1T3JA

Mitofusin domain hr2 v686m/i708m mutant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
62
structure length
62
Chain Sequence
ATTFARLCQQVDMTQKHLEEEIARLSKEIDQLEKMQNNSKLLRNKAVQLESELENFSKQFLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords mitofusin 1
publication title Structural basis of mitochondrial tethering by mitofusin complexes
pubmed doi rcsb
source organism Mus musculus
total genus 28
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2004-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1t3jA00
2XDJA 2NPSB 1URQD 3RK2B 1GL2D 1NHLA 3HD7D 4WY4A 1N7SA 3RL0D 5CCGD 2N1TD 3B5ND 1KILA 3RK3B 5KJ7A 4WY4B 1N7SB 4W7ZA 1KILB 2H8PD 1JTHA 2HG5D 1SFCC 3P8CE 1URQA 1GL2A 4OH8B 5CCGA 1SFCA 2N1TA 3B5NA 1JTHB 2PP6A 4LGDE 1SFCD 1GL2B 2YMYA 3HD7B 2N1TB 4JF7A 3HTKB 1L4AC 1T3JA 1L4AA 5CCHC 2WZ7A 3KYQA 4N78E 1L4AD 2NPSC 2KOGA 3RK2C 3TSIA 1URQB 3RL0B 5CCHD 1SFCB 3B5NB 3M0DC 3RK3C 4WY4C 1N7SC 4W7YA 2NPSD 3RK2D 1KILC 2HFED 2M8RA 3PP5A 5KJ7C 3RK3D 1XTGB 3VOPA 5CCHA 4W80A 4WY4D 1N7SD 1L4AB 1KILD 1URQC 1GL2C 3HD7C 3RL0C 5KJ7D 1HVVA 2NPSA 5CCGC 2N1TC 3B5NC 3HD7A
chains in the Genus database with same CATH superfamily
1LTSC 1NOHA 1T8ZA 2GA1A 1NTME 3WUUA 1GL2D 1VQ6P 1FZEA 2WT7A 3B8EB 1NTKG 3CMEP 1N7SB 1E79H 3LW5J 3VMAA 1OX3A 1KILB 1JTHA 1ZV8A 4ZNCA 1SQPK 1NTZK 3PLNA 1FJKA 4AQRD 3A5TA 2JO1A 1OIPA 1NJIQ 1HWTC 2IFMA 2YMYA 3H1HE 5CJ0A 5B5EE 1SQXG 2E76C 1JEKA 2YNYA 2ZYGA 3SFDC 2FYUJ 1N2DC 1VF5C 2QM8A 3HE5B 4EYYQ 1BDDA 1W2BO 3KYQA 2E76D 1L0LD 3RK2C 3TSIA 1VF5D 2SPZA 1VL2A 1L0NE 4KHXA 4HB1A 3RK2D 2FYUD 4ZKUA 1GZLA 1AA0A 5APWA 1PGOA 1BGYE 1J1EC 5AW9B 1XTGB 4PV1B 1S3JA 3NFQA 2P10A 3NMDA 2V4HA 2P7JA 2CK3H 3IR9A 3H1KJ 3H1IE 4JPZB 2Q9IA 1J1DB 4TLFA 5AW5B 2R32A 1H89A 4RJTA 2HPCB 3B4SA 5AVSB 5GTIH 4H13C 2H7HA 2E76B 3RK3B 4MN4C 1NTKK 1M1JC 1QGKB 2C0XA 2JR8A 1VF5B 1VQ7P 4H13D 3M91A 3AE7C 4Y28J 2QE7H 2YIUC 2E5TA 4I7ZC 1L0LK 1RF0A 3IF4A 4M3LA 1X79B 1T3JA 4C7NB 2ZYDA 1JM0A 3VN0A 1J1EB 2XZRA 4PJ0H 1DIPA 2FYUK 1YIJP 1HGZA 1PPJG 1Q86Q 1CI6B 2QJPC 4NPDA 2AEFA 4DCKA 2K9JA 1MKMA 3CXHI 1NTMJ 2V7QJ 5AVZB 3AE8C 1QL1A 4PD4H 3CX5D 3C8VA 3SWKA 1KB9D 4YTPC 1DD4A 3CPWO 3CCJP 2FYNC 1KQLA 1HVVA 4OGQD 3CC2P 1HF9A 4ASWA 4I1LA 2IYOA 1S9KD 1NHLA 1N7SA 3H1HJ 2Y0EA 4I6MC 1RE3C 1KILA 2I1JA 1FDOA 1RE4C 2W6AA 1IFJA 3MHVA 1QEXA 1LWUB 1GW4A 3B5NA 1OVRA 2JWDA 3L70D 3H1HD 1E5WA 2WITA 3VMYA 3HE5A 3AECC 2KIKA 5APQA 1FZFA 1P84D 1G2CA 3TGUG 1BGYJ 2O1JA 1YQ3C 4OGQB 3BCCE 4HH2A 1MUUA 2YXRB 3E1IA 3JC22 2Y9YA 1YJWP 1BCCE 3A0HH 2FYNB 1SVFA 1M90Q 3OJAB 3TF5A 3H1IJ 1YTZT 4DJGA 2UWJE 1VQMP 4GIFA 1VQ4P 3S9OA 2W27A 3HUSA 4JQ0D 5AW7B 2FFDA 1FZCA 1LTAC 4L73A 1SQQJ 4Y99C 3Q1MA 2A06E 2HPCA 4JBZA 1S1CX 1YJNP 1BE3J 1LTJB 3D6YA 1Z56A 1JMMA 1Y9BA 1NU1E 3SWFA 2H43A 1ZR2A 4XFJA 5CHXA 1KYOD 3H1JJ 1SQQD 3V6IA 1SFCC 5GTIE 5GTHH 2Q3IA 1CSBA 3FGAD 3P8CE 4ZMDA 1BE3D 1OFCX 1LT9A 2GM4A 5AW4B 1KFMA 1SFCD 4PD4I 1HTLC 3ZDMA 3H1JD 2WT7B 1N73A 1DH3A 4OWFA 3CCVP 2E75C 1CI6A 3CCQP 2IBZD 2RMZA 3WU2H 3L36A 4DZOA 1NAFA 2LXBA 2JWAA 1K9MQ 1VQLP 5KLIC 3VP9A 1W5CE 2E75D 4PJ0E 3GHGA 1YHQP 1YTZI 1RHZB 4U3FD 3L75E 2WMMA 3L37A 1FBMA 3II6A 4GOFA 1EDKA 3E1RA 3H1LE 4CPGA 3GG2A 3CMAP 1VQ9P 1RF1A 1SQQK 2FXMA 5AVUB 3Q5RA 1WMKA 3R4YA 2ZYAA 2LXCB 3L74G 1RF0C 3L73G 1PP9G 4HKZH 4D6TD 2BCCG 4O9BA 1SQXE 2WPQA 3BASA 2NZ2A 1OXZA 1JCCA 2BASA 1KD1Q 2E75B 3CWBD 1WRGA 2ZT9C 3S1KA 1QLED 2J58A 2M3EA 4Z1MH 1BCCJ 2WSCH 1BSHA 1T2KC 3WMM0 4JF7A 4IOIH 1L4AC 3A2AA 3D70A 4JYBA 1T2KD 4H0LC 1OMIA 3AE4C 2R5DA 1YQ4C 3AE9C 1J2JB 1L4AD 2OYOA 5K5GB 2WSFH 3EFGA 1LJ2A 3N4XA 4GODA 3A0BH 1N7SC 3A0HE 1KILC 3CX5I 3PP5A 1T6AA 1NU1J 1KQGB 1FAVA 4L76A 2E5YA 5CCHA 1GU4A 1N7SD 2K9YA 1KILD 1LTJA 3O6QA 3FXDA 3GW6A 3B5NC 2I8DA 1AQ5A 3HD7A 3MZWB 3U59A 3M0DA 3Q2YA 3B71A 2NPSB 3G4SP 2WTYA 3RBXA 3B5ND 2ZVOB 3V2NA 3L72D 2KLVA 3MTUE 3NTNA 1EDJA 5AVVB 2AXCA 3W68A 3BRVB 2OARA 2O3JA 3V2QA 2H89C 1EC5A 1HJ0A 5AW1B 1PZQA 5AVQB 5DJTB 5GTHE 4OVNF 1IFMA 3CXHH 3L75J 4PV1C 4RKUJ 3CD6P 3BATA 1IK7A 2QJYB 1U57A 5AW3B 5KKZB 5BVZA 2VRSA 2FFDC 1GK6A 1FZCC 3H1LJ 4PV1D 1J1DC 1USDA 1M1KQ 2P2UA 1HH0A 4EI2A 1IJDB 2IZ0A 2QVAA 1L0LG 3WU2E 3B5NB 3M0AA 2QRXA 1KV4A 3RK3C 3L75D 1UIIA 1OW7A 1VQNP 1K04A 3G3ZA 2R3CA 2FYUG 5CBNA 3H1LD 4KJMA 3RK3D 1ZXGA 4KT0J 4W80A 2WVRA 1G2CB 3AEDC 1GTWA 1YYCA 1WT6A 2R5BA 2QG4A 2ZVNB 1SQVJ 5M1BA 1IK9A 3USSA 3EWKA 3AE3C 2G3AA 4YXDC 4GKGA 3HUSB 1PGPA 2YKQA 2Y9ZA 3IAOA 2FFDB 1FZCB 1URQA 2HODA 4N3YB 2IZ1A 4TT3H 1FZBA 4H44B 1JY3N 1ZP0C 1NYHA 2PP6A 3GHGC 2E74B 2L91A 3H25A 1SQVD 3MD0A 2KSEA 3VYIA 2POHA 1KQFB 4JYCA 5DJUB 4C7RA 3H1KD 1SQBJ 3QWOC 4N78E 2W6JH 4IL6H 4GDOA 1M7LA 2ZXEB 3ITKA 1MFZA 2KOGA 1JY2P 1RF1C 4XE5B 1KFNA 1LT9B 2OYHA 2KB7P 2E42A 2WPRA 1OVUA 2P58A 5AVWB 2HFED 1OZHA 5KLVE 1SQBD 3P7KA 2JDIH 1EZVD 2OTJP 2W83C 1TU3F 1N73B 3A0BE 1LWUC 1ZRTD 1IFPA 1FZGA 3RL0C 1OW8A 2NPSA 1DX7A 2QJKB 1G1JA 2C0WA 2M5AA 1RQVA 3GHGB 2JP3A 5KAIH 2DW3A 2QSIA 3RL0D 4OGQC 1QVGO 3MP7B 1M56D 5C39A 2QEXP 1LTBC 1SQVK 2PRRA 3CCRP 2BEZF 3L71E 4LLHA 2OQQA 2H8PD 1N86A 1NTMD 1KORA 4WBAA 2FYZA 3VMZA 1K8AQ 4UB6H 2Q5UA 1RF1B 3L70G 3H1HG 2XU6A 5AVYB 1YBKA 3FXEA 3AEEC 1OWAA 5CCHC 2N9BA 2WZ7A 2FBWC 3CXHE 2WSEJ 3Q5PA 1LTJC 2ZXXA 1N7LA 1SQBK 4R4LA 4R4MA 1L0NJ 3RL0B 5CCHD 3M0DC 4K3AA 2CPBA 5AVTB 1QVFO 3L4FA 3R2PA 3V4WA 3I56P 4EOTA 1UIXA 1GDTA 3L73E 4ZKPA 1EDLA 1PP9E 3H32A 2BCCE 2KK7A 5H2FH 3AEAC 3CL3D 2QA4P 1GU5A 1L0ND 3TNUB 1X9VA 3H1IG 3Q3DA 1IFIA 5EFWB 2KZJA 5AVXB 1BGYD 1JO5A 2N9YB 2QM7A 3PTZA 3AE5C 1NTMK 2Q1KA 1FOSE 2ZFCA 3EQ2A 1AJYA 1BSNA 2WSCJ 1VQ8P 2IFNA 4A7PA 1SQPE 1NTZE 4WVZA 3H1ID 1SQQG 2P67A 1OVVA 1GK4A 3JSVC 3O6QB 1BE3G 1Q90D 4IFMA 1FDMA 3AE2C 3KHUA 2MKVA 3HD7B 2N1TB 3TDKA 2BEQD 3CX5H 1JY3O 4DT0A 3H1JG 5KLVJ 2D2CD 1GD2E 3O8ZA 1USEA 1JB0J 1KB9H 2KNCB 4L74A 2IBZG 5APTA 1GMJA 1AV1A 1NGMB 2V7QH 3V5BA 2M0BA 4IL6E 2OYIB 1L0NK 4W7YA 4U3FG 5KLVD 3FWNA 3T97B 3G9RA 1YITP 2YMKA 1X8YA 3L71J 1Q2NA 1JOCA 1KTMA 1URQC 1PGJA 3G71P 5L8RJ 1MV8A 1LT1A 2KP8A 4NPEA 3EFFK 1VQKP 3HTKA 1URQD 2D2CB 1IFNA 1U7JA 2ZJSE 1P84H 2PAJA 3L71D 3M06A 1NTKE 2OTKE 4D6TG 5KAIE 4WWIA 4WY4B 3NXSA 4PD4E 5KAFH 1DEBA 1S5LH 3K5BA 3CWBG 1EDIA 1S72P 2Y0CA 1RY3A 3KPEA 2AEMA 2KI7B 1L0LE 2CPSA 2KYVA 4UB6E 3BCCJ 2W90A 1PGQA 5CBOA 3CXHD 2FYUE 3L73J 1FS0E 1NKZB 2AXTH 4B86A 2NPSC 5TJHA 2M3BA 1URQB 2HODB 2P1JA 3G6EP 1FDIA 2XV5A 1K05A 2NPSD 3L35A 3BCCD 1EZVI 1CW5A 3TK1A 1MZ9A 1KYOH 2IPPA 5AVRB 1A02F 1BCCD 1YI2P 3TNUA 5KTBA 1SQPJ 1NTZJ 1JUNA 1KZUB 4N6JA 5AW2B 1AQTA 2QJYC 5H2FE 2OYHB 1AVOA 5KKZC 3PJSK 5B66H 1NAYA 2XNDH 1KB9I 1ZR4A 3AE1C 4I2LC 3L72G 4IL6X 1SQPD 1NTZD 2A06D 2HYNA 2JKVA 3PHLA 2PGDA 1RE4A 3RL0g 1KN7A 5CCGA 2N1TA 3N7NA 4AYCA 1NU1D 1FJPA 5APYA 4L75A 2M5AB 1Y47A 3MGNA 2KNCA 1Q7YQ 3P8CD 2JJLA 1EQ7A 3E7KA 2FY8A 3V2RA 3KXDA 2KLUA 3CX5E 1PPJE 2R3SA 2OYIA 1KB9E 5TISH 2J59M 3T97A 5AW6B 3S4RA 2K37A 1P84I 1PV3A 1FU1A 3L75G 3HUSC 1S9KE 1NVOA 2K3RA 4H44C 1NTKJ 2KSJA 3H1LG 1SS1A 3I5CA 2E74C 1FE6A 1FOSF 1JY3P 2KXPB 4H44D 4WB4A 2C9LY 2E74D 4C46A 4WY4A 1L0LJ 3L70E 1SQXJ 1NTKD 1NU1K 4PD4D 2YKOA 3H32B 1LT9C 1P84E 1EXIA 4OH8B 1SFCA 2W8ZA 3FX0A 1X0TA 2R44A 5KAFE 2I1KA 1GL2B 1S5LE 1KYOI 1SQVG 3KQGA 1SQXD 1N73C 1S2EA 1GW3A 1LTIC 3TGUE 2HR3A 5APXA 3VP8A 3H1KG 2QJKC 3Q5SA 5APUA 3CCUP 4RO0A 2RH0A 2HLOA 3UIAA 1VQ5P 2AXTE 1D7MA 2FKWB 5BU8B 2IBZI 2FXPA 2GUVA 2M8RA 1SQBG 1EZVG 4NPFX 2O01H 2G8YA 4BWNA 3MUDA 1KYOE 1LTGC 1VQPP 1SQQE 2L5GB 4HJGH 3IFMA 1BE3E 1FC2C 3RK2B 2ZAEB 3RGUA 2OTLP 1KMIZ 4YPCA 3BVHA 1QL2A 1SQXK 3CI9A 1ZOYC 4U7JA 5B66E 1EXJA 3H1JE 1H0TA 1H8AA 1BDCA 1L2PA 1Y8AA 3SSUA 2IBZE 2NRGA 3BRTB 1NTMG 3V2PA 1JNMA 1YJ9P 3H6PA 3LW5H 3C9IA 3HTKB 1NWQA 2Z4EA 1M57D 2AEJA 2RN0A 3AEGC 2QIWA 1JCDA 2E43A 3SWYA 4U3FE 1L4AA 3VMXA 1JMBA 1PPJD 4H13B 4HYTB 1Q81Q 1QX8A 3U1CA 3KZIH 3PRJA 1M1JB 2KZIA 3CCMP 3FWLA 3GLMA 1R5SA 1JY2N 5APVA 1W2EA 5E79H 2YIUB 2A45G 1PL5A 3GMAA 4GT1A 5TISE 3SFEC 4I7ZB 3AEFC 3L70J 1R5LA 1ZLLA 1S5LX 1HUCA 4D6TE 2RKLA 1M8OB 3HD7C 4BXLA 1AFOA 1L0NG 2WSSH 2Q3EA 4ASVA 5CCGC 2N1TC 1RH5B 5APSA 3D71A 3CWBE 3HD7D 2QJPB 3L74E 1BGYG 5CCGD 2N1TD 3CCSP 2LR2A 5KJ7A 2YXQB 1VQOP 2IX7C 4K35A 2Q7CA 3TGUJ 2Q6QA 2H88C 2WPSA 4BRYB 1GL2A 2OYIC 2XNXA 3VTPC 3OW2O 3JCUH 2OGUA 1LP1B 2YO2A 4LGDE 1VPCA 1PIXA 1CZQA 2B9BA 3KDPB 2B88A 3MIWA 1IC2A 3WUVA 3TGUD 3LIEA 2O01N 4UB8H 1R8EA 1MFTA 1XTCC 2FXOA 1HBWA 3V4QA 1DEEG 1NKNA 4EIJA 2K88A 2D2CC 3LIDA 3CC7P 1KILE 5CMZA 2B87B 1Q82Q 4WY4C 2WSFJ 5KLVG 4N78D 2KS1B 2WWWA 1VDFA 3VOPA 3OAKA 4WY4D 3L72E 2Z5IA 5CJ4A 2B89A 1KC8Q 3C1LA 2JEEA 3P32A 3I55P 1A02J 5AW8B 2KUBA 3HE4B 2XDJA 3CCLP 3A7OA 1IO4A 1RQUA 4C7NA 4IFFA 1T3UA 3AE6C 3L71G 2WQYC 4U3FJ 3U1AA 1HGVA 2HG5D 1AVYA 1H88A 5B5EH 1OW6A 1JTHB 1S4XA 3D6ZA 2A45H 1ZW0A 4Y99B 2LKMA 1U7MA 2WSEH 3M9BA 5BU5A 1M1JA 1NH4A 4IFDK 2IDBA 1FZAA 3MUDC 3RBZA 4D6TJ 2OYHC 3RK3E 1NO4A 2W6BA 1K73Q 3GF7A 3F89A 3CCEP 2O1KA 1SFCB 1LGHB 3CWBJ 3OA7A 1IZNB 5AW0B 2GUSA 3KZIE 3L74J 3AEBC 3BCCG 3P8MC 1PP9J 4XA4A 5KLVK 2BCCJ 1HJBA 1JY2O 5E79E 1BCCG 2J5UA 1LWUA 4RESB 4AUWA 3L74D 1DD3A 3L73D 5KLIB 1PP9D 4QMAA 2BCCD 2ZT9D 1SQVE 4BRYA 3WUTA 4W7ZA 1SQPG 1NTZG 3F5HA 3TYYA 2A06G 3HRNA 1LP1A 1LTTC 1PFIA 3H1KE 2YO3A 2ITAA 1N8RQ 4YXWH 1NU1G 3IN6A 2PFXA 4H0LD 3JCUE 1IFDA 1RE3A 1X22A 3QH9A 3ABVC 2MJZA 3A3YB 1ZMEC 3CC4P 1SQBE 2WPVB 1EZVE 4LC1A 3L72J 1LNQA 2YKPA 1H0TB 2XKMA 2B87A 1ZRTE 4UB8E 3W67A 2Z5HA 2O01J 2ZT9B 2Y0DA 1SP4A 2KS1A 3PH0A 4EDFA 3M9QA 2K9JB 5KJ7C 4GOEA 2C9NY 1L4AB 3GF3A 3CLQA 3HE4A 4DOJA 2K1AA 1SLQA 1GL2C 3M9HA 5KJ7D 1ZN5A 1KQSO 1G1IA 4H0LB 2A45I 2IYPA
chains in the Genus database with same CATH topology
1LTSC 2FXMA 5AVUB 1NOHA 1T8ZA 3IFMA 5AVXB 1JO5A 2QM7A 1GL2D 3RK2B 1NTMK 1FZEA 2WT7A 1FOSE 1RF0C 2ZFCA 3EQ2A 3B8EB 4O9BA 2WPQA 3BVHA 1N7SB 2IFNA 1QL2A 1SQXK 3BASA 3CI9A 1KILB 1OXZA 1JCCA 1JTHA 1ZV8A 2BASA 1SQPK 1NTZK 2P67A 1WRGA 1H8AA 1GK4A 1FJKA 4AQRD 3A5TA 2J58A 3BRTB 3V2PA 2WSCH 1JNMA 4IFMA 1HWTC 1FDMA 3H6PA 2IFMA 3LW5H 1T2KC 2YMYA 3HD7B 3WMM0 5CJ0A 3C9IA 2N1TB 4JF7A 3HTKB 1NWQA 2Z4EA 2YNYA 1L4AC 3A2AA 1JY3O 1JCDA 2E43A 3SWYA 4JYBA 1N2DC 1T2KD 1GD2E 2QM8A 3O8ZA 1L4AA 3HE5B 2R5DA 3VMXA 1J2JB 3KYQA 4HYTB 1L4AD 3U1CA 3RK2C 3TSIA 5APTA 1M1JB 2WSFH 3EFGA 3N4XA 3V5BA 2OYIB 5APVA 1JY2N 1L0NK 1W2EA 1N7SC 4KHXA 4W7YA 3RK2D 1KILC 2A45G 4ZKUA 1GZLA 5APWA 4GT1A 3PP5A 1FAVA 1J1EC 1ZLLA 5AW9B 1XTGB 5CCHA 1GU4A 1HUCA 1N7SD 1X8YA 1JOCA 3NFQA 3NMDA 1KILD 1URQC 1LTJA 3HD7C 1AFOA 2P7JA 5CCGC 2N1TC 3B5NC 5APSA 1MV8A 3IR9A 1AQ5A 3HD7A 2KP8A 2Q9IA 1J1DB 3M0DA 3U59A 5AW5B 2R32A 3HTKA 2NPSB 1H89A 1URQD 1IFNA 3HD7D 2HPCB 2WTYA 5AVSB 2N1TD 5CCGD 3B5ND 3V2NA 2H7HA 2KLVA 2PAJA 3M06A 3RK3B 3MTUE 3NTNA 5KJ7A 4WY4B 5AVVB 3NXSA 1NTKK 2IX7C 1M1JC 2Q7CA 3BRVB 2C0XA 2OARA 3V2QA 1DEBA 2WPSA 3M91A 1GL2A 2OYIC 2XNXA 3VTPC 5AW1B 5AVQB 1RY3A 3KPEA 2YO2A 4LGDE 1VPCA 1IFMA 1CZQA 2CPSA 3KDPB 1L0LK 2KYVA 1RF0A 3BATA 3MIWA 1IC2A 4M3LA 1X79B 1T3JA 4C7NB 5AW3B 3LIEA 5BVZA 3VN0A 1J1EB 2XZRA 2VRSA 1XTCC 2FFDC 1GK6A 1FZCC 1HBWA 2FYUK 1NKZB 1HGZA 3V4QA 1J1DC 1NKNA 4B86A 4EIJA 2NPSC 1CI6B 2P2UA 2M3BA 1URQB 1HH0A 2HODB 1IJDB 2P1JA 3LIDA 3B5NB 3M0AA 5CMZA 3RK3C 4WY4C 2XV5A 2NPSD 3G3ZA 3L35A 2R3CA 5AVZB 1CW5A 3TK1A 1MZ9A 1QL1A 4N78D 2IPPA 2WWWA 5AVRB 1VDFA 1A02F 3RK3D 3VOPA 3OAKA 4W80A 4WY4D 3TNUA 1G2CB 1GTWA 5KTBA 5CJ4A 2Z5IA 1YYCA 1JUNA 1KZUB 1KQLA 2JEEA 1HVVA 3P32A 4N6JA 1WT6A 1A02J 5AW2B 5AW8B 3HE4B 2R5BA 2XDJA 2OYHB 4I1LA 1S9KD 1NHLA 3A7OA 1N7SA 1IO4A 4I6MC 1IK9A 1RE3C 1KILA 2I1JA 1ZR4A 4C7NA 4I2LC 4IFFA 1T3UA 4GKGA 3U1AA 3HUSB 2YKQA 2HYNA 1RE4C 1HGVA 2W6AA 1IFIA 2HG5D 2FFDB 1IFJA 1FZCB 1URQA 2HODA 4N3YB 1H88A 1FZBA 1RE4A 1LWUB 5CCGA 2N1TA 1JY3N 1GW4A 3B5NA 3N7NA 1JTHB 3GHGC 2PP6A 4AYCA 1FJPA 1E5WA 5APYA 2A45H 3MD0A 3MGNA 3VYIA 4Y99B 2LKMA 2POHA 2WITA 3VMYA 3HE5A 2WSEH 3P8CD 5APQA 4JYCA 1FZFA 2JJLA 3M9BA 4C7RA 5BU5A 1G2CA 1EQ7A 2O1JA 4HH2A 1M1JA 3V2RA 1NH4A 1MUUA 4IFDK 1FZAA 4N78E 3E1IA 2OYHC 1M7LA 2ZXEB 1NO4A 1MFZA 2KOGA 2W6BA 1JY2P 2OYIA 1SVFA 1RF1C 4XE5B 2O1KA 1SFCB 1LGHB 1KFNA 1LT9B 2OYHA 2KB7P 2J59M 3OJAB 3T97A 5AW6B 2E42A 1YTZT 2WPRA 3OA7A 1FU1A 5AW0B 2GUSA 5AVWB 3HUSC 2HFED 3P7KA 3P8MC 4GIFA 4XA4A 2W27A 5KLVK 1S9KE 3HUSA 1HJBA 1N73B 2KSJA 1LWUC 1JY2O 5AW7B 2FFDA 1FZCA 3I5CA 1LTAC 1FOSF 1FZGA 1LWUA 3RL0C 1JY3P 4Y99C 2NPSA 2HPCA 4RESB 1DX7A 1G1JA 4WB4A 2C9LY 4AUWA 2C0WA 1LTJB 3GHGB 1Z56A 1JMMA 4C46A 4WY4A 3RL0D 3SWFA 2H43A 1ZR2A 5CHXA 1NU1K 1LTBC 1SQVK 2YKOA 4W7ZA 4LLHA 2H8PD 3TYYA 1SFCC 3H32B 1LT9C 2Q3IA 3HRNA 1CSBA 3P8CE 1LTTC 1N86A 1PFIA 4OH8B 4WBAA 1SFCA 2FYZA 1LT9A 3VMZA 2YO3A 2GM4A 2Q5UA 5AW4B 1RF1B 1KFMA 2I1KA 1SFCD 1GL2B 3KQGA 1HTLC 2XU6A 1N73C 5AVYB 1IFDA 1RE3A 2WT7B 1N73A 1GW3A 1OWAA 1DH3A 1LTIC 2MJZA 3A3YB 5CCHC 1CI6A 2N9BA 2WZ7A 5APXA 3VP8A 3L36A 5APUA 4DZOA 1LTJC 4LC1A 2YKPA 1NAFA 1N7LA 1SQBK 2XKMA 3VP9A 3RL0B 5CCHD 3GHGA 2Z5HA 1YTZI 3M0DC 2HLOA 5AVTB 2CPBA 3UIAA 1SP4A 3L4FA 2FKWB 5BU8B 3L37A 2GUVA 3M9QA 1FBMA 2M8RA 3R2PA 3V4WA 5KJ7C 4EOTA 3II6A 1GDTA 2C9NY 4ZKPA 2O01H 3H32A 1L4AB 3CL3D 3CLQA 3HE4A 1GU5A 4DOJA 3MUDA 1SLQA 1GL2C 3M9HA 5KJ7D 1ZN5A 1LTGC 1G1IA 2A45I 3TNUB 2L5GB 1X9VA 1RF1A 1SQQK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XDJ A;  2NPS B;  1URQ D;  3RK2 B;  1GL2 D;  1NHL A;  3HD7 D;  4WY4 A;  1N7S A;  3RL0 D;  5CCG D;  2N1T D;  3B5N D;  1KIL A;  3RK3 B;  5KJ7 A;  4WY4 B;  1N7S B;  4W7Z A;  1KIL B;  2H8P D;  1JTH A;  2HG5 D;  1SFC C;  3P8C E;  1URQ A;  1GL2 A;  4OH8 B;  5CCG A;  1SFC A;  2N1T A;  3B5N A;  1JTH B;  2PP6 A;  4LGD E;  1SFC D;  1GL2 B;  2YMY A;  3HD7 B;  2N1T B;  4JF7 A;  3HTK B;  1L4A C;  1T3J A;  1L4A A;  5CCH C;  2WZ7 A;  3KYQ A;  4N78 E;  1L4A D;  2NPS C;  2KOG A;  3RK2 C;  3TSI A;  1URQ B;  3RL0 B;  5CCH D;  1SFC B;  3B5N B;  3M0D C;  3RK3 C;  4WY4 C;  1N7S C;  4W7Y A;  2NPS D;  3RK2 D;  1KIL C;  2HFE D;  2M8R A;  3PP5 A;  5KJ7 C;  3RK3 D;  1XTG B;  3VOP A;  5CCH A;  4W80 A;  4WY4 D;  1N7S D;  1L4A B;  1KIL D;  1URQ C;  1GL2 C;  3HD7 C;  3RL0 C;  5KJ7 D;  1HVV A;  2NPS A;  5CCG C;  2N1T C;  3B5N C;  3HD7 A; 
#chains in the Genus database with same CATH topology
 1LTS C;  1NOH A;  1T8Z A;  2GA1 A;  1NTM E;  3WUU A;  1GL2 D;  1VQ6 P;  1FZE A;  2WT7 A;  3B8E B;  1NTK G;  3CME P;  1N7S B;  1E79 H;  3LW5 J;  3VMA A;  1OX3 A;  1KIL B;  1JTH A;  1ZV8 A;  4ZNC A;  1SQP K;  1NTZ K;  3PLN A;  1FJK A;  4AQR D;  3A5T A;  2JO1 A;  1OIP A;  1NJI Q;  1HWT C;  2IFM A;  2YMY A;  3H1H E;  5CJ0 A;  5B5E E;  1SQX G;  2E76 C;  1JEK A;  2YNY A;  2ZYG A;  3SFD C;  2FYU J;  1N2D C;  1VF5 C;  2QM8 A;  3HE5 B;  4EYY Q;  1BDD A;  1W2B O;  3KYQ A;  2E76 D;  1L0L D;  3RK2 C;  3TSI A;  1VF5 D;  2SPZ A;  1VL2 A;  1L0N E;  4KHX A;  4HB1 A;  3RK2 D;  2FYU D;  4ZKU A;  1GZL A;  1AA0 A;  5APW A;  1PGO A;  1BGY E;  1J1E C;  5AW9 B;  1XTG B;  4PV1 B;  1S3J A;  3NFQ A;  2P10 A;  3NMD A;  2V4H A;  2P7J A;  2CK3 H;  3IR9 A;  3H1K J;  3H1I E;  4JPZ B;  2Q9I A;  1J1D B;  4TLF A;  5AW5 B;  2R32 A;  1H89 A;  4RJT A;  2HPC B;  3B4S A;  5AVS B;  5GTI H;  4H13 C;  2H7H A;  2E76 B;  3RK3 B;  4MN4 C;  1NTK K;  1M1J C;  1QGK B;  2C0X A;  2JR8 A;  1VF5 B;  1VQ7 P;  4H13 D;  3M91 A;  3AE7 C;  4Y28 J;  2QE7 H;  2YIU C;  2E5T A;  4I7Z C;  1L0L K;  1RF0 A;  3IF4 A;  4M3L A;  1X79 B;  1T3J A;  4C7N B;  2ZYD A;  1JM0 A;  3VN0 A;  1J1E B;  2XZR A;  4PJ0 H;  1DIP A;  2FYU K;  1YIJ P;  1HGZ A;  1PPJ G;  1Q86 Q;  1CI6 B;  2QJP C;  4NPD A;  2AEF A;  4DCK A;  2K9J A;  1MKM A;  3CXH I;  1NTM J;  2V7Q J;  5AVZ B;  3AE8 C;  1QL1 A;  4PD4 H;  3CX5 D;  3C8V A;  3SWK A;  1KB9 D;  4YTP C;  1DD4 A;  3CPW O;  3CCJ P;  2FYN C;  1KQL A;  1HVV A;  4OGQ D;  3CC2 P;  1HF9 A;  4ASW A;  4I1L A;  2IYO A;  1S9K D;  1NHL A;  1N7S A;  3H1H J;  2Y0E A;  4I6M C;  1RE3 C;  1KIL A;  2I1J A;  1FDO A;  1RE4 C;  2W6A A;  1IFJ A;  3MHV A;  1QEX A;  1LWU B;  1GW4 A;  3B5N A;  1OVR A;  2JWD A;  3L70 D;  3H1H D;  1E5W A;  2WIT A;  3VMY A;  3HE5 A;  3AEC C;  2KIK A;  5APQ A;  1FZF A;  1P84 D;  1G2C A;  3TGU G;  1BGY J;  2O1J A;  1YQ3 C;  4OGQ B;  3BCC E;  4HH2 A;  1MUU A;  2YXR B;  3E1I A;  3JC2 2;  2Y9Y A;  1YJW P;  1BCC E;  3A0H H;  2FYN B;  1SVF A;  1M90 Q;  3OJA B;  3TF5 A;  3H1I J;  1YTZ T;  4DJG A;  2UWJ E;  1VQM P;  4GIF A;  1VQ4 P;  3S9O A;  2W27 A;  3HUS A;  4JQ0 D;  5AW7 B;  2FFD A;  1FZC A;  1LTA C;  4L73 A;  1SQQ J;  4Y99 C;  3Q1M A;  2A06 E;  2HPC A;  4JBZ A;  1S1C X;  1YJN P;  1BE3 J;  1LTJ B;  3D6Y A;  1Z56 A;  1JMM A;  1Y9B A;  1NU1 E;  3SWF A;  2H43 A;  1ZR2 A;  4XFJ A;  5CHX A;  1KYO D;  3H1J J;  1SQQ D;  3V6I A;  1SFC C;  5GTI E;  5GTH H;  2Q3I A;  1CSB A;  3FGA D;  3P8C E;  4ZMD A;  1BE3 D;  1OFC X;  1LT9 A;  2GM4 A;  5AW4 B;  1KFM A;  1SFC D;  4PD4 I;  1HTL C;  3ZDM A;  3H1J D;  2WT7 B;  1N73 A;  1DH3 A;  4OWF A;  3CCV P;  2E75 C;  1CI6 A;  3CCQ P;  2IBZ D;  2RMZ A;  3WU2 H;  3L36 A;  4DZO A;  1NAF A;  2LXB A;  2JWA A;  1K9M Q;  1VQL P;  5KLI C;  3VP9 A;  1W5C E;  2E75 D;  4PJ0 E;  3GHG A;  1YHQ P;  1YTZ I;  1RHZ B;  4U3F D;  3L75 E;  2WMM A;  3L37 A;  1FBM A;  3II6 A;  4GOF A;  1EDK A;  3E1R A;  3H1L E;  4CPG A;  3GG2 A;  3CMA P;  1VQ9 P;  1RF1 A;  1SQQ K;  2FXM A;  5AVU B;  3Q5R A;  1WMK A;  3R4Y A;  2ZYA A;  2LXC B;  3L74 G;  1RF0 C;  3L73 G;  1PP9 G;  4HKZ H;  4D6T D;  2BCC G;  4O9B A;  1SQX E;  2WPQ A;  3BAS A;  2NZ2 A;  1OXZ A;  1JCC A;  2BAS A;  1KD1 Q;  2E75 B;  3CWB D;  1WRG A;  2ZT9 C;  3S1K A;  1QLE D;  2J58 A;  2M3E A;  4Z1M H;  1BCC J;  2WSC H;  1BSH A;  1T2K C;  3WMM 0;  4JF7 A;  4IOI H;  1L4A C;  3A2A A;  3D70 A;  4JYB A;  1T2K D;  4H0L C;  1OMI A;  3AE4 C;  2R5D A;  1YQ4 C;  3AE9 C;  1J2J B;  1L4A D;  2OYO A;  5K5G B;  2WSF H;  3EFG A;  1LJ2 A;  3N4X A;  4GOD A;  3A0B H;  1N7S C;  3A0H E;  1KIL C;  3CX5 I;  3PP5 A;  1T6A A;  1NU1 J;  1KQG B;  1FAV A;  4L76 A;  2E5Y A;  5CCH A;  1GU4 A;  1N7S D;  2K9Y A;  1KIL D;  1LTJ A;  3O6Q A;  3FXD A;  3GW6 A;  3B5N C;  2I8D A;  1AQ5 A;  3HD7 A;  3MZW B;  3U59 A;  3M0D A;  3Q2Y A;  3B71 A;  2NPS B;  3G4S P;  2WTY A;  3RBX A;  3B5N D;  2ZVO B;  3V2N A;  3L72 D;  2KLV A;  3MTU E;  3NTN A;  1EDJ A;  5AVV B;  2AXC A;  3W68 A;  3BRV B;  2OAR A;  2O3J A;  3V2Q A;  2H89 C;  1EC5 A;  1HJ0 A;  5AW1 B;  1PZQ A;  5AVQ B;  5DJT B;  5GTH E;  4OVN F;  1IFM A;  3CXH H;  3L75 J;  4PV1 C;  4RKU J;  3CD6 P;  3BAT A;  1IK7 A;  2QJY B;  1U57 A;  5AW3 B;  5KKZ B;  5BVZ A;  2VRS A;  2FFD C;  1GK6 A;  1FZC C;  3H1L J;  4PV1 D;  1J1D C;  1USD A;  1M1K Q;  2P2U A;  1HH0 A;  4EI2 A;  1IJD B;  2IZ0 A;  2QVA A;  1L0L G;  3WU2 E;  3B5N B;  3M0A A;  2QRX A;  1KV4 A;  3RK3 C;  3L75 D;  1UII A;  1OW7 A;  1VQN P;  1K04 A;  3G3Z A;  2R3C A;  2FYU G;  5CBN A;  3H1L D;  4KJM A;  3RK3 D;  1ZXG A;  4KT0 J;  4W80 A;  2WVR A;  1G2C B;  3AED C;  1GTW A;  1YYC A;  1WT6 A;  2R5B A;  2QG4 A;  2ZVN B;  1SQV J;  5M1B A;  1IK9 A;  3USS A;  3EWK A;  3AE3 C;  2G3A A;  4YXD C;  4GKG A;  3HUS B;  1PGP A;  2YKQ A;  2Y9Z A;  3IAO A;  2FFD B;  1FZC B;  1URQ A;  2HOD A;  4N3Y B;  2IZ1 A;  4TT3 H;  1FZB A;  4H44 B;  1JY3 N;  1ZP0 C;  1NYH A;  2PP6 A;  3GHG C;  2E74 B;  2L91 A;  3H25 A;  1SQV D;  3MD0 A;  2KSE A;  3VYI A;  2POH A;  1KQF B;  4JYC A;  5DJU B;  4C7R A;  3H1K D;  1SQB J;  3QWO C;  4N78 E;  2W6J H;  4IL6 H;  4GDO A;  1M7L A;  2ZXE B;  3ITK A;  1MFZ A;  2KOG A;  1JY2 P;  1RF1 C;  4XE5 B;  1KFN A;  1LT9 B;  2OYH A;  2KB7 P;  2E42 A;  2WPR A;  1OVU A;  2P58 A;  5AVW B;  2HFE D;  1OZH A;  5KLV E;  1SQB D;  3P7K A;  2JDI H;  1EZV D;  2OTJ P;  2W83 C;  1TU3 F;  1N73 B;  3A0B E;  1LWU C;  1ZRT D;  1IFP A;  1FZG A;  3RL0 C;  1OW8 A;  2NPS A;  1DX7 A;  2QJK B;  1G1J A;  2C0W A;  2M5A A;  1RQV A;  3GHG B;  2JP3 A;  5KAI H;  2DW3 A;  2QSI A;  3RL0 D;  4OGQ C;  1QVG O;  3MP7 B;  1M56 D;  5C39 A;  2QEX P;  1LTB C;  1SQV K;  2PRR A;  3CCR P;  2BEZ F;  3L71 E;  4LLH A;  2OQQ A;  2H8P D;  1N86 A;  1NTM D;  1KOR A;  4WBA A;  2FYZ A;  3VMZ A;  1K8A Q;  4UB6 H;  2Q5U A;  1RF1 B;  3L70 G;  3H1H G;  2XU6 A;  5AVY B;  1YBK A;  3FXE A;  3AEE C;  1OWA A;  5CCH C;  2N9B A;  2WZ7 A;  2FBW C;  3CXH E;  2WSE J;  3Q5P A;  1LTJ C;  2ZXX A;  1N7L A;  1SQB K;  4R4L A;  4R4M A;  1L0N J;  3RL0 B;  5CCH D;  3M0D C;  4K3A A;  2CPB A;  5AVT B;  1QVF O;  3L4F A;  3R2P A;  3V4W A;  3I56 P;  4EOT A;  1UIX A;  1GDT A;  3L73 E;  4ZKP A;  1EDL A;  1PP9 E;  3H32 A;  2BCC E;  2KK7 A;  5H2F H;  3AEA C;  3CL3 D;  2QA4 P;  1GU5 A;  1L0N D;  3TNU B;  1X9V A;  3H1I G;  3Q3D A;  1IFI A;  5EFW B;  2KZJ A;  5AVX B;  1BGY D;  1JO5 A;  2N9Y B;  2QM7 A;  3PTZ A;  3AE5 C;  1NTM K;  2Q1K A;  1FOS E;  2ZFC A;  3EQ2 A;  1AJY A;  1BSN A;  2WSC J;  1VQ8 P;  2IFN A;  4A7P A;  1SQP E;  1NTZ E;  4WVZ A;  3H1I D;  1SQQ G;  2P67 A;  1OVV A;  1GK4 A;  3JSV C;  3O6Q B;  1BE3 G;  1Q90 D;  4IFM A;  1FDM A;  3AE2 C;  3KHU A;  2MKV A;  3HD7 B;  2N1T B;  3TDK A;  2BEQ D;  3CX5 H;  1JY3 O;  4DT0 A;  3H1J G;  5KLV J;  2D2C D;  1GD2 E;  3O8Z A;  1USE A;  1JB0 J;  1KB9 H;  2KNC B;  4L74 A;  2IBZ G;  5APT A;  1GMJ A;  1AV1 A;  1NGM B;  2V7Q H;  3V5B A;  2M0B A;  4IL6 E;  2OYI B;  1L0N K;  4W7Y A;  4U3F G;  5KLV D;  3FWN A;  3T97 B;  3G9R A;  1YIT P;  2YMK A;  1X8Y A;  3L71 J;  1Q2N A;  1JOC A;  1KTM A;  1URQ C;  1PGJ A;  3G71 P;  5L8R J;  1MV8 A;  1LT1 A;  2KP8 A;  4NPE A;  3EFF K;  1VQK P;  3HTK A;  1URQ D;  2D2C B;  1IFN A;  1U7J A;  2ZJS E;  1P84 H;  2PAJ A;  3L71 D;  3M06 A;  1NTK E;  2OTK E;  4D6T G;  5KAI E;  4WWI A;  4WY4 B;  3NXS A;  4PD4 E;  5KAF H;  1DEB A;  1S5L H;  3K5B A;  3CWB G;  1EDI A;  1S72 P;  2Y0C A;  1RY3 A;  3KPE A;  2AEM A;  2KI7 B;  1L0L E;  2CPS A;  2KYV A;  4UB6 E;  3BCC J;  2W90 A;  1PGQ A;  5CBO A;  3CXH D;  2FYU E;  3L73 J;  1FS0 E;  1NKZ B;  2AXT H;  4B86 A;  2NPS C;  5TJH A;  2M3B A;  1URQ B;  2HOD B;  2P1J A;  3G6E P;  1FDI A;  2XV5 A;  1K05 A;  2NPS D;  3L35 A;  3BCC D;  1EZV I;  1CW5 A;  3TK1 A;  1MZ9 A;  1KYO H;  2IPP A;  5AVR B;  1A02 F;  1BCC D;  1YI2 P;  3TNU A;  5KTB A;  1SQP J;  1NTZ J;  1JUN A;  1KZU B;  4N6J A;  5AW2 B;  1AQT A;  2QJY C;  5H2F E;  2OYH B;  1AVO A;  5KKZ C;  3PJS K;  5B66 H;  1NAY A;  2XND H;  1KB9 I;  1ZR4 A;  3AE1 C;  4I2L C;  3L72 G;  4IL6 X;  1SQP D;  1NTZ D;  2A06 D;  2HYN A;  2JKV A;  3PHL A;  2PGD A;  1RE4 A;  3RL0 g;  1KN7 A;  5CCG A;  2N1T A;  3N7N A;  4AYC A;  1NU1 D;  1FJP A;  5APY A;  4L75 A;  2M5A B;  1Y47 A;  3MGN A;  2KNC A;  1Q7Y Q;  3P8C D;  2JJL A;  1EQ7 A;  3E7K A;  2FY8 A;  3V2R A;  3KXD A;  2KLU A;  3CX5 E;  1PPJ E;  2R3S A;  2OYI A;  1KB9 E;  5TIS H;  2J59 M;  3T97 A;  5AW6 B;  3S4R A;  2K37 A;  1P84 I;  1PV3 A;  1FU1 A;  3L75 G;  3HUS C;  1S9K E;  1NVO A;  2K3R A;  4H44 C;  1NTK J;  2KSJ A;  3H1L G;  1SS1 A;  3I5C A;  2E74 C;  1FE6 A;  1FOS F;  1JY3 P;  2KXP B;  4H44 D;  4WB4 A;  2C9L Y;  2E74 D;  4C46 A;  4WY4 A;  1L0L J;  3L70 E;  1SQX J;  1NTK D;  1NU1 K;  4PD4 D;  2YKO A;  3H32 B;  1LT9 C;  1P84 E;  1EXI A;  4OH8 B;  1SFC A;  2W8Z A;  3FX0 A;  1X0T A;  2R44 A;  5KAF E;  2I1K A;  1GL2 B;  1S5L E;  1KYO I;  1SQV G;  3KQG A;  1SQX D;  1N73 C;  1S2E A;  1GW3 A;  1LTI C;  3TGU E;  2HR3 A;  5APX A;  3VP8 A;  3H1K G;  2QJK C;  3Q5S A;  5APU A;  3CCU P;  4RO0 A;  2RH0 A;  2HLO A;  3UIA A;  1VQ5 P;  2AXT E;  1D7M A;  2FKW B;  5BU8 B;  2IBZ I;  2FXP A;  2GUV A;  2M8R A;  1SQB G;  1EZV G;  4NPF X;  2O01 H;  2G8Y A;  4BWN A;  3MUD A;  1KYO E;  1LTG C;  1VQP P;  1SQQ E;  2L5G B;  4HJG H;  3IFM A;  1BE3 E;  1FC2 C;  3RK2 B;  2ZAE B;  3RGU A;  2OTL P;  1KMI Z;  4YPC A;  3BVH A;  1QL2 A;  1SQX K;  3CI9 A;  1ZOY C;  4U7J A;  5B66 E;  1EXJ A;  3H1J E;  1H0T A;  1H8A A;  1BDC A;  1L2P A;  1Y8A A;  3SSU A;  2IBZ E;  2NRG A;  3BRT B;  1NTM G;  3V2P A;  1JNM A;  1YJ9 P;  3H6P A;  3LW5 H;  3C9I A;  3HTK B;  1NWQ A;  2Z4E A;  1M57 D;  2AEJ A;  2RN0 A;  3AEG C;  2QIW A;  1JCD A;  2E43 A;  3SWY A;  4U3F E;  1L4A A;  3VMX A;  1JMB A;  1PPJ D;  4H13 B;  4HYT B;  1Q81 Q;  1QX8 A;  3U1C A;  3KZI H;  3PRJ A;  1M1J B;  2KZI A;  3CCM P;  3FWL A;  3GLM A;  1R5S A;  1JY2 N;  5APV A;  1W2E A;  5E79 H;  2YIU B;  2A45 G;  1PL5 A;  3GMA A;  4GT1 A;  5TIS E;  3SFE C;  4I7Z B;  3AEF C;  3L70 J;  1R5L A;  1ZLL A;  1S5L X;  1HUC A;  4D6T E;  2RKL A;  1M8O B;  3HD7 C;  4BXL A;  1AFO A;  1L0N G;  2WSS H;  2Q3E A;  4ASV A;  5CCG C;  2N1T C;  1RH5 B;  5APS A;  3D71 A;  3CWB E;  3HD7 D;  2QJP B;  3L74 E;  1BGY G;  5CCG D;  2N1T D;  3CCS P;  2LR2 A;  5KJ7 A;  2YXQ B;  1VQO P;  2IX7 C;  4K35 A;  2Q7C A;  3TGU J;  2Q6Q A;  2H88 C;  2WPS A;  4BRY B;  1GL2 A;  2OYI C;  2XNX A;  3VTP C;  3OW2 O;  3JCU H;  2OGU A;  1LP1 B;  2YO2 A;  4LGD E;  1VPC A;  1PIX A;  1CZQ A;  2B9B A;  3KDP B;  2B88 A;  3MIW A;  1IC2 A;  3WUV A;  3TGU D;  3LIE A;  2O01 N;  4UB8 H;  1R8E A;  1MFT A;  1XTC C;  2FXO A;  1HBW A;  3V4Q A;  1DEE G;  1NKN A;  4EIJ A;  2K88 A;  2D2C C;  3LID A;  3CC7 P;  1KIL E;  5CMZ A;  2B87 B;  1Q82 Q;  4WY4 C;  2WSF J;  5KLV G;  4N78 D;  2KS1 B;  2WWW A;  1VDF A;  3VOP A;  3OAK A;  4WY4 D;  3L72 E;  2Z5I A;  5CJ4 A;  2B89 A;  1KC8 Q;  3C1L A;  2JEE A;  3P32 A;  3I55 P;  1A02 J;  5AW8 B;  2KUB A;  3HE4 B;  2XDJ A;  3CCL P;  3A7O A;  1IO4 A;  1RQU A;  4C7N A;  4IFF A;  1T3U A;  3AE6 C;  3L71 G;  2WQY C;  4U3F J;  3U1A A;  1HGV A;  2HG5 D;  1AVY A;  1H88 A;  5B5E H;  1OW6 A;  1JTH B;  1S4X A;  3D6Z A;  2A45 H;  1ZW0 A;  4Y99 B;  2LKM A;  1U7M A;  2WSE H;  3M9B A;  5BU5 A;  1M1J A;  1NH4 A;  4IFD K;  2IDB A;  1FZA A;  3MUD C;  3RBZ A;  4D6T J;  2OYH C;  3RK3 E;  1NO4 A;  2W6B A;  1K73 Q;  3GF7 A;  3F89 A;  3CCE P;  2O1K A;  1SFC B;  1LGH B;  3CWB J;  3OA7 A;  1IZN B;  5AW0 B;  2GUS A;  3KZI E;  3L74 J;  3AEB C;  3BCC G;  3P8M C;  1PP9 J;  4XA4 A;  5KLV K;  2BCC J;  1HJB A;  1JY2 O;  5E79 E;  1BCC G;  2J5U A;  1LWU A;  4RES B;  4AUW A;  3L74 D;  1DD3 A;  3L73 D;  5KLI B;  1PP9 D;  4QMA A;  2BCC D;  2ZT9 D;  1SQV E;  4BRY A;  3WUT A;  4W7Z A;  1SQP G;  1NTZ G;  3F5H A;  3TYY A;  2A06 G;  3HRN A;  1LP1 A;  1LTT C;  1PFI A;  3H1K E;  2YO3 A;  2ITA A;  1N8R Q;  4YXW H;  1NU1 G;  3IN6 A;  2PFX A;  4H0L D;  3JCU E;  1IFD A;  1RE3 A;  1X22 A;  3QH9 A;  3ABV C;  2MJZ A;  3A3Y B;  1ZME C;  3CC4 P;  1SQB E;  2WPV B;  1EZV E;  4LC1 A;  3L72 J;  1LNQ A;  2YKP A;  1H0T B;  2XKM A;  2B87 A;  1ZRT E;  4UB8 E;  3W67 A;  2Z5H A;  2O01 J;  2ZT9 B;  2Y0D A;  1SP4 A;  2KS1 A;  3PH0 A;  4EDF A;  3M9Q A;  2K9J B;  5KJ7 C;  4GOE A;  2C9N Y;  1L4A B;  3GF3 A;  3CLQ A;  3HE4 A;  4DOJ A;  2K1A A;  1SLQ A;  1GL2 C;  3M9H A;  5KJ7 D;  1ZN5 A;  1KQS O;  1G1I A;  4H0L B;  2A45 I;  2IYP A; 
#chains in the Genus database with same CATH homology
 1LTS C;  2FXM A;  5AVU B;  1NOH A;  1T8Z A;  3IFM A;  5AVX B;  1JO5 A;  2QM7 A;  1GL2 D;  3RK2 B;  1NTM K;  1FZE A;  2WT7 A;  1FOS E;  1RF0 C;  2ZFC A;  3EQ2 A;  3B8E B;  4O9B A;  2WPQ A;  3BVH A;  1N7S B;  2IFN A;  1QL2 A;  1SQX K;  3BAS A;  3CI9 A;  1KIL B;  1OXZ A;  1JCC A;  1JTH A;  1ZV8 A;  2BAS A;  1SQP K;  1NTZ K;  2P67 A;  1WRG A;  1H8A A;  1GK4 A;  1FJK A;  4AQR D;  3A5T A;  2J58 A;  3BRT B;  3V2P A;  2WSC H;  1JNM A;  4IFM A;  1HWT C;  1FDM A;  3H6P A;  2IFM A;  3LW5 H;  1T2K C;  2YMY A;  3HD7 B;  3WMM 0;  5CJ0 A;  3C9I A;  2N1T B;  4JF7 A;  3HTK B;  1NWQ A;  2Z4E A;  2YNY A;  1L4A C;  3A2A A;  1JY3 O;  1JCD A;  2E43 A;  3SWY A;  4JYB A;  1N2D C;  1T2K D;  1GD2 E;  2QM8 A;  3O8Z A;  1L4A A;  3HE5 B;  2R5D A;  3VMX A;  1J2J B;  3KYQ A;  4HYT B;  1L4A D;  3U1C A;  3RK2 C;  3TSI A;  5APT A;  1M1J B;  2WSF H;  3EFG A;  3N4X A;  3V5B A;  2OYI B;  5APV A;  1JY2 N;  1L0N K;  1W2E A;  1N7S C;  4KHX A;  4W7Y A;  3RK2 D;  1KIL C;  2A45 G;  4ZKU A;  1GZL A;  5APW A;  4GT1 A;  3PP5 A;  1FAV A;  1J1E C;  1ZLL A;  5AW9 B;  1XTG B;  5CCH A;  1GU4 A;  1HUC A;  1N7S D;  1X8Y A;  1JOC A;  3NFQ A;  3NMD A;  1KIL D;  1URQ C;  1LTJ A;  3HD7 C;  1AFO A;  2P7J A;  5CCG C;  2N1T C;  3B5N C;  5APS A;  1MV8 A;  3IR9 A;  1AQ5 A;  3HD7 A;  2KP8 A;  2Q9I A;  1J1D B;  3M0D A;  3U59 A;  5AW5 B;  2R32 A;  3HTK A;  2NPS B;  1H89 A;  1URQ D;  1IFN A;  3HD7 D;  2HPC B;  2WTY A;  5AVS B;  2N1T D;  5CCG D;  3B5N D;  3V2N A;  2H7H A;  2KLV A;  2PAJ A;  3M06 A;  3RK3 B;  3MTU E;  3NTN A;  5KJ7 A;  4WY4 B;  5AVV B;  3NXS A;  1NTK K;  2IX7 C;  1M1J C;  2Q7C A;  3BRV B;  2C0X A;  2OAR A;  3V2Q A;  1DEB A;  2WPS A;  3M91 A;  1GL2 A;  2OYI C;  2XNX A;  3VTP C;  5AW1 B;  5AVQ B;  1RY3 A;  3KPE A;  2YO2 A;  4LGD E;  1VPC A;  1IFM A;  1CZQ A;  2CPS A;  3KDP B;  1L0L K;  2KYV A;  1RF0 A;  3BAT A;  3MIW A;  1IC2 A;  4M3L A;  1X79 B;  1T3J A;  4C7N B;  5AW3 B;  3LIE A;  5BVZ A;  3VN0 A;  1J1E B;  2XZR A;  2VRS A;  1XTC C;  2FFD C;  1GK6 A;  1FZC C;  1HBW A;  2FYU K;  1NKZ B;  1HGZ A;  3V4Q A;  1J1D C;  1NKN A;  4B86 A;  4EIJ A;  2NPS C;  1CI6 B;  2P2U A;  2M3B A;  1URQ B;  1HH0 A;  2HOD B;  1IJD B;  2P1J A;  3LID A;  3B5N B;  3M0A A;  5CMZ A;  3RK3 C;  4WY4 C;  2XV5 A;  2NPS D;  3G3Z A;  3L35 A;  2R3C A;  5AVZ B;  1CW5 A;  3TK1 A;  1MZ9 A;  1QL1 A;  4N78 D;  2IPP A;  2WWW A;  5AVR B;  1VDF A;  1A02 F;  3RK3 D;  3VOP A;  3OAK A;  4W80 A;  4WY4 D;  3TNU A;  1G2C B;  1GTW A;  5KTB A;  5CJ4 A;  2Z5I A;  1YYC A;  1JUN A;  1KZU B;  1KQL A;  2JEE A;  1HVV A;  3P32 A;  4N6J A;  1WT6 A;  1A02 J;  5AW2 B;  5AW8 B;  3HE4 B;  2R5B A;  2XDJ A;  2OYH B;  4I1L A;  1S9K D;  1NHL A;  3A7O A;  1N7S A;  1IO4 A;  4I6M C;  1IK9 A;  1RE3 C;  1KIL A;  2I1J A;  1ZR4 A;  4C7N A;  4I2L C;  4IFF A;  1T3U A;  4GKG A;  3U1A A;  3HUS B;  2YKQ A;  2HYN A;  1RE4 C;  1HGV A;  2W6A A;  1IFI A;  2HG5 D;  2FFD B;  1IFJ A;  1FZC B;  1URQ A;  2HOD A;  4N3Y B;  1H88 A;  1FZB A;  1RE4 A;  1LWU B;  5CCG A;  2N1T A;  1JY3 N;  1GW4 A;  3B5N A;  3N7N A;  1JTH B;  3GHG C;  2PP6 A;  4AYC A;  1FJP A;  1E5W A;  5APY A;  2A45 H;  3MD0 A;  3MGN A;  3VYI A;  4Y99 B;  2LKM A;  2POH A;  2WIT A;  3VMY A;  3HE5 A;  2WSE H;  3P8C D;  5APQ A;  4JYC A;  1FZF A;  2JJL A;  3M9B A;  4C7R A;  5BU5 A;  1G2C A;  1EQ7 A;  2O1J A;  4HH2 A;  1M1J A;  3V2R A;  1NH4 A;  1MUU A;  4IFD K;  1FZA A;  4N78 E;  3E1I A;  2OYH C;  1M7L A;  2ZXE B;  1NO4 A;  1MFZ A;  2KOG A;  2W6B A;  1JY2 P;  2OYI A;  1SVF A;  1RF1 C;  4XE5 B;  2O1K A;  1SFC B;  1LGH B;  1KFN A;  1LT9 B;  2OYH A;  2KB7 P;  2J59 M;  3OJA B;  3T97 A;  5AW6 B;  2E42 A;  1YTZ T;  2WPR A;  3OA7 A;  1FU1 A;  5AW0 B;  2GUS A;  5AVW B;  3HUS C;  2HFE D;  3P7K A;  3P8M C;  4GIF A;  4XA4 A;  2W27 A;  5KLV K;  1S9K E;  3HUS A;  1HJB A;  1N73 B;  2KSJ A;  1LWU C;  1JY2 O;  5AW7 B;  2FFD A;  1FZC A;  3I5C A;  1LTA C;  1FOS F;  1FZG A;  1LWU A;  3RL0 C;  1JY3 P;  4Y99 C;  2NPS A;  2HPC A;  4RES B;  1DX7 A;  1G1J A;  4WB4 A;  2C9L Y;  4AUW A;  2C0W A;  1LTJ B;  3GHG B;  1Z56 A;  1JMM A;  4C46 A;  4WY4 A;  3RL0 D;  3SWF A;  2H43 A;  1ZR2 A;  5CHX A;  1NU1 K;  1LTB C;  1SQV K;  2YKO A;  4W7Z A;  4LLH A;  2H8P D;  3TYY A;  1SFC C;  3H32 B;  1LT9 C;  2Q3I A;  3HRN A;  1CSB A;  3P8C E;  1LTT C;  1N86 A;  1PFI A;  4OH8 B;  4WBA A;  1SFC A;  2FYZ A;  1LT9 A;  3VMZ A;  2YO3 A;  2GM4 A;  2Q5U A;  5AW4 B;  1RF1 B;  1KFM A;  2I1K A;  1SFC D;  1GL2 B;  3KQG A;  1HTL C;  2XU6 A;  1N73 C;  5AVY B;  1IFD A;  1RE3 A;  2WT7 B;  1N73 A;  1GW3 A;  1OWA A;  1DH3 A;  1LTI C;  2MJZ A;  3A3Y B;  5CCH C;  1CI6 A;  2N9B A;  2WZ7 A;  5APX A;  3VP8 A;  3L36 A;  5APU A;  4DZO A;  1LTJ C;  4LC1 A;  2YKP A;  1NAF A;  1N7L A;  1SQB K;  2XKM A;  3VP9 A;  3RL0 B;  5CCH D;  3GHG A;  2Z5H A;  1YTZ I;  3M0D C;  2HLO A;  5AVT B;  2CPB A;  3UIA A;  1SP4 A;  3L4F A;  2FKW B;  5BU8 B;  3L37 A;  2GUV A;  3M9Q A;  1FBM A;  2M8R A;  3R2P A;  3V4W A;  5KJ7 C;  4EOT A;  3II6 A;  1GDT A;  2C9N Y;  4ZKP A;  2O01 H;  3H32 A;  1L4A B;  3CL3 D;  3CLQ A;  3HE4 A;  1GU5 A;  4DOJ A;  3MUD A;  1SLQ A;  1GL2 C;  3M9H A;  5KJ7 D;  1ZN5 A;  1LTG C;  1G1I A;  2A45 I;  3TNU B;  2L5G B;  1X9V A;  1RF1 A;  1SQQ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...