I56 P;  3PP5 A;  4NPF X;  2CPS A;  2V4H A;  1LTI C;  3L71 J;  5KAF E;  3II6 A;  3VYI A;  1N7S A;  3AE3 C;  3V4W A;  2H43 A;  5KLV K;  1FZC A;  2FYU K;  2P58 A;  2W6B A;  1CI6 B;  3H1K J;  2JO1 A;  3UIA A;  3BCC D;  3LID A;  1EXI A;  1IFM A;  1BE3 J;  1BGY J;  1QEX A;  2JJL A;  1FZC C;  2O1J A;  4DOJ A;  2WTY A;  2WPV B;  1J1D B;  2JKV A;  1A02 J;  1SQX G;  1SQQ G;  4GT1 A;  1JY2 P;  1M57 D;  1QVF O;  2AEM A;  4U3F D;  2ZAE B;  1SQB E;  2YO3 A;  5APV A;  3CX5 H;  1S5L H;  2Q3E A;  3FX0 A;  4QMA A;  5KLV J;  3Q2Y A;  2FFD B;  1L0N D;  1SQP J;  5APS A;  3BRV B;  2Q3I A;  3RK3 C;  4JYC A;  2E76 D;  1L0N E;  1HUC A;  1X8Y A;  1L0L G;  2HR3 A;  2B89 A;  5AVQ B;  4PV1 C;  1YHQ P;  1RF1 B;  1H88 A;  1SQB D;  1NWQ A;  3CCU P;  5KAI H;  1SQX J;  1LT9 B;  3H1L G;  3TNU B;  4PD4 I;  1BGY G;  1J1E C;  1LGH B;  1W2E A;  2O1K A;  4IFF A;  4EIJ A;  3L74 E;  2OTL P;  4I7Z B;  3PLN A;  2XU6 A;  2RMZ A;  1S72 P;  1LTG C;  1RE3 A;  1OWA A;  2FYN B;  2KLU A;  2M8R A;  3H1K E;  4OGQ D;  1MZ9 A;  3TK1 A;  5KTB A;  3VTP C;  1QL1 A;  4JPZ B;  1M90 Q;  1NAY A;  2JDI H;  4YXD C;  1PV3 A;  4RO0 A;  3H1I E;  1N73 C;  2FXO A;  3B4S A;  1KYO D;  3CX5 I;  2N1T A;  3L72 J;  1SLQ A;  1RH5 B;  2R3S A;  3WU2 E;  3IAO A;  1GW4 A;  1K05 A;  2Y0D A;  4IFM A;  5AVS B;  3VP9 A;  3CC4 P;  1M1J A;  1N7S C;  1SFC C;  2B88 A;  1LT9 C;  2IBZ G;  2NPS C;  2QJY B;  3B8E B;  5APT A;  1SQX K;  4HKZ H;  3V2Q A;  5EFW B;  4ASW A;  1BCC D;  1USE A;  2QSI A;  1Q90 D;  4N78 D;  3S4R A;  4R4L A;  2R5B A;  3MUD A;  2E5Y A;  1K9M Q;  3P8C E;  5DJT B;  1M1J B;  1YQ3 C;  3RL0 g;  3JCU E;  4UB8 E;  1P84 H;  3H1H J;  2W6J H;  1FDO A;  2FYU G;  2KNC A;  3MZW B;  1AFO A;  3AEF C;  5AVY B;  2KLV A;  2KZJ A;  3Q3D A;  2J58 A;  2WSF H;  3H1I D;  4M3L A;  3PRJ A;  1SQQ J;  4OH8 B;  1SQV J;  4AUW A;  3FWN A;  2K3R A;  1VQO P;  1KTM A;  2QRX A;  1BE3 G;  2NRG A;  2FYZ A;  3P7K A;  1FZF A;  1IJD B;  3H1K D;  3WUT A;  3M9Q A;  1BCC E;  1RF0 A;  1JTH A;  2O01 H;  3GG2 A;  3H1K G;  3KQG A;  1J1D C;  1FZG A;  3USS A;  3KPE A;  2I1K A;  1J2J B;  4XE5 B;  1NTZ D;  1UIX A;  2E76 B;  2Q7C A;  3VP8 A;  3L71 G;  3W67 A;  2UWJ E;  1LTJ B;  1NTK J;  1RE3 C;  5APQ A;  1JY3 P;  5BU5 A;  1GL2 B;  2KK7 A;  1GU4 A;  1HJB A;  1DH3 A;  2XZR A;  3KHU A;  3SWY A;  5GTH H;  3H1J D;  1JB0 J;  2QEX P;  2YMY A;  2OGU A;  1AV1 A;  2KS1 A;  2W6A A;  4GIF A;  2QJY C;  3V4Q A;  1GK6 A;  4UB8 H;  2E5T A;  3MD0 A;  3OA7 A;  3SSU A;  3U59 A;  1H0T A;  1ZOY C;  1EZV G;  1LT1 A;  1NTZ J;  2WIT A;  1M1J C;  2AEF A;  2E75 C;  2K1A A;  3L73 J;  2ZJS E;  3B71 A;  4RES B;  5APU A;  5KLI C;  3G6E P;  2B87 B;  3H25 A;  2PP6 A;  1KB9 E;  2K37 A;  3AED C;  1ZXG A;  1USD A;  2PAJ A;  1X79 B;  1BCC J;  4D6T G;  1JY3 N;  2QVA A;  1QVG O;  4N78 E;  1VF5 B;  1L4A C;  3AE4 C;  3TGU J;  4EYY Q;  2P67 A;  3EQ2 A;  4KHX A;  4PD4 H;  1D7M A;  1X0T A;  5AW5 B;  4H13 B;  5H2F E;  2RH0 A;  5KKZ C;  1OVU A;  3HD7 D;  3A2A A;  3N7N A;  3BVH A;  2K9J B;  4Y28 J;  5AW4 B;  2CPB A;  3GHG C;  2ZVO B;  5AW8 B;  5B5E H;  3F5H A;  1P84 I;  2GUV A;  2J59 M;  4TT3 H;  2ZXX A;  3HTK B;  3D71 A;  1L2P A;  1S5L E;  2Z5I A;  4W7Z A;  1DX7 A;  1U7M A;  2LR2 A;  3IR9 A;  1N7L A;  3KZI H;  4PJ0 H;  1H0T B;  1URQ B;  1S2E A;  2POH A;  3MP7 B;  4DCK A;  5CCG A;  1SQP E;  3CPW O;  1YI2 P;  1GL2 A;  3TGU D;  1VQ8 P;  3V5B A;  4EOT A;  2BEQ D;  1NTK G;  4I1L A;  5KAI E;  1ZR2 A;  3CWB G;  1IC2 A;  5CCH D;  2JEE A;  4MN4 C;  2XV5 A;  1NTK D;  5CCG C;  3D70 A;  1OVR A;  1HGV A;  1ZW0 A;  3RBX A;  4PV1 B;  2P2U A;  5AVZ B;  2M0B A;  3WUV A;  3V2P A;  2C9L Y;  2YXR B;  4I6M C;  3RL0 B;  3Q5S A;  4IL6 H;  1H89 A;  3CCE P;  3BCC J;  3BAT A;  4WY4 D;  2JP3 A;  2YKQ A;  1SFC A;  2NPS A;  4W7Y A;  1HJ0 A;  2P7J A;  5KJ7 D;  3RK2 B;  3A0B E;  1PL5 A;  3WU2 H;  2HFE D;  3A3Y B;  1NH4 A;  1VL2 A;  3KDP B;  4YPC A;  4BXL A;  1NTM E;  4C7R A;  1N2D C;  1OFC X;  2WPQ A;  3KYQ A;  1FOS F;  3RGU A;  1NTM K;  4ZKP A;  2IFN A;  1KFM A;  1EZV I;  2FKW B;  3H1H D;  3M91 A;  2C9N Y;  3D6Y A;  3CCQ P;  4W80 A;  1NTZ G;  1P84 D;  3CL3 D;  2QM7 A;  1IFI A;  3TGU G;  4YXW H;  3L74 G;  1FOS E;  1WRG A;  1X22 A;  4H0L C;  1HTL C;  1L0N J;  1SQP D;  2KSE A;  1JCD A;  2L91 A;  2KYV A;  2R44 A;  4WY4 C;  1EZV D;  1NU1 D;  1SFC B;  1T3J A;  1T6A A;  2NPS B;  2WSE J;  3L73 G;  5AW2 B;  2WSE H;  2NZ2 A;  5CHX A;  3RBZ A;  1SQV K;  1BDC A;  3H1I G;  1HH0 A;  3RK3 B;  4CPG A;  2WWW A;  2FYU D;  1VF5 D;  1KZU B;  1MFZ A;  5CCH C;  2ZT9 B;  1PP9 J;  1YIJ P;  1SQV E;  1L0L E;  3A0H E;  3O6Q A;  1AQ5 A;  5AW0 B;  1WMK A;  1JO5 A;  1LTJ C;  5K5G B;  1NTM J;  3RL0 C;  4EI2 A;  3E1I A;  2Y9Y A;  2O3J A;  2WSF J;  2QJP B;  3AEE C;  3FXD A;  3FWL A;  1PZQ A;  5APW A;  3U1A A;  1VQ5 P;  1YIT P;  1BE3 E;  2MKV A;  1BGY E;  1URQ D;  2PFX A;  2J5U A;  3AE7 C;  2IX7 C;  5H2F H;  2IYO A;  1OZH A;  5CMZ A;  3QWO C;  3Q5P A;  1EDL A;  3LIE A;  5AW6 B;  1K8A Q;  3G71 P;  1BSN A;  1L0N K;  2QJK B;  3AE6 C;  1SP4 A;  1FC2 C;  3B5N D;  3L72 D;  1NVO A;  2W83 C;  1RF1 A;  3C9I A;  1GW3 A;  1HBW A;  1OW8 A;  1IK9 A;  1FZE A;  1Q81 Q;  1FZC B;  2E76 C;  1SQB K;  2FBW C;  2OAR A;  3H1H G;  3EWK A;  2QA4 P;  1DEE G;  3C1L A;  3NMD A;  3SWK A;  3TNU A;  1ZR4 A;  4B86 A;  2HPC B;  1CZQ A;  1L4A D;  3L73 D;  1DEB A;  1VQ4 P;  2OTJ P;  3ABV C;  4U3F J;  1URQ A;  1OXZ A;  3BRT B;  2H7H A;  1BCC G;  3CMA P;  1PIX A;  2BCC D;  1HGZ A;  1Z56 A;  1NU1 G;  1PP9 E;  1Q2N A;  1XTC C;  1G1J A;  1BGY D;  1VPC A;  2E75 D;  2N9B A;  3GF7 A;  1ZV8 A;  3NXS A;  1KIL A;  2K9J A;  1HVV A;  2WSC H;  3CXH H;  1DD3 A;  4C7N B;  1Y9B A;  1E79 H;  4KJM A;  1KV4 A;  2WPR A;  1FBM A;  1LTJ A;  1EDJ A;  1RE4 C;  4I7Z C;  1GU5 A;  1FAV A;  1S3J A;  3FXE A;  3HUS B;  1KIL E;  2AXT H;  3JSV C;  4DT0 A;  2YO2 A;  3CME P;  2H8P D;  3TSI A;  1L4A B;  1ZRT E;  1E5W A;  1SQX D;  2B87 A;  3H32 A;  4LLH A;  4IOI H;  1U57 A;  3OJA B;  4LC1 A;  3M06 A;  3RK2 D;  3V2N A;  5B66 H;  1KN7 A;  4HYT B;  2SPZ A;  1FZB A;  1JOC A;  1IFJ A;  2QJK C;  3P8M C;  1Q82 Q;  1EC5 A;  3H1L D;  2KUB A;  1R8E A;  1LWU B;  1JTH B;  2A06 G;  1J1E B;  4JBZ A;  4WB4 A;  2ZYG A;  1EDK A;  3O6Q B;  4WVZ A;  1S9K E;  1URQ C;  2KOG A;  3H1H E;  3CXH I;  3JCU H;  3L75 G;  1MKM A;  5GTH E;  1SQP G;  5GTI H;  1NO4 A;  1VDF A;  1SQB G;  3RL0 D;  3VMZ A;  1QL2 A;  5B5E E;  5CBN A;  1SQQ E;  4IL6 X;  4D6T D;  3CCR P;  1KFN A;  2LXB A;  3CI9 A;  4IFD K;  1VQN P;  1XTG B;  3CCJ P;  1NU1 E;  3L75 J;  3MTU E;  1QGK B;  2WPS A;  2ZXE B;  5KKZ B;  2FY8 A;  1BDD A;  1M8O B;  1RE4 A;  2WVR A;  1OX3 A;  1SQQ D;  3H1L E;  2N1T B;  4U7J A;  4OWF A;  1JY2 N;  1Q86 Q;  2E42 A;  2A45 G;  2KSJ A;  1RQV A;  4TLF A;  1Y8A A;  3SFD C;  2OYI B;  4ZNC A;  5TIS H;  2IDB A;  4H0L B;  3VN0 A;  3H1J G;  1S9K D;  1KIL C;  1KD1 Q;  1M7L A;  4H0L D;  1FE6 A;  1R5S A;  2PGD A;  4Y99 C;  5CJ4 A;  3CCM P;  1W2B O;  1YYC A;  2GUS A;  2KNC B;  3ZDM A;  5E79 E;  1SVF A;  3L70 D;  3PHL A;  5APX A;  3CWB D;  5TIS E;  2KIK A;  4BWN A;  2D2C B;  2OQQ A;  3CXH D;  5GTI E;  1L0L K;  1JM0 A;  1N86 A;  2IBZ I;  1OW6 A;  1LT9 A;  1FZA A;  1AVY A;  1NHL A;  2R5D A;  2YIU B;  1IFP A;  3AEB C;  2BAS A;  3L35 A;  2W27 A;  3EFG A;  2N1T D;  2C0X A;  1LP1 B;  1PGP A;  3A0B H;  1KQF B;  2M3E A;  1BE3 D;  2OYO A;  4N3Y B;  1NU1 J;  3L75 E;  1LJ2 A;  1FJP A;  1KB9 H;  1K04 A;  2B9B A;  2N1T C;  3AEA C;  3M9B A;  5AVW B;  2E74 B;  1AA0 A;  1LTS C;  3BCC E;  3H1L J;  1VQP P;  4L73 A;  1NGM B;  4Z1M H;  3PH0 A;  4PV1 D;  3AEG C;  3Q1M A;  1H8A A;  5AVU B;  2DW3 A;  1L0L J;  5KLV D;  2MJZ A;  4ZKU A;  3BAS A;  1PP9 D;  4L75 A;  1LP1 A;  1M56 D;  1T3U A;  1UII A;  1NYH A;  2YMK A;  3WMM 0;  3HRN A;  3HTK A;  3NTN A;  2GA1 A;  4PD4 D;  2IBZ E;  4RKU J;  5KLV G;  1AJY A;  1JMM A;  3G3Z A;  1HWT C;  3E7K A;  4AYC A;  4H44 B;  1SQB J;  1FU1 A;  3S1K A;  1RF0 C;  2WMM A;  1EZV E;  1KIL D;  1RHZ B;  4HJG H;  4UB6 E;  5L8R J;  2JR8 A;  2H89 C;  4PJ0 E;  3SFE C;  4BRY B;  3W68 A;  1YJW P;  4KT0 J;  1MFT A;  4WY4 A;  1YBK A;  3H1J E;  3AEC C;  2OYI C;  2V7Q H;  1DD4 A;  3IN6 A;  3AE2 C;  2Z5H A;  2I8D A;  1NTM G;  1P84 E;  2LKM A;  1NTK K;  4ASV A;  2YKO A;  3Q5R A;  1EDI A;  5AW7 B;  1OIP A;  2XDJ A;  3HD7 A;  3M9H A;  2OYI A;  1OVV A;  5AVX B;  1VQ9 P;  2IPP A;  1KB9 I;  2XKM A;  1X9V A;  2BCC E;  2HOD A;  3CCV P;  1Q7Y Q;  4ZMD A;  4WBA A;  1IFD A;  3C8V A;  1KC8 Q;  2WSC J;  3GW6 A;  3CXH E;  3V6I A;  1PP9 G;  1IZN B;  3CD6 P;  1EQ7 A;  3L71 D;  3T97 B;  3HE5 A;  3WUU A;  1JEK A;  2KS1 B;  4H44 C;  4D6T E;  1N73 A;  3VMX A;  2FYU E;  2OYH C;  3H1I J;  4A7P A;  3AE5 C;  3HE4 B;  2IFM A;  3AE1 C;  3L37 A;  4JQ0 D;  1N7S B;  4GDO A;  5M1B A;  3L72 E;  2YNY A;  2IBZ D;  3L74 D;  4AQR D;  1GD2 E;  5APY A;  2ZFC A;  4GOF A;  5CJ0 A;  2M5A B;  2OYH A;  3IFM A;  3MIW A;  3RK2 C;  2AXC A;  2YXQ B;  1L0N G;  5KLV E;  1LWU A;  3L70 G;  3QH9 A;  4XA4 A;  2I1J A;  3R4Y A;  2D2C C;  4U3F G;  1YTZ T;  2D2C D;  3L70 J;  1NU1 K;  1KMI Z;  2ZT9 D;  2WQY C;  3B5N B;  3VMA A;  2FYN C;  1KOR A;  1SQV D;  2WT7 B;  1SQX E;  3L75 D;  1YJ9 P;  2BCC J;  2O01 N;  2L5G B;  3E1R A;  3JC2 2;  2R32 A;  2V7Q J;  4NPD A;  3HD7 B;  1IK7 A;  3KZI E;  4GOD A;  2Q5U A;  1VQ7 P;  2QG4 A;  3HUS A;  4HH2 A;  3R2P A;  1JNM A;  3KXD A;  1PGJ A;  1CSB A;  1TU3 F;  1R5L A;  3VOP A;  3CC7 P;  4K3A A;  1VQM P;  2OYH B;  1CW5 A;  3FGA D;  5AVT B;  1MV8 A;  3TYY A;  3TDK A;  4BRY A;  2FXM A;  2ZVN B;  1KQG B;  3HE4 A;  4RJT A;  1KIL B;  3CCS P;  2Z4E A;  1VQL P;  4YTP C;  2WZ7 A;  1GL2 D;  3GF3 A;  4JYB A;  4LGD E;  3OW2 O;  3AE8 C;  2OTK E;  2FFD C;  2RN0 A;  3HE5 B;  5C39 A;  4GKG A;  1YTZ I;  2HYN A;  3V2R A;  3U1C A;  2O01 J;  3VMY A;  4H13 C;  1NTZ K;  2QIW A;  2C0W A;  2LXC B;  1A02 F;  3G4S P;  2A06 D;  1JMB A;  1S1C X;  1T8Z A;  1ZLL A;  2QJP C;  2QM8 A;  3B5N C;  5AVR B;  3CX5 E;  1FJK A;  1GZL A;  2HOD B;  1IFN A;  3GHG B;  2JWA A;  4WY4 B;  4DZO A;  1SFC D;  1N7S D;  2NPS D;  3PTZ A;  3CLQ A;  3A7O A;  3CWB E;  3MGN A;  1SQV G;  2HLO A;  2R3C A;  2CK3 H;  3MHV A;  3NFQ A;  5KJ7 A;  5AW1 B;  1FDI A;  2E75 B;  2Q1K A;  3CX5 D;  2G8Y A;  4U3F E;  3A0H H;  1PGQ A;  2PRR A;  2QE7 H;  3L74 J;  3TF5 A;  2BEZ F;  1AQT A;  2KI7 B;  2ZYD A;  2IYP A;  3IF4 A;  3L73 E;  2GM4 A;  1K73 Q;  1VF5 C;  1FS0 E;  1LWU C;  2Y0C A;  1G1I A;  3F89 A;  2KP8 A;  2N9Y B;  1ZP0 C;  3S9O A;  3I55 P;  1T2K D;  1GTW A;  2E43 A;  2YIU C;  3M0D A;  4OGQ C;  3TGU E;  1SS1 A;  4I2L C;  4L76 A;  1LNQ A;  5TJH A;  3D6Z A;  1KYO H;  1FDM A;  4K35 A;  2Y0E A;  1KB9 D;  3L4F A;  2Y9Z A;  2AXT E;  1W5C E;  3M0D C;  3EFF K;  3BCC G;  2K9Y A;  3OAK A;  1N8R Q;  5AVV B;  2FFD A;  5CCH A;  1T2K C;  1LTA C;  3GHG A;  4WWI A;  4PD4 E;  2YKP A;  1QX8 A;  3AE9 C;  1PPJ G;  2A45 H;  3I5C A;  4H13 D;  1ZME C;  3A5T A;  4UB6 H;  2A45 I;  3RK3 D;  3ITK A;  3LW5 H;  1LTT C;  3O8Z A;  1GK4 A;  1KQL A;  1PFI A;  3CCL P;  3CWB J;  2G3A A;  3CC2 P;  2Q6Q A;  3LW5 J;  2WSS H;  4NPE A;  1GL2 C;  4XFJ A;  5DJU B;  1JCC A;  1PPJ D;  2ITA A;  5CBO A;  2Q9I A;  1CI6 A;  2IZ0 A;  3H1J J;  3N4X A;  2P10 A;  5KJ7 C;  5AW9 B;  4Y99 B;  3SWF A;  1RF1 C;  4GOE A;  1S4X A;  3H6P A;  3M0A A;  1MUU A;  1RY3 A;  1NTZ E;  2FXP A;  2ZYA A;  4N6J A;  3B5N A;  5E79 H;  2WT7 A;  2AEJ A;  4EDF A;  1JUN A;  5BU8 B;  1AVO A;  1ZRT D;  2RKL A;  1KYO I;  2XND H;  3MUD C;  1OMI A;  3GLM A;  2M3B A;  2IZ1 A;  1JY3 O;  1SQQ K;  2BCC G;  5CCG D;  5KAF H;  1JY2 O;  1EXJ A;  2VRS A;  3L71 E;  1WT6 A;  2W90 A;  5B66 E;  2ZT9 C;  1LTB C;  1GMJ A;  1L4A A;  1IO4 A;  1NOH A;  2E74 D;  4D6T J;  1NTK E;  2FYU J;  1RQU A;  5AW3 B;  1G2C B;  2KZI A;  4OGQ B;  1KQS O;  2H88 C;  4C46 A;  1N73 B; 
#chains in the Genus database with same CATH homology
 3L36 A;  3P32 A;  2XNX A;  3T97 A;  4JF7 A;  2HG5 D;  1G2C A;  2KB7 P;  3P8C D;  1GDT A;  3HUS C;  4C7N A;  1NKN A;  1NKZ B;  5BVZ A;  3HD7 C;  1ZN5 A;  3H32 B;  4O9B A;  1SQP K;  2P1J A;  2HPC A;  1NAF A;  3PP5 A;  2CPS A;  1LTI C;  3VYI A;  2H43 A;  3II6 A;  1N7S A;  3V4W A;  5KLV K;  1FZC A;  2FYU K;  2W6B A;  1CI6 B;  3UIA A;  3LID A;  1IFM A;  1FZC C;  2JJL A;  2O1J A;  4DOJ A;  2WTY A;  1J1D B;  1A02 J;  4GT1 A;  1JY2 P;  5APV A;  2YO3 A;  2FFD B;  5APS A;  3BRV B;  2Q3I A;  3RK3 C;  4JYC A;  5AVQ B;  1X8Y A;  1HUC A;  3VP9 A;  1RF1 B;  1H88 A;  1NWQ A;  1LT9 B;  3TNU B;  1J1E C;  1LGH B;  4IFF A;  1W2E A;  2O1K A;  4EIJ A;  2XU6 A;  1LTG C;  1RE3 A;  1OWA A;  2M8R A;  3TK1 A;  1MZ9 A;  5KTB A;  3VTP C;  1QL1 A;  1N73 C;  2N1T A;  1SLQ A;  1GW4 A;  4IFM A;  5AVS B;  1M1J A;  1N7S C;  1SFC C;  2NPS C;  1LT9 C;  3B8E B;  5APT A;  1SQX K;  3V2Q A;  4N78 D;  2R5B A;  3MUD A;  3P8C E;  1M1J B;  1AFO A;  5AVY B;  2KLV A;  2J58 A;  2WSF H;  4M3L A;  4OH8 B;  4AUW A;  2FYZ A;  3P7K A;  1FZF A;  1IJD B;  3M9Q A;  1RF0 A;  1FZG A;  1JTH A;  2O01 H;  3KQG A;  1J1D C;  3KPE A;  2I1K A;  1J2J B;  4XE5 B;  3VP8 A;  2Q7C A;  1LTJ B;  1RE3 C;  5APQ A;  5BU5 A;  1JY3 P;  1GU4 A;  1GL2 B;  1HJB A;  1DH3 A;  2XZR A;  3SWY A;  2YMY A;  2W6A A;  4GIF A;  1GK6 A;  3MD0 A;  3OA7 A;  3U59 A;  2WIT A;  1M1J C;  4RES B;  5APU A;  2PP6 A;  2PAJ A;  1X79 B;  1JY3 N;  4N78 E;  1L4A C;  2P67 A;  3EQ2 A;  4KHX A;  5AW5 B;  3HD7 D;  3A2A A;  3N7N A;  3BVH A;  5AW4 B;  2CPB A;  3GHG C;  5AW8 B;  2J59 M;  2GUV A;  3HTK B;  2Z5I A;  4W7Z A;  1DX7 A;  3IR9 A;  1N7L A;  1URQ B;  2POH A;  5CCG A;  1GL2 A;  3V5B A;  4EOT A;  4I1L A;  1ZR2 A;  1IC2 A;  5CCH D;  2JEE A;  5CCG C;  2XV5 A;  1HGV A;  5AVZ B;  2P2U A;  2C9L Y;  3V2P A;  4I6M C;  3RL0 B;  1H89 A;  3BAT A;  4WY4 D;  2YKQ A;  1SFC A;  2NPS A;  4W7Y A;  2P7J A;  5KJ7 D;  3RK2 B;  4ZKU A;  2HFE D;  3A3Y B;  1NH4 A;  3KDP B;  1GU5 A;  4C7R A;  1N2D C;  2WPQ A;  3KYQ A;  1FOS F;  1NTM K;  4ZKP A;  2IFN A;  1KFM A;  2FKW B;  3M91 A;  2C9N Y;  4W80 A;  3CL3 D;  2QM7 A;  1IFI A;  1FOS E;  1WRG A;  1HTL C;  1JCD A;  2KYV A;  4WY4 C;  1SFC B;  2NPS B;  1T3J A;  5AW2 B;  2WSE H;  5CHX A;  1SQV K;  1HH0 A;  3RK3 B;  2WWW A;  1KZU B;  1MFZ A;  5CCH C;  1AQ5 A;  5AW0 B;  1JO5 A;  1LTJ C;  3RL0 C;  3E1I A;  5APW A;  3U1A A;  1URQ D;  2IX7 C;  5CMZ A;  3LIE A;  1L0N K;  1SP4 A;  3B5N D;  1RF1 A;  3C9I A;  1GW3 A;  1HBW A;  1IK9 A;  1FZE A;  1FZC B;  1SQB K;  2OAR A;  3NMD A;  1ZR4 A;  3TNU A;  4B86 A;  2HPC B;  1CZQ A;  1L4A D;  1DEB A;  1URQ A;  1OXZ A;  3BRT B;  2H7H A;  1HGZ A;  1Z56 A;  1XTC C;  1G1J A;  1VPC A;  2N9B A;  1ZV8 A;  3NXS A;  1KIL A;  1HVV A;  2WSC H;  4C7N B;  2WPR A;  1FBM A;  1LTJ A;  1RE4 C;  1FAV A;  3HUS B;  2YO2 A;  2H8P D;  3TSI A;  1L4A B;  1E5W A;  3H32 A;  4LLH A;  4LC1 A;  3OJA B;  3RK2 D;  3M06 A;  3V2N A;  4HYT B;  1FZB A;  1JOC A;  1IFJ A;  3P8M C;  1LWU B;  1JTH B;  1J1E B;  4WB4 A;  1S9K E;  1URQ C;  2KOG A;  1NO4 A;  1VDF A;  3RL0 D;  3VMZ A;  1QL2 A;  1KFN A;  3CI9 A;  1XTG B;  3MTU E;  2WPS A;  2ZXE B;  1RE4 A;  2N1T B;  1JY2 N;  2E42 A;  2A45 G;  2KSJ A;  2OYI B;  1S9K D;  3VN0 A;  1KIL C;  1M7L A;  4Y99 C;  5CJ4 A;  1YYC A;  2GUS A;  1SVF A;  5APX A;  1L0L K;  1N86 A;  1LT9 A;  1FZA A;  1NHL A;  2R5D A;  3L35 A;  2BAS A;  2W27 A;  3EFG A;  2N1T D;  2C0X A;  4N3Y B;  1FJP A;  5AVW B;  2N1T C;  3M9B A;  1LTS C;  1H8A A;  5AVU B;  2MJZ A;  3BAS A;  1T3U A;  3WMM 0;  3HRN A;  3HTK A;  3NTN A;  1JMM A;  3G3Z A;  1HWT C;  4AYC A;  1FU1 A;  1RF0 C;  1KIL D;  4WY4 A;  2OYI C;  2Z5H A;  2LKM A;  1NTK K;  2YKO A;  5AW7 B;  2XDJ A;  3HD7 A;  3M9H A;  2OYI A;  5AVX B;  2IPP A;  2XKM A;  1X9V A;  2HOD A;  4WBA A;  1IFD A;  1EQ7 A;  3HE5 A;  1N73 A;  3VMX A;  2OYH C;  3HE4 B;  2IFM A;  3L37 A;  1GD2 E;  1N7S B;  4IFD K;  2YNY A;  4AQR D;  5APY A;  2ZFC A;  5CJ0 A;  2OYH A;  3IFM A;  3MIW A;  3RK2 C;  1LWU A;  4XA4 A;  2I1J A;  1YTZ T;  1NU1 K;  3B5N B;  2WT7 B;  2L5G B;  2R32 A;  3HD7 B;  2Q5U A;  3HUS A;  4HH2 A;  3R2P A;  1JNM A;  1CSB A;  3VOP A;  2OYH B;  1CW5 A;  5AVT B;  1MV8 A;  3TYY A;  2FXM A;  3HE4 A;  2Z4E A;  1KIL B;  2WZ7 A;  1GL2 D;  4JYB A;  4LGD E;  2FFD C;  3HE5 B;  4GKG A;  1YTZ I;  2HYN A;  3V2R A;  3U1C A;  3VMY A;  1NTZ K;  1A02 F;  2C0W A;  1T8Z A;  1ZLL A;  3B5N C;  5AVR B;  3V4Q A;  2QM8 A;  1T2K D;  1FJK A;  1GZL A;  2HOD B;  1IFN A;  3GHG B;  4WY4 B;  4DZO A;  1SFC D;  1N7S D;  2NPS D;  3CLQ A;  3A7O A;  3MGN A;  2HLO A;  2R3C A;  3NFQ A;  5KJ7 A;  5AW1 B;  2GM4 A;  1LWU C;  1G1I A;  1GTW A;  2KP8 A;  2E43 A;  3M0D A;  4I2L C;  1FDM A;  3L4F A;  3OAK A;  3M0D C;  5AVV B;  2FFD A;  5CCH A;  1T2K C;  1LTA C;  3GHG A;  2YKP A;  3I5C A;  2A45 H;  3A5T A;  2A45 I;  3RK3 D;  3LW5 H;  1LTT C;  3O8Z A;  1GK4 A;  1KQL A;  1PFI A;  5AW6 B;  1GL2 C;  1JCC A;  2Q9I A;  1CI6 A;  3N4X A;  5KJ7 C;  5AW9 B;  4Y99 B;  3SWF A;  1RF1 C;  3H6P A;  3M0A A;  1MUU A;  1RY3 A;  4N6J A;  2WT7 A;  3B5N A;  1JUN A;  5BU8 B;  2M3B A;  1JY3 O;  1SQQ K;  5CCG D;  1JY2 O;  2VRS A;  1WT6 A;  1LTB C;  1L4A A;  1IO4 A;  1NOH A;  5AW3 B;  1G2C B;  4C46 A;  1N73 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...