1RF0A

Crystal structure of fragment d of gammae132a fibrinogen
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
64
structure length
64
Chain Sequence
IEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Calcium-Binding Site beta2, Adjacent to the "b" Polymerization Site, Modulates Lateral Aggregation of Protofibrils during Fibrin Polymerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 23
structure length 64
sequence length 64
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1rf0A00
1JY2P 1RF0C 1LTJC 2OYIA 1FZCA 1LTJA 1RF0A 1JY2O 2FFDB 1FZGA 1RF1A 2Z4EA 2OYIC 1FZBA 1W2EA 1LWUB 1JY3N 2OYIB 2Q9IA 1FZCB 2HPCA 2A45I 1RF1C 2A45G 1JY3O 2FFDC 1M1JB 3H32A 1RE4A 1LTJB 1JY2N 3GHGC 2HODB 1T3UA 2OYHA 3HUSC 2H43A 1LWUA 1LT9B 3E1IA 2HPCB 1FZFA 1N86A 1N73C 1M1JC 1LT9C 2XNXA 2OYHC 1LT9A 1M1JA 3H32B 3HUSB 1RE3C 3BVHA 2FFDA 1JY3P 3GHGB 2OYHB 2HODA 1FZCC 1LWUC 1N73B 1RE3A 2A45H 3HUSA 1FZEA 3GHGA 1FZAA 1RF1B 1RE4C 2HLOA 1N73A
chains in the Genus database with same CATH superfamily
1J2JB 5AVWB 3A0HE 3MGNA 2KUBA 5APVA 1XTGB 4GOEA 1W2EA 3A2AA 2O3JA 2P67A 4XFJA 1SQBD 2GUSA 2ZT9B 1SQVK 2K9YA 4OWFA 1KQGB 3CCSP 2DW3A 1K9MQ 1RH5B 2M0BA 1K73Q 5H2FE 1X9VA 4HJGH 3N7NA 1L0LE 2KNCA 1KQFB 1X0TA 3TYYA 3K5BA 2BCCG 1HTLC 1KILC 4DOJA 4EOTA 3PH0A 3HRNA 2QJYC 1Y47A 3PP5A 1BDDA 1NU1J 2JWDA 3IAOA 5APYA 2HPCB 1FZFA 1URQA 1ZR2A 1KV4A 1LT9A 3HD7A 1YQ4C 5KAIH 3HUSB 2WSFJ 2FFDA 2BEQD 3I5CA 2W6AA 3AE8C 1EQ7A 1RQVA 2L5GB 2W6BA 4ZKPA 3Q5PA 1LNQA 2R5DA 3VMYA 3A0BE 2HFED 1SQXG 2WPSA 2HLOA 3CCUP 1AFOA 1Q2NA 3VTPC 3A7OA 1H89A 2OTJP 3R4YA 3AE5C 1FJKA 2Z4EA 2KYVA 4KT0J 1N7LA 4L73A 4L75A 4RO0A 3L73D 2MJZA 1ZXGA 3D71A 1NTZE 2QEXP 4WY4A 5GTIH 3TGUJ 2YKQA 4DT0A 5CCGC 1OWAA 1NH4A 2XZRA 3O6QA 2A06G 5AVXB 1IZNB 2WSCH 2JKVA 2QIWA 1BGYG 1YTZT 5TJHA 5K5GB 1VQ4P 3L70G 1VQ8P 3VOPA 1ZN5A 5AW1B 3H1LE 1SQPG 2QSIA 1PV3A 4N78D 1M1JC 5AVTB 1QLED 4I6MC 4PJ0E 3CCMP 2KNCB 3CCQP 1NTKG 1PL5A 2WPVB 3KHUA 3M9HA 1YIJP 1PFIA 2WT7A 1EDJA 1L0LG 2BASA 3VMAA 4EDFA 2E76C 1L0NG 1N7SC 3H1LJ 1FZAA 4GKGA 1SFCC 4TLFA 1KQSO 2I8DA 1FE6A 3HTKA 5AW9B 3S4RA 4GOFA 5CJ4A 1Q81Q 1N73A 1AQ5A 1W5CE 2PP6A 2K1AA 1OMIA 3L74G 3L75J 4BRYA 2K9JB 2POHA 4OH8B 2MKVA 3I55P 1GK4A 1LTBC 2FXPA 2KZIA 5GTHE 3WU2E 3H1KJ 2ITAA 3CX5H 1GW3A 1IC2A 2K9JA 2IYOA 3BCCD 2H7HA 3M06A 2W83C 3M9QA 3RBZA 2YXRB 3L35A 3CCVP 1GW4A 4EI2A 1BDCA 2IBZG 1LT9B 3HD7B 5AW0B 3SWKA 1VQLP 3G3ZA 1JCDA 1YJ9P 1ZR4A 5KLVG 1VQOP 2KOGA 3H32B 1WT6A 3AEEC 1Q90D 2YO2A 3CX5D 3CCEP 4HKZH 5APXA 4LLHA 1GTWA 2OTLP 1SQPJ 1KYOD 4IL6H 1NU1G 1J1DB 1FU1A 2IBZI 5C39A 3CLQA 1EZVD 2KXPB 3H1JE 1OFCX 4NPFX 1NJIQ 1Q82Q 4WY4C 3LW5J 1L0LJ 1LT1A 1M1KQ 2FYUJ 1L4AA 1JB0J 2YO3A 5B66H 1NTMJ 2P58A 3HD7D 2Y9YA 1VQNP 2ZAEB 3MZWB 2OTKE 1IK9A 4H13D 1KORA 1YBKA 5CCHA 1EZVI 1L2PA 4WWIA 4BRYB 2R3CA 1S3JA 2AEMA 1BGYJ 1BE3G 2PAJA 5AVYB 4CPGA 5BU5A 3Q5RA 1KZUB 2KK7A 4GODA 2XKMA 5CCGD 1EC5A 3TNUA 2NPSC 4I7ZB 1KB9I 3D70A 2B89A 1LGHB 3H1HD 1JY3P 3L71J 3MHVA 2HODA 2M5AB 3KPEA 1OW8A 3GF3A 1QX8A 4W7ZA 2RN0A 1N73B 1NTZK 3VP8A 4ZKUA 1QVFO 1OX3A 1QVGO 2HR3A 1R5SA 4YTPC 1KYOE 2B9BA 4JYCA 1JUNA 1JCCA 3QH9A 4D6TE 1AVYA 1KILD 3A0BH 5APUA 2KZJA 4H13B 5AW4B 1EZVE 3H1JD 5E79H 1S5LH 1H0TB 5BVZA 2Q7CA 3TSIA 3TDKA 2Y9ZA 2KB7P 1EDKA 2N9YB 3WU2H 2FYUG 1NTKJ 3WUVA 2QG4A 4PV1B 2JR8A 1RE4A 2JDIH 2OARA 3V2RA 1M90Q 1NVOA 1T3UA 2OYHA 1U7JA 2RH0A 2I1JA 4H44C 4N6JA 1YHQP 3KXDA 1NTME 4PJ0H 4C46A 2H43A 2IYPA 2R44A 4K3AA 1N86A 4JYBA 2GUVA 1S5LE 5E79E 2WQYC 1PP9J 1FAVA 1KN7A 3L37A 1W2BO 3CXHD 5KAIE 4UB8H 1VF5B 2FYUK 3JSVC 1KILB 1IFIA 4IL6E 4RKUJ 3FWLA 3HTKB 1RE3A 1BE3J 1LP1A 2A45H 2G3AA 3CI9A 3H1HE 5APSA 3L72D 1S9KE 3B5NB 5B5EH 1HUCA 2YMYA 1RF0A 1YQ3C 4PV1D 4AQRD 3LIDA 1T6AA 3G71P 2FFDB 1FBMA 3SFEC 1JY3N 4A7PA 2Q9IA 1L0NE 4JPZB 1L0LD 3WMM0 1AVOA 3RGUA 1OZHA 4IOIH 3CWBJ 3KZIE 2SPZA 1NKZB 2W6JH 1R8EA 3S1KA 3TGUD 2IFNA 2A06E 1KILE 1WRGA 3CWBE 2Z5HA 5M1BA 3GHGC 1SS1A 3TK1A 2QE7H 2ZXEB 1BCCD 1N7SB 1NO4A 1L0NJ 1VF5D 3H1LG 1P84I 1JOCA 5KJ7A 1JTHB 1OIPA 3M0DA 1N8RQ 3JCUH 1FDIA 1SQVJ 3B5ND 4XE5B 3EFGA 2B87B 2JP3A 3MUDA 1NTMD 4YXWH 1ZMEC 3AE4C 4R4LA 1SQBJ 1HGVA 2E5YA 4H13C 4WBAA 1KC8Q 3Q3DA 1DH3A 1VQ9P 2YIUB 3V2PA 2AEJA 1Q86Q 3BRTB 5KLVK 1VQMP 1KD1Q 3IR9A 2WMMA 1S9KD 2ZVOB 1JMBA 3L74E 1URQC 1UIIA 1N7SD 5KLVE 1BCCJ 2A45G 1SQXD 1NTKD 2FFDC 2N1TA 2ZYAA 1MV8A 3CD6P 3B5NC 1GZLA 1ZRTE 4GDOA 3VN0A 3TGUE 1KB9E 3L73G 4KHXA 3PLNA 1KTMA 1SLQA 2A06D 3OAKA 1RE3C 2C0XA 2J58A 3GMAA 5GTIE 1VQ6P 2C0WA 3SWYA 3OA7A 1IFNA 1BSNA 3TNUB 3V4WA 2GM4A 1IFDA 5AVVB 3CMAP 1AQTA 1BE3D 3Q1MA 3EFFK 1NTZG 1RY3A 1VDFA 1OW6A 3PTZA 3SFDC 1PGPA 2R3SA 1KQLA 3OW2O 1J1DC 2K37A 4I2LC 4LGDE 4PV1C 3GW6A 1L0NK 2KS1B 1BGYE 3Q5SA 3CCRP 3I56P 1L0LK 2QRXA 2WSEH 3RK3D 1GL2C 1MUUA 4L76A 4BXLA 1Y9BA 1RF1C 1JTHA 1OVRA 1RQUA 1DEEG 1NTKK 3AE7C 4R4MA 3RL0D 3SSUA 2JEEA 3U1AA 2J5UA 5KLVD 1LTGC 1NTKE 1NYHA 5DJTB 5KJ7C 3CCJP 3EQ2A 2FYUE 1PGQA 1N73C 2W27A 3VYIA 3AEDC 1KB9D 3H1JJ 5AVQB 2KI7B 1DD4A 1T3JA 1DD3A 1WMKA 4IL6X 3RK2C 4ZMDA 5CCHD 1VPCA 1CI6B 1S4XA 1NTMK 3B4SA 3P7KA 4YXDC 4ASWA 4GIFA 1QL2A 2P1JA 3CL3D 2ZVNB 4W80A 2V4HA 2E75B 3V2QA 3RK3B 3W67A 3L71E 1LTJC 5CCGA 2RKLA 3RL0B 1M56D 1P84D 3P8CE 1MFZA 3FXEA 2O01H 2YNYA 3KZIH 4UB6H 5AVZB 1UIXA 2FYNC 1DEBA 2N1TC 2Q3EA 2RMZA 3O8ZA 3AEFC 4WVZA 1USDA 1JY3O 3CPWO 1M1JB 3GF7A 4Y28J 3AEAC 4ASVA 3RK2B 4C7NB 3D6YA 3AE2C 1NTZJ 2LKMA 2O1KA 2ZFCA 2XDJA 5AVUB 4DCKA 4RJTA 3A5TA 3L75E 4B86A 2M3EA 3E1IA 2W90A 1GK6A 3H1IJ 4KJMA 4LC1A 1A02F 2E43A 4UB6E 4IFDK 3EWKA 2B87A 1FS0E 1N7SA 3M0DC 2E75D 1IK7A 3CWBG 5B66E 3TGUG 3H1JG 3MP7B 2E42A 4JBZA 1H0TA 1PPJE 2E76D 4OVNF 1RHZB 3HE4B 2FYUD 2QJKC 3H1LD 3AE9C 3NFQA 4RESB 3CC4P 4N78E 1RF1B 1SQPK 3HE4A 1JY2P 2OYIA 1X79B 2E74B 1FZCA 3CCLP 1PIXA 1JY2O 1KFNA 1RF1A 3RK2D 2NPSA 3L4FA 2QA4P 2OYIB 2C9LY 1NTMG 1URQD 2O01N 3FXDA 1P84E 1GL2D 1YYCA 2JO1A 3P8CD 4TT3H 3B8EB 3ITKA 1KMIZ 1PZQA 2Q6QA 3PRJA 2V7QJ 3NXSA 1YI2P 3AEBC 3II6A 5B5EE 1ZLLA 2QJPB 3QWOC 1JMMA 1YJNP 2E76B 1GU5A 1ZV8A 1OVVA 2YXQB 3CXHE 3HE5A 4PD4I 4U3FE 5CHXA 3SWFA 2P2UA 1KILA 2WZ7A 2XNXA 1SQQJ 3L75D 1M1JA 4I1LA 1LP1B 3W68A 1GDTA 1HWTC 2E74D 3E7KA 3H1KD 4IFFA 5KLIB 4DZOA 1PGJA 3LW5H 1FZEA 1SFCA 2FXMA 1MKMA 2UWJE 5AW7B 1PPJD 4EYYQ 1NOHA 1MZ9A 1URQB 1RE4C 2JWAA 2WSEJ 2WT7B 1GL2B 2KSJA 3V5BA 2IPPA 2FKWB 4ZNCA 3M9BA 1ZP0C 1AA0A 1BCCG 1S2EA 1LTSC 1LWUB 5CCHC 1FC2C 1X22A 1J1EB 3CXHI 4PD4E 1EDLA 2XU6A 1U7MA 4Z1MH 2YMKA 1IFMA 5CBOA 2FYZA 2QM8A 1IJDB 1G2CA 1JY2N 3BATA 2B88A 5TISE 1HH0A 1KFMA 3AE6C 2NZ2A 3RL0g 1YJWP 3MD0A 4D6TG 5KKZB 4C7RA 2LXBA 2H88C 2YKPA 2V7QH 1SQVG 2QJPC 3MIWA 1Y8AA 3AECC 1VQ7P 2WSSH 1MFTA 4PD4H 1SQQG 3GHGB 3UIAA 2WTYA 1KYOI 3WUUA 2LXCB 1VQKP 3ABVC 4U3FJ 4WY4B 4HB1A 3GHGA 3H1IE 1BSHA 3KDPB 1VL2A 2IFMA 1YTZI 1J1EC 1HBWA 1FDMA 1LTJA 2VRSA 3KQGA 2JJLA 2XNDH 3C1LA 4U3FG 3E1RA 1FZBA 3NTNA 1L4AC 2E74C 1OW7A 1IO4A 2NRGA 1E5WA 2HYNA 1YITP 2IX7C 1CZQA 3C8VA 4UB8E 4AUWA 2Y0EA 2XV5A 2YIUC 5CMZA 2Q5UA 2HG5D 2FBWC 1SQXK 1X8YA 5KLIC 3CX5E 3L73J 1R5LA 2WWWA 2IZ1A 3L70J 1LWUA 2FY8A 5AW6B 4U7JA 3VP9A 4Y99C 4PD4D 2W8ZA 1GD2E 3GG2A 4WY4D 4OGQB 3S9OA 3M0AA 3G6EP 4M3LA 3F89A 2NPSD 3M91A 4OGQC 4H0LD 1ZOYC 5KTBA 1PP9E 1LTIC 3AE3C 1S72P 1QEXA 3B71A 5AW8B 2E5TA 2FYNB 1Z56A 1OXZA 1QGKB 4JQ0D 2C9NY 1SQXJ 2L91A 1BGYD 3KYQA 5TISH 2OYIC 1NHLA 2CPSA 2WSCJ 2Y0CA 5CBNA 1FZGA 5AW3B 1SQVE 1JEKA 3PHLA 2A45I 3RK3C 2E75C 3FGAD 3L72E 3L73E 4XA4A 1JM0A 1NGMB 3MTUE 1QL1A 1NTZD 1OVUA 4NPDA 2H89C 3ZDMA 5BU8B 5APWA 3H1IG 3BRVB 4OGQD 2AEFA 4MN4C 2Q3IA 1VF5C 1DX7A 2P7JA 3IFMA 2NPSB 1NAYA 1L0ND 2N9BA 4GT1A 4H0LB 4I7ZC 1HVVA 2BCCJ 2ZYGA 3BASA 4HYTB 1K04A 3VMZA 3G4SP 2D2CB 1HJ0A 2WVRA 1CI6A 3V2NA 3L71G 2OGUA 1NAFA 4L74A 1ZW0A 2J59M 2PFXA 4YPCA 1H88A 3Q2YA 1SP4A 2I1KA 2QM7A 1M7LA 1GL2A 1M57D 1LJ2A 2WPRA 3G9RA 4D6TJ 5KAFE 2KLVA 3D6ZA 1RF0C 2N1TB 5AW5B 5KJ7D 2BCCD 1GU4A 1GMJA 1S1CX 3CC2P 3IN6A 1DIPA 1PP9D 5APQA 1EDIA 3H1KG 3B5NA 1T2KD 1Q7YQ 3H25A 2K88A 2O1JA 2CPBA 2OQQA 3P8MC 1SQVD 1FJPA 1JO5A 2KS1A 3U59A 2D2CC 2D2CD 3F5HA 2O01J 1KB9H 5AVSB 2P10A 3L72J 2WPQA 1NKNA 5H2FH 1A02J 1SFCD 3AEGC 1KYOH 2IZ0A 3BCCE 3L74D 1D7MA 1H8AA 1SQBG 3IF4A 1EZVG 2KLUA 3USSA 1SQPE 1LT9C 1FDOA 1SQXE 1USEA 3HD7C 4IFMA 2OYHC 1FOSE 2OYOA 5GTHH 2N1TD 2ZXXA 3MUDC 1NWQA 2OYHB 3R2PA 5AVRB 4QMAA 2QVAA 2LR2A 2IDBA 2M3BA 2WSFH 3AE1C 1EXJA 4K35A 2PGDA 3V6IA 4W7YA 1SQQE 1G2CB 3CWBD 3CXHH 1IFPA 3L70D 1CW5A 1NU1K 2BCCE 1BCCE 1LTTC 1NU1E 1K05A 2Y0DA 1FZCB 1SFCB 3BCCJ 3L75G 1SQQK 3L74J 4WB4A 5DJUB 1VQ5P 4AYCA 3H1HG 1AV1A 3U1CA 1T2KC 3CC7P 1LTAC 1HF9A 4Y99B 3A0HH 4U3FD 5AW2B 2QJKB 4C7NA 2IBZE 2BEZF 2R32A 5KLVJ 3H1KE 1CSBA 2Z5IA 3TF5A 1SVFA 3FWNA 2GA1A 1VQPP 1P84H 3JC22 3BVHA 1AJYA 3CX5I 1SQBK 3V4QA 4EIJA 1T8ZA 1L4AB 2AXTE 2KIKA 3C9IA 2YKOA 3HUSA 4H0LC 2KSEA 2G8YA 1E79H 1SQPD 4H44D 5KAFH 5EFWB 1G1JA 5APTA 1M8OB 3H6PA 1SQBE 1IFJA 4NPEA 1PGOA 1TU3F 1ZRTD 2H8PD 2KP8A 2ZYDA 2K3RA 1N2DC 3A3YB 1S5LX 3T97B 3VMXA 4D6TD 2HPCA 2Q1KA 3JCUE 3L70E 2ZJSE 1PPJG 3L71D 2AXTH 2WITA 3H32A 3RL0C 3T97A 1JNMA 1SQQD 1LTJB 2HODB 2M5AA 2ZT9D 3HUSC 3P32A 1G1IA 5KKZC 2FXOA 4JF7A 4DJGA 1NU1D 1FOSF 3L72G 1HJBA 1L4AD 2CK3H 3LIEA 1BE3E 1U57A 3H1HJ 3O6QB 3FX0A 3PJSK 2QJYB 1HGZA 1XTCC 4H44B 4O9BA 4BWNA 3OJAB 3HE5B 3BCCG 1EXIA 3CMEP 3NMDA 2PRRA 1PP9G 3H1ID 5CJ0A 2R5BA 3WUTA 3N4XA 4N3YB 1LWUC 5L8RJ 3RBXA 1K8AQ 1FZCC 3GLMA 2AXCA 3L36A 3RK3E 2IBZD 4HH2A 2M8RA 2ZT9C
chains in the Genus database with same CATH topology
1J2JB 5AVWB 3MGNA 5APVA 1XTGB 1W2EA 3A2AA 2P67A 2GUSA 1SQVK 1X9VA 3TYYA 3N7NA 1HTLC 1KILC 4DOJA 4EOTA 3HRNA 3PP5A 5APYA 2HPCB 1FZFA 1URQA 1ZR2A 1LT9A 3HD7A 3HUSB 2FFDA 3I5CA 2W6AA 1EQ7A 2L5GB 2W6BA 4ZKPA 2R5DA 3VMYA 2HFED 2WPSA 2HLOA 1AFOA 3VTPC 3A7OA 1H89A 1FJKA 2Z4EA 2KYVA 1N7LA 2MJZA 4WY4A 2YKQA 5CCGC 1OWAA 1NH4A 2XZRA 5AVXB 2WSCH 1YTZT 3VOPA 1ZN5A 5AW1B 4N78D 5AVTB 1M1JC 4I6MC 1PFIA 3M9HA 2WT7A 2BASA 1N7SC 1FZAA 4GKGA 1SFCC 5AW9B 1N73A 3HTKA 5CJ4A 1AQ5A 2PP6A 2POHA 4OH8B 1GK4A 1LTBC 1GW3A 1IC2A 2H7HA 3M06A 3M9QA 3L35A 1GW4A 5AW0B 1LT9B 3HD7B 3G3ZA 1JCDA 1ZR4A 2KOGA 3H32B 1WT6A 2YO2A 5APXA 1GTWA 4LLHA 1J1DB 1FU1A 3CLQA 4WY4C 1L4AA 2YO3A 3HD7D 1IK9A 5CCHA 2R3CA 2PAJA 5AVYB 1KZUB 2XKMA 5CCGD 3TNUA 2NPSC 1LGHB 1JY3P 2HODA 3KPEA 1N73B 4W7ZA 1NTZK 3VP8A 4ZKUA 4JYCA 1JCCA 1KILD 5APUA 5AW4B 2Q7CA 3TSIA 2KB7P 1RE4A 2OARA 3V2RA 2OYHA 1FJPA 1T3UA 4N6JA 2I1JA 2H43A 4C46A 1N86A 4JYBA 2GUVA 1FAVA 3L37A 2FYUK 1KILB 1IFIA 3HTKB 1RE3A 2A45H 5APSA 3CI9A 1S9KE 3B5NB 1HUCA 2YMYA 1RF0A 1A02J 4AQRD 2FFDB 3LIDA 1FBMA 1JY3N 2Q9IA 3WMM0 1NKZB 2IFNA 1WRGA 3TK1A 2Z5HA 3GHGC 2ZXEB 1N7SB 1NO4A 1JOCA 5KJ7A 1JTHB 3M0DA 3B5ND 4XE5B 3EFGA 3MUDA 1DX7A 1JUNA 1HGVA 4WBAA 1DH3A 3V2PA 3BRTB 5KLVK 3IR9A 1S9KD 1URQC 1N7SD 2A45G 2FFDC 2N1TA 1MV8A 3B5NC 1GZLA 3VN0A 4KHXA 1SLQA 3OAKA 1RE3C 2C0XA 2J58A 2C0WA 3SWYA 3OA7A 1IFNA 3TNUB 3V4WA 2GM4A 1IFDA 5AVVB 1VDFA 1RY3A 1KQLA 1J1DC 4LGDE 4I2LC 1L0NK 1L0LK 2WSEH 3RK3D 1RF1C 1GL2C 1MUUA 1JTHA 1NTKK 3RL0D 2JEEA 3U1AA 1LTGC 5KJ7C 3EQ2A 1N73C 2W27A 3VYIA 5AVQB 1T3JA 3RK2C 5CCHD 1VPCA 1CI6B 1NTMK 3P7KA 4GIFA 1QL2A 2P1JA 3CL3D 4W80A 3V2QA 3RK3B 1LTJC 5CCGA 5BVZA 3RL0B 3P8CE 5AVZB 1MFZA 2O01H 2YNYA 1DEBA 2N1TC 3O8ZA 1JY3O 1M1JB 3RK2B 4C7NB 1FOSF 2LKMA 2O1KA 2ZFCA 2XDJA 5AVUB 3A5TA 4B86A 3E1IA 1A02F 1GK6A 4LC1A 2E43A 4IFDK 1N7SA 3M0DC 2E42A 3HE4B 3NFQA 4RESB 4N78E 1RF1B 1SQPK 3HE4A 1JY2P 2OYIA 1X79B 1FZCA 1JY2O 1KFNA 1RF1A 3RK2D 2NPSA 3L4FA 2OYIB 2C9LY 1URQD 1YYCA 1GL2D 3P8CD 3B8EB 3NXSA 3II6A 1ZLLA 1JMMA 1GU5A 1ZV8A 3HE5A 5CHXA 3SWFA 2P2UA 1KILA 2WZ7A 2XNXA 1GDTA 4I1LA 1M1JA 1HWTC 4IFFA 4DZOA 3LW5H 1FZEA 1SFCA 2FXMA 5AW7B 1NOHA 1MZ9A 1URQB 1RE4C 2WT7B 1GL2B 2KSJA 3V5BA 2IPPA 2FKWB 3M9BA 1LTSC 1LWUB 5CCHC 1J1EB 2XU6A 1IFMA 2FYZA 2QM8A 1IJDB 1G2CA 1JY2N 3BATA 1HH0A 1KFMA 3MD0A 4C7RA 2YKPA 3MIWA 3GHGB 3UIAA 2WTYA 4WY4B 3GHGA 3KDPB 2IFMA 1YTZI 1J1EC 1HBWA 1FDMA 1LTJA 2VRSA 3KQGA 2JJLA 1IO4A 1FZBA 3NTNA 1L4AC 1E5WA 2HYNA 2IX7C 1CZQA 4AUWA 2XV5A 5CMZA 2Q5UA 2HG5D 1SQXK 1X8YA 2WWWA 5AW6B 3VP9A 1LWUA 4Y99C 1GD2E 4WY4D 3M0AA 4M3LA 3M91A 2NPSD 5KTBA 1LTIC 5AW8B 1Z56A 1OXZA 2C9NY 3KYQA 2OYIC 1NHLA 2CPSA 1FZGA 5AW3B 2A45I 3RK3C 4XA4A 3MTUE 1QL1A 1T2KD 5BU8B 5APWA 3BRVB 2Q3IA 2P7JA 3IFMA 2NPSB 4GT1A 2N9BA 5BU5A 1HVVA 3BASA 4HYTB 3VMZA 1CI6A 3V2NA 1H88A 1NAFA 2J59M 1SP4A 2I1KA 2QM7A 1M7LA 1GL2A 2WPRA 2KLVA 1RF0C 2N1TB 5AW5B 5KJ7D 1GU4A 5APQA 3B5NA 2O1JA 2CPBA 3P8MC 1JO5A 3U59A 5AVSB 2WPQA 1NKNA 1SFCD 1H8AA 1LT9C 3HD7C 2OYHC 4IFMA 1FOSE 2N1TD 2OYHB 1NWQA 3R2PA 5AVRB 2M3BA 2WSFH 4W7YA 1G2CB 1CW5A 1NU1K 1FZCB 1LTTC 1SFCB 1SQQK 4WB4A 4AYCA 3U1CA 1T2KC 1LTAC 4Y99B 5AW2B 4C7NA 2R32A 1CSBA 2Z5IA 1SVFA 3BVHA 1SQBK 3V4QA 4EIJA 1T8ZA 1L4AB 3C9IA 3HUSA 2YKOA 1G1JA 5APTA 3H6PA 1IFJA 2KP8A 2H8PD 1N2DC 3A3YB 3VMXA 2HPCA 3RL0C 2WITA 3H32A 1JNMA 3T97A 1LTJB 2HODB 3HUSC 3P32A 1G1IA 4JF7A 1HJBA 1L4AD 3LIEA 4O9BA 1HGZA 1XTCC 3OJAB 3HE5B 3NMDA 5CJ0A 2R5BA 1FZCC 3N4XA 4N3YB 1LWUC 3L36A 4HH2A 2M8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY2 P;  1RF0 C;  1LTJ C;  2OYI A;  1FZC A;  1LTJ A;  1RF0 A;  1JY2 O;  2FFD B;  1FZG A;  1RF1 A;  2Z4E A;  2OYI C;  1FZB A;  1W2E A;  1LWU B;  1JY3 N;  2OYI B;  2Q9I A;  1FZC B;  2HPC A;  2A45 I;  1RF1 C;  2A45 G;  1JY3 O;  2FFD C;  1M1J B;  3H32 A;  1RE4 A;  1LTJ B;  1JY2 N;  3GHG C;  2HOD B;  1T3U A;  2OYH A;  3HUS C;  2H43 A;  1LWU A;  1LT9 B;  3E1I A;  2HPC B;  1FZF A;  1N86 A;  1N73 C;  1M1J C;  1LT9 C;  2XNX A;  2OYH C;  1LT9 A;  1M1J A;  3H32 B;  3HUS B;  1RE3 C;  3BVH A;  2FFD A;  1JY3 P;  3GHG B;  2OYH B;  2HOD A;  1FZC C;  1LWU C;  1N73 B;  1RE3 A;  2A45 H;  3HUS A;  1FZE A;  3GHG A;  1FZA A;  1RF1 B;  1RE4 C;  2HLO A;  1N73 A; 
#chains in the Genus database with same CATH topology
 1J2J B;  5AVW B;  3A0H E;  3MGN A;  2KUB A;  5APV A;  1XTG B;  4GOE A;  1W2E A;  3A2A A;  2O3J A;  2P67 A;  4XFJ A;  1SQB D;  2GUS A;  2ZT9 B;  1SQV K;  2K9Y A;  4OWF A;  1KQG B;  3CCS P;  2DW3 A;  1K9M Q;  1RH5 B;  2M0B A;  1K73 Q;  5H2F E;  1X9V A;  4HJG H;  3N7N A;  1L0L E;  2KNC A;  1KQF B;  1X0T A;  3TYY A;  3K5B A;  2BCC G;  1HTL C;  1KIL C;  4DOJ A;  4EOT A;  3PH0 A;  3HRN A;  2QJY C;  1Y47 A;  3PP5 A;  1BDD A;  1NU1 J;  2JWD A;  3IAO A;  5APY A;  2HPC B;  1FZF A;  1URQ A;  1ZR2 A;  1KV4 A;  1LT9 A;  3HD7 A;  1YQ4 C;  5KAI H;  3HUS B;  2WSF J;  2FFD A;  2BEQ D;  3I5C A;  2W6A A;  3AE8 C;  1EQ7 A;  1RQV A;  2L5G B;  2W6B A;  4ZKP A;  3Q5P A;  1LNQ A;  2R5D A;  3VMY A;  3A0B E;  2HFE D;  1SQX G;  2WPS A;  2HLO A;  3CCU P;  1AFO A;  1Q2N A;  3VTP C;  3A7O A;  1H89 A;  2OTJ P;  3R4Y A;  3AE5 C;  1FJK A;  2Z4E A;  2KYV A;  4KT0 J;  1N7L A;  4L73 A;  4L75 A;  4RO0 A;  3L73 D;  2MJZ A;  1ZXG A;  3D71 A;  1NTZ E;  2QEX P;  4WY4 A;  5GTI H;  3TGU J;  2YKQ A;  4DT0 A;  5CCG C;  1OWA A;  1NH4 A;  2XZR A;  3O6Q A;  2A06 G;  5AVX B;  1IZN B;  2WSC H;  2JKV A;  2QIW A;  1BGY G;  1YTZ T;  5TJH A;  5K5G B;  1VQ4 P;  3L70 G;  1VQ8 P;  3VOP A;  1ZN5 A;  5AW1 B;  3H1L E;  1SQP G;  2QSI A;  1PV3 A;  4N78 D;  1M1J C;  5AVT B;  1QLE D;  4I6M C;  4PJ0 E;  3CCM P;  2KNC B;  3CCQ P;  1NTK G;  1PL5 A;  2WPV B;  3KHU A;  3M9H A;  1YIJ P;  1PFI A;  2WT7 A;  1EDJ A;  1L0L G;  2BAS A;  3VMA A;  4EDF A;  2E76 C;  1L0N G;  1N7S C;  3H1L J;  1FZA A;  4GKG A;  1SFC C;  4TLF A;  1KQS O;  2I8D A;  1FE6 A;  3HTK A;  5AW9 B;  3S4R A;  4GOF A;  5CJ4 A;  1Q81 Q;  1N73 A;  1AQ5 A;  1W5C E;  2PP6 A;  2K1A A;  1OMI A;  3L74 G;  3L75 J;  4BRY A;  2K9J B;  2POH A;  4OH8 B;  2MKV A;  3I55 P;  1GK4 A;  1LTB C;  2FXP A;  2KZI A;  5GTH E;  3WU2 E;  3H1K J;  2ITA A;  3CX5 H;  1GW3 A;  1IC2 A;  2K9J A;  2IYO A;  3BCC D;  2H7H A;  3M06 A;  2W83 C;  3M9Q A;  3RBZ A;  2YXR B;  3L35 A;  3CCV P;  1GW4 A;  4EI2 A;  1BDC A;  2IBZ G;  1LT9 B;  3HD7 B;  5AW0 B;  3SWK A;  1VQL P;  3G3Z A;  1JCD A;  1YJ9 P;  1ZR4 A;  5KLV G;  1VQO P;  2KOG A;  3H32 B;  1WT6 A;  3AEE C;  1Q90 D;  2YO2 A;  3CX5 D;  3CCE P;  4HKZ H;  5APX A;  4LLH A;  1GTW A;  2OTL P;  1SQP J;  1KYO D;  4IL6 H;  1NU1 G;  1J1D B;  1FU1 A;  2IBZ I;  5C39 A;  3CLQ A;  1EZV D;  2KXP B;  3H1J E;  1OFC X;  4NPF X;  1NJI Q;  1Q82 Q;  4WY4 C;  3LW5 J;  1L0L J;  1LT1 A;  1M1K Q;  2FYU J;  1L4A A;  1JB0 J;  2YO3 A;  5B66 H;  1NTM J;  2P58 A;  3HD7 D;  2Y9Y A;  1VQN P;  2ZAE B;  3MZW B;  2OTK E;  1IK9 A;  4H13 D;  1KOR A;  1YBK A;  5CCH A;  1EZV I;  1L2P A;  4WWI A;  4BRY B;  2R3C A;  1S3J A;  2AEM A;  1BGY J;  1BE3 G;  2PAJ A;  5AVY B;  4CPG A;  5BU5 A;  3Q5R A;  1KZU B;  2KK7 A;  4GOD A;  2XKM A;  5CCG D;  1EC5 A;  3TNU A;  2NPS C;  4I7Z B;  1KB9 I;  3D70 A;  2B89 A;  1LGH B;  3H1H D;  1JY3 P;  3L71 J;  3MHV A;  2HOD A;  2M5A B;  3KPE A;  1OW8 A;  3GF3 A;  1QX8 A;  4W7Z A;  2RN0 A;  1N73 B;  1NTZ K;  3VP8 A;  4ZKU A;  1QVF O;  1OX3 A;  1QVG O;  2HR3 A;  1R5S A;  4YTP C;  1KYO E;  2B9B A;  4JYC A;  1JUN A;  1JCC A;  3QH9 A;  4D6T E;  1AVY A;  1KIL D;  3A0B H;  5APU A;  2KZJ A;  4H13 B;  5AW4 B;  1EZV E;  3H1J D;  5E79 H;  1S5L H;  1H0T B;  5BVZ A;  2Q7C A;  3TSI A;  3TDK A;  2Y9Z A;  2KB7 P;  1EDK A;  2N9Y B;  3WU2 H;  2FYU G;  1NTK J;  3WUV A;  2QG4 A;  4PV1 B;  2JR8 A;  1RE4 A;  2JDI H;  2OAR A;  3V2R A;  1M90 Q;  1NVO A;  1T3U A;  2OYH A;  1U7J A;  2RH0 A;  2I1J A;  4H44 C;  4N6J A;  1YHQ P;  3KXD A;  1NTM E;  4PJ0 H;  4C46 A;  2H43 A;  2IYP A;  2R44 A;  4K3A A;  1N86 A;  4JYB A;  2GUV A;  1S5L E;  5E79 E;  2WQY C;  1PP9 J;  1FAV A;  1KN7 A;  3L37 A;  1W2B O;  3CXH D;  5KAI E;  4UB8 H;  1VF5 B;  2FYU K;  3JSV C;  1KIL B;  1IFI A;  4IL6 E;  4RKU J;  3FWL A;  3HTK B;  1RE3 A;  1BE3 J;  1LP1 A;  2A45 H;  2G3A A;  3CI9 A;  3H1H E;  5APS A;  3L72 D;  1S9K E;  3B5N B;  5B5E H;  1HUC A;  2YMY A;  1RF0 A;  1YQ3 C;  4PV1 D;  4AQR D;  3LID A;  1T6A A;  3G71 P;  2FFD B;  1FBM A;  3SFE C;  1JY3 N;  4A7P A;  2Q9I A;  1L0N E;  4JPZ B;  1L0L D;  3WMM 0;  1AVO A;  3RGU A;  1OZH A;  4IOI H;  3CWB J;  3KZI E;  2SPZ A;  1NKZ B;  2W6J H;  1R8E A;  3S1K A;  3TGU D;  2IFN A;  2A06 E;  1KIL E;  1WRG A;  3CWB E;  2Z5H A;  5M1B A;  3GHG C;  1SS1 A;  3TK1 A;  2QE7 H;  2ZXE B;  1BCC D;  1N7S B;  1NO4 A;  1L0N J;  1VF5 D;  3H1L G;  1P84 I;  1JOC A;  5KJ7 A;  1JTH B;  1OIP A;  3M0D A;  1N8R Q;  3JCU H;  1FDI A;  1SQV J;  3B5N D;  4XE5 B;  3EFG A;  2B87 B;  2JP3 A;  3MUD A;  1NTM D;  4YXW H;  1ZME C;  3AE4 C;  4R4L A;  1SQB J;  1HGV A;  2E5Y A;  4H13 C;  4WBA A;  1KC8 Q;  3Q3D A;  1DH3 A;  1VQ9 P;  2YIU B;  3V2P A;  2AEJ A;  1Q86 Q;  3BRT B;  5KLV K;  1VQM P;  1KD1 Q;  3IR9 A;  2WMM A;  1S9K D;  2ZVO B;  1JMB A;  3L74 E;  1URQ C;  1UII A;  1N7S D;  5KLV E;  1BCC J;  2A45 G;  1SQX D;  1NTK D;  2FFD C;  2N1T A;  2ZYA A;  1MV8 A;  3CD6 P;  3B5N C;  1GZL A;  1ZRT E;  4GDO A;  3VN0 A;  3TGU E;  1KB9 E;  3L73 G;  4KHX A;  3PLN A;  1KTM A;  1SLQ A;  2A06 D;  3OAK A;  1RE3 C;  2C0X A;  2J58 A;  3GMA A;  5GTI E;  1VQ6 P;  2C0W A;  3SWY A;  3OA7 A;  1IFN A;  1BSN A;  3TNU B;  3V4W A;  2GM4 A;  1IFD A;  5AVV B;  3CMA P;  1AQT A;  1BE3 D;  3Q1M A;  3EFF K;  1NTZ G;  1RY3 A;  1VDF A;  1OW6 A;  3PTZ A;  3SFD C;  1PGP A;  2R3S A;  1KQL A;  3OW2 O;  1J1D C;  2K37 A;  4I2L C;  4LGD E;  4PV1 C;  3GW6 A;  1L0N K;  2KS1 B;  1BGY E;  3Q5S A;  3CCR P;  3I56 P;  1L0L K;  2QRX A;  2WSE H;  3RK3 D;  1GL2 C;  1MUU A;  4L76 A;  4BXL A;  1Y9B A;  1RF1 C;  1JTH A;  1OVR A;  1RQU A;  1DEE G;  1NTK K;  3AE7 C;  4R4M A;  3RL0 D;  3SSU A;  2JEE A;  3U1A A;  2J5U A;  5KLV D;  1LTG C;  1NTK E;  1NYH A;  5DJT B;  5KJ7 C;  3CCJ P;  3EQ2 A;  2FYU E;  1PGQ A;  1N73 C;  2W27 A;  3VYI A;  3AED C;  1KB9 D;  3H1J J;  5AVQ B;  2KI7 B;  1DD4 A;  1T3J A;  1DD3 A;  1WMK A;  4IL6 X;  3RK2 C;  4ZMD A;  5CCH D;  1VPC A;  1CI6 B;  1S4X A;  1NTM K;  3B4S A;  3P7K A;  4YXD C;  4ASW A;  4GIF A;  1QL2 A;  2P1J A;  3CL3 D;  2ZVN B;  4W80 A;  2V4H A;  2E75 B;  3V2Q A;  3RK3 B;  3W67 A;  3L71 E;  1LTJ C;  5CCG A;  2RKL A;  3RL0 B;  1M56 D;  1P84 D;  3P8C E;  1MFZ A;  3FXE A;  2O01 H;  2YNY A;  3KZI H;  4UB6 H;  5AVZ B;  1UIX A;  2FYN C;  1DEB A;  2N1T C;  2Q3E A;  2RMZ A;  3O8Z A;  3AEF C;  4WVZ A;  1USD A;  1JY3 O;  3CPW O;  1M1J B;  3GF7 A;  4Y28 J;  3AEA C;  4ASV A;  3RK2 B;  4C7N B;  3D6Y A;  3AE2 C;  1NTZ J;  2LKM A;  2O1K A;  2ZFC A;  2XDJ A;  5AVU B;  4DCK A;  4RJT A;  3A5T A;  3L75 E;  4B86 A;  2M3E A;  3E1I A;  2W90 A;  1GK6 A;  3H1I J;  4KJM A;  4LC1 A;  1A02 F;  2E43 A;  4UB6 E;  4IFD K;  3EWK A;  2B87 A;  1FS0 E;  1N7S A;  3M0D C;  2E75 D;  1IK7 A;  3CWB G;  5B66 E;  3TGU G;  3H1J G;  3MP7 B;  2E42 A;  4JBZ A;  1H0T A;  1PPJ E;  2E76 D;  4OVN F;  1RHZ B;  3HE4 B;  2FYU D;  2QJK C;  3H1L D;  3AE9 C;  3NFQ A;  4RES B;  3CC4 P;  4N78 E;  1RF1 B;  1SQP K;  3HE4 A;  1JY2 P;  2OYI A;  1X79 B;  2E74 B;  1FZC A;  3CCL P;  1PIX A;  1JY2 O;  1KFN A;  1RF1 A;  3RK2 D;  2NPS A;  3L4F A;  2QA4 P;  2OYI B;  2C9L Y;  1NTM G;  1URQ D;  2O01 N;  3FXD A;  1P84 E;  1GL2 D;  1YYC A;  2JO1 A;  3P8C D;  4TT3 H;  3B8E B;  3ITK A;  1KMI Z;  1PZQ A;  2Q6Q A;  3PRJ A;  2V7Q J;  3NXS A;  1YI2 P;  3AEB C;  3II6 A;  5B5E E;  1ZLL A;  2QJP B;  3QWO C;  1JMM A;  1YJN P;  2E76 B;  1GU5 A;  1ZV8 A;  1OVV A;  2YXQ B;  3CXH E;  3HE5 A;  4PD4 I;  4U3F E;  5CHX A;  3SWF A;  2P2U A;  1KIL A;  2WZ7 A;  2XNX A;  1SQQ J;  3L75 D;  1M1J A;  4I1L A;  1LP1 B;  3W68 A;  1GDT A;  1HWT C;  2E74 D;  3E7K A;  3H1K D;  4IFF A;  5KLI B;  4DZO A;  1PGJ A;  3LW5 H;  1FZE A;  1SFC A;  2FXM A;  1MKM A;  2UWJ E;  5AW7 B;  1PPJ D;  4EYY Q;  1NOH A;  1MZ9 A;  1URQ B;  1RE4 C;  2JWA A;  2WSE J;  2WT7 B;  1GL2 B;  2KSJ A;  3V5B A;  2IPP A;  2FKW B;  4ZNC A;  3M9B A;  1ZP0 C;  1AA0 A;  1BCC G;  1S2E A;  1LTS C;  1LWU B;  5CCH C;  1FC2 C;  1X22 A;  1J1E B;  3CXH I;  4PD4 E;  1EDL A;  2XU6 A;  1U7M A;  4Z1M H;  2YMK A;  1IFM A;  5CBO A;  2FYZ A;  2QM8 A;  1IJD B;  1G2C A;  1JY2 N;  3BAT A;  2B88 A;  5TIS E;  1HH0 A;  1KFM A;  3AE6 C;  2NZ2 A;  3RL0 g;  1YJW P;  3MD0 A;  4D6T G;  5KKZ B;  4C7R A;  2LXB A;  2H88 C;  2YKP A;  2V7Q H;  1SQV G;  2QJP C;  3MIW A;  1Y8A A;  3AEC C;  1VQ7 P;  2WSS H;  1MFT A;  4PD4 H;  1SQQ G;  3GHG B;  3UIA A;  2WTY A;  1KYO I;  3WUU A;  2LXC B;  1VQK P;  3ABV C;  4U3F J;  4WY4 B;  4HB1 A;  3GHG A;  3H1I E;  1BSH A;  3KDP B;  1VL2 A;  2IFM A;  1YTZ I;  1J1E C;  1HBW A;  1FDM A;  1LTJ A;  2VRS A;  3KQG A;  2JJL A;  2XND H;  3C1L A;  4U3F G;  3E1R A;  1FZB A;  3NTN A;  1L4A C;  2E74 C;  1OW7 A;  1IO4 A;  2NRG A;  1E5W A;  2HYN A;  1YIT P;  2IX7 C;  1CZQ A;  3C8V A;  4UB8 E;  4AUW A;  2Y0E A;  2XV5 A;  2YIU C;  5CMZ A;  2Q5U A;  2HG5 D;  2FBW C;  1SQX K;  1X8Y A;  5KLI C;  3CX5 E;  3L73 J;  1R5L A;  2WWW A;  2IZ1 A;  3L70 J;  1LWU A;  2FY8 A;  5AW6 B;  4U7J A;  3VP9 A;  4Y99 C;  4PD4 D;  2W8Z A;  1GD2 E;  3GG2 A;  4WY4 D;  4OGQ B;  3S9O A;  3M0A A;  3G6E P;  4M3L A;  3F89 A;  2NPS D;  3M91 A;  4OGQ C;  4H0L D;  1ZOY C;  5KTB A;  1PP9 E;  1LTI C;  3AE3 C;  1S72 P;  1QEX A;  3B71 A;  5AW8 B;  2E5T A;  2FYN B;  1Z56 A;  1OXZ A;  1QGK B;  4JQ0 D;  2C9N Y;  1SQX J;  2L91 A;  1BGY D;  3KYQ A;  5TIS H;  2OYI C;  1NHL A;  2CPS A;  2WSC J;  2Y0C A;  5CBN A;  1FZG A;  5AW3 B;  1SQV E;  1JEK A;  3PHL A;  2A45 I;  3RK3 C;  2E75 C;  3FGA D;  3L72 E;  3L73 E;  4XA4 A;  1JM0 A;  1NGM B;  3MTU E;  1QL1 A;  1NTZ D;  1OVU A;  4NPD A;  2H89 C;  3ZDM A;  5BU8 B;  5APW A;  3H1I G;  3BRV B;  4OGQ D;  2AEF A;  4MN4 C;  2Q3I A;  1VF5 C;  1DX7 A;  2P7J A;  3IFM A;  2NPS B;  1NAY A;  1L0N D;  2N9B A;  4GT1 A;  4H0L B;  4I7Z C;  1HVV A;  2BCC J;  2ZYG A;  3BAS A;  4HYT B;  1K04 A;  3VMZ A;  3G4S P;  2D2C B;  1HJ0 A;  2WVR A;  1CI6 A;  3V2N A;  3L71 G;  2OGU A;  1NAF A;  4L74 A;  1ZW0 A;  2J59 M;  2PFX A;  4YPC A;  1H88 A;  3Q2Y A;  1SP4 A;  2I1K A;  2QM7 A;  1M7L A;  1GL2 A;  1M57 D;  1LJ2 A;  2WPR A;  3G9R A;  4D6T J;  5KAF E;  2KLV A;  3D6Z A;  1RF0 C;  2N1T B;  5AW5 B;  5KJ7 D;  2BCC D;  1GU4 A;  1GMJ A;  1S1C X;  3CC2 P;  3IN6 A;  1DIP A;  1PP9 D;  5APQ A;  1EDI A;  3H1K G;  3B5N A;  1T2K D;  1Q7Y Q;  3H25 A;  2K88 A;  2O1J A;  2CPB A;  2OQQ A;  3P8M C;  1SQV D;  1FJP A;  1JO5 A;  2KS1 A;  3U59 A;  2D2C C;  2D2C D;  3F5H A;  2O01 J;  1KB9 H;  5AVS B;  2P10 A;  3L72 J;  2WPQ A;  1NKN A;  5H2F H;  1A02 J;  1SFC D;  3AEG C;  1KYO H;  2IZ0 A;  3BCC E;  3L74 D;  1D7M A;  1H8A A;  1SQB G;  3IF4 A;  1EZV G;  2KLU A;  3USS A;  1SQP E;  1LT9 C;  1FDO A;  1SQX E;  1USE A;  3HD7 C;  4IFM A;  2OYH C;  1FOS E;  2OYO A;  5GTH H;  2N1T D;  2ZXX A;  3MUD C;  1NWQ A;  2OYH B;  3R2P A;  5AVR B;  4QMA A;  2QVA A;  2LR2 A;  2IDB A;  2M3B A;  2WSF H;  3AE1 C;  1EXJ A;  4K35 A;  2PGD A;  3V6I A;  4W7Y A;  1SQQ E;  1G2C B;  3CWB D;  3CXH H;  1IFP A;  3L70 D;  1CW5 A;  1NU1 K;  2BCC E;  1BCC E;  1LTT C;  1NU1 E;  1K05 A;  2Y0D A;  1FZC B;  1SFC B;  3BCC J;  3L75 G;  1SQQ K;  3L74 J;  4WB4 A;  5DJU B;  1VQ5 P;  4AYC A;  3H1H G;  1AV1 A;  3U1C A;  1T2K C;  3CC7 P;  1LTA C;  1HF9 A;  4Y99 B;  3A0H H;  4U3F D;  5AW2 B;  2QJK B;  4C7N A;  2IBZ E;  2BEZ F;  2R32 A;  5KLV J;  3H1K E;  1CSB A;  2Z5I A;  3TF5 A;  1SVF A;  3FWN A;  2GA1 A;  1VQP P;  1P84 H;  3JC2 2;  3BVH A;  1AJY A;  3CX5 I;  1SQB K;  3V4Q A;  4EIJ A;  1T8Z A;  1L4A B;  2AXT E;  2KIK A;  3C9I A;  2YKO A;  3HUS A;  4H0L C;  2KSE A;  2G8Y A;  1E79 H;  1SQP D;  4H44 D;  5KAF H;  5EFW B;  1G1J A;  5APT A;  1M8O B;  3H6P A;  1SQB E;  1IFJ A;  4NPE A;  1PGO A;  1TU3 F;  1ZRT D;  2H8P D;  2KP8 A;  2ZYD A;  2K3R A;  1N2D C;  3A3Y B;  1S5L X;  3T97 B;  3VMX A;  4D6T D;  2HPC A;  2Q1K A;  3JCU E;  3L70 E;  2ZJS E;  1PPJ G;  3L71 D;  2AXT H;  2WIT A;  3H32 A;  3RL0 C;  3T97 A;  1JNM A;  1SQQ D;  1LTJ B;  2HOD B;  2M5A A;  2ZT9 D;  3HUS C;  3P32 A;  1G1I A;  5KKZ C;  2FXO A;  4JF7 A;  4DJG A;  1NU1 D;  1FOS F;  3L72 G;  1HJB A;  1L4A D;  2CK3 H;  3LIE A;  1BE3 E;  1U57 A;  3H1H J;  3O6Q B;  3FX0 A;  3PJS K;  2QJY B;  1HGZ A;  1XTC C;  4H44 B;  4O9B A;  4BWN A;  3OJA B;  3HE5 B;  3BCC G;  1EXI A;  3CME P;  3NMD A;  2PRR A;  1PP9 G;  3H1I D;  5CJ0 A;  2R5B A;  3WUT A;  3N4X A;  4N3Y B;  1LWU C;  5L8R J;  3RBX A;  1K8A Q;  1FZC C;  3GLM A;  2AXC A;  3L36 A;  3RK3 E;  2IBZ D;  4HH2 A;  2M8R A;  2ZT9 C; 
#chains in the Genus database with same CATH homology
 1J2J B;  5AVW B;  3MGN A;  5APV A;  1XTG B;  1W2E A;  3A2A A;  2P67 A;  2GUS A;  1SQV K;  1X9V A;  3TYY A;  3N7N A;  1HTL C;  1KIL C;  4DOJ A;  4EOT A;  3HRN A;  3PP5 A;  5APY A;  2HPC B;  1FZF A;  1URQ A;  1ZR2 A;  1LT9 A;  3HD7 A;  3HUS B;  2FFD A;  3I5C A;  2W6A A;  1EQ7 A;  2L5G B;  2W6B A;  4ZKP A;  2R5D A;  3VMY A;  2HFE D;  2WPS A;  2HLO A;  1AFO A;  3VTP C;  3A7O A;  1H89 A;  1FJK A;  2Z4E A;  2KYV A;  1N7L A;  2MJZ A;  4WY4 A;  2YKQ A;  5CCG C;  1OWA A;  1NH4 A;  2XZR A;  5AVX B;  2WSC H;  1YTZ T;  3VOP A;  1ZN5 A;  5AW1 B;  4N78 D;  5AVT B;  1M1J C;  4I6M C;  1PFI A;  3M9H A;  2WT7 A;  2BAS A;  1N7S C;  1FZA A;  4GKG A;  1SFC C;  5AW9 B;  1N73 A;  3HTK A;  5CJ4 A;  1AQ5 A;  2PP6 A;  2POH A;  4OH8 B;  1GK4 A;  1LTB C;  1GW3 A;  1IC2 A;  2H7H A;  3M06 A;  3M9Q A;  3L35 A;  1GW4 A;  5AW0 B;  1LT9 B;  3HD7 B;  3G3Z A;  1JCD A;  1ZR4 A;  2KOG A;  3H32 B;  1WT6 A;  2YO2 A;  5APX A;  1GTW A;  4LLH A;  1J1D B;  1FU1 A;  3CLQ A;  4WY4 C;  1L4A A;  2YO3 A;  3HD7 D;  1IK9 A;  5CCH A;  2R3C A;  2PAJ A;  5AVY B;  1KZU B;  2XKM A;  5CCG D;  3TNU A;  2NPS C;  1LGH B;  1JY3 P;  2HOD A;  3KPE A;  1N73 B;  4W7Z A;  1NTZ K;  3VP8 A;  4ZKU A;  4JYC A;  1JCC A;  1KIL D;  5APU A;  5AW4 B;  2Q7C A;  3TSI A;  2KB7 P;  1RE4 A;  2OAR A;  3V2R A;  2OYH A;  1FJP A;  1T3U A;  4N6J A;  2I1J A;  2H43 A;  4C46 A;  1N86 A;  4JYB A;  2GUV A;  1FAV A;  3L37 A;  2FYU K;  1KIL B;  1IFI A;  3HTK B;  1RE3 A;  2A45 H;  5APS A;  3CI9 A;  1S9K E;  3B5N B;  1HUC A;  2YMY A;  1RF0 A;  1A02 J;  4AQR D;  2FFD B;  3LID A;  1FBM A;  1JY3 N;  2Q9I A;  3WMM 0;  1NKZ B;  2IFN A;  1WRG A;  3TK1 A;  2Z5H A;  3GHG C;  2ZXE B;  1N7S B;  1NO4 A;  1JOC A;  5KJ7 A;  1JTH B;  3M0D A;  3B5N D;  4XE5 B;  3EFG A;  3MUD A;  1DX7 A;  1JUN A;  1HGV A;  4WBA A;  1DH3 A;  3V2P A;  3BRT B;  5KLV K;  3IR9 A;  1S9K D;  1URQ C;  1N7S D;  2A45 G;  2FFD C;  2N1T A;  1MV8 A;  3B5N C;  1GZL A;  3VN0 A;  4KHX A;  1SLQ A;  3OAK A;  1RE3 C;  2C0X A;  2J58 A;  2C0W A;  3SWY A;  3OA7 A;  1IFN A;  3TNU B;  3V4W A;  2GM4 A;  1IFD A;  5AVV B;  1VDF A;  1RY3 A;  1KQL A;  1J1D C;  4LGD E;  4I2L C;  1L0N K;  1L0L K;  2WSE H;  3RK3 D;  1RF1 C;  1GL2 C;  1MUU A;  1JTH A;  1NTK K;  3RL0 D;  2JEE A;  3U1A A;  1LTG C;  5KJ7 C;  3EQ2 A;  1N73 C;  2W27 A;  3VYI A;  5AVQ B;  1T3J A;  3RK2 C;  5CCH D;  1VPC A;  1CI6 B;  1NTM K;  3P7K A;  4GIF A;  1QL2 A;  2P1J A;  3CL3 D;  4W80 A;  3V2Q A;  3RK3 B;  1LTJ C;  5CCG A;  5BVZ A;  3RL0 B;  3P8C E;  5AVZ B;  1MFZ A;  2O01 H;  2YNY A;  1DEB A;  2N1T C;  3O8Z A;  1JY3 O;  1M1J B;  3RK2 B;  4C7N B;  1FOS F;  2LKM A;  2O1K A;  2ZFC A;  2XDJ A;  5AVU B;  3A5T A;  4B86 A;  3E1I A;  1A02 F;  1GK6 A;  4LC1 A;  2E43 A;  4IFD K;  1N7S A;  3M0D C;  2E42 A;  3HE4 B;  3NFQ A;  4RES B;  4N78 E;  1RF1 B;  1SQP K;  3HE4 A;  1JY2 P;  2OYI A;  1X79 B;  1FZC A;  1JY2 O;  1KFN A;  1RF1 A;  3RK2 D;  2NPS A;  3L4F A;  2OYI B;  2C9L Y;  1URQ D;  1YYC A;  1GL2 D;  3P8C D;  3B8E B;  3NXS A;  3II6 A;  1ZLL A;  1JMM A;  1GU5 A;  1ZV8 A;  3HE5 A;  5CHX A;  3SWF A;  2P2U A;  1KIL A;  2WZ7 A;  2XNX A;  1GDT A;  4I1L A;  1M1J A;  1HWT C;  4IFF A;  4DZO A;  3LW5 H;  1FZE A;  1SFC A;  2FXM A;  5AW7 B;  1NOH A;  1MZ9 A;  1URQ B;  1RE4 C;  2WT7 B;  1GL2 B;  2KSJ A;  3V5B A;  2IPP A;  2FKW B;  3M9B A;  1LTS C;  1LWU B;  5CCH C;  1J1E B;  2XU6 A;  1IFM A;  2FYZ A;  2QM8 A;  1IJD B;  1G2C A;  1JY2 N;  3BAT A;  1HH0 A;  1KFM A;  3MD0 A;  4C7R A;  2YKP A;  3MIW A;  3GHG B;  3UIA A;  2WTY A;  4WY4 B;  3GHG A;  3KDP B;  2IFM A;  1YTZ I;  1J1E C;  1HBW A;  1FDM A;  1LTJ A;  2VRS A;  3KQG A;  2JJL A;  1IO4 A;  1FZB A;  3NTN A;  1L4A C;  1E5W A;  2HYN A;  2IX7 C;  1CZQ A;  4AUW A;  2XV5 A;  5CMZ A;  2Q5U A;  2HG5 D;  1SQX K;  1X8Y A;  2WWW A;  5AW6 B;  3VP9 A;  1LWU A;  4Y99 C;  1GD2 E;  4WY4 D;  3M0A A;  4M3L A;  3M91 A;  2NPS D;  5KTB A;  1LTI C;  5AW8 B;  1Z56 A;  1OXZ A;  2C9N Y;  3KYQ A;  2OYI C;  1NHL A;  2CPS A;  1FZG A;  5AW3 B;  2A45 I;  3RK3 C;  4XA4 A;  3MTU E;  1QL1 A;  1T2K D;  5BU8 B;  5APW A;  3BRV B;  2Q3I A;  2P7J A;  3IFM A;  2NPS B;  4GT1 A;  2N9B A;  5BU5 A;  1HVV A;  3BAS A;  4HYT B;  3VMZ A;  1CI6 A;  3V2N A;  1H88 A;  1NAF A;  2J59 M;  1SP4 A;  2I1K A;  2QM7 A;  1M7L A;  1GL2 A;  2WPR A;  2KLV A;  1RF0 C;  2N1T B;  5AW5 B;  5KJ7 D;  1GU4 A;  5APQ A;  3B5N A;  2O1J A;  2CPB A;  3P8M C;  1JO5 A;  3U59 A;  5AVS B;  2WPQ A;  1NKN A;  1SFC D;  1H8A A;  1LT9 C;  3HD7 C;  2OYH C;  4IFM A;  1FOS E;  2N1T D;  2OYH B;  1NWQ A;  3R2P A;  5AVR B;  2M3B A;  2WSF H;  4W7Y A;  1G2C B;  1CW5 A;  1NU1 K;  1FZC B;  1LTT C;  1SFC B;  1SQQ K;  4WB4 A;  4AYC A;  3U1C A;  1T2K C;  1LTA C;  4Y99 B;  5AW2 B;  4C7N A;  2R32 A;  1CSB A;  2Z5I A;  1SVF A;  3BVH A;  1SQB K;  3V4Q A;  4EIJ A;  1T8Z A;  1L4A B;  3C9I A;  3HUS A;  2YKO A;  1G1J A;  5APT A;  3H6P A;  1IFJ A;  2KP8 A;  2H8P D;  1N2D C;  3A3Y B;  3VMX A;  2HPC A;  3RL0 C;  2WIT A;  3H32 A;  1JNM A;  3T97 A;  1LTJ B;  2HOD B;  3HUS C;  3P32 A;  1G1I A;  4JF7 A;  1HJB A;  1L4A D;  3LIE A;  4O9B A;  1HGZ A;  1XTC C;  3OJA B;  3HE5 B;  3NMD A;  5CJ0 A;  2R5B A;  1FZC C;  3N4X A;  4N3Y B;  1LWU C;  3L36 A;  4HH2 A;  2M8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...