1RF0A

Crystal structure of fragment d of gammae132a fibrinogen
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
64
structure length
64
Chain Sequence
IEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
publication title Calcium-Binding Site beta2, Adjacent to the "b" Polymerization Site, Modulates Lateral Aggregation of Protofibrils during Fibrin Polymerization.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 64
sequence length 64
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1rf0A00
1LWUB 1M1JC 1T3UA 1JY3O 1FZFA 1JY3P 3GHGA 1LTJB 3HUSC 1FZGA 1W2EA 2A45G 1FZCB 1LT9B 1N73C 2OYHB 1LWUC 1RE4A 1LTJC 1RF0C 2A45I 1RF1A 2FFDA 1JY2N 1LT9C 3GHGB 2H43A 1FZCC 2OYHC 2HPCA 2OYIA 1JY2O 1JY2P 2HODA 2HLOA 1RE3A 3H32A 2Q9IA 1FZEA 1M1JA 3GHGC 2OYHA 1RF1B 2FFDB 3HUSA 3E1IA 2HPCB 1RE4C 1N73A 2OYIB 1N86A 2HODB 3H32B 1LWUA 2A45H 3BVHA 2FFDC 1RF1C 1M1JB 1FZBA 1LTJA 1RF0A 1RE3C 2XNXA 1JY3N 1LT9A 1FZCA 2OYIC 3HUSB 1FZAA 1N73B 2Z4EA
chains in the Genus database with same CATH superfamily
1M1KQ 5AVTB 2JWAA 1KB9H 1JOCA 3O8ZA 1MZ9A 2XU6A 4WWIA 1BCCD 3H1ID 3MIWA 1NTZK 2E75D 3H32B 4ASWA 2Y0DA 3IAOA 1SQPJ 1BE3J 3Q1MA 1IK9A 3TGUG 1HGVA 4HJGH 5AW2B 1DX7A 3VMZA 1JY2P 3HE5B 1KV4A 3H1LG 1TU3F 2OARA 4YXDC 3LIDA 2BCCE 4D6TD 1LJ2A 2JEEA 1URQA 5BU8B 1KZUB 4BRYA 5H2FE 2ZT9D 3MGNA 1KN7A 2M8RA 2YKQA 1P84D 1SQBJ 1L0NK 1L0LE 3GHGA 1KQSO 3L74D 2KS1B 2WWWA 3TDKA 3A2AA 3T97B 3L4FA 2OYHB 3BCCG 1KYOD 1JTHB 2JP3A 2K9YA 4WY4B 1NTKE 5CCGA 3HD7A 2LXBA 2WVRA 1JMBA 1BSNA 4C7NB 3D70A 1JY3O 1VQLP 3TK1A 2RH0A 4OGQB 1EQ7A 4K35A 1NU1K 1FC2C 3CC4P 3FGAD 1NH4A 2OYHC 3W68A 3V5BA 2H7HA 4RKUJ 2KSJA 4WY4C 4DCKA 1H0TB 4EDFA 1IJDB 3L74G 3RL0B 3AE2C 1SQQK 3WUVA 2E42A 2POHA 2A06E 2W8ZA 1MFZA 3O6QA 5AVWB 4OGQC 3TGUJ 2FXPA 3A0BH 3L75G 2K1AA 2O01N 3H1LJ 4W7ZA 3RK2B 3H1JG 3I5CA 1NTME 1JCDA 1PGOA 3RL0C 1M56D 1HF9A 1EZVI 4U3FD 5AW4B 4PV1D 3N4XA 2LXCB 1GL2A 3IFMA 1S1CX 3G4SP 1YBKA 3RK2C 1S5LE 3GF7A 3E7KA 1AQ5A 3L70E 3C1LA 5AVZB 1EC5A 1WT6A 2KNCA 5TISE 1NAYA 1VQ7P 1ZMEC 3CX5D 1DD3A 1X22A 2XDJA 4TT3H 3FX0A 2YO2A 4GDOA 3B5ND 1QX8A 1Z56A 2XNDH 1LWUC 1SQVD 2B87A 3H1KG 3BCCJ 4QMAA 4GIFA 4IFFA 3RBXA 4EOTA 4ZKPA 2N9BA 1JM0A 2YO3A 2G8YA 1N86A 1T2KC 2FYUK 1GL2D 1SVFA 3ZDMA 3Q5SA 3L73G 1U57A 5KKZB 3CLQA 1AJYA 5AVSB 3CCVP 2QG4A 3HUSA 1Q86Q 2KZJA 1NOHA 1NAFA 3D6ZA 3C9IA 3L74J 3FWNA 1PIXA 3VMYA 2Q1KA 5GTIE 2P1JA 3PRJA 1BCCE 5KKZC 3L75J 5APSA 3H1IE 1IK7A 1S4XA 1VQ6P 1FOSE 3H25A 3SFEC 3H1JJ 2QRXA 1K9MQ 1RE4A 3WU2E 3A3YB 1OX3A 3TF5A 1ZN5A 1HJBA 1URQB 1NTZD 3CWBD 1D7MA 2AXTE 1L2PA 2ZXEB 3S9OA 2M3BA 1NKZB 1FZCA 1IC2A 3F5HA 2QA4P 1ZR2A 3MD0A 2KYVA 1LGHB 3JSVC 4D6TE 1PL5A 1H88A 2IX7C 3GHGB 5APXA 3KZIH 3JCUH 1VQMP 2HLOA 1URQC 1S9KD 1PV3A 1H89A 2FKWB 1GD2E 4HYTB 3PJSK 5AW0B 1G2CA 4L75A 2BCCG 2WPVB 3H1KJ 2WSFH 3GHGC 5APUA 2LKMA 1NTZG 3CWBG 4ZKUA 2KI7B 1CSBA 1L0ND 4JYBA 1PGJA 5APTA 3HD7B 3V2PA 3SWYA 4I7ZB 1L0LG 4OVNF 1W2EA 1JTHA 3MTUE 2Q7CA 2W6AA 3VMAA 3L73J 5AVVB 1KYOE 2JR8A 2IFNA 2C9NY 2KSEA 3V2NA 2PRRA 5CCGC 1KILA 3HD7C 2L5GB 4AYCA 4I7ZC 3U1AA 2OYOA 5CBNA 2E5TA 1YTZI 1JB0J 1NTKG 2WPSA 2OTJP 1QVGO 1PPJD 1OVUA 2WSFJ 1BGYD 2OTLP 1OW6A 1NU1D 1P84I 4BXLA 1FDOA 3NFQA 3Q3DA 3V2RA 2Q9IA 2NPSA 1NO4A 3PHLA 4WY4D 4EI2A 3M0DA 1SQQD 2I1KA 1SP4A 2JJLA 1GL2B 3W67A 3BRVB 1JO5A 4H0LB 2A06G 4OGQD 4U3FE 4DZOA 1W2BO 1FZEA 3CCQP 2CPBA 2G3AA 3M06A 2D2CB 1L4AA 1KYOI 1RF0A 4YTPC 5KAIE 1NTMG 2IBZD 3RL0D 2BCCJ 1VQKP 1GL2C 1WRGA 2QM7A 4H0LC 2JO1A 1YITP 4UB8E 2WITA 2K37A 1NU1G 2KLUA 2KXPB 4PJ0E 2B87B 5CCHA 4W80A 3K5BA 3V4QA 4HB1A 1FJKA 1AQTA 2NPSD 2PAJA 3RK2D 3CX5E 3UIAA 4ASVA 1L0LJ 5KLVK 2ZXXA 3L70G 4XFJA 2HPCA 1SQVE 1RE3A 2IFMA 1LTSC 2P67A 5APWA 3HUSB 2YKPA 4IL6H 3L72D 1QLED 2C0WA 2IBZG 3P32A 2J58A 2ZYAA 2KK7A 2Q6QA 2YXQB 5GTHE 1XTGB 2Q3IA 1HWTC 4WB4A 3D6YA 1NTKJ 1T2KD 2XV5A 2FYUD 2L91A 3AEFC 3RGUA 5CCHD 4NPEA 1U7JA 4HKZH 2I1JA 3HUSC 2A45G 1UIIA 2PP6A 1IZNB 2O01H 3FWLA 1GU4A 2HODA 1VF5B 3AE3C 4JPZB 1S5LH 1JMMA 2YIUB 3CI9A 4UB6E 1NHLA 3Q2YA 3CX5I 1FZCB 5TISH 3SFDC 1J1DB 1HTLC 1XTCC 3AE5C 1LTAC 1OMIA 1AVOA 1RE4C 3AECC 1BCCG 1NTZE 3CWBE 3H1IG 2IDBA 1VF5C 4PD4D 2YIUC 4EYYQ 3H6PA 2WSCJ 4I2LC 1NTMJ 2FYUG 4GOEA 1G2CB 1FZCC 4LLHA 1PGPA 1J1DC 3HRNA 1SQPK 3TSIA 2R3CA 1IFJA 5B5EH 3AE1C 1CI6A 1K04A 1S9KE 1U7MA 3VMXA 2O01J 3IN6A 4NPDA 4JF7A 3H1HD 2LR2A 4D6TG 1MUUA 2WSSH 3L70J 1URQD 4JQ0D 1FBMA 1OW7A 3EQ2A 3JC22 3P8CD 1KORA 3CXHD 1IFPA 1JY3N 1HVVA 2N1TA 1L0NE 1R5LA 1H8AA 3L37A 5K5GB 3M9QA 3OJAB 1KILB 1Y8AA 5KJ7A 3AEDC 2ITAA 1SQBK 2O1JA 2QSIA 3FXDA 3WU2H 1SFCA 5APVA 5CJ0A 1Q82Q 2M5AA 4GODA 3R2PA 1IFMA 3RK3B 4M3LA 2IZ1A 1KILC 1LP1A 2KUBA 1N7LA 2NPSB 4IOIH 2W27A 1CZQA 2CPSA 5E79E 1DH3A 2Y9YA 5CCGD 1PPJE 2FYNB 3HD7D 1DD4A 2IYPA 1BGYE 3PLNA 5AW8B 3OA7A 1GK6A 1NU1E 1KB9E 2KOGA 2H8PD 5AVQB 1P84H 3RK3C 1YI2P 3B4SA 1BCCJ 1EDJA 3H1IJ 5KJ7D 2RKLA 2NPSC 1SQQE 1L4AB 2P58A 1X9VA 2FYUJ 5AW3B 3G6EP 2H43A 3C8VA 2CK3H 1GU5A 2QEXP 4RESB 2BEQD 1N73A 3TYYA 4BWNA 2FXMA 5KTBA 2AEMA 5B66E 4L73A 2FBWC 1L4AC 2IBZE 1KYOH 4L74A 1RF0C 2YMYA 4D6TJ 1BDCA 1JY2O 4U3FG 1M1JA 3GMAA 3AE8C 2HPCB 4XE5B 5CHXA 4O9BA 3RK3E 1Q7YQ 1LT9A 3OAKA 4JBZA 1ZXGA 3L35A 2QJKB 5CCHC 2VRSA 3A0HH 2KZIA 4H0LD 2AEFA 1IFDA 3EWKA 2W6JH 2NZ2A 1NKNA 4IL6X 2D2CD 3GLMA 1E79H 3M9HA 3QH9A 1GMJA 1RE3C 1LNQA 2RMZA 1KD1Q 5KLVD 2H89C 3II6A 1Y47A 2QJKC 3L72E 3BRTB 3PP5A 3WMM0 1J2JB 1SQVG 1SQXD 4I1LA 1MV8A 1FS0E 1T8ZA 2HODB 1EXJA 5CMZA 3VOPA 2FYUE 2IBZI 2JKVA 3TNUA 3EFFK 2OYIA 3S4RA 5KAIH 2WPRA 2HR3A 3AE6C 4UB8H 1KFMA 3VP9A 2WQYC 4PJ0H 2ZJSE 2A45I 1BSHA 1S2EA 3L71D 1PP9D 3B71A 3G3ZA 1BDDA 3CX5H 2J59M 1KTMA 2E74B 4R4MA 3A0BE 1WMKA 1CI6B 4PD4E 3LW5J 4N78D 2Z5IA 2W90A 4K3AA 4A7PA 4U3FJ 1KC8Q 1LTBC 1KQGB 1VQ4P 1EZVD 1VF5D 2M0BA 3P7KA 1T3UA 2Z4EA 5GTHH 2E74C 1EDLA 1MKMA 3V6IA 1DIPA 2N1TB 3MHVA 3H1HE 3LIEA 5DJTB 1AFOA 3NMDA 3KDPB 1SQPD 1FDMA 3L71G 2ZYGA 1BE3D 3KYQA 1M8OB 3P8CE 2JWDA 3CXHE 1RH5B 1DEEG 1RF1A 1SFCB 4U7JA 2ZYDA 2N1TC 2K9JA 2M5AB 1SQVJ 3AE9C 2YMKA 1GDTA 1FDIA 1QL2A 2KB7P 1LP1B 3VP8A 3PTZA 3P8MC 3CCRP 1N8RQ 5KJ7C 3GF3A 4GOFA 5CJ4A 5H2FH 1L0NG 4PD4I 3RL0g 1KB9D 1YHQP 1SFCC 3AEGC 1SQBD 1VDFA 2FYZA 1VQ8P 2XKMA 1IFNA 1FZAA 3AEBC 2OTKE 5KAFE 1E5WA 1VL2A 1ZW0A 1KILD 1QEXA 2R5BA 4RJTA 3I56P 3HTKA 1N73B 1JY3P 4DT0A 4Y99B 3CXHI 1PPJG 3CCMP 2QJYB 1FZGA 3OW2O 1BGYG 1PZQA 1OXZA 1OVVA 4H13B 1JNMA 3RK3D 1NYHA 3G9RA 1M1JB 1NTZJ 2D2CC 3CWBJ 4EIJA 2IYOA 1SQQG 2P10A 2K3RA 1LT9B 2B88A 2Q5UA 2HYNA 2QJYC 1YTZT 3B8EB 4WVZA 2OQQA 1UIXA 1OVRA 2WZ7A 3CL3D 4H13C 1SQXK 1LTJA 3VN0A 1OFCX 1M1JC 1NGMB 3V2QA 2IZ0A 3TGUD 1L4AD 1LT9C 4C46A 3H1LD 5BVZA 2WSCH 1S72P 1M90Q 4JYCA 1G1JA 1RQUA 1IO4A 1YQ3C 1KQLA 1FZFA 1AV1A 1L0NJ 5KLVE 3IR9A 3GW6A 1J1EB 4Z1MH 3QWOC 2WSEH 3M91A 2O3JA 3ITKA 2FXOA 3ABVC 3TNUB 2OYIB 4KJMA 1VQ9P 1A02J 4GKGA 4DOJA 1SQXE 1K05A 1L0LK 1M57D 1X79B 1T3JA 1GTWA 2GUVA 3PH0A 2IPPA 1RHZB 1IFIA 3L72G 2ZAEB 3AEAC 5AW9B 3CCEP 1J1EC 5B66H 4L76A 4OH8B 4N6JA 1DEBA 2XNXA 2OYIC 1HGZA 2GA1A 3BCCD 2V4HA 3Q5PA 1BGYJ 2FFDA 1USEA 2E76D 3N7NA 1NTKK 5CBOA 1NU1J 3L71E 1PP9E 2QVAA 3R4YA 2AEJA 3HE4A 3CCUP 2A45H 1OZHA 1OW8A 2C9LY 2WSEJ 1SQQJ 2B89A 3CMEP 3CMAP 4N78E 1PGQA 5EFWB 1ZRTD 3M9BA 4H44D 5AVXB 1USDA 4CPGA 3NTNA 1EZVE 2WT7A 4YXWH 2KP8A 1R8EA 1VQNP 5GTIH 3L75D 2UWJE 1Y9BA 5AW7B 3U59A 5AW1B 3H1JD 1W5CE 1RF1B 1SQPE 3CCLP 1NTMK 2K9JB 1K73Q 2E74D 1BE3E 1ZOYC 3NXSA 3AE4C 5KLIB 2AXTH 3SWKA 2PFXA 3CD6P 2QJPB 3H1HG 2QM8A 2R32A 3MUDA 1AVYA 1RF1C 3FXEA 2ZVNB 5BU5A 1FU1A 3CCSP 4AQRD 4IL6E 2N1TD 4Y28J 5KLIC 1M7LA 3L72J 2W83C 4I6MC 3VTPC 3CCJP 3E1RA 3KHUA 2QJPC 4PD4H 5APQA 3B5NA 1KMIZ 3KXDA 5DJUB 1N7SA 3SWFA 1SQBE 3KPEA 2I8DA 2R44A 1YYCA 3H1KD 3HTKB 3M0DC 2FYNC 1EDIA 2Y9ZA 4AUWA 1SFCD 3AEEC 1A02F 1Q2NA 2E5YA 2WPQA 1KILE 1OWAA 1LWUB 3Q5RA 3KQGA 5AVUB 2B9BA 3L73D 3M0AA 1JY2N 2OGUA 3VYIA 2HFED 1SLQA 2Y0EA 3V4WA 3CXHH 2E75B 2ZVOB 4IFDK 1FZBA 2GM4A 2Z5HA 2FY8A 1LTJB 1N7SD 4XA4A 1VQ5P 1R5SA 1LTGC 1RQVA 1X0TA 1KB9I 3L36A 2QIWA 2E75C 1NVOA 5B5EE 1HJ0A 1LTJC 3TGUE 2E76B 1FAVA 2ZT9B 3F89A 3H1HJ 3H1LE 4H13D 2E43A 5KAFH 3LW5H 2O1KA 3USSA 1JCCA 1VQPP 3IF4A 1QGKB 3U1CA 2QE7H 4MN4C 1LT1A 2GUSA 1YIJP 1HH0A 1S5LX 3H32A 2E76C 2XZRA 1KFNA 2ZT9C 3E1IA 4H44B 2BCCD 1YJWP 2KLVA 5M1BA 2BEZF 2YXRB 4WBAA 3WUTA 3MZWB 3HE5A 4B86A 5KLVG 1QL1A 2HG5D 4BRYB 1JUNA 2FFDB 2C0XA 2RN0A 4HH2A 2N9YB 4LC1A 1HUCA 1L0LD 4H44C 1SQXG 4KHXA 1X8YA 3HE4B 3BCCE 1ZR4A 5C39A 3MP7B 3SSUA 4ZNCA 1GW4A 2FFDC 1FOSF 1P84E 5AVRB 5AVYB 5AW5B 2WT7B 2KS1A 1NTKD 3BASA 1S3JA 2MKVA 1Q90D 2R3SA 1PP9G 3T97A 3L74E 1CW5A 1ZRTE 2BASA 2OYHA 1GW3A 2P2UA 2V7QH 1ZV8A 2AXCA 2YKOA 1RY3A 1NWQA 4WY4A 4NPFX 2YNYA 4PV1B 4UB6H 3L75E 3GG2A 2P7JA 4C7NA 4IFMA 3H1JE 5TJHA 3BVHA 2A06D 5APYA 1KQFB 1PFIA 2Q3EA 1EZVG 5AW6B 2H88C 2SPZA 1T6AA 1YQ4C 2R5DA 1VQOP 3O6QB 3A0HE 3AE7C 1H0TA 4KT0J 2WTYA 4PV1C 3A5TA 1NTMD 2M3EA 1SQPG 4YPCA 1GK4A 1FJPA 2NRGA 1QVFO 1OIPA 3B5NB 3RBZA 3MUDC 1BE3G 1N7SB 3CPWO 1AA0A 2PGDA 3BATA 3EFGA 5KLVJ 4W7YA 2V7QJ 1MFTA 1VPCA 2W6BA 4TLFA 1LTIC 1NJIQ 1GZLA 1SQXJ 2KIKA 3L70D 1EXIA 4R4LA 1SS1A 3B5NC 4DJGA 1N7SC 3H1KE 1SQVK 3S1KA 1ZLLA 2KNCB 2Y0CA 1EDKA 1LWUA 4OWFA 1Q81Q 1SQBG 2JDIH 1LTTC 2ZFCA 3CC7P 5L8RJ 1N73C 1JEKA 4Y99C 3WUUA 3L73E 1N2DC 4GT1A 3G71P 3A7OA 3L71J 1PP9J 3KZIE 3JCUE 3D71A 3I55P 1HBWA 4C7RA 2J5UA 2DW3A 1K8AQ 1YJNP 2MJZA 4N3YB 1YJ9P 1ZP0C 5E79H 1G1IA 1FE6A 4RO0A 4ZMDA 4LGDE 2K88A 3CC2P 2WMMA
chains in the Genus database with same CATH topology
5AVTB 3NXSA 5CCGC 1KILA 1JOCA 3HD7C 2L5GB 3II6A 3O8ZA 4AYCA 3U1AA 1MZ9A 3BRTB 2XU6A 3PP5A 2QM8A 3WMM0 1J2JB 2R32A 3MUDA 3MIWA 4I1LA 1NTZK 1YTZI 2WPSA 1MV8A 1T8ZA 2HODB 3H32B 1RF1C 5CMZA 5BU5A 3VOPA 1FU1A 4AQRD 1IK9A 3NFQA 3V2RA 1HGVA 2N1TD 3TNUA 5AW2B 1M7LA 4I6MC 3VTPC 3VMZA 2OYIA 1DX7A 1JY2P 3HE5B 2Q9IA 2NPSA 1NO4A 2WPRA 4WY4D 3M0DA 5APQA 3B5NA 1N7SA 2I1KA 2OARA 3SWFA 3LIDA 1SP4A 2JJLA 3KPEA 1GL2B 1KFMA 3BRVB 1JO5A 1YYCA 3VP9A 2JEEA 1URQA 3HTKB 3M0DC 5BU8B 1KZUB 2A45I 4AUWA 1SFCD 4DZOA 1FZEA 2CPBA 3MGNA 3G3ZA 1A02F 3M06A 2WPQA 1L4AA 2M8RA 2YKQA 2J59M 1RF0A 1OWAA 3RL0D 1L0NK 1LWUB 1CI6B 3KQGA 3GHGA 5AVUB 1GL2C 1WRGA 4N78D 2QM7A 3M0AA 2Z5IA 1JY2N 2WITA 3VYIA 2HFED 1SLQA 3V4WA 5CCHA 4W80A 2WWWA 1LTBC 3V4QA 1FJKA 4IFDK 1FZBA 2GM4A 2NPSD 3P7KA 2PAJA 3RK2D 3A2AA 2Z5HA 1T3UA 2Z4EA 3UIAA 1LTJB 1N7SD 3L4FA 4XA4A 5KLVK 2OYHB 1LTGC 2N1TB 3LIEA 1JTHB 2HPCA 1AFOA 3NMDA 3KDPB 1FDMA 1RE3A 4WY4B 2IFMA 1LTSC 5CCGA 2P67A 3HD7A 3L36A 5APWA 3KYQA 3P8CE 3HUSB 4C7NB 2YKPA 1JY3O 3TK1A 1EQ7A 2C0WA 3P32A 1NU1K 2J58A 1LTJC 1RF1A 1SFCB 1NH4A 1XTGB 2OYHC 1FAVA 3V5BA 2N1TC 2H7HA 2Q3IA 1HWTC 2E43A 2KSJA 4WB4A 4WY4C 1GDTA 3LW5H 1T2KD 2XV5A 1IJDB 1QL2A 3RL0B 1SQQK 2KB7P 2O1KA 3VP8A 3P8MC 5CCHD 5KJ7C 2E42A 2POHA 5CJ4A 1JCCA 2I1JA 3HUSC 1MFZA 2A45G 5AVWB 2PP6A 3U1CA 2GUSA 1HH0A 2O01H 1GU4A 2HODA 3H32A 1SFCC 2XZRA 1KFNA 1VDFA 2FYZA 3E1IA 1JMMA 3CI9A 4W7ZA 2XKMA 2KLVA 3RK2B 1NHLA 3I5CA 1JCDA 1IFNA 1FZAA 4WBAA 3RL0C 1FZCB 1E5WA 3HE5A 5AW4B 4B86A 1J1DB 1HTLC 1XTCC 1QL1A 2HG5D 1KILD 1JUNA 3N4XA 1LTAC 2FFDB 2C0XA 1GL2A 4HH2A 1RE4C 2R5BA 4LC1A 3IFMA 1HUCA 3HTKA 3H6PA 1N73B 4KHXA 1X8YA 3HE4B 4I2LC 3RK2C 1JY3P 4Y99B 1FZGA 1G2CB 1AQ5A 1OXZA 1FZCC 4LLHA 5AVZB 1WT6A 1J1DC 3HRNA 1ZR4A 1SQPK 1JNMA 3RK3D 3TSIA 2R3CA 1IFJA 1GW4A 1CI6A 2FFDC 1M1JB 1S9KE 3VMXA 2XDJA 4EIJA 1FOSF 5AVRB 2YO2A 5AVYB 3B5ND 4JF7A 1LT9B 1Z56A 1LWUC 5AW5B 2Q5UA 2HYNA 2WT7B 1YTZT 1MUUA 3B8EB 3BASA 4GIFA 4IFFA 4EOTA 4ZKPA 2N9BA 1URQD 2WZ7A 1FBMA 3CL3D 3EQ2A 2YO3A 3P8CD 3T97A 1N86A 1SQXK 1T2KC 1LTJA 1CW5A 1JY3N 2BASA 3VN0A 2FYUK 2OYHA 1HVVA 1GL2D 1GW3A 1M1JC 2N1TA 2P2UA 1SVFA 3V2QA 1L4AD 1ZV8A 2YKOA 1H8AA 1RY3A 3L37A 1NWQA 3M9QA 4WY4A 3OJAB 1LT9C 2YNYA 4C46A 1KILB 5BVZA 5KJ7A 2WSCH 3CLQA 2P7JA 5AVSB 3HUSA 4C7NA 1SQBK 4IFMA 1NOHA 2O1JA 4JYCA 1NAFA 3BVHA 3C9IA 5APYA 1G1JA 1IO4A 1PFIA 1KQLA 1FZFA 5AW6B 1SFCA 5APVA 5CJ0A 2R5DA 3VMYA 3IR9A 3R2PA 1J1EB 1IFMA 3RK3B 2WTYA 4M3LA 2WSEH 3M91A 1KILC 3A5TA 2P1JA 1N7LA 5APSA 3TNUB 2OYIB 1A02J 4GKGA 4DOJA 2NPSB 2W27A 1CZQA 2CPSA 1FOSE 1GK4A 1L0LK 1DH3A 1FJPA 3B5NB 1X79B 1N7SB 1T3JA 5CCGD 3HD7D 5AW8B 1GTWA 2GUVA 1RE4A 3OA7A 2IPPA 3A3YB 1IFIA 1GK6A 3BATA 3EFGA 1ZN5A 1HJBA 1URQB 4W7YA 5AW9B 1J1EC 2KOGA 2H8PD 5AVQB 1VPCA 2W6BA 3RK3C 1LTIC 4OH8B 2ZXEB 4N6JA 2M3BA 1DEBA 1NKZB 5KJ7D 1GZLA 2XNXA 1FZCA 2OYIC 1HGZA 1IC2A 2NPSC 1L4AB 1X9VA 1ZR2A 3B5NC 3MD0A 2KYVA 5AW3B 1LGHB 1N7SC 1H88A 2FFDA 1SQVK 2H43A 2IX7C 3GHGB 5APXA 3N7NA 1NTKK 2HLOA 1GU5A 1ZLLA 1URQC 1S9KD 4RESB 1H89A 3TYYA 2FKWB 1N73A 3HE4A 1GD2E 1LWUA 2A45H 4HYTB 2FXMA 5AW0B 5KTBA 1G2CA 1LTTC 2ZFCA 2C9LY 1L4AC 1N73C 1RF0C 2YMYA 4Y99C 2WSFH 4N78E 1JY2O 1N2DC 1M1JA 3GHGC 5APUA 4GT1A 2LKMA 2HPCB 3A7OA 3M9BA 4XE5B 5CHXA 4ZKUA 4O9BA 5AVXB 1CSBA 1HBWA 1LT9A 3NTNA 3OAKA 4JYBA 5APTA 4C7RA 3HD7B 3L35A 3V2PA 2WT7A 3SWYA 5CCHC 2KP8A 2MJZA 1W2EA 2VRSA 1JTHA 3MTUE 4N3YB 2Q7CA 1IFDA 2W6AA 5AW7B 5AVVB 1G1IA 5AW1B 3U59A 1RF1B 1NKNA 2IFNA 1NTMK 2C9NY 4LGDE 3M9HA 3V2NA 1RE3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LWU B;  1M1J C;  1T3U A;  1JY3 O;  1FZF A;  1JY3 P;  3GHG A;  1LTJ B;  3HUS C;  1FZG A;  1W2E A;  2A45 G;  1FZC B;  1LT9 B;  1N73 C;  2OYH B;  1LWU C;  1RE4 A;  1LTJ C;  1RF0 C;  2A45 I;  1RF1 A;  2FFD A;  1JY2 N;  1LT9 C;  3GHG B;  2H43 A;  1FZC C;  2OYH C;  2HPC A;  2OYI A;  1JY2 O;  1JY2 P;  2HOD A;  2HLO A;  1RE3 A;  3H32 A;  2Q9I A;  1FZE A;  1M1J A;  3GHG C;  2OYH A;  1RF1 B;  2FFD B;  3HUS A;  3E1I A;  2HPC B;  1RE4 C;  1N73 A;  2OYI B;  1N86 A;  2HOD B;  3H32 B;  1LWU A;  2A45 H;  3BVH A;  2FFD C;  1RF1 C;  1M1J B;  1FZB A;  1LTJ A;  1RF0 A;  1RE3 C;  2XNX A;  1JY3 N;  1LT9 A;  1FZC A;  2OYI C;  3HUS B;  1FZA A;  1N73 B;  2Z4E A; 
#chains in the Genus database with same CATH topology
 1M1K Q;  5AVT B;  2JWA A;  1KB9 H;  1JOC A;  3O8Z A;  1MZ9 A;  2XU6 A;  4WWI A;  1BCC D;  3H1I D;  3MIW A;  1NTZ K;  2E75 D;  3H32 B;  4ASW A;  2Y0D A;  3IAO A;  1SQP J;  1BE3 J;  3Q1M A;  1IK9 A;  3TGU G;  1HGV A;  4HJG H;  5AW2 B;  1DX7 A;  3VMZ A;  1JY2 P;  3HE5 B;  1KV4 A;  3H1L G;  1TU3 F;  2OAR A;  4YXD C;  3LID A;  2BCC E;  4D6T D;  1LJ2 A;  2JEE A;  1URQ A;  5BU8 B;  1KZU B;  4BRY A;  5H2F E;  2ZT9 D;  3MGN A;  1KN7 A;  2M8R A;  2YKQ A;  1P84 D;  1SQB J;  1L0N K;  1L0L E;  3GHG A;  1KQS O;  3L74 D;  2KS1 B;  2WWW A;  3TDK A;  3A2A A;  3T97 B;  3L4F A;  2OYH B;  3BCC G;  1KYO D;  1JTH B;  2JP3 A;  2K9Y A;  4WY4 B;  1NTK E;  5CCG A;  3HD7 A;  2LXB A;  2WVR A;  1JMB A;  1BSN A;  4C7N B;  3D70 A;  1JY3 O;  1VQL P;  3TK1 A;  2RH0 A;  4OGQ B;  1EQ7 A;  4K35 A;  1NU1 K;  1FC2 C;  3CC4 P;  3FGA D;  1NH4 A;  2OYH C;  3W68 A;  3V5B A;  2H7H A;  4RKU J;  2KSJ A;  4WY4 C;  4DCK A;  1H0T B;  4EDF A;  1IJD B;  3L74 G;  3RL0 B;  3AE2 C;  1SQQ K;  3WUV A;  2E42 A;  2POH A;  2A06 E;  2W8Z A;  1MFZ A;  3O6Q A;  5AVW B;  4OGQ C;  3TGU J;  2FXP A;  3A0B H;  3L75 G;  2K1A A;  2O01 N;  3H1L J;  4W7Z A;  3RK2 B;  3H1J G;  3I5C A;  1NTM E;  1JCD A;  1PGO A;  3RL0 C;  1M56 D;  1HF9 A;  1EZV I;  4U3F D;  5AW4 B;  4PV1 D;  3N4X A;  2LXC B;  1GL2 A;  3IFM A;  1S1C X;  3G4S P;  1YBK A;  3RK2 C;  1S5L E;  3GF7 A;  3E7K A;  1AQ5 A;  3L70 E;  3C1L A;  5AVZ B;  1EC5 A;  1WT6 A;  2KNC A;  5TIS E;  1NAY A;  1VQ7 P;  1ZME C;  3CX5 D;  1DD3 A;  1X22 A;  2XDJ A;  4TT3 H;  3FX0 A;  2YO2 A;  4GDO A;  3B5N D;  1QX8 A;  1Z56 A;  2XND H;  1LWU C;  1SQV D;  2B87 A;  3H1K G;  3BCC J;  4QMA A;  4GIF A;  4IFF A;  3RBX A;  4EOT A;  4ZKP A;  2N9B A;  1JM0 A;  2YO3 A;  2G8Y A;  1N86 A;  1T2K C;  2FYU K;  1GL2 D;  1SVF A;  3ZDM A;  3Q5S A;  3L73 G;  1U57 A;  5KKZ B;  3CLQ A;  1AJY A;  5AVS B;  3CCV P;  2QG4 A;  3HUS A;  1Q86 Q;  2KZJ A;  1NOH A;  1NAF A;  3D6Z A;  3C9I A;  3L74 J;  3FWN A;  1PIX A;  3VMY A;  2Q1K A;  5GTI E;  2P1J A;  3PRJ A;  1BCC E;  5KKZ C;  3L75 J;  5APS A;  3H1I E;  1IK7 A;  1S4X A;  1VQ6 P;  1FOS E;  3H25 A;  3SFE C;  3H1J J;  2QRX A;  1K9M Q;  1RE4 A;  3WU2 E;  3A3Y B;  1OX3 A;  3TF5 A;  1ZN5 A;  1HJB A;  1URQ B;  1NTZ D;  3CWB D;  1D7M A;  2AXT E;  1L2P A;  2ZXE B;  3S9O A;  2M3B A;  1NKZ B;  1FZC A;  1IC2 A;  3F5H A;  2QA4 P;  1ZR2 A;  3MD0 A;  2KYV A;  1LGH B;  3JSV C;  4D6T E;  1PL5 A;  1H88 A;  2IX7 C;  3GHG B;  5APX A;  3KZI H;  3JCU H;  1VQM P;  2HLO A;  1URQ C;  1S9K D;  1PV3 A;  1H89 A;  2FKW B;  1GD2 E;  4HYT B;  3PJS K;  5AW0 B;  1G2C A;  4L75 A;  2BCC G;  2WPV B;  3H1K J;  2WSF H;  3GHG C;  5APU A;  2LKM A;  1NTZ G;  3CWB G;  4ZKU A;  2KI7 B;  1CSB A;  1L0N D;  4JYB A;  1PGJ A;  5APT A;  3HD7 B;  3V2P A;  3SWY A;  4I7Z B;  1L0L G;  4OVN F;  1W2E A;  1JTH A;  3MTU E;  2Q7C A;  2W6A A;  3VMA A;  3L73 J;  5AVV B;  1KYO E;  2JR8 A;  2IFN A;  2C9N Y;  2KSE A;  3V2N A;  2PRR A;  5CCG C;  1KIL A;  3HD7 C;  2L5G B;  4AYC A;  4I7Z C;  3U1A A;  2OYO A;  5CBN A;  2E5T A;  1YTZ I;  1JB0 J;  1NTK G;  2WPS A;  2OTJ P;  1QVG O;  1PPJ D;  1OVU A;  2WSF J;  1BGY D;  2OTL P;  1OW6 A;  1NU1 D;  1P84 I;  4BXL A;  1FDO A;  3NFQ A;  3Q3D A;  3V2R A;  2Q9I A;  2NPS A;  1NO4 A;  3PHL A;  4WY4 D;  4EI2 A;  3M0D A;  1SQQ D;  2I1K A;  1SP4 A;  2JJL A;  1GL2 B;  3W67 A;  3BRV B;  1JO5 A;  4H0L B;  2A06 G;  4OGQ D;  4U3F E;  4DZO A;  1W2B O;  1FZE A;  3CCQ P;  2CPB A;  2G3A A;  3M06 A;  2D2C B;  1L4A A;  1KYO I;  1RF0 A;  4YTP C;  5KAI E;  1NTM G;  2IBZ D;  3RL0 D;  2BCC J;  1VQK P;  1GL2 C;  1WRG A;  2QM7 A;  4H0L C;  2JO1 A;  1YIT P;  4UB8 E;  2WIT A;  2K37 A;  1NU1 G;  2KLU A;  2KXP B;  4PJ0 E;  2B87 B;  5CCH A;  4W80 A;  3K5B A;  3V4Q A;  4HB1 A;  1FJK A;  1AQT A;  2NPS D;  2PAJ A;  3RK2 D;  3CX5 E;  3UIA A;  4ASV A;  1L0L J;  5KLV K;  2ZXX A;  3L70 G;  4XFJ A;  2HPC A;  1SQV E;  1RE3 A;  2IFM A;  1LTS C;  2P67 A;  5APW A;  3HUS B;  2YKP A;  4IL6 H;  3L72 D;  1QLE D;  2C0W A;  2IBZ G;  3P32 A;  2J58 A;  2ZYA A;  2KK7 A;  2Q6Q A;  2YXQ B;  5GTH E;  1XTG B;  2Q3I A;  1HWT C;  4WB4 A;  3D6Y A;  1NTK J;  1T2K D;  2XV5 A;  2FYU D;  2L91 A;  3AEF C;  3RGU A;  5CCH D;  4NPE A;  1U7J A;  4HKZ H;  2I1J A;  3HUS C;  2A45 G;  1UII A;  2PP6 A;  1IZN B;  2O01 H;  3FWL A;  1GU4 A;  2HOD A;  1VF5 B;  3AE3 C;  4JPZ B;  1S5L H;  1JMM A;  2YIU B;  3CI9 A;  4UB6 E;  1NHL A;  3Q2Y A;  3CX5 I;  1FZC B;  5TIS H;  3SFD C;  1J1D B;  1HTL C;  1XTC C;  3AE5 C;  1LTA C;  1OMI A;  1AVO A;  1RE4 C;  3AEC C;  1BCC G;  1NTZ E;  3CWB E;  3H1I G;  2IDB A;  1VF5 C;  4PD4 D;  2YIU C;  4EYY Q;  3H6P A;  2WSC J;  4I2L C;  1NTM J;  2FYU G;  4GOE A;  1G2C B;  1FZC C;  4LLH A;  1PGP A;  1J1D C;  3HRN A;  1SQP K;  3TSI A;  2R3C A;  1IFJ A;  5B5E H;  3AE1 C;  1CI6 A;  1K04 A;  1S9K E;  1U7M A;  3VMX A;  2O01 J;  3IN6 A;  4NPD A;  4JF7 A;  3H1H D;  2LR2 A;  4D6T G;  1MUU A;  2WSS H;  3L70 J;  1URQ D;  4JQ0 D;  1FBM A;  1OW7 A;  3EQ2 A;  3JC2 2;  3P8C D;  1KOR A;  3CXH D;  1IFP A;  1JY3 N;  1HVV A;  2N1T A;  1L0N E;  1R5L A;  1H8A A;  3L37 A;  5K5G B;  3M9Q A;  3OJA B;  1KIL B;  1Y8A A;  5KJ7 A;  3AED C;  2ITA A;  1SQB K;  2O1J A;  2QSI A;  3FXD A;  3WU2 H;  1SFC A;  5APV A;  5CJ0 A;  1Q82 Q;  2M5A A;  4GOD A;  3R2P A;  1IFM A;  3RK3 B;  4M3L A;  2IZ1 A;  1KIL C;  1LP1 A;  2KUB A;  1N7L A;  2NPS B;  4IOI H;  2W27 A;  1CZQ A;  2CPS A;  5E79 E;  1DH3 A;  2Y9Y A;  5CCG D;  1PPJ E;  2FYN B;  3HD7 D;  1DD4 A;  2IYP A;  1BGY E;  3PLN A;  5AW8 B;  3OA7 A;  1GK6 A;  1NU1 E;  1KB9 E;  2KOG A;  2H8P D;  5AVQ B;  1P84 H;  3RK3 C;  1YI2 P;  3B4S A;  1BCC J;  1EDJ A;  3H1I J;  5KJ7 D;  2RKL A;  2NPS C;  1SQQ E;  1L4A B;  2P58 A;  1X9V A;  2FYU J;  5AW3 B;  3G6E P;  2H43 A;  3C8V A;  2CK3 H;  1GU5 A;  2QEX P;  4RES B;  2BEQ D;  1N73 A;  3TYY A;  4BWN A;  2FXM A;  5KTB A;  2AEM A;  5B66 E;  4L73 A;  2FBW C;  1L4A C;  2IBZ E;  1KYO H;  4L74 A;  1RF0 C;  2YMY A;  4D6T J;  1BDC A;  1JY2 O;  4U3F G;  1M1J A;  3GMA A;  3AE8 C;  2HPC B;  4XE5 B;  5CHX A;  4O9B A;  3RK3 E;  1Q7Y Q;  1LT9 A;  3OAK A;  4JBZ A;  1ZXG A;  3L35 A;  2QJK B;  5CCH C;  2VRS A;  3A0H H;  2KZI A;  4H0L D;  2AEF A;  1IFD A;  3EWK A;  2W6J H;  2NZ2 A;  1NKN A;  4IL6 X;  2D2C D;  3GLM A;  1E79 H;  3M9H A;  3QH9 A;  1GMJ A;  1RE3 C;  1LNQ A;  2RMZ A;  1KD1 Q;  5KLV D;  2H89 C;  3II6 A;  1Y47 A;  2QJK C;  3L72 E;  3BRT B;  3PP5 A;  3WMM 0;  1J2J B;  1SQV G;  1SQX D;  4I1L A;  1MV8 A;  1FS0 E;  1T8Z A;  2HOD B;  1EXJ A;  5CMZ A;  3VOP A;  2FYU E;  2IBZ I;  2JKV A;  3TNU A;  3EFF K;  2OYI A;  3S4R A;  5KAI H;  2WPR A;  2HR3 A;  3AE6 C;  4UB8 H;  1KFM A;  3VP9 A;  2WQY C;  4PJ0 H;  2ZJS E;  2A45 I;  1BSH A;  1S2E A;  3L71 D;  1PP9 D;  3B71 A;  3G3Z A;  1BDD A;  3CX5 H;  2J59 M;  1KTM A;  2E74 B;  4R4M A;  3A0B E;  1WMK A;  1CI6 B;  4PD4 E;  3LW5 J;  4N78 D;  2Z5I A;  2W90 A;  4K3A A;  4A7P A;  4U3F J;  1KC8 Q;  1LTB C;  1KQG B;  1VQ4 P;  1EZV D;  1VF5 D;  2M0B A;  3P7K A;  1T3U A;  2Z4E A;  5GTH H;  2E74 C;  1EDL A;  1MKM A;  3V6I A;  1DIP A;  2N1T B;  3MHV A;  3H1H E;  3LIE A;  5DJT B;  1AFO A;  3NMD A;  3KDP B;  1SQP D;  1FDM A;  3L71 G;  2ZYG A;  1BE3 D;  3KYQ A;  1M8O B;  3P8C E;  2JWD A;  3CXH E;  1RH5 B;  1DEE G;  1RF1 A;  1SFC B;  4U7J A;  2ZYD A;  2N1T C;  2K9J A;  2M5A B;  1SQV J;  3AE9 C;  2YMK A;  1GDT A;  1FDI A;  1QL2 A;  2KB7 P;  1LP1 B;  3VP8 A;  3PTZ A;  3P8M C;  3CCR P;  1N8R Q;  5KJ7 C;  3GF3 A;  4GOF A;  5CJ4 A;  5H2F H;  1L0N G;  4PD4 I;  3RL0 g;  1KB9 D;  1YHQ P;  1SFC C;  3AEG C;  1SQB D;  1VDF A;  2FYZ A;  1VQ8 P;  2XKM A;  1IFN A;  1FZA A;  3AEB C;  2OTK E;  5KAF E;  1E5W A;  1VL2 A;  1ZW0 A;  1KIL D;  1QEX A;  2R5B A;  4RJT A;  3I56 P;  3HTK A;  1N73 B;  1JY3 P;  4DT0 A;  4Y99 B;  3CXH I;  1PPJ G;  3CCM P;  2QJY B;  1FZG A;  3OW2 O;  1BGY G;  1PZQ A;  1OXZ A;  1OVV A;  4H13 B;  1JNM A;  3RK3 D;  1NYH A;  3G9R A;  1M1J B;  1NTZ J;  2D2C C;  3CWB J;  4EIJ A;  2IYO A;  1SQQ G;  2P10 A;  2K3R A;  1LT9 B;  2B88 A;  2Q5U A;  2HYN A;  2QJY C;  1YTZ T;  3B8E B;  4WVZ A;  2OQQ A;  1UIX A;  1OVR A;  2WZ7 A;  3CL3 D;  4H13 C;  1SQX K;  1LTJ A;  3VN0 A;  1OFC X;  1M1J C;  1NGM B;  3V2Q A;  2IZ0 A;  3TGU D;  1L4A D;  1LT9 C;  4C46 A;  3H1L D;  5BVZ A;  2WSC H;  1S72 P;  1M90 Q;  4JYC A;  1G1J A;  1RQU A;  1IO4 A;  1YQ3 C;  1KQL A;  1FZF A;  1AV1 A;  1L0N J;  5KLV E;  3IR9 A;  3GW6 A;  1J1E B;  4Z1M H;  3QWO C;  2WSE H;  3M91 A;  2O3J A;  3ITK A;  2FXO A;  3ABV C;  3TNU B;  2OYI B;  4KJM A;  1VQ9 P;  1A02 J;  4GKG A;  4DOJ A;  1SQX E;  1K05 A;  1L0L K;  1M57 D;  1X79 B;  1T3J A;  1GTW A;  2GUV A;  3PH0 A;  2IPP A;  1RHZ B;  1IFI A;  3L72 G;  2ZAE B;  3AEA C;  5AW9 B;  3CCE P;  1J1E C;  5B66 H;  4L76 A;  4OH8 B;  4N6J A;  1DEB A;  2XNX A;  2OYI C;  1HGZ A;  2GA1 A;  3BCC D;  2V4H A;  3Q5P A;  1BGY J;  2FFD A;  1USE A;  2E76 D;  3N7N A;  1NTK K;  5CBO A;  1NU1 J;  3L71 E;  1PP9 E;  2QVA A;  3R4Y A;  2AEJ A;  3HE4 A;  3CCU P;  2A45 H;  1OZH A;  1OW8 A;  2C9L Y;  2WSE J;  1SQQ J;  2B89 A;  3CME P;  3CMA P;  4N78 E;  1PGQ A;  5EFW B;  1ZRT D;  3M9B A;  4H44 D;  5AVX B;  1USD A;  4CPG A;  3NTN A;  1EZV E;  2WT7 A;  4YXW H;  2KP8 A;  1R8E A;  1VQN P;  5GTI H;  3L75 D;  2UWJ E;  1Y9B A;  5AW7 B;  3U59 A;  5AW1 B;  3H1J D;  1W5C E;  1RF1 B;  1SQP E;  3CCL P;  1NTM K;  2K9J B;  1K73 Q;  2E74 D;  1BE3 E;  1ZOY C;  3NXS A;  3AE4 C;  5KLI B;  2AXT H;  3SWK A;  2PFX A;  3CD6 P;  2QJP B;  3H1H G;  2QM8 A;  2R32 A;  3MUD A;  1AVY A;  1RF1 C;  3FXE A;  2ZVN B;  5BU5 A;  1FU1 A;  3CCS P;  4AQR D;  4IL6 E;  2N1T D;  4Y28 J;  5KLI C;  1M7L A;  3L72 J;  2W83 C;  4I6M C;  3VTP C;  3CCJ P;  3E1R A;  3KHU A;  2QJP C;  4PD4 H;  5APQ A;  3B5N A;  1KMI Z;  3KXD A;  5DJU B;  1N7S A;  3SWF A;  1SQB E;  3KPE A;  2I8D A;  2R44 A;  1YYC A;  3H1K D;  3HTK B;  3M0D C;  2FYN C;  1EDI A;  2Y9Z A;  4AUW A;  1SFC D;  3AEE C;  1A02 F;  1Q2N A;  2E5Y A;  2WPQ A;  1KIL E;  1OWA A;  1LWU B;  3Q5R A;  3KQG A;  5AVU B;  2B9B A;  3L73 D;  3M0A A;  1JY2 N;  2OGU A;  3VYI A;  2HFE D;  1SLQ A;  2Y0E A;  3V4W A;  3CXH H;  2E75 B;  2ZVO B;  4IFD K;  1FZB A;  2GM4 A;  2Z5H A;  2FY8 A;  1LTJ B;  1N7S D;  4XA4 A;  1VQ5 P;  1R5S A;  1LTG C;  1RQV A;  1X0T A;  1KB9 I;  3L36 A;  2QIW A;  2E75 C;  1NVO A;  5B5E E;  1HJ0 A;  1LTJ C;  3TGU E;  2E76 B;  1FAV A;  2ZT9 B;  3F89 A;  3H1H J;  3H1L E;  4H13 D;  2E43 A;  5KAF H;  3LW5 H;  2O1K A;  3USS A;  1JCC A;  1VQP P;  3IF4 A;  1QGK B;  3U1C A;  2QE7 H;  4MN4 C;  1LT1 A;  2GUS A;  1YIJ P;  1HH0 A;  1S5L X;  3H32 A;  2E76 C;  2XZR A;  1KFN A;  2ZT9 C;  3E1I A;  4H44 B;  2BCC D;  1YJW P;  2KLV A;  5M1B A;  2BEZ F;  2YXR B;  4WBA A;  3WUT A;  3MZW B;  3HE5 A;  4B86 A;  5KLV G;  1QL1 A;  2HG5 D;  4BRY B;  1JUN A;  2FFD B;  2C0X A;  2RN0 A;  4HH2 A;  2N9Y B;  4LC1 A;  1HUC A;  1L0L D;  4H44 C;  1SQX G;  4KHX A;  1X8Y A;  3HE4 B;  3BCC E;  1ZR4 A;  5C39 A;  3MP7 B;  3SSU A;  4ZNC A;  1GW4 A;  2FFD C;  1FOS F;  1P84 E;  5AVR B;  5AVY B;  5AW5 B;  2WT7 B;  2KS1 A;  1NTK D;  3BAS A;  1S3J A;  2MKV A;  1Q90 D;  2R3S A;  1PP9 G;  3T97 A;  3L74 E;  1CW5 A;  1ZRT E;  2BAS A;  2OYH A;  1GW3 A;  2P2U A;  2V7Q H;  1ZV8 A;  2AXC A;  2YKO A;  1RY3 A;  1NWQ A;  4WY4 A;  4NPF X;  2YNY A;  4PV1 B;  4UB6 H;  3L75 E;  3GG2 A;  2P7J A;  4C7N A;  4IFM A;  3H1J E;  5TJH A;  3BVH A;  2A06 D;  5APY A;  1KQF B;  1PFI A;  2Q3E A;  1EZV G;  5AW6 B;  2H88 C;  2SPZ A;  1T6A A;  1YQ4 C;  2R5D A;  1VQO P;  3O6Q B;  3A0H E;  3AE7 C;  1H0T A;  4KT0 J;  2WTY A;  4PV1 C;  3A5T A;  1NTM D;  2M3E A;  1SQP G;  4YPC A;  1GK4 A;  1FJP A;  2NRG A;  1QVF O;  1OIP A;  3B5N B;  3RBZ A;  3MUD C;  1BE3 G;  1N7S B;  3CPW O;  1AA0 A;  2PGD A;  3BAT A;  3EFG A;  5KLV J;  4W7Y A;  2V7Q J;  1MFT A;  1VPC A;  2W6B A;  4TLF A;  1LTI C;  1NJI Q;  1GZL A;  1SQX J;  2KIK A;  3L70 D;  1EXI A;  4R4L A;  1SS1 A;  3B5N C;  4DJG A;  1N7S C;  3H1K E;  1SQV K;  3S1K A;  1ZLL A;  2KNC B;  2Y0C A;  1EDK A;  1LWU A;  4OWF A;  1Q81 Q;  1SQB G;  2JDI H;  1LTT C;  2ZFC A;  3CC7 P;  5L8R J;  1N73 C;  1JEK A;  4Y99 C;  3WUU A;  3L73 E;  1N2D C;  4GT1 A;  3G71 P;  3A7O A;  3L71 J;  1PP9 J;  3KZI E;  3JCU E;  3D71 A;  3I55 P;  1HBW A;  4C7R A;  2J5U A;  2DW3 A;  1K8A Q;  1YJN P;  2MJZ A;  4N3Y B;  1YJ9 P;  1ZP0 C;  5E79 H;  1G1I A;  1FE6 A;  4RO0 A;  4ZMD A;  4LGD E;  2K88 A;  3CC2 P;  2WMM A; 
#chains in the Genus database with same CATH homology
 5AVT B;  3NXS A;  5CCG C;  1KIL A;  1JOC A;  3HD7 C;  2L5G B;  3II6 A;  3O8Z A;  4AYC A;  3U1A A;  1MZ9 A;  3BRT B;  2XU6 A;  3PP5 A;  2QM8 A;  3WMM 0;  1J2J B;  2R32 A;  3MUD A;  3MIW A;  4I1L A;  1NTZ K;  1YTZ I;  2WPS A;  1MV8 A;  1T8Z A;  2HOD B;  3H32 B;  1RF1 C;  5CMZ A;  5BU5 A;  3VOP A;  1FU1 A;  4AQR D;  1IK9 A;  3NFQ A;  3V2R A;  1HGV A;  2N1T D;  3TNU A;  5AW2 B;  1M7L A;  4I6M C;  3VTP C;  3VMZ A;  2OYI A;  1DX7 A;  1JY2 P;  3HE5 B;  2Q9I A;  2NPS A;  1NO4 A;  2WPR A;  4WY4 D;  3M0D A;  5APQ A;  3B5N A;  1N7S A;  2I1K A;  2OAR A;  3SWF A;  3LID A;  1SP4 A;  2JJL A;  3KPE A;  1GL2 B;  1KFM A;  3BRV B;  1JO5 A;  1YYC A;  3VP9 A;  2JEE A;  1URQ A;  3HTK B;  3M0D C;  5BU8 B;  1KZU B;  2A45 I;  4AUW A;  1SFC D;  4DZO A;  1FZE A;  2CPB A;  3MGN A;  3G3Z A;  1A02 F;  3M06 A;  2WPQ A;  1L4A A;  2M8R A;  2YKQ A;  2J59 M;  1RF0 A;  1OWA A;  3RL0 D;  1L0N K;  1LWU B;  1CI6 B;  3KQG A;  3GHG A;  5AVU B;  1GL2 C;  1WRG A;  4N78 D;  2QM7 A;  3M0A A;  2Z5I A;  1JY2 N;  2WIT A;  3VYI A;  2HFE D;  1SLQ A;  3V4W A;  5CCH A;  4W80 A;  2WWW A;  1LTB C;  3V4Q A;  1FJK A;  4IFD K;  1FZB A;  2GM4 A;  2NPS D;  3P7K A;  2PAJ A;  3RK2 D;  3A2A A;  2Z5H A;  1T3U A;  2Z4E A;  3UIA A;  1LTJ B;  1N7S D;  3L4F A;  4XA4 A;  5KLV K;  2OYH B;  1LTG C;  2N1T B;  3LIE A;  1JTH B;  2HPC A;  1AFO A;  3NMD A;  3KDP B;  1FDM A;  1RE3 A;  4WY4 B;  2IFM A;  1LTS C;  5CCG A;  2P67 A;  3HD7 A;  3L36 A;  5APW A;  3KYQ A;  3P8C E;  3HUS B;  4C7N B;  2YKP A;  1JY3 O;  3TK1 A;  1EQ7 A;  2C0W A;  3P32 A;  1NU1 K;  2J58 A;  1LTJ C;  1RF1 A;  1SFC B;  1NH4 A;  1XTG B;  2OYH C;  1FAV A;  3V5B A;  2N1T C;  2H7H A;  2Q3I A;  1HWT C;  2E43 A;  2KSJ A;  4WB4 A;  4WY4 C;  1GDT A;  3LW5 H;  1T2K D;  2XV5 A;  1IJD B;  1QL2 A;  3RL0 B;  1SQQ K;  2KB7 P;  2O1K A;  3VP8 A;  3P8M C;  5CCH D;  5KJ7 C;  2E42 A;  2POH A;  5CJ4 A;  1JCC A;  2I1J A;  3HUS C;  1MFZ A;  2A45 G;  5AVW B;  2PP6 A;  3U1C A;  2GUS A;  1HH0 A;  2O01 H;  1GU4 A;  2HOD A;  3H32 A;  1SFC C;  2XZR A;  1KFN A;  1VDF A;  2FYZ A;  3E1I A;  1JMM A;  3CI9 A;  4W7Z A;  2XKM A;  2KLV A;  3RK2 B;  1NHL A;  3I5C A;  1JCD A;  1IFN A;  1FZA A;  4WBA A;  3RL0 C;  1FZC B;  1E5W A;  3HE5 A;  5AW4 B;  4B86 A;  1J1D B;  1HTL C;  1XTC C;  1QL1 A;  2HG5 D;  1KIL D;  1JUN A;  3N4X A;  1LTA C;  2FFD B;  2C0X A;  1GL2 A;  4HH2 A;  1RE4 C;  2R5B A;  4LC1 A;  3IFM A;  1HUC A;  3HTK A;  3H6P A;  1N73 B;  4KHX A;  1X8Y A;  3HE4 B;  4I2L C;  3RK2 C;  1JY3 P;  4Y99 B;  1FZG A;  1G2C B;  1AQ5 A;  1OXZ A;  1FZC C;  4LLH A;  5AVZ B;  1WT6 A;  1J1D C;  3HRN A;  1ZR4 A;  1SQP K;  1JNM A;  3RK3 D;  3TSI A;  2R3C A;  1IFJ A;  1GW4 A;  1CI6 A;  2FFD C;  1M1J B;  1S9K E;  3VMX A;  2XDJ A;  4EIJ A;  1FOS F;  5AVR B;  2YO2 A;  5AVY B;  3B5N D;  4JF7 A;  1LT9 B;  1Z56 A;  1LWU C;  5AW5 B;  2Q5U A;  2HYN A;  2WT7 B;  1YTZ T;  1MUU A;  3B8E B;  3BAS A;  4GIF A;  4IFF A;  4EOT A;  4ZKP A;  2N9B A;  1URQ D;  2WZ7 A;  1FBM A;  3CL3 D;  3EQ2 A;  2YO3 A;  3P8C D;  3T97 A;  1N86 A;  1SQX K;  1T2K C;  1LTJ A;  1CW5 A;  1JY3 N;  2BAS A;  3VN0 A;  2FYU K;  2OYH A;  1HVV A;  1GL2 D;  1GW3 A;  1M1J C;  2N1T A;  2P2U A;  1SVF A;  3V2Q A;  1L4A D;  1ZV8 A;  2YKO A;  1H8A A;  1RY3 A;  3L37 A;  1NWQ A;  3M9Q A;  4WY4 A;  3OJA B;  1LT9 C;  2YNY A;  4C46 A;  1KIL B;  5BVZ A;  5KJ7 A;  2WSC H;  3CLQ A;  2P7J A;  5AVS B;  3HUS A;  4C7N A;  1SQB K;  4IFM A;  1NOH A;  2O1J A;  4JYC A;  1NAF A;  3BVH A;  3C9I A;  5APY A;  1G1J A;  1IO4 A;  1PFI A;  1KQL A;  1FZF A;  5AW6 B;  1SFC A;  5APV A;  5CJ0 A;  2R5D A;  3VMY A;  3IR9 A;  3R2P A;  1J1E B;  1IFM A;  3RK3 B;  2WTY A;  4M3L A;  2WSE H;  3M91 A;  1KIL C;  3A5T A;  2P1J A;  1N7L A;  5APS A;  3TNU B;  2OYI B;  1A02 J;  4GKG A;  4DOJ A;  2NPS B;  2W27 A;  1CZQ A;  2CPS A;  1FOS E;  1GK4 A;  1L0L K;  1DH3 A;  1FJP A;  3B5N B;  1X79 B;  1N7S B;  1T3J A;  5CCG D;  3HD7 D;  5AW8 B;  1GTW A;  2GUV A;  1RE4 A;  3OA7 A;  2IPP A;  3A3Y B;  1IFI A;  1GK6 A;  3BAT A;  3EFG A;  1ZN5 A;  1HJB A;  1URQ B;  4W7Y A;  5AW9 B;  1J1E C;  2KOG A;  2H8P D;  5AVQ B;  1VPC A;  2W6B A;  3RK3 C;  1LTI C;  4OH8 B;  2ZXE B;  4N6J A;  2M3B A;  1DEB A;  1NKZ B;  5KJ7 D;  1GZL A;  2XNX A;  1FZC A;  2OYI C;  1HGZ A;  1IC2 A;  2NPS C;  1L4A B;  1X9V A;  1ZR2 A;  3B5N C;  3MD0 A;  2KYV A;  5AW3 B;  1LGH B;  1N7S C;  1H88 A;  2FFD A;  1SQV K;  2H43 A;  2IX7 C;  3GHG B;  5APX A;  3N7N A;  1NTK K;  2HLO A;  1GU5 A;  1ZLL A;  1URQ C;  1S9K D;  4RES B;  1H89 A;  3TYY A;  2FKW B;  1N73 A;  3HE4 A;  1GD2 E;  1LWU A;  2A45 H;  4HYT B;  2FXM A;  5AW0 B;  5KTB A;  1G2C A;  1LTT C;  2ZFC A;  2C9L Y;  1L4A C;  1N73 C;  1RF0 C;  2YMY A;  4Y99 C;  2WSF H;  4N78 E;  1JY2 O;  1N2D C;  1M1J A;  3GHG C;  5APU A;  4GT1 A;  2LKM A;  2HPC B;  3A7O A;  3M9B A;  4XE5 B;  5CHX A;  4ZKU A;  4O9B A;  5AVX B;  1CSB A;  1HBW A;  1LT9 A;  3NTN A;  3OAK A;  4JYB A;  5APT A;  4C7R A;  3HD7 B;  3L35 A;  3V2P A;  2WT7 A;  3SWY A;  5CCH C;  2KP8 A;  2MJZ A;  1W2E A;  2VRS A;  1JTH A;  3MTU E;  4N3Y B;  2Q7C A;  1IFD A;  2W6A A;  5AW7 B;  5AVV B;  1G1I A;  5AW1 B;  3U59 A;  1RF1 B;  1NKN A;  2IFN A;  1NTM K;  2C9N Y;  4LGD E;  3M9H A;  3V2N A;  1RE3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...