1L0LG

Structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
b'GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
molecule tags Oxidoreductase
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
total genus 20
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1l0lG00
1BE3G 3CXHH 1NTKG 4U3FG 3L71G 3CX5H 3L73G 1EZVG 1BCCG 1L0NG 1SQVG 3H1HG 3H1LG 3L75G 1SQPG 1KYOH 3H1KG 1NTZG 3H1IG 1BGYG 3L72G 5KLVG 1NU1G 1KB9H 1SQXG 3TGUG 3CWBG 1L0LG 4D6TG 2A06G 2IBZG 2FYUG 3H1JG 1P84H 1NTMG 3BCCG 3L74G 1SQBG 4PD4H 2BCCG 3L70G 1PPJG 1SQQG 1PP9G
chains in the Genus database with same CATH superfamily
1VQ4P 3M9BA 1Q90D 2A45I 2K88A 3CXHH 2LKMA 3IF4A 4C7RA 1M90Q 2WPRA 1H0TB 4MN4C 1R5SA 3EFGA 3LW5J 4GOEA 1N8RQ 1OZHA 2R3CA 4RKUJ 2A06E 1KMIZ 5CMZA 1OWAA 1FE6A 2KS1A 1SQVG 4O9BA 3L75G 2FFDA 1HGVA 3M0DC 2V4HA 1NTZG 4OGQB 2H43A 1HH0A 1JEKA 3VTPC 1KZUB 2AXTE 3L74J 5CBOA 2XV5A 2W8ZA 1N7SD 1Z56A 2P1JA 3KQGA 3L37A 4H0LC 5KJ7D 5TISE 1IFJA 1K04A 2E76D 1SQBD 2L5GB 2QM7A 3CLQA 3L71D 1S5LH 2KNCB 1HBWA 1EZVE 3D70A 1U57A 2WITA 4UB8E 4HH2A 3LIEA 3H1LE 1G2CA 3G3ZA 1N73B 1PGJA 3H1IE 3QH9A 3V2RA 5APQA 2SPZA 2K3RA 2QE7H 1UIIA 2YKPA 1GL2B 3C1LA 4L73A 2O01J 3TGUE 3BRTB 3KXDA 2KLUA 4W80A 1FZCC 1M56D 2V7QJ 2W6JH 3MHVA 1SQPJ 1YTZT 3AEBC 5AVUB 1JY3O 4EYYQ 2K9YA 1FU1A 1KFMA 2KSJA 3HD7A 3VN0A 3RL0C 3CMEP 1MZ9A 2O1KA 3H1JE 2QJYC 3CWBJ 4I7ZB 1NTME 4YXWH 3CD6P 4KT0J 1AVYA 1AV1A 1N7SA 1ZOYC 1LTJA 3CX5E 3II6A 1S72P 1VQKP 2A45G 5C39A 1SFCA 3HE5A 1BE3D 3GW6A 3WU2E 5DJTB 1PGPA 3S1KA 5KLIB 3V4QA 5H2FE 1AVOA 3B8EB 1SVFA 1ZLLA 1BDDA 1RHZB 2KXPB 4C46A 1VQLP 1EZVI 3CX5I 2R5BA 5E79E 3USSA 2KP8A 4PD4D 3B4SA 5APUA 3RL0D 2K37A 2N1TB 4H44C 4DCKA 3HD7D 3L72D 3L71G 3OA7A 3RK2D 3O6QB 1L2PA 4NPFX 4OGQD 3SSUA 1MFZA 5KKZC 3HUSC 1URQA 3A2AA 4WWIA 1L4AB 3FXEA 3JC22 4DZOA 5CCHC 4UB6H 1BGYD 1LP1A 1SFCD 2N9YB 2R32A 2WT7B 4JYBA 5AVTB 4JQ0D 1QVGO 1NU1G 1VQ6P 1DH3A 4IFMA 1BCCD 2ZVOB 3TDKA 4WY4B 2Q3EA 4WY4D 1H89A 4ASWA 3F5HA 2OYHC 4UB6E 3V2NA 1KB9I 3VP9A 2I1JA 2JEEA 4U7JA 5APXA 3Q5RA 3TGUJ 5E79H 5CJ0A 3WUUA 1L4AD 3GHGC 1VF5D 2LXCB 1SQPE 4PV1D 1NVOA 2QM8A 4PD4H 1PV3A 2ZJSE 1MUUA 2JR8A 4Y99C 4AYCA 5KLVK 2W27A 4HKZH 1JCCA 5AVVB 1EDJA 5AW0B 1KYOI 1OW7A 5B5EE 1ZN5A 1HJ0A 1QX8A 3CWBE 3IN6A 1NWQA 1OXZA 2FYUJ 2KIKA 5AW2B 1JOCA 3HTKA 1M1JA 2QSIA 3AE7C 1URQD 2M3BA 3RL0B 2NPSB 3VOPA 1IO4A 3JCUE 4DOJA 1JTHA 1X79B 1G1IA 3L72J 3D6ZA 2ZVNB 1Q7YQ 2LR2A 1BCCG 4XA4A 1H88A 3GMAA 2H88C 1NU1D 1CW5A 4I1LA 4PJ0E 1VQ9P 2KSEA 2H8PD 2C9NY 1PZQA 1PP9E 3GG2A 5TJHA 3S4RA 1KTMA 1HVVA 1ZV8A 2H7HA 1FC2C 1RE4C 4GT1A 1YJWP 3CC2P 1LT9A 1NHLA 2FXPA 1L4AA 2ZYGA 1GU4A 1PGOA 1OVUA 1PL5A 3L73E 4H0LB 2D2CC 1RF0C 1ZP0C 1J1EC 5APWA 1G1JA 1LWUA 2P10A 2KK7A 2N1TA 3ABVC 4YPCA 1S4XA 3NMDA 3NXSA 1S5LX 1EXJA 2BASA 2O01H 3FX0A 2OYIA 1IFNA 2E74B 2HODA 3H1LJ 3GF7A 3E7KA 1T2KD 2O01N 3MP7B 1RF1B 1YTZI 3L70J 2CK3H 5CCHA 1SQPD 2YMKA 1GK6A 3CC4P 1IFDA 4L74A 1YJ9P 1EXIA 2WPVB 2YXQB 3HTKB 1K73Q 2O3JA 2D2CB 3HE5B 1KB9H 3A0BH 2YO2A 2YO3A 2FXMA 1KD1Q 4GDOA 1Y8AA 3M9HA 4PV1B 1OIPA 1YHQP 2XU6A 1T3UA 2A06G 3AE2C 2KYVA 1LTSC 3IR9A 5GTIE 1T2KC 2QG4A 3JCUH 3L75E 3BATA 3GF3A 3M9QA 2QA4P 3T97B 2J58A 1HGZA 3L72E 2R5DA 1PPJG 3VMYA 1M1JC 2Z5HA 1FJPA 1EC5A 3OJAB 5CCGA 1XTGB 1ZRTD 1YJNP 2C9LY 1LP1B 2C0WA 3TSIA 5AVSB 4PD4E 4CPGA 4YTPC 1M7LA 1IFIA 1LGHB 5BVZA 3MIWA 3LIDA 2MJZA 4LLHA 1EZVG 5B5EH 3M0AA 1JMMA 2ITAA 1VQ7P 1BGYJ 1YQ4C 3RK2B 2NRGA 2OARA 5AW5B 2IFMA 2QJKB 3H1HJ 4RESB 1JMBA 2Q5UA 4KHXA 1BE3E 1KILC 1MV8A 1NU1K 1RY3A 4BRYB 5K5GB 3AE3C 3D6YA 2QEXP 3CX5D 2D2CD 2PP6A 1NAYA 2QJYB 1LT9C 2HFED 4KJMA 4WY4C 5APSA 1NTMD 2Q1KA 1HUCA 1AFOA 3H1JD 3L71J 1SQQJ 1H8AA 2HPCB 3NFQA 1RF0A 1DEBA 2K9JA 2IFNA 3VMXA 1IFMA 4JPZB 4Z1MH 2WZ7A 3I5CA 1VQ8P 3HUSB 3L74D 3T97A 1N7SB 1KQLA 2JWAA 1FZBA 1YQ3C 5AW8B 1IK7A 2KOGA 3KYQA 2OTLP 3CX5H 4NPEA 2ZXEB 3OW2O 1A02F 2Q3IA 3CL3D 2PRRA 1KILA 4H0LD 3H6PA 4PD4I 1R5LA 5CJ4A 3AECC 1M57D 2FYUE 2KZJA 2Y0EA 3A3YB 5H2FH 4EIJA 2FBWC 3HRNA 4ZNCA 1NKZB 1SQBE 3AE4C 2FYNB 2IYOA 4OVNF 4WY4A 1GDTA 2OYIB 2JO1A 1SQVD 1P84I 2ZT9D 1L0ND 1DD3A 1GL2D 1P84E 1SQXG 1Q82Q 3RL0g 1LWUB 1KFNA 3I56P 3KHUA 3RK3C 4BWNA 2OGUA 1J2JB 1EDIA 1VQPP 2FYNC 5KAIH 3CPWO 1NGMB 1FDOA 1FDMA 1NKNA 2JWDA 1BDCA 2A06D 1SQQD 2E76B 4XFJA 3V2PA 3VMZA 2BCCG 1DD4A 1NJIQ 3U1CA 1KB9D 1DIPA 2P7JA 1CZQA 4D6TJ 1KYOE 1OW6A 1HWTC 2IBZD 1J1DB 4H13D 3PTZA 4U3FG 5AVWB 1KILD 5L8RJ 3BVHA 1KORA 1W5CE 4GOFA 5B66H 5M1BA 3W68A 1FZCB 2PFXA 3BRVB 1GL2C 3PRJA 2IBZE 3H1KJ 1KYOD 2NPSA 3H1HG 3CCLP 5APTA 1X22A 2A45H 3SWFA 4EOTA 1KB9E 1M8OB 4TLFA 3L70E 3V5BA 1BGYG 1SFCB 3AE5C 1JY3P 1SQQE 1NTKD 2RH0A 3H1IJ 1SLQA 1USEA 2KUBA 2Y0CA 2E76C 2E5YA 2K1AA 3RK3B 3S9OA 3CXHE 1L0LG 4IOIH 4D6TG 1NH4A 1KILB 2BCCD 1VDFA 2B9BA 2WSSH 1EDKA 2YIUC 4H13B 1CSBA 4W7YA 2OYIC 1A02J 1L0NE 1NU1J 1P84D 1SQVE 1LWUC 3A7OA 3MTUE 4M3LA 1U7MA 4BXLA 3WUVA 1AQ5A 3AEEC 3IFMA 2PAJA 1FDIA 4D6TD 1L0LD 2RMZA 1WRGA 3V6IA 4LGDE 1NO4A 2FYUD 4EI2A 3L75J 4IL6X 2HPCA 2M0BA 2OYOA 5KLVD 1N73A 1G2CB 1SQVK 2FY8A 2NPSD 3GLMA 1N7SC 4A7PA 3BASA 1FZCA 1X9VA 2GUSA 2CPSA 2M3EA 3B71A 3EFFK 2IBZI 4WVZA 2HODB 1E5WA 3SFEC 3L74E 3VMAA 1E79H 2JDIH 3H1IG 4U3FJ 2I8DA 4WBAA 4BRYA 4DJGA 1S5LE 3PP5A 4HB1A 1GW4A 3P8CD 1FS0E 2KI7B 4DT0A 2OTKE 2ZYDA 1SP4A 4N78D 2WSEJ 2WSCJ 1IK9A 1FZFA 3M91A 3Q5PA 3BCCD 1LT9B 2WPQA 3RGUA 1MFTA 1M1KQ 2QJKC 5AW9B 2FKWB 2WTYA 2BEZF 2ZT9B 4ZMDA 4W7ZA 3AE9C 1OFCX 5TISH 1VQMP 2L91A 1PFIA 5DJUB 1NTZK 4UB8H 4C7NA 3R2PA 2E75D 3RK2C 2WVRA 2J59M 1RQVA 3KDPB 2OYHA 2BEQD 3N7NA 3H1KD 3H1JJ 3A0BE 1M1JB 1ZRTE 2ZXXA 4JBZA 2YIUB 2O1JA 1VQOP 3TK1A 1XTCC 1FAVA 1FZGA 2FYZA 1T3JA 3H1KG 3KZIE 5AVXB 3EWKA 3P32A 1KQGB 2HYNA 3HUSA 2JJLA 1ZR2A 2IPPA 2NZ2A 3L75D 5CCHD 5KJ7C 3TGUG 2K9JB 4PV1C 1X0TA 1LTTC 1SQBJ 1U7JA 1FBMA 1WT6A 2W83C 5KAIE 1DX7A 3Q1MA 1RE4A 1RE3A 2OTJP 2FXOA 2QJPB 4IL6E 2QIWA 3P8MC 3E1IA 3H1JG 4PJ0H 5B66E 1P84H 2ZFCA 3BCCG 1AJYA 1Q81Q 1JUNA 3B5NC 2G3AA 5CCGD 1KV4A 2C0XA 2WT7A 1LTBC 2NPSC 1RE3C 1R8EA 3L36A 2V7QH 3MGNA 1SQPK 3FWLA 4IFFA 2RKLA 1LT1A 1GK4A 2E74C 4Y28J 3CCJP 1LTAC 2FFDB 4AUWA 2XNXA 1Q86Q 1KYOH 2IX7C 3Q2YA 1K8AQ 3C8VA 2J5UA 3OAKA 1JY2P 5AW1B 3MZWB 4RO0A 5KLVG 5CHXA 3HD7C 5GTIH 2HG5D 1EQ7A 2WSFH 4LC1A 3L73D 1NAFA 2KS1B 1PPJD 4WB4A 2POHA 1GTWA 1VPCA 3G9RA 4NPDA 3G71P 1JM0A 2UWJE 3L35A 3TYYA 1IC2A 2FYUG 3L4FA 3U59A 1PP9D 3H32A 2Y9ZA 1OX3A 1GZLA 1H0TA 2OQQA 5KKZB 2VRSA 2E5TA 1PGQA 1USDA 1MKMA 1S3JA 1WMKA 1L0NJ 1NU1E 3Q5SA 4HYTB 3NTNA 1JNMA 1NTKG 5AVZB 3H32B 2AXTH 3BCCJ 1NTZD 1OW8A 2ZAEB 3HE4A 3PH0A 2GA1A 2Q6QA 1HTLC 3L73G 2YKQA 2I1KA 2LXBA 3CWBD 3MUDA 5APVA 3SWKA 5KLVJ 1RF1A 1FOSF 1JO5A 2WMMA 1QVFO 1URQC 1PP9J 4K3AA 3PJSK 3RBZA 4U3FD 1SQBK 3P7KA 1SQQK 4GIFA 2WSFJ 1YITP 4I2LC 5AW4B 1N86A 4K35A 4U3FE 1URQB 3WUTA 3GHGB 4ASVA 5BU8B 2KNCA 2YKOA 2WPSA 2R44A 3O6QA 2AXCA 3B5NA 3JSVC 5KJ7A 1OVRA 3M0DA 1BCCE 3I55P 1LTJC 1QL1A 2YNYA 1SQXJ 3H25A 2XZRA 3CCVP 1K05A 1NTZE 1QL2A 3V4WA 4RJTA 1BGYE 5CBNA 3CCEP 3MD0A 3CCMP 1L4AC 3AE1C 2JKVA 1BE3J 3TNUA 5AW7B 2YXRB 2DW3A 5EFWB 1JTHB 2N1TC 4L75A 2BCCJ 1FZEA 1FJKA 1SS1A 1JY2N 2IZ1A 1JCDA 2W6BA 1NYHA 2B89A 3HE4B 2Z5IA 3H1LG 5APYA 1VL2A 3TF5A 2AEMA 3WMM0 1NTKJ 1RQUA 5BU5A 1K9MQ 1LTJB 3EQ2A 5AW6B 2M8RA 1PPJE 4H44D 1KQSO 1NOHA 1Y9BA 1AA0A 3AEGC 2W90A 1D7MA 3PHLA 1GW3A 3B5ND 5KAFE 3K5BA 5CCGC 1GMJA 3HD7B 2Q7CA 3D71A 1W2BO 2HR3A 3KZIH 1FZAA 4AQRD 4JF7A 2XDJA 5AW3B 3MUDC 1RF1C 1NTMG 3AEAC 4YXDC 1HF9A 2FFDC 1QGKB 1BE3G 4I7ZC 1OMIA 1UIXA 2Y9YA 1J1EB 3IAOA 3L73J 1ZW0A 4GODA 2XKMA 4OWFA 5AVYB 3U1AA 1GD2E 2FYUK 2E42A 1YYCA 3B5NB 3VP8A 3TGUD 3V2QA 1VQNP 2GUVA 2WWWA 2AEJA 2RN0A 1QLED 1T8ZA 1NTKK 2P2UA 1DEEG 2KLVA 3AE6C 1L0LJ 3AEFC 3H1ID 3KPEA 1Y47A 3L72G 3SFDC 1HJBA 3H1LD 3FWNA 3ZDMA 3CCSP 2IZ0A 1ZMEC 2B87B 3E1RA 1N73C 1JB0J 1EZVD 5GTHE 1YI2P 1ZR4A 1L0NK 3G6EP 1S2EA 3C9IA 2WSEH 3ITKA 3L71E 4EDFA 2YMYA 1LTIC 2M5AA 4HJGH 2CPBA 1IFPA 2PGDA 2QRXA 3CCRP 1YIJP 3H1KE 1SQBG 1AQTA 2MKVA 1TU3F 3Q3DA 2G8YA 1SQXK 1N2DC 3N4XA 4N3YB 1BSHA 3CCQP 1KN7A 4OGQC 1OVVA 2QVAA 4Y99B 2ZYAA 3G4SP 2ZT9C 1YBKA 2H89C 1W2EA 2P67A 2XNDH 1NTMJ 1IZNB 1BSNA 3CXHI 2N9BA 1LTGC 4TT3H 1CI6B 3WU2H 2HLOA 3RBXA 3VYIA 1SQPG 1Q2NA 3BCCE 3QWOC 4N6JA 1L0LK 2OYHB 1GL2A 1SQVJ 4R4MA 4N78E 2QJPC 3CCUP 4L76A 4IL6H 1S9KD 2E75B 2IDBA 2AEFA 2B88A 4C7NB 3P8CE 2KB7P 3CWBG 4GKGA 3A5TA 2E74D 2Y0DA 1VF5C 1KQFB 3PLNA 2Q9IA 3FXDA 2M5AB 3LW5H 4I6MC 1JY2O 1FOSE 2E43A 5AVRB 2IBZG 3A0HH 3TNUB 3H1HE 3F89A 2B87A 3GHGA 3UIAA 3L70G 4H44B 4OH8B 1ZXGA 4B86A 1SQQG 5KLVE 1PP9G 1BCCJ 3A0HE 5KTBA 3W67A 2IYPA 1SQXE 1N7LA 3CI9A 2N1TD 2JP3A 3RK3D 1NTZJ 2P58A 1L0LE 4D6TE 1NTMK 3O8ZA 2WSCH 5GTHH 1X8YA 1LNQA 3RK3E 1JY3N 5KAFH 1L0NG 1SQXD 1IJDB 2KZIA 3AE8C 3SWYA 5KLIC 4ZKUA 4JYCA 2BCCE 3CC7P 1EDLA 2GM4A 2WQYC 1T6AA 3CXHD 4H13C 1LJ2A 4QMAA 2Z4EA 3H1HD 2R3SA 2W6AA 4ZKPA 1NTKE 1CI6A 1S1CX 3FGAD 1VQ5P 3AEDC 3L70D 3M06A 1RH5B 1SFCC 2E75C 1KC8Q 4R4LA 5AVQB 4XE5B 1VF5B 1GU5A 4IFDK 1S9KE 3R4YA 1QEXA 3L74G 1J1DC 1KILE 1PIXA 3CMAP
chains in the Genus database with same CATH topology
1BE3G 3CXHH 1NTKG 4U3FG 3L71G 3CX5H 3L73G 1EZVG 1BCCG 1L0NG 1SQVG 3H1HG 3H1LG 3L75G 1SQPG 1KYOH 3H1KG 1NTZG 3H1IG 1BGYG 3L72G 5KLVG 1NU1G 1KB9H 1SQXG 3TGUG 3CWBG 1L0LG 4D6TG 2A06G 2IBZG 2FYUG 3H1JG 1P84H 1NTMG 3BCCG 3L74G 1SQBG 4PD4H 2BCCG 3L70G 1PPJG 1SQQG 1PP9G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE3 G;  3CXH H;  1NTK G;  4U3F G;  3L71 G;  3CX5 H;  3L73 G;  1EZV G;  1BCC G;  1L0N G;  1SQV G;  3H1H G;  3H1L G;  3L75 G;  1SQP G;  1KYO H;  3H1K G;  1NTZ G;  3H1I G;  1BGY G;  3L72 G;  5KLV G;  1NU1 G;  1KB9 H;  1SQX G;  3TGU G;  3CWB G;  1L0L G;  4D6T G;  2A06 G;  2IBZ G;  2FYU G;  3H1J G;  1P84 H;  1NTM G;  3BCC G;  3L74 G;  1SQB G;  4PD4 H;  2BCC G;  3L70 G;  1PPJ G;  1SQQ G;  1PP9 G; 
#chains in the Genus database with same CATH topology
 1VQ4 P;  3M9B A;  1Q90 D;  2A45 I;  2K88 A;  3CXH H;  2LKM A;  3IF4 A;  4C7R A;  1M90 Q;  2WPR A;  1H0T B;  4MN4 C;  1R5S A;  3EFG A;  3LW5 J;  4GOE A;  1N8R Q;  1OZH A;  2R3C A;  4RKU J;  2A06 E;  1KMI Z;  5CMZ A;  1OWA A;  1FE6 A;  2KS1 A;  1SQV G;  4O9B A;  3L75 G;  2FFD A;  1HGV A;  3M0D C;  2V4H A;  1NTZ G;  4OGQ B;  2H43 A;  1HH0 A;  1JEK A;  3VTP C;  1KZU B;  2AXT E;  3L74 J;  5CBO A;  2XV5 A;  2W8Z A;  1N7S D;  1Z56 A;  2P1J A;  3KQG A;  3L37 A;  4H0L C;  5KJ7 D;  5TIS E;  1IFJ A;  1K04 A;  2E76 D;  1SQB D;  2L5G B;  2QM7 A;  3CLQ A;  3L71 D;  1S5L H;  2KNC B;  1HBW A;  1EZV E;  3D70 A;  1U57 A;  2WIT A;  4UB8 E;  4HH2 A;  3LIE A;  3H1L E;  1G2C A;  3G3Z A;  1N73 B;  1PGJ A;  3H1I E;  3QH9 A;  3V2R A;  5APQ A;  2SPZ A;  2K3R A;  2QE7 H;  1UII A;  2YKP A;  1GL2 B;  3C1L A;  4L73 A;  2O01 J;  3TGU E;  3BRT B;  3KXD A;  2KLU A;  4W80 A;  1FZC C;  1M56 D;  2V7Q J;  2W6J H;  3MHV A;  1SQP J;  1YTZ T;  3AEB C;  5AVU B;  1JY3 O;  4EYY Q;  2K9Y A;  1FU1 A;  1KFM A;  2KSJ A;  3HD7 A;  3VN0 A;  3RL0 C;  3CME P;  1MZ9 A;  2O1K A;  3H1J E;  2QJY C;  3CWB J;  4I7Z B;  1NTM E;  4YXW H;  3CD6 P;  4KT0 J;  1AVY A;  1AV1 A;  1N7S A;  1ZOY C;  1LTJ A;  3CX5 E;  3II6 A;  1S72 P;  1VQK P;  2A45 G;  5C39 A;  1SFC A;  3HE5 A;  1BE3 D;  3GW6 A;  3WU2 E;  5DJT B;  1PGP A;  3S1K A;  5KLI B;  3V4Q A;  5H2F E;  1AVO A;  3B8E B;  1SVF A;  1ZLL A;  1BDD A;  1RHZ B;  2KXP B;  4C46 A;  1VQL P;  1EZV I;  3CX5 I;  2R5B A;  5E79 E;  3USS A;  2KP8 A;  4PD4 D;  3B4S A;  5APU A;  3RL0 D;  2K37 A;  2N1T B;  4H44 C;  4DCK A;  3HD7 D;  3L72 D;  3L71 G;  3OA7 A;  3RK2 D;  3O6Q B;  1L2P A;  4NPF X;  4OGQ D;  3SSU A;  1MFZ A;  5KKZ C;  3HUS C;  1URQ A;  3A2A A;  4WWI A;  1L4A B;  3FXE A;  3JC2 2;  4DZO A;  5CCH C;  4UB6 H;  1BGY D;  1LP1 A;  1SFC D;  2N9Y B;  2R32 A;  2WT7 B;  4JYB A;  5AVT B;  4JQ0 D;  1QVG O;  1NU1 G;  1VQ6 P;  1DH3 A;  4IFM A;  1BCC D;  2ZVO B;  3TDK A;  4WY4 B;  2Q3E A;  4WY4 D;  1H89 A;  4ASW A;  3F5H A;  2OYH C;  4UB6 E;  3V2N A;  1KB9 I;  3VP9 A;  2I1J A;  2JEE A;  4U7J A;  5APX A;  3Q5R A;  3TGU J;  5E79 H;  5CJ0 A;  3WUU A;  1L4A D;  3GHG C;  1VF5 D;  2LXC B;  1SQP E;  4PV1 D;  1NVO A;  2QM8 A;  4PD4 H;  1PV3 A;  2ZJS E;  1MUU A;  2JR8 A;  4Y99 C;  4AYC A;  5KLV K;  2W27 A;  4HKZ H;  1JCC A;  5AVV B;  1EDJ A;  5AW0 B;  1KYO I;  1OW7 A;  5B5E E;  1ZN5 A;  1HJ0 A;  1QX8 A;  3CWB E;  3IN6 A;  1NWQ A;  1OXZ A;  2FYU J;  2KIK A;  5AW2 B;  1JOC A;  3HTK A;  1M1J A;  2QSI A;  3AE7 C;  1URQ D;  2M3B A;  3RL0 B;  2NPS B;  3VOP A;  1IO4 A;  3JCU E;  4DOJ A;  1JTH A;  1X79 B;  1G1I A;  3L72 J;  3D6Z A;  2ZVN B;  1Q7Y Q;  2LR2 A;  1BCC G;  4XA4 A;  1H88 A;  3GMA A;  2H88 C;  1NU1 D;  1CW5 A;  4I1L A;  4PJ0 E;  1VQ9 P;  2KSE A;  2H8P D;  2C9N Y;  1PZQ A;  1PP9 E;  3GG2 A;  5TJH A;  3S4R A;  1KTM A;  1HVV A;  1ZV8 A;  2H7H A;  1FC2 C;  1RE4 C;  4GT1 A;  1YJW P;  3CC2 P;  1LT9 A;  1NHL A;  2FXP A;  1L4A A;  2ZYG A;  1GU4 A;  1PGO A;  1OVU A;  1PL5 A;  3L73 E;  4H0L B;  2D2C C;  1RF0 C;  1ZP0 C;  1J1E C;  5APW A;  1G1J A;  1LWU A;  2P10 A;  2KK7 A;  2N1T A;  3ABV C;  4YPC A;  1S4X A;  3NMD A;  3NXS A;  1S5L X;  1EXJ A;  2BAS A;  2O01 H;  3FX0 A;  2OYI A;  1IFN A;  2E74 B;  2HOD A;  3H1L J;  3GF7 A;  3E7K A;  1T2K D;  2O01 N;  3MP7 B;  1RF1 B;  1YTZ I;  3L70 J;  2CK3 H;  5CCH A;  1SQP D;  2YMK A;  1GK6 A;  3CC4 P;  1IFD A;  4L74 A;  1YJ9 P;  1EXI A;  2WPV B;  2YXQ B;  3HTK B;  1K73 Q;  2O3J A;  2D2C B;  3HE5 B;  1KB9 H;  3A0B H;  2YO2 A;  2YO3 A;  2FXM A;  1KD1 Q;  4GDO A;  1Y8A A;  3M9H A;  4PV1 B;  1OIP A;  1YHQ P;  2XU6 A;  1T3U A;  2A06 G;  3AE2 C;  2KYV A;  1LTS C;  3IR9 A;  5GTI E;  1T2K C;  2QG4 A;  3JCU H;  3L75 E;  3BAT A;  3GF3 A;  3M9Q A;  2QA4 P;  3T97 B;  2J58 A;  1HGZ A;  3L72 E;  2R5D A;  1PPJ G;  3VMY A;  1M1J C;  2Z5H A;  1FJP A;  1EC5 A;  3OJA B;  5CCG A;  1XTG B;  1ZRT D;  1YJN P;  2C9L Y;  1LP1 B;  2C0W A;  3TSI A;  5AVS B;  4PD4 E;  4CPG A;  4YTP C;  1M7L A;  1IFI A;  1LGH B;  5BVZ A;  3MIW A;  3LID A;  2MJZ A;  4LLH A;  1EZV G;  5B5E H;  3M0A A;  1JMM A;  2ITA A;  1VQ7 P;  1BGY J;  1YQ4 C;  3RK2 B;  2NRG A;  2OAR A;  5AW5 B;  2IFM A;  2QJK B;  3H1H J;  4RES B;  1JMB A;  2Q5U A;  4KHX A;  1BE3 E;  1KIL C;  1MV8 A;  1NU1 K;  1RY3 A;  4BRY B;  5K5G B;  3AE3 C;  3D6Y A;  2QEX P;  3CX5 D;  2D2C D;  2PP6 A;  1NAY A;  2QJY B;  1LT9 C;  2HFE D;  4KJM A;  4WY4 C;  5APS A;  1NTM D;  2Q1K A;  1HUC A;  1AFO A;  3H1J D;  3L71 J;  1SQQ J;  1H8A A;  2HPC B;  3NFQ A;  1RF0 A;  1DEB A;  2K9J A;  2IFN A;  3VMX A;  1IFM A;  4JPZ B;  4Z1M H;  2WZ7 A;  3I5C A;  1VQ8 P;  3HUS B;  3L74 D;  3T97 A;  1N7S B;  1KQL A;  2JWA A;  1FZB A;  1YQ3 C;  5AW8 B;  1IK7 A;  2KOG A;  3KYQ A;  2OTL P;  3CX5 H;  4NPE A;  2ZXE B;  3OW2 O;  1A02 F;  2Q3I A;  3CL3 D;  2PRR A;  1KIL A;  4H0L D;  3H6P A;  4PD4 I;  1R5L A;  5CJ4 A;  3AEC C;  1M57 D;  2FYU E;  2KZJ A;  2Y0E A;  3A3Y B;  5H2F H;  4EIJ A;  2FBW C;  3HRN A;  4ZNC A;  1NKZ B;  1SQB E;  3AE4 C;  2FYN B;  2IYO A;  4OVN F;  4WY4 A;  1GDT A;  2OYI B;  2JO1 A;  1SQV D;  1P84 I;  2ZT9 D;  1L0N D;  1DD3 A;  1GL2 D;  1P84 E;  1SQX G;  1Q82 Q;  3RL0 g;  1LWU B;  1KFN A;  3I56 P;  3KHU A;  3RK3 C;  4BWN A;  2OGU A;  1J2J B;  1EDI A;  1VQP P;  2FYN C;  5KAI H;  3CPW O;  1NGM B;  1FDO A;  1FDM A;  1NKN A;  2JWD A;  1BDC A;  2A06 D;  1SQQ D;  2E76 B;  4XFJ A;  3V2P A;  3VMZ A;  2BCC G;  1DD4 A;  1NJI Q;  3U1C A;  1KB9 D;  1DIP A;  2P7J A;  1CZQ A;  4D6T J;  1KYO E;  1OW6 A;  1HWT C;  2IBZ D;  1J1D B;  4H13 D;  3PTZ A;  4U3F G;  5AVW B;  1KIL D;  5L8R J;  3BVH A;  1KOR A;  1W5C E;  4GOF A;  5B66 H;  5M1B A;  3W68 A;  1FZC B;  2PFX A;  3BRV B;  1GL2 C;  3PRJ A;  2IBZ E;  3H1K J;  1KYO D;  2NPS A;  3H1H G;  3CCL P;  5APT A;  1X22 A;  2A45 H;  3SWF A;  4EOT A;  1KB9 E;  1M8O B;  4TLF A;  3L70 E;  3V5B A;  1BGY G;  1SFC B;  3AE5 C;  1JY3 P;  1SQQ E;  1NTK D;  2RH0 A;  3H1I J;  1SLQ A;  1USE A;  2KUB A;  2Y0C A;  2E76 C;  2E5Y A;  2K1A A;  3RK3 B;  3S9O A;  3CXH E;  1L0L G;  4IOI H;  4D6T G;  1NH4 A;  1KIL B;  2BCC D;  1VDF A;  2B9B A;  2WSS H;  1EDK A;  2YIU C;  4H13 B;  1CSB A;  4W7Y A;  2OYI C;  1A02 J;  1L0N E;  1NU1 J;  1P84 D;  1SQV E;  1LWU C;  3A7O A;  3MTU E;  4M3L A;  1U7M A;  4BXL A;  3WUV A;  1AQ5 A;  3AEE C;  3IFM A;  2PAJ A;  1FDI A;  4D6T D;  1L0L D;  2RMZ A;  1WRG A;  3V6I A;  4LGD E;  1NO4 A;  2FYU D;  4EI2 A;  3L75 J;  4IL6 X;  2HPC A;  2M0B A;  2OYO A;  5KLV D;  1N73 A;  1G2C B;  1SQV K;  2FY8 A;  2NPS D;  3GLM A;  1N7S C;  4A7P A;  3BAS A;  1FZC A;  1X9V A;  2GUS A;  2CPS A;  2M3E A;  3B71 A;  3EFF K;  2IBZ I;  4WVZ A;  2HOD B;  1E5W A;  3SFE C;  3L74 E;  3VMA A;  1E79 H;  2JDI H;  3H1I G;  4U3F J;  2I8D A;  4WBA A;  4BRY A;  4DJG A;  1S5L E;  3PP5 A;  4HB1 A;  1GW4 A;  3P8C D;  1FS0 E;  2KI7 B;  4DT0 A;  2OTK E;  2ZYD A;  1SP4 A;  4N78 D;  2WSE J;  2WSC J;  1IK9 A;  1FZF A;  3M91 A;  3Q5P A;  3BCC D;  1LT9 B;  2WPQ A;  3RGU A;  1MFT A;  1M1K Q;  2QJK C;  5AW9 B;  2FKW B;  2WTY A;  2BEZ F;  2ZT9 B;  4ZMD A;  4W7Z A;  3AE9 C;  1OFC X;  5TIS H;  1VQM P;  2L91 A;  1PFI A;  5DJU B;  1NTZ K;  4UB8 H;  4C7N A;  3R2P A;  2E75 D;  3RK2 C;  2WVR A;  2J59 M;  1RQV A;  3KDP B;  2OYH A;  2BEQ D;  3N7N A;  3H1K D;  3H1J J;  3A0B E;  1M1J B;  1ZRT E;  2ZXX A;  4JBZ A;  2YIU B;  2O1J A;  1VQO P;  3TK1 A;  1XTC C;  1FAV A;  1FZG A;  2FYZ A;  1T3J A;  3H1K G;  3KZI E;  5AVX B;  3EWK A;  3P32 A;  1KQG B;  2HYN A;  3HUS A;  2JJL A;  1ZR2 A;  2IPP A;  2NZ2 A;  3L75 D;  5CCH D;  5KJ7 C;  3TGU G;  2K9J B;  4PV1 C;  1X0T A;  1LTT C;  1SQB J;  1U7J A;  1FBM A;  1WT6 A;  2W83 C;  5KAI E;  1DX7 A;  3Q1M A;  1RE4 A;  1RE3 A;  2OTJ P;  2FXO A;  2QJP B;  4IL6 E;  2QIW A;  3P8M C;  3E1I A;  3H1J G;  4PJ0 H;  5B66 E;  1P84 H;  2ZFC A;  3BCC G;  1AJY A;  1Q81 Q;  1JUN A;  3B5N C;  2G3A A;  5CCG D;  1KV4 A;  2C0X A;  2WT7 A;  1LTB C;  2NPS C;  1RE3 C;  1R8E A;  3L36 A;  2V7Q H;  3MGN A;  1SQP K;  3FWL A;  4IFF A;  2RKL A;  1LT1 A;  1GK4 A;  2E74 C;  4Y28 J;  3CCJ P;  1LTA C;  2FFD B;  4AUW A;  2XNX A;  1Q86 Q;  1KYO H;  2IX7 C;  3Q2Y A;  1K8A Q;  3C8V A;  2J5U A;  3OAK A;  1JY2 P;  5AW1 B;  3MZW B;  4RO0 A;  5KLV G;  5CHX A;  3HD7 C;  5GTI H;  2HG5 D;  1EQ7 A;  2WSF H;  4LC1 A;  3L73 D;  1NAF A;  2KS1 B;  1PPJ D;  4WB4 A;  2POH A;  1GTW A;  1VPC A;  3G9R A;  4NPD A;  3G71 P;  1JM0 A;  2UWJ E;  3L35 A;  3TYY A;  1IC2 A;  2FYU G;  3L4F A;  3U59 A;  1PP9 D;  3H32 A;  2Y9Z A;  1OX3 A;  1GZL A;  1H0T A;  2OQQ A;  5KKZ B;  2VRS A;  2E5T A;  1PGQ A;  1USD A;  1MKM A;  1S3J A;  1WMK A;  1L0N J;  1NU1 E;  3Q5S A;  4HYT B;  3NTN A;  1JNM A;  1NTK G;  5AVZ B;  3H32 B;  2AXT H;  3BCC J;  1NTZ D;  1OW8 A;  2ZAE B;  3HE4 A;  3PH0 A;  2GA1 A;  2Q6Q A;  1HTL C;  3L73 G;  2YKQ A;  2I1K A;  2LXB A;  3CWB D;  3MUD A;  5APV A;  3SWK A;  5KLV J;  1RF1 A;  1FOS F;  1JO5 A;  2WMM A;  1QVF O;  1URQ C;  1PP9 J;  4K3A A;  3PJS K;  3RBZ A;  4U3F D;  1SQB K;  3P7K A;  1SQQ K;  4GIF A;  2WSF J;  1YIT P;  4I2L C;  5AW4 B;  1N86 A;  4K35 A;  4U3F E;  1URQ B;  3WUT A;  3GHG B;  4ASV A;  5BU8 B;  2KNC A;  2YKO A;  2WPS A;  2R44 A;  3O6Q A;  2AXC A;  3B5N A;  3JSV C;  5KJ7 A;  1OVR A;  3M0D A;  1BCC E;  3I55 P;  1LTJ C;  1QL1 A;  2YNY A;  1SQX J;  3H25 A;  2XZR A;  3CCV P;  1K05 A;  1NTZ E;  1QL2 A;  3V4W A;  4RJT A;  1BGY E;  5CBN A;  3CCE P;  3MD0 A;  3CCM P;  1L4A C;  3AE1 C;  2JKV A;  1BE3 J;  3TNU A;  5AW7 B;  2YXR B;  2DW3 A;  5EFW B;  1JTH B;  2N1T C;  4L75 A;  2BCC J;  1FZE A;  1FJK A;  1SS1 A;  1JY2 N;  2IZ1 A;  1JCD A;  2W6B A;  1NYH A;  2B89 A;  3HE4 B;  2Z5I A;  3H1L G;  5APY A;  1VL2 A;  3TF5 A;  2AEM A;  3WMM 0;  1NTK J;  1RQU A;  5BU5 A;  1K9M Q;  1LTJ B;  3EQ2 A;  5AW6 B;  2M8R A;  1PPJ E;  4H44 D;  1KQS O;  1NOH A;  1Y9B A;  1AA0 A;  3AEG C;  2W90 A;  1D7M A;  3PHL A;  1GW3 A;  3B5N D;  5KAF E;  3K5B A;  5CCG C;  1GMJ A;  3HD7 B;  2Q7C A;  3D71 A;  1W2B O;  2HR3 A;  3KZI H;  1FZA A;  4AQR D;  4JF7 A;  2XDJ A;  5AW3 B;  3MUD C;  1RF1 C;  1NTM G;  3AEA C;  4YXD C;  1HF9 A;  2FFD C;  1QGK B;  1BE3 G;  4I7Z C;  1OMI A;  1UIX A;  2Y9Y A;  1J1E B;  3IAO A;  3L73 J;  1ZW0 A;  4GOD A;  2XKM A;  4OWF A;  5AVY B;  3U1A A;  1GD2 E;  2FYU K;  2E42 A;  1YYC A;  3B5N B;  3VP8 A;  3TGU D;  3V2Q A;  1VQN P;  2GUV A;  2WWW A;  2AEJ A;  2RN0 A;  1QLE D;  1T8Z A;  1NTK K;  2P2U A;  1DEE G;  2KLV A;  3AE6 C;  1L0L J;  3AEF C;  3H1I D;  3KPE A;  1Y47 A;  3L72 G;  3SFD C;  1HJB A;  3H1L D;  3FWN A;  3ZDM A;  3CCS P;  2IZ0 A;  1ZME C;  2B87 B;  3E1R A;  1N73 C;  1JB0 J;  1EZV D;  5GTH E;  1YI2 P;  1ZR4 A;  1L0N K;  3G6E P;  1S2E A;  3C9I A;  2WSE H;  3ITK A;  3L71 E;  4EDF A;  2YMY A;  1LTI C;  2M5A A;  4HJG H;  2CPB A;  1IFP A;  2PGD A;  2QRX A;  3CCR P;  1YIJ P;  3H1K E;  1SQB G;  1AQT A;  2MKV A;  1TU3 F;  3Q3D A;  2G8Y A;  1SQX K;  1N2D C;  3N4X A;  4N3Y B;  1BSH A;  3CCQ P;  1KN7 A;  4OGQ C;  1OVV A;  2QVA A;  4Y99 B;  2ZYA A;  3G4S P;  2ZT9 C;  1YBK A;  2H89 C;  1W2E A;  2P67 A;  2XND H;  1NTM J;  1IZN B;  1BSN A;  3CXH I;  2N9B A;  1LTG C;  4TT3 H;  1CI6 B;  3WU2 H;  2HLO A;  3RBX A;  3VYI A;  1SQP G;  1Q2N A;  3BCC E;  3QWO C;  4N6J A;  1L0L K;  2OYH B;  1GL2 A;  1SQV J;  4R4M A;  4N78 E;  2QJP C;  3CCU P;  4L76 A;  4IL6 H;  1S9K D;  2E75 B;  2IDB A;  2AEF A;  2B88 A;  4C7N B;  3P8C E;  2KB7 P;  3CWB G;  4GKG A;  3A5T A;  2E74 D;  2Y0D A;  1VF5 C;  1KQF B;  3PLN A;  2Q9I A;  3FXD A;  2M5A B;  3LW5 H;  4I6M C;  1JY2 O;  1FOS E;  2E43 A;  5AVR B;  2IBZ G;  3A0H H;  3TNU B;  3H1H E;  3F89 A;  2B87 A;  3GHG A;  3UIA A;  3L70 G;  4H44 B;  4OH8 B;  1ZXG A;  4B86 A;  1SQQ G;  5KLV E;  1PP9 G;  1BCC J;  3A0H E;  5KTB A;  3W67 A;  2IYP A;  1SQX E;  1N7L A;  3CI9 A;  2N1T D;  2JP3 A;  3RK3 D;  1NTZ J;  2P58 A;  1L0L E;  4D6T E;  1NTM K;  3O8Z A;  2WSC H;  5GTH H;  1X8Y A;  1LNQ A;  3RK3 E;  1JY3 N;  5KAF H;  1L0N G;  1SQX D;  1IJD B;  2KZI A;  3AE8 C;  3SWY A;  5KLI C;  4ZKU A;  4JYC A;  2BCC E;  3CC7 P;  1EDL A;  2GM4 A;  2WQY C;  1T6A A;  3CXH D;  4H13 C;  1LJ2 A;  4QMA A;  2Z4E A;  3H1H D;  2R3S A;  2W6A A;  4ZKP A;  1NTK E;  1CI6 A;  1S1C X;  3FGA D;  1VQ5 P;  3AED C;  3L70 D;  3M06 A;  1RH5 B;  1SFC C;  2E75 C;  1KC8 Q;  4R4L A;  5AVQ B;  4XE5 B;  1VF5 B;  1GU5 A;  4IFD K;  1S9K E;  3R4Y A;  1QEX A;  3L74 G;  1J1D C;  1KIL E;  1PIX A;  3CMA P; 
#chains in the Genus database with same CATH homology
 1BE3 G;  3CXH H;  1NTK G;  4U3F G;  3L71 G;  3CX5 H;  3L73 G;  1EZV G;  1BCC G;  1L0N G;  1SQV G;  3H1H G;  3H1L G;  3L75 G;  1SQP G;  1KYO H;  3H1K G;  1NTZ G;  3H1I G;  1BGY G;  3L72 G;  5KLV G;  1NU1 G;  1KB9 H;  1SQX G;  3TGU G;  3CWB G;  1L0L G;  4D6T G;  2A06 G;  2IBZ G;  2FYU G;  3H1J G;  1P84 H;  1NTM G;  3BCC G;  3L74 G;  1SQB G;  4PD4 H;  2BCC G;  3L70 G;  1PPJ G;  1SQQ G;  1PP9 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...