1L0LG

Structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 20
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1l0lG00
3H1HG 1SQXG 5KLVG 4PD4H 2BCCG 1NTKG 1L0LG 1SQQG 3CWBG 2FYUG 1SQVG 3L74G 3TGUG 1BE3G 3L72G 4D6TG 1P84H 3H1KG 3L75G 1SQBG 1PPJG 3CXHH 1KB9H 1KYOH 1NU1G 4U3FG 3BCCG 1EZVG 3H1IG 3H1JG 1L0NG 2IBZG 3H1LG 3L70G 1PP9G 3L71G 1NTZG 1NTMG 1SQPG 1BCCG 1BGYG 3L73G 3CX5H 2A06G
chains in the Genus database with same CATH superfamily
1NH4A 1VF5C 3EQ2A 1U7MA 1M56D 5DJTB 1S2EA 5KLIC 3AEEC 4D6TD 3EFFK 2FYUG 3S1KA 1AJYA 2GUVA 3L74E 1U7JA 1NVOA 4GT1A 3CC2P 1BDDA 1NTME 4H44B 4N78D 5E79E 5APSA 4GKGA 1ZP0C 1DEBA 3FX0A 2Q9IA 1BE3G 3L4FA 1NTZK 1DD4A 1JM0A 2H89C 4IFFA 3PHLA 1L4AC 2WSEH 5BU5A 2WQYC 2LXCB 3PTZA 3KQGA 4WY4B 5K5GB 4DJGA 2C9NY 2BCCJ 2K3RA 3H32B 1AFOA 1G2CA 1S1CX 1NU1K 1X79B 2ZXXA 5AVSB 3H1IG 3USSA 1LTIC 5KAFH 1FDOA 3L70G 3A7OA 2CK3H 2BCCD 5DJUB 1VQ6P 3TYYA 1NTZG 4IL6X 1SQPG 4C7NA 2G8YA 1SFCC 1Q81Q 2IZ0A 1VQ7P 1OW8A 1FAVA 3H1LJ 1KTMA 3MUDC 2Q6QA 1GW3A 2WPSA 1SQXK 3BCCJ 5AW2B 2ZVNB 1S4XA 1NTKJ 1H88A 4U3FE 3L72D 2GM4A 1R5SA 1KILC 1YJ9P 1FZFA 1SQXE 1N7SA 5KKZB 1E5WA 3AE5C 1VQMP 3HD7C 3RK2B 1E79H 3A0HE 3L72G 1H0TA 1FOSE 2VRSA 3OA7A 3HD7D 5GTIH 1OW6A 3D6YA 2ZYDA 2E76D 1LT9A 1URQB 2W8ZA 4AYCA 5KAIH 1YITP 2E75B 1GZLA 1TU3F 3B8EB 4NPEA 3AEFC 3RK3B 2YNYA 3GW6A 1XTGB 2WTYA 3H1HD 1ZRTD 5AW8B 1M57D 1LTSC 1OVVA 2FY8A 2P67A 4K35A 5AVVB 3VMAA 2NPSC 1NOHA 3ZDMA 4U7JA 4DT0A 2JO1A 2AXTH 3L73G 5AW0B 1LP1B 2D2CB 2E74B 3CX5H 2Q5UA 1ZMEC 3LIEA 3RBZA 1HJBA 1VQKP 4H13C 1L0ND 4DCKA 1SQPD 2QA4P 1NTZD 1NU1J 2XV5A 3V2RA 1VF5B 5KKZC 1LNQA 1YTZT 3L74G 3CL3D 3L70E 4O9BA 3MGNA 5AVWB 1NTMJ 1FZAA 1RE4A 1NU1D 1AA0A 5B66H 3CCMP 3KYQA 3L71J 5KLVD 4D6TG 2V7QH 1KC8Q 3P8CE 1LWUC 1M1JA 4W7ZA 3GHGC 2KK7A 1VQ4P 1N73B 1KYOI 3H1KE 3NTNA 5BVZA 2P2UA 3JC22 1URQD 3AE4C 3VMXA 1CI6A 1HVVA 1ZR4A 4RJTA 3H1JG 3OW2O 2A06D 2ZAEB 3AE1C 1PP9G 4PD4E 1JY2P 2QRXA 1SFCA 5GTHH 2K37A 3TGUJ 1N7SC 2WPRA 1VQPP 3L71E 1VDFA 1YYCA 5KAIE 2OYHA 3BCCD 1VQLP 3L75E 3AE3C 3Q2YA 1JB0J 5KLVG 1IFMA 1X0TA 3ABVC 4GIFA 3GHGA 2OYIB 3ITKA 1RE3A 2JP3A 3TNUB 1SQBD 3AE7C 2M8RA 5CCGD 5CMZA 1XTCC 1VQOP 1JOCA 1JCCA 1P84I 5AW5B 3JCUH 1S9KE 4GOFA 4LLHA 2E5TA 4OVNF 5KAFE 3TSIA 4ASVA 2WSEJ 2KSEA 3B5NB 3HE4B 4LC1A 5AVUB 1GMJA 1N86A 2M5AA 3FGAD 3H6PA 3WMM0 1JY2O 1SQQJ 1W2BO 2E76C 2C9LY 2Q1KA 2JWDA 3MD0A 3P32A 4L76A 4L73A 1JCDA 3SWKA 2N1TD 3E1IA 2N1TA 3GF7A 3SFEC 3SWYA 2ZT9C 1YHQP 3IR9A 3CMEP 4UB6E 2OTKE 1GDTA 3KPEA 1W2EA 1KB9E 1RF1B 1HGZA 3CCUP 2KNCA 2UWJE 1FE6A 3OAKA 3H1LD 3A0HH 5CCHA 3CMAP 1Y8AA 2E5YA 2XZRA 2ZYAA 3CCVP 1LWUA 3Q5SA 1KB9I 2QJKB 3NMDA 2QSIA 1SQVG 2J5UA 1CI6B 2QJYB 3L37A 3M9QA 4EI2A 5TISH 5CHXA 3HUSA 1FC2C 1KILE 5AVTB 5M1BA 1PP9J 1U57A 4BXLA 2IFNA 5H2FE 2IX7C 1JEKA 5CBOA 1QEXA 3RGUA 1EXJA 2KZJA 2XKMA 4PJ0E 1PZQA 1X22A 3CX5E 2OQQA 4N6JA 4W80A 3A5TA 3Q3DA 2OYIC 3E1RA 3P8MC 3HD7B 5AVQB 1YJWP 1N8RQ 1OVRA 1M1JC 1L0LE 1QGKB 4PV1D 1EZVE 1GK6A 3L73E 3LW5H 5B5EH 1HF9A 3GF3A 1IK9A 4D6TJ 2BEZF 1OVUA 2N9YB 4RO0A 3HE4A 5EFWB 4WBAA 3CCRP 2OYIA 2E43A 1LGHB 2ZT9D 1RY3A 2P7JA 2N1TC 4CPGA 3CWBJ 3CXHD 2E75C 2WPQA 3KXDA 1VF5D 3LIDA 3T97A 1BE3D 2WZ7A 2Z4EA 2BEQD 1UIIA 3KZIH 3CC7P 2H43A 2OARA 2MJZA 4HB1A 1FOSF 3TGUG 4XE5B 1J1DC 1JO5A 1FZCB 4A7PA 2KXPB 4OGQC 2Z5HA 1PPJG 2I1KA 3CXHH 1SFCB 4GOEA 4IL6E 1UIXA 1AQTA 2ZFCA 3CWBE 1VL2A 3AEAC 3S9OA 3U59A 5KLVK 2WT7B 1LTJC 2ITAA 3G4SP 2IYOA 2E76B 2R3CA 2JDIH 4JYCA 1SQQE 1L4AA 2FYUE 1MZ9A 2G3AA 4R4MA 4XFJA 1H89A 3RK2D 4H0LD 2A06G 3BRTB 4C7NB 1BGYE 4B86A 1USDA 3BVHA 2FBWC 1PL5A 1VQ8P 1KYOD 1NTKE 1YJNP 1NTKG 3AE6C 1SP4A 1T6AA 1URQC 3BATA 3MHVA 1PPJD 4H44C 3D71A 1ZR2A 2XNDH 1VQNP 2QEXP 2M3BA 2LXBA 3VTPC 1IFDA 1NTZJ 4ZMDA 1FZBA 3C9IA 4EYYQ 3TGUE 1K04A 3O6QA 2YIUB 5APUA 3HRNA 3Q5PA 1AVOA 1LTJB 1KYOH 5E79H 1HGVA 5KLVJ 2PFXA 1IK7A 1LJ2A 4UB8H 1LTTC 3UIAA 2R5DA 3EWKA 2I1JA 2IBZE 2H8PD 2R32A 1HTLC 4H13D 4W7YA 3M9HA 4WY4D 3WUTA 1AV1A 2KP8A 1MUUA 1YIJP 4D6TE 3M0AA 1IFNA 2P1JA 4OGQB 3BRVB 1IC2A 1KQGB 1KILB 5APQA 3H1JD 1NTMD 1G1JA 2FYZA 2HG5D 2YMYA 4M3LA 2A45H 4N78E 2C0XA 3TK1A 5KJ7C 4XA4A 4KJMA 1PV3A 2WSFJ 3NFQA 1GL2A 4TT3H 5AW1B 5H2FH 2OYHC 1SQBK 2P10A 2IYPA 1SQPJ 2NPSD 2R3SA 2RH0A 2Y0DA 1NJIQ 3O8ZA 1QLED 1YBKA 1PGOA 3AEGC 1JY3N 1OWAA 4NPDA 3V4QA 3WU2H 1NKNA 1SQVD 1WT6A 2KYVA 2LR2A 2YIUC 2K9JA 3HE5B 3L70J 2Y9ZA 2L5GB 1J1EC 1MFZA 3VP9A 3SWFA 1G1IA 4KT0J 4ASWA 1IFIA 2OYOA 4Z1MH 4ZNCA 5BU8B 1M90Q 1RQVA 5CBNA 4RESB 3H32A 1NGMB 4NPFX 1KQLA 1YQ4C 1BE3J 2HLOA 2QJPB 4WY4A 3L72E 2AEFA 1QX8A 4BRYA 2W27A 3IF4A 3G71P 1USEA 1QL2A 1T2KC 4Y99B 3VP8A 2H7HA 4JPZB 3CC4P 2B87B 2BASA 1SQXG 3A0BE 3IFMA 1EXIA 1AVYA 5CJ0A 2HODA 1PFIA 1CZQA 2IPPA 1NYHA 5CJ4A 1L4AD 1RF0C 1Q2NA 4K3AA 3U1CA 3HD7A 1M7LA 2J58A 2CPBA 3PH0A 1FU1A 2GA1A 3AE2C 1L2PA 3RL0B 4YXDC 5C39A 1SQBG 2QVAA 1QL1A 3H1HE 2RN0A 1R5LA 2WPVB 2NRGA 5AW9B 5KTBA 5AVRB 2Q7CA 4U3FG 2FFDC 1FZEA 2OTLP 3BCCG 2Y0EA 1NHLA 1IZNB 1OZHA 2PRRA 2RKLA 1P84E 3F5HA 3H1LG 1JY2N 2IBZG 3HUSB 4HH2A 5CCHC 3CCLP 1S5LX 1EC5A 3RK3E 4C46A 1NTZE 2NPSB 1HUCA 2KLVA 1PP9D 1S3JA 5APYA 3M91A 4Y99C 2WT7A 1DIPA 1EDKA 4H44D 1QVGO 1M8OB 1BCCE 1PGQA 1FDIA 1SQVJ 3H1JJ 1BSNA 3H1ID 3L70D 1VPCA 4PD4I 3W68A 1FJKA 4I1LA 3RL0g 4BWNA 1JTHA 2R44A 3VMYA 3CWBG 5GTHE 1GD2E 2KZIA 5KJ7D 2AEJA 1ZXGA 2DW3A 3EFGA 3L35A 1EDIA 3PRJA 1Q90D 3GMAA 2A45G 3G9RA 3H1KD 3MUDA 4UB8E 5TJHA 4YXWH 1RF0A 4PV1B 2JR8A 4DOJA 3L74D 2KLUA 1GL2C 1KFMA 1KORA 1N73C 4EDFA 2H88C 3A3YB 3JSVC 5APWA 4PD4D 4YPCA 4EIJA 2FFDB 2O01J 2O01N 1FS0E 2FFDA 2XNXA 3L71D 5APVA 4I6MC 2IZ1A 4TLFA 1K8AQ 3V2PA 3WUUA 1DEEG 2ZVOB 3CD6P 3Q1MA 2P58A 2AEMA 3IAOA 1N2DC 1SQPK 4RKUJ 3CCJP 1MKMA 1SQBE 2W83C 1T8ZA 2HODB 2YKOA 2FXOA 1PIXA 2BCCE 1GW4A 2LKMA 4WB4A 3V2QA 2RMZA 5CCHD 3H25A 1LTGC 1S9KD 2V7QJ 3M0DA 2B87A 3FWLA 1OMIA 2JJLA 2R5BA 2WWWA 5AW6B 1NWQA 3M06A 1S5LE 2SPZA 2HPCB 1BSHA 2QG4A 4U3FD 2Y9YA 1A02J 1CW5A 4IOIH 1CSBA 1RE4C 1SQXD 3MP7B 4JYBA 4QMAA 5B5EE 2HPCA 3B5NC 2B89A 2M3EA 1J2JB 1LT9C 2YO3A 3II6A 3N7NA 2FXMA 3RL0C 1KB9H 2I8DA 3R4YA 1Y47A 2KOGA 2C0WA 2AXCA 1N73A 1H0TB 1NAFA 3KHUA 1KB9D 1SVFA 1EQ7A 2KI7B 2K9JB 3HE5A 2KIKA 2YO2A 3H1HJ 1L0NG 3MZWB 1KQFB 2E42A 3CX5I 4JBZA 3S4RA 1EZVI 3G3ZA 1LTAC 1T2KD 1HH0A 4IFMA 1ZV8A 2M0BA 2O1KA 1JNMA 3D6ZA 1DD3A 1HWTC 1ZRTE 1EDJA 4N3YB 1GL2B 2Y0CA 3L74J 3H1HG 3MTUE 2IFMA 3H1IJ 5TISE 3I5CA 2KB7P 1NAYA 3P7KA 1NTKK 3B71A 3M9BA 3F89A 3W67A 1LP1A 1Q82Q 1KILD 3NXSA 5KJ7A 4IL6H 5GTIE 3PLNA 3V4WA 1L0NE 1SQPE 5AVZB 2W6JH 3L73J 4BRYB 1KN7A 1P84H 3CI9A 1LT9B 1URQA 4HYTB 3CCQP 5CCGC 1H8AA 2J59M 1L0LD 4PV1C 3WUVA 1KD1Q 1NU1E 3AE8C 1SS1A 2AXTE 2PGDA 3QWOC 4MN4C 5KLVE 3P8CD 2JEEA 5B66E 3VN0A 1KFNA 2QE7H 1SFCD 1LT1A 4OWFA 3L71G 3B5ND 3CXHE 1OFCX 1N7SB 3HTKA 3L72J 1NTMG 1RH5B 1BCCG 3E7KA 1S72P 2WSSH 4WY4C 3VOPA 2A06E 2OGUA 1YI2P 2B88A 1K9MQ 5AVYB 3CCSP 3AEDC 3FXEA 4R4LA 3AEBC 2K9YA 1SQQG 1JY3P 1WRGA 2GUSA 2WSCJ 1KILA 2FYNB 1IO4A 3BCCE 1GU5A 4C7RA 1BCCJ 3L75D 3CWBD 3QH9A 3B4SA 1MV8A 3VYIA 1HJ0A 2KSJA 1R8EA 3VMZA 3HTKB 1SQQD 1L0LJ 1A02F 1LWUB 2FYUD 3V6IA 1KMIZ 3V5BA 1LTJA 2KUBA 2WSCH 3CCEP 1OXZA 2O1JA 4H0LC 3TDKA 2KNCB 5AW3B 2W6AA 4I7ZC 1BGYD 2WMMA 1RF1A 2ZXEB 2O01H 2XU6A 3RBXA 2IBZI 1QVFO 1KYOE 1N7LA 2QIWA 1KQSO 4L75A 1S5LH 1PPJE 3IN6A 1HBWA 1SQVK 1Y9BA 2JKVA 3G6EP 1KV4A 2QM8A 1OIPA 1GK4A 3M0DC 3RK3C 1KZUB 1Z56A 4PD4H 1L0LG 1BDCA 1GL2D 3TGUD 2FYNC 4OGQD 2ZT9B 5APXA 2QJYC 4EOTA 2YXRB 1SQBJ 3H1LE 1FJPA 1FBMA 1OW7A 3HUSC 1W5CE 1X8YA 1JUNA 1K05A 1T3JA 3C1LA 1J1EB 1N7SD 2FYUK 4H13B 1L0LK 2V4HA 3L75G 2KS1B 1ZOYC 4UB6H 4GODA 2O3JA 1VQ9P 4Y28J 3CXHI 1NU1G 1RQUA 1Q86Q 1NO4A 2E75D 3GLMA 1SQXJ 3JCUE 1EZVG 3V2NA 1PGPA 2HR3A 4KHXA 5AW4B 1X9VA 4I7ZB 3WU2E 4IFDK 3H1JE 5CCGA 2POHA 1K73Q 3CX5D 1WMKA 1FZCA 3N4XA 4AUWA 4PJ0H 1YTZI 5APTA 5AW7B 4ZKUA 1G2CB 1M1KQ 1L0NK 2ZJSE 1EZVD 3CLQA 3FXDA 3L73D 1SLQA 1T3UA 2L91A 1GU4A 3OJAB 3CPWO 1DH3A 4H0LB 1SQVE 2OYHB 1M1JB 5AVXB 2N9BA 2FKWB 2QJKC 2FXPA 3O6QB 4ZKPA 1J1DB 2W6BA 1EDLA 2QJPC 3K5BA 1JMBA 1BE3E 1MFTA 1NKZB 1SQQK 1RE3C 4HJGH 2N1TB 1GTWA 2YKPA 3KZIE 2QM7A 2HFED 3FWNA 3GG2A 4U3FJ 2PAJA 2WITA 5L8RJ 2M5AB 1IJDB 1PGJA 2IBZD 2Q3EA 2XDJA 3R2PA 4GDOA 3SSUA 2YMKA 3A0BH 1Q7YQ 3H1KJ 1VQ5P 1LTBC 3D70A 2K88A 1RHZB 2WVRA 3BASA 1BGYG 1NTMK 2Z5IA 1L0NJ 1L4AB 2MKVA 4OH8B 3SFDC 3TNUA 3Q5RA 3MIWA 3PJSK 4L74A 3GHGB 1FDMA 3LW5J 4DZOA 1JY3O 5KLIB 2BCCG 1YQ3C 2A45I 3AECC 4YTPC 1ZN5A 3RK2C 2OTJP 2ZYGA 1JTHB 2Q3IA 3AE9C 1AQ5A 2WSFH 1FZGA 1IFPA 1BGYJ 2K1AA 3U1AA 3I55P 2D2CD 2E74D 2YKQA 1NTKD 2PP6A 3H1KG 2B9BA 4WWIA 4AQRD 2IDBA 1P84D 2HYNA 3TF5A 2FYUJ 2NPSA 3A2AA 3I56P 1FZCC 1ZW0A 4LGDE 2KS1A 3KDPB 3RK3D 1DX7A 3T97B 1PP9E 4JQ0D 3PP5A 3RL0D 4I2LC 4HKZH 2CPSA 1BCCD 1JMMA 3B5NA 2D2CC 2E74C 1D7MA 1OX3A 3H1IE 3L75J 4JF7A 2JWAA 2NZ2A 4WVZA 1RF1C 1IFJA 3C8VA 2W90A 1ZLLA 3L36A 2YXQB
chains in the Genus database with same CATH topology
3H1HG 1SQXG 5KLVG 4PD4H 2BCCG 1NTKG 1L0LG 1SQQG 3CWBG 2FYUG 1SQVG 3L74G 3TGUG 1BE3G 3L72G 4D6TG 1P84H 3H1KG 3L75G 1SQBG 1PPJG 3CXHH 1KB9H 1KYOH 1NU1G 4U3FG 3BCCG 1EZVG 3H1IG 3H1JG 1L0NG 2IBZG 3H1LG 3L70G 1PP9G 3L71G 1NTZG 1NTMG 1SQPG 1BCCG 1BGYG 3L73G 3CX5H 2A06G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1H G;  1SQX G;  5KLV G;  4PD4 H;  2BCC G;  1NTK G;  1L0L G;  1SQQ G;  3CWB G;  2FYU G;  1SQV G;  3L74 G;  3TGU G;  1BE3 G;  3L72 G;  4D6T G;  1P84 H;  3H1K G;  3L75 G;  1SQB G;  1PPJ G;  3CXH H;  1KB9 H;  1KYO H;  1NU1 G;  4U3F G;  3BCC G;  1EZV G;  3H1I G;  3H1J G;  1L0N G;  2IBZ G;  3H1L G;  3L70 G;  1PP9 G;  3L71 G;  1NTZ G;  1NTM G;  1SQP G;  1BCC G;  1BGY G;  3L73 G;  3CX5 H;  2A06 G; 
#chains in the Genus database with same CATH topology
 1NH4 A;  1VF5 C;  3EQ2 A;  1U7M A;  1M56 D;  5DJT B;  1S2E A;  5KLI C;  3AEE C;  4D6T D;  3EFF K;  2FYU G;  3S1K A;  1AJY A;  2GUV A;  3L74 E;  1U7J A;  1NVO A;  4GT1 A;  3CC2 P;  1BDD A;  1NTM E;  4H44 B;  4N78 D;  5E79 E;  5APS A;  4GKG A;  1ZP0 C;  1DEB A;  3FX0 A;  2Q9I A;  1BE3 G;  3L4F A;  1NTZ K;  1DD4 A;  1JM0 A;  2H89 C;  4IFF A;  3PHL A;  1L4A C;  2WSE H;  5BU5 A;  2WQY C;  2LXC B;  3PTZ A;  3KQG A;  4WY4 B;  5K5G B;  4DJG A;  2C9N Y;  2BCC J;  2K3R A;  3H32 B;  1AFO A;  1G2C A;  1S1C X;  1NU1 K;  1X79 B;  2ZXX A;  5AVS B;  3H1I G;  3USS A;  1LTI C;  5KAF H;  1FDO A;  3L70 G;  3A7O A;  2CK3 H;  2BCC D;  5DJU B;  1VQ6 P;  3TYY A;  1NTZ G;  4IL6 X;  1SQP G;  4C7N A;  2G8Y A;  1SFC C;  1Q81 Q;  2IZ0 A;  1VQ7 P;  1OW8 A;  1FAV A;  3H1L J;  1KTM A;  3MUD C;  2Q6Q A;  1GW3 A;  2WPS A;  1SQX K;  3BCC J;  5AW2 B;  2ZVN B;  1S4X A;  1NTK J;  1H88 A;  4U3F E;  3L72 D;  2GM4 A;  1R5S A;  1KIL C;  1YJ9 P;  1FZF A;  1SQX E;  1N7S A;  5KKZ B;  1E5W A;  3AE5 C;  1VQM P;  3HD7 C;  3RK2 B;  1E79 H;  3A0H E;  3L72 G;  1H0T A;  1FOS E;  2VRS A;  3OA7 A;  3HD7 D;  5GTI H;  1OW6 A;  3D6Y A;  2ZYD A;  2E76 D;  1LT9 A;  1URQ B;  2W8Z A;  4AYC A;  5KAI H;  1YIT P;  2E75 B;  1GZL A;  1TU3 F;  3B8E B;  4NPE A;  3AEF C;  3RK3 B;  2YNY A;  3GW6 A;  1XTG B;  2WTY A;  3H1H D;  1ZRT D;  5AW8 B;  1M57 D;  1LTS C;  1OVV A;  2FY8 A;  2P67 A;  4K35 A;  5AVV B;  3VMA A;  2NPS C;  1NOH A;  3ZDM A;  4U7J A;  4DT0 A;  2JO1 A;  2AXT H;  3L73 G;  5AW0 B;  1LP1 B;  2D2C B;  2E74 B;  3CX5 H;  2Q5U A;  1ZME C;  3LIE A;  3RBZ A;  1HJB A;  1VQK P;  4H13 C;  1L0N D;  4DCK A;  1SQP D;  2QA4 P;  1NTZ D;  1NU1 J;  2XV5 A;  3V2R A;  1VF5 B;  5KKZ C;  1LNQ A;  1YTZ T;  3L74 G;  3CL3 D;  3L70 E;  4O9B A;  3MGN A;  5AVW B;  1NTM J;  1FZA A;  1RE4 A;  1NU1 D;  1AA0 A;  5B66 H;  3CCM P;  3KYQ A;  3L71 J;  5KLV D;  4D6T G;  2V7Q H;  1KC8 Q;  3P8C E;  1LWU C;  1M1J A;  4W7Z A;  3GHG C;  2KK7 A;  1VQ4 P;  1N73 B;  1KYO I;  3H1K E;  3NTN A;  5BVZ A;  2P2U A;  3JC2 2;  1URQ D;  3AE4 C;  3VMX A;  1CI6 A;  1HVV A;  1ZR4 A;  4RJT A;  3H1J G;  3OW2 O;  2A06 D;  2ZAE B;  3AE1 C;  1PP9 G;  4PD4 E;  1JY2 P;  2QRX A;  1SFC A;  5GTH H;  2K37 A;  3TGU J;  1N7S C;  2WPR A;  1VQP P;  3L71 E;  1VDF A;  1YYC A;  5KAI E;  2OYH A;  3BCC D;  1VQL P;  3L75 E;  3AE3 C;  3Q2Y A;  1JB0 J;  5KLV G;  1IFM A;  1X0T A;  3ABV C;  4GIF A;  3GHG A;  2OYI B;  3ITK A;  1RE3 A;  2JP3 A;  3TNU B;  1SQB D;  3AE7 C;  2M8R A;  5CCG D;  5CMZ A;  1XTC C;  1VQO P;  1JOC A;  1JCC A;  1P84 I;  5AW5 B;  3JCU H;  1S9K E;  4GOF A;  4LLH A;  2E5T A;  4OVN F;  5KAF E;  3TSI A;  4ASV A;  2WSE J;  2KSE A;  3B5N B;  3HE4 B;  4LC1 A;  5AVU B;  1GMJ A;  1N86 A;  2M5A A;  3FGA D;  3H6P A;  3WMM 0;  1JY2 O;  1SQQ J;  1W2B O;  2E76 C;  2C9L Y;  2Q1K A;  2JWD A;  3MD0 A;  3P32 A;  4L76 A;  4L73 A;  1JCD A;  3SWK A;  2N1T D;  3E1I A;  2N1T A;  3GF7 A;  3SFE C;  3SWY A;  2ZT9 C;  1YHQ P;  3IR9 A;  3CME P;  4UB6 E;  2OTK E;  1GDT A;  3KPE A;  1W2E A;  1KB9 E;  1RF1 B;  1HGZ A;  3CCU P;  2KNC A;  2UWJ E;  1FE6 A;  3OAK A;  3H1L D;  3A0H H;  5CCH A;  3CMA P;  1Y8A A;  2E5Y A;  2XZR A;  2ZYA A;  3CCV P;  1LWU A;  3Q5S A;  1KB9 I;  2QJK B;  3NMD A;  2QSI A;  1SQV G;  2J5U A;  1CI6 B;  2QJY B;  3L37 A;  3M9Q A;  4EI2 A;  5TIS H;  5CHX A;  3HUS A;  1FC2 C;  1KIL E;  5AVT B;  5M1B A;  1PP9 J;  1U57 A;  4BXL A;  2IFN A;  5H2F E;  2IX7 C;  1JEK A;  5CBO A;  1QEX A;  3RGU A;  1EXJ A;  2KZJ A;  2XKM A;  4PJ0 E;  1PZQ A;  1X22 A;  3CX5 E;  2OQQ A;  4N6J A;  4W80 A;  3A5T A;  3Q3D A;  2OYI C;  3E1R A;  3P8M C;  3HD7 B;  5AVQ B;  1YJW P;  1N8R Q;  1OVR A;  1M1J C;  1L0L E;  1QGK B;  4PV1 D;  1EZV E;  1GK6 A;  3L73 E;  3LW5 H;  5B5E H;  1HF9 A;  3GF3 A;  1IK9 A;  4D6T J;  2BEZ F;  1OVU A;  2N9Y B;  4RO0 A;  3HE4 A;  5EFW B;  4WBA A;  3CCR P;  2OYI A;  2E43 A;  1LGH B;  2ZT9 D;  1RY3 A;  2P7J A;  2N1T C;  4CPG A;  3CWB J;  3CXH D;  2E75 C;  2WPQ A;  3KXD A;  1VF5 D;  3LID A;  3T97 A;  1BE3 D;  2WZ7 A;  2Z4E A;  2BEQ D;  1UII A;  3KZI H;  3CC7 P;  2H43 A;  2OAR A;  2MJZ A;  4HB1 A;  1FOS F;  3TGU G;  4XE5 B;  1J1D C;  1JO5 A;  1FZC B;  4A7P A;  2KXP B;  4OGQ C;  2Z5H A;  1PPJ G;  2I1K A;  3CXH H;  1SFC B;  4GOE A;  4IL6 E;  1UIX A;  1AQT A;  2ZFC A;  3CWB E;  1VL2 A;  3AEA C;  3S9O A;  3U59 A;  5KLV K;  2WT7 B;  1LTJ C;  2ITA A;  3G4S P;  2IYO A;  2E76 B;  2R3C A;  2JDI H;  4JYC A;  1SQQ E;  1L4A A;  2FYU E;  1MZ9 A;  2G3A A;  4R4M A;  4XFJ A;  1H89 A;  3RK2 D;  4H0L D;  2A06 G;  3BRT B;  4C7N B;  1BGY E;  4B86 A;  1USD A;  3BVH A;  2FBW C;  1PL5 A;  1VQ8 P;  1KYO D;  1NTK E;  1YJN P;  1NTK G;  3AE6 C;  1SP4 A;  1T6A A;  1URQ C;  3BAT A;  3MHV A;  1PPJ D;  4H44 C;  3D71 A;  1ZR2 A;  2XND H;  1VQN P;  2QEX P;  2M3B A;  2LXB A;  3VTP C;  1IFD A;  1NTZ J;  4ZMD A;  1FZB A;  3C9I A;  4EYY Q;  3TGU E;  1K04 A;  3O6Q A;  2YIU B;  5APU A;  3HRN A;  3Q5P A;  1AVO A;  1LTJ B;  1KYO H;  5E79 H;  1HGV A;  5KLV J;  2PFX A;  1IK7 A;  1LJ2 A;  4UB8 H;  1LTT C;  3UIA A;  2R5D A;  3EWK A;  2I1J A;  2IBZ E;  2H8P D;  2R32 A;  1HTL C;  4H13 D;  4W7Y A;  3M9H A;  4WY4 D;  3WUT A;  1AV1 A;  2KP8 A;  1MUU A;  1YIJ P;  4D6T E;  3M0A A;  1IFN A;  2P1J A;  4OGQ B;  3BRV B;  1IC2 A;  1KQG B;  1KIL B;  5APQ A;  3H1J D;  1NTM D;  1G1J A;  2FYZ A;  2HG5 D;  2YMY A;  4M3L A;  2A45 H;  4N78 E;  2C0X A;  3TK1 A;  5KJ7 C;  4XA4 A;  4KJM A;  1PV3 A;  2WSF J;  3NFQ A;  1GL2 A;  4TT3 H;  5AW1 B;  5H2F H;  2OYH C;  1SQB K;  2P10 A;  2IYP A;  1SQP J;  2NPS D;  2R3S A;  2RH0 A;  2Y0D A;  1NJI Q;  3O8Z A;  1QLE D;  1YBK A;  1PGO A;  3AEG C;  1JY3 N;  1OWA A;  4NPD A;  3V4Q A;  3WU2 H;  1NKN A;  1SQV D;  1WT6 A;  2KYV A;  2LR2 A;  2YIU C;  2K9J A;  3HE5 B;  3L70 J;  2Y9Z A;  2L5G B;  1J1E C;  1MFZ A;  3VP9 A;  3SWF A;  1G1I A;  4KT0 J;  4ASW A;  1IFI A;  2OYO A;  4Z1M H;  4ZNC A;  5BU8 B;  1M90 Q;  1RQV A;  5CBN A;  4RES B;  3H32 A;  1NGM B;  4NPF X;  1KQL A;  1YQ4 C;  1BE3 J;  2HLO A;  2QJP B;  4WY4 A;  3L72 E;  2AEF A;  1QX8 A;  4BRY A;  2W27 A;  3IF4 A;  3G71 P;  1USE A;  1QL2 A;  1T2K C;  4Y99 B;  3VP8 A;  2H7H A;  4JPZ B;  3CC4 P;  2B87 B;  2BAS A;  1SQX G;  3A0B E;  3IFM A;  1EXI A;  1AVY A;  5CJ0 A;  2HOD A;  1PFI A;  1CZQ A;  2IPP A;  1NYH A;  5CJ4 A;  1L4A D;  1RF0 C;  1Q2N A;  4K3A A;  3U1C A;  3HD7 A;  1M7L A;  2J58 A;  2CPB A;  3PH0 A;  1FU1 A;  2GA1 A;  3AE2 C;  1L2P A;  3RL0 B;  4YXD C;  5C39 A;  1SQB G;  2QVA A;  1QL1 A;  3H1H E;  2RN0 A;  1R5L A;  2WPV B;  2NRG A;  5AW9 B;  5KTB A;  5AVR B;  2Q7C A;  4U3F G;  2FFD C;  1FZE A;  2OTL P;  3BCC G;  2Y0E A;  1NHL A;  1IZN B;  1OZH A;  2PRR A;  2RKL A;  1P84 E;  3F5H A;  3H1L G;  1JY2 N;  2IBZ G;  3HUS B;  4HH2 A;  5CCH C;  3CCL P;  1S5L X;  1EC5 A;  3RK3 E;  4C46 A;  1NTZ E;  2NPS B;  1HUC A;  2KLV A;  1PP9 D;  1S3J A;  5APY A;  3M91 A;  4Y99 C;  2WT7 A;  1DIP A;  1EDK A;  4H44 D;  1QVG O;  1M8O B;  1BCC E;  1PGQ A;  1FDI A;  1SQV J;  3H1J J;  1BSN A;  3H1I D;  3L70 D;  1VPC A;  4PD4 I;  3W68 A;  1FJK A;  4I1L A;  3RL0 g;  4BWN A;  1JTH A;  2R44 A;  3VMY A;  3CWB G;  5GTH E;  1GD2 E;  2KZI A;  5KJ7 D;  2AEJ A;  1ZXG A;  2DW3 A;  3EFG A;  3L35 A;  1EDI A;  3PRJ A;  1Q90 D;  3GMA A;  2A45 G;  3G9R A;  3H1K D;  3MUD A;  4UB8 E;  5TJH A;  4YXW H;  1RF0 A;  4PV1 B;  2JR8 A;  4DOJ A;  3L74 D;  2KLU A;  1GL2 C;  1KFM A;  1KOR A;  1N73 C;  4EDF A;  2H88 C;  3A3Y B;  3JSV C;  5APW A;  4PD4 D;  4YPC A;  4EIJ A;  2FFD B;  2O01 J;  2O01 N;  1FS0 E;  2FFD A;  2XNX A;  3L71 D;  5APV A;  4I6M C;  2IZ1 A;  4TLF A;  1K8A Q;  3V2P A;  3WUU A;  1DEE G;  2ZVO B;  3CD6 P;  3Q1M A;  2P58 A;  2AEM A;  3IAO A;  1N2D C;  1SQP K;  4RKU J;  3CCJ P;  1MKM A;  1SQB E;  2W83 C;  1T8Z A;  2HOD B;  2YKO A;  2FXO A;  1PIX A;  2BCC E;  1GW4 A;  2LKM A;  4WB4 A;  3V2Q A;  2RMZ A;  5CCH D;  3H25 A;  1LTG C;  1S9K D;  2V7Q J;  3M0D A;  2B87 A;  3FWL A;  1OMI A;  2JJL A;  2R5B A;  2WWW A;  5AW6 B;  1NWQ A;  3M06 A;  1S5L E;  2SPZ A;  2HPC B;  1BSH A;  2QG4 A;  4U3F D;  2Y9Y A;  1A02 J;  1CW5 A;  4IOI H;  1CSB A;  1RE4 C;  1SQX D;  3MP7 B;  4JYB A;  4QMA A;  5B5E E;  2HPC A;  3B5N C;  2B89 A;  2M3E A;  1J2J B;  1LT9 C;  2YO3 A;  3II6 A;  3N7N A;  2FXM A;  3RL0 C;  1KB9 H;  2I8D A;  3R4Y A;  1Y47 A;  2KOG A;  2C0W A;  2AXC A;  1N73 A;  1H0T B;  1NAF A;  3KHU A;  1KB9 D;  1SVF A;  1EQ7 A;  2KI7 B;  2K9J B;  3HE5 A;  2KIK A;  2YO2 A;  3H1H J;  1L0N G;  3MZW B;  1KQF B;  2E42 A;  3CX5 I;  4JBZ A;  3S4R A;  1EZV I;  3G3Z A;  1LTA C;  1T2K D;  1HH0 A;  4IFM A;  1ZV8 A;  2M0B A;  2O1K A;  1JNM A;  3D6Z A;  1DD3 A;  1HWT C;  1ZRT E;  1EDJ A;  4N3Y B;  1GL2 B;  2Y0C A;  3L74 J;  3H1H G;  3MTU E;  2IFM A;  3H1I J;  5TIS E;  3I5C A;  2KB7 P;  1NAY A;  3P7K A;  1NTK K;  3B71 A;  3M9B A;  3F89 A;  3W67 A;  1LP1 A;  1Q82 Q;  1KIL D;  3NXS A;  5KJ7 A;  4IL6 H;  5GTI E;  3PLN A;  3V4W A;  1L0N E;  1SQP E;  5AVZ B;  2W6J H;  3L73 J;  4BRY B;  1KN7 A;  1P84 H;  3CI9 A;  1LT9 B;  1URQ A;  4HYT B;  3CCQ P;  5CCG C;  1H8A A;  2J59 M;  1L0L D;  4PV1 C;  3WUV A;  1KD1 Q;  1NU1 E;  3AE8 C;  1SS1 A;  2AXT E;  2PGD A;  3QWO C;  4MN4 C;  5KLV E;  3P8C D;  2JEE A;  5B66 E;  3VN0 A;  1KFN A;  2QE7 H;  1SFC D;  1LT1 A;  4OWF A;  3L71 G;  3B5N D;  3CXH E;  1OFC X;  1N7S B;  3HTK A;  3L72 J;  1NTM G;  1RH5 B;  1BCC G;  3E7K A;  1S72 P;  2WSS H;  4WY4 C;  3VOP A;  2A06 E;  2OGU A;  1YI2 P;  2B88 A;  1K9M Q;  5AVY B;  3CCS P;  3AED C;  3FXE A;  4R4L A;  3AEB C;  2K9Y A;  1SQQ G;  1JY3 P;  1WRG A;  2GUS A;  2WSC J;  1KIL A;  2FYN B;  1IO4 A;  3BCC E;  1GU5 A;  4C7R A;  1BCC J;  3L75 D;  3CWB D;  3QH9 A;  3B4S A;  1MV8 A;  3VYI A;  1HJ0 A;  2KSJ A;  1R8E A;  3VMZ A;  3HTK B;  1SQQ D;  1L0L J;  1A02 F;  1LWU B;  2FYU D;  3V6I A;  1KMI Z;  3V5B A;  1LTJ A;  2KUB A;  2WSC H;  3CCE P;  1OXZ A;  2O1J A;  4H0L C;  3TDK A;  2KNC B;  5AW3 B;  2W6A A;  4I7Z C;  1BGY D;  2WMM A;  1RF1 A;  2ZXE B;  2O01 H;  2XU6 A;  3RBX A;  2IBZ I;  1QVF O;  1KYO E;  1N7L A;  2QIW A;  1KQS O;  4L75 A;  1S5L H;  1PPJ E;  3IN6 A;  1HBW A;  1SQV K;  1Y9B A;  2JKV A;  3G6E P;  1KV4 A;  2QM8 A;  1OIP A;  1GK4 A;  3M0D C;  3RK3 C;  1KZU B;  1Z56 A;  4PD4 H;  1L0L G;  1BDC A;  1GL2 D;  3TGU D;  2FYN C;  4OGQ D;  2ZT9 B;  5APX A;  2QJY C;  4EOT A;  2YXR B;  1SQB J;  3H1L E;  1FJP A;  1FBM A;  1OW7 A;  3HUS C;  1W5C E;  1X8Y A;  1JUN A;  1K05 A;  1T3J A;  3C1L A;  1J1E B;  1N7S D;  2FYU K;  4H13 B;  1L0L K;  2V4H A;  3L75 G;  2KS1 B;  1ZOY C;  4UB6 H;  4GOD A;  2O3J A;  1VQ9 P;  4Y28 J;  3CXH I;  1NU1 G;  1RQU A;  1Q86 Q;  1NO4 A;  2E75 D;  3GLM A;  1SQX J;  3JCU E;  1EZV G;  3V2N A;  1PGP A;  2HR3 A;  4KHX A;  5AW4 B;  1X9V A;  4I7Z B;  3WU2 E;  4IFD K;  3H1J E;  5CCG A;  2POH A;  1K73 Q;  3CX5 D;  1WMK A;  1FZC A;  3N4X A;  4AUW A;  4PJ0 H;  1YTZ I;  5APT A;  5AW7 B;  4ZKU A;  1G2C B;  1M1K Q;  1L0N K;  2ZJS E;  1EZV D;  3CLQ A;  3FXD A;  3L73 D;  1SLQ A;  1T3U A;  2L91 A;  1GU4 A;  3OJA B;  3CPW O;  1DH3 A;  4H0L B;  1SQV E;  2OYH B;  1M1J B;  5AVX B;  2N9B A;  2FKW B;  2QJK C;  2FXP A;  3O6Q B;  4ZKP A;  1J1D B;  2W6B A;  1EDL A;  2QJP C;  3K5B A;  1JMB A;  1BE3 E;  1MFT A;  1NKZ B;  1SQQ K;  1RE3 C;  4HJG H;  2N1T B;  1GTW A;  2YKP A;  3KZI E;  2QM7 A;  2HFE D;  3FWN A;  3GG2 A;  4U3F J;  2PAJ A;  2WIT A;  5L8R J;  2M5A B;  1IJD B;  1PGJ A;  2IBZ D;  2Q3E A;  2XDJ A;  3R2P A;  4GDO A;  3SSU A;  2YMK A;  3A0B H;  1Q7Y Q;  3H1K J;  1VQ5 P;  1LTB C;  3D70 A;  2K88 A;  1RHZ B;  2WVR A;  3BAS A;  1BGY G;  1NTM K;  2Z5I A;  1L0N J;  1L4A B;  2MKV A;  4OH8 B;  3SFD C;  3TNU A;  3Q5R A;  3MIW A;  3PJS K;  4L74 A;  3GHG B;  1FDM A;  3LW5 J;  4DZO A;  1JY3 O;  5KLI B;  2BCC G;  1YQ3 C;  2A45 I;  3AEC C;  4YTP C;  1ZN5 A;  3RK2 C;  2OTJ P;  2ZYG A;  1JTH B;  2Q3I A;  3AE9 C;  1AQ5 A;  2WSF H;  1FZG A;  1IFP A;  1BGY J;  2K1A A;  3U1A A;  3I55 P;  2D2C D;  2E74 D;  2YKQ A;  1NTK D;  2PP6 A;  3H1K G;  2B9B A;  4WWI A;  4AQR D;  2IDB A;  1P84 D;  2HYN A;  3TF5 A;  2FYU J;  2NPS A;  3A2A A;  3I56 P;  1FZC C;  1ZW0 A;  4LGD E;  2KS1 A;  3KDP B;  3RK3 D;  1DX7 A;  3T97 B;  1PP9 E;  4JQ0 D;  3PP5 A;  3RL0 D;  4I2L C;  4HKZ H;  2CPS A;  1BCC D;  1JMM A;  3B5N A;  2D2C C;  2E74 C;  1D7M A;  1OX3 A;  3H1I E;  3L75 J;  4JF7 A;  2JWA A;  2NZ2 A;  4WVZ A;  1RF1 C;  1IFJ A;  3C8V A;  2W90 A;  1ZLL A;  3L36 A;  2YXQ B; 
#chains in the Genus database with same CATH homology
 3H1H G;  1SQX G;  5KLV G;  4PD4 H;  2BCC G;  1NTK G;  1L0L G;  1SQQ G;  3CWB G;  2FYU G;  1SQV G;  3L74 G;  3TGU G;  1BE3 G;  3L72 G;  4D6T G;  1P84 H;  3H1K G;  3L75 G;  1SQB G;  1PPJ G;  3CXH H;  1KB9 H;  1KYO H;  1NU1 G;  4U3F G;  3BCC G;  1EZV G;  3H1I G;  3H1J G;  1L0N G;  2IBZ G;  3H1L G;  3L70 G;  1PP9 G;  3L71 G;  1NTZ G;  1NTM G;  1SQP G;  1BCC G;  1BGY G;  3L73 G;  3CX5 H;  2A06 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...