1T3JA

Mitofusin domain hr2 v686m/i708m mutant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
62
structure length
62
Chain Sequence
b'ATTFARLCQQVDMTQKHLEEEIARLSKEIDQLEKMQNNSKLLRNKAVQLESELENFSKQFLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords mitofusin 1
publication title Structural basis of mitochondrial tethering by mitofusin complexes
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 28
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2004-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1t3jA00
2HG5D 3PP5A 4N78E 3KYQA 1SFCC 2N1TB 3HTKB 5CCGA 1XTGB 5CCGD 4W7ZA 1NHLA 1T3JA 1L4AA 5CCHA 2PP6A 5CCHD 1KILB 2NPSC 3B5NB 3HD7B 4W80A 4W7YA 2NPSD 2WZ7A 1URQB 2H8PD 3RK2B 1GL2B 1N7SB 4OH8B 3B5NC 3M0DC 3P8CE 1SFCA 3VOPA 1SFCD 4LGDE 4WY4B 2N1TC 2N1TA 2NPSA 2N1TD 3RK3B 1JTHA 1L4AB 3RL0B 1KILC 3HD7C 3B5NA 3RK3C 3B5ND 1URQC 3HD7D 4JF7A 3RK2C 1URQD 3RK2D 2KOGA 1GL2C 3TSIA 1N7SC 1SFCB 2HFED 2XDJA 2YMYA 4WY4C 4WY4A 2NPSB 1JTHB 4WY4D 5CCGC 1KILA 3HD7A 1KILD 1L4AC 1HVVA 1URQA 3RK3D 5CCHC 1L4AD 3RL0C 2M8RA 3RL0D 1GL2A 1N7SA 1GL2D 1N7SD 5KJ7C 5KJ7A 5KJ7D
chains in the Genus database with same CATH superfamily
1WRGA 2QM7A 1YITP 1SQVE 1SQPD 3KYQA 2HLOA 4AUWA 1EZVI 3N7NA 1IFIA 3GLMA 1USEA 4OGQD 5B66E 2W27A 1LTGC 2OTKE 4L73A 1SQVK 4D6TJ 2CPBA 3E1RA 5B5EH 2O3JA 5AVZB 1PFIA 4EYYQ 2NRGA 3CX5E 3V2PA 3L74G 3L37A 1SQQG 3Q2YA 2N1TC 3C9IA 1FZCC 4GOEA 1N7LA 2Q5UA 1GK4A 3L72E 1N73C 1RF0A 1LNQA 1EZVE 2IFMA 1ZMEC 3CL3D 3H1HJ 5BU5A 5GTIE 2FKWB 3B5ND 1FE6A 3RK2C 1NAFA 2OQQA 4ASVA 2HFED 3L71J 1GDTA 1W2EA 3LW5H 2IDBA 3CCLP 4HYTB 2D2CB 2YKQA 2NPSB 2ZJSE 1LTJC 1P84D 2YXQB 1R5SA 2ZT9C 2R3SA 1L4AC 1QEXA 2QSIA 4H44D 3RL0C 3CMEP 1OFCX 1J1EB 1USDA 1SQXK 3KDPB 3HE4B 2AEMA 1JOCA 2HG5D 4IFFA 3VMYA 2H88C 2PGDA 1OW6A 2XKMA 1X0TA 1SFCC 3C1LA 4JPZB 1KYOI 1NHLA 4DZOA 4BRYA 1KILB 4O9BA 3Q1MA 4H13B 1U7JA 4C7NA 1GL2B 5APXA 1RE3A 3P7KA 3H1KD 1EC5A 1DIPA 1YTZT 3VOPA 5KAIH 2KLUA 2J58A 3GF7A 1L0LG 1JY2N 4OVNF 2N1TA 2HODB 1KC8Q 1FZCA 3HUSA 5AVVB 1HBWA 4I7ZC 4GT1A 3RBZA 1X79B 1SQQJ 1KYOE 2JDIH 5AW8B 1K9MQ 2QJPB 3WU2E 2O01N 1N7SC 1IFPA 1HF9A 2GUVA 1NTZD 1E5WA 1QL1A 3PJSK 2JWAA 1SQBE 2ZYDA 1NTKE 3AEAC 3JC22 1HH0A 2GUSA 1SQVD 1VQ8P 2QRXA 1EDLA 2QE7H 1AVYA 1SQBK 2K9JA 2D2CC 5TISH 1NTKK 3EFFK 2JO1A 5KLVG 1M90Q 3FXDA 2O01H 2IFNA 2Y9YA 3GF3A 4PD4D 1IFJA 1VF5D 2ZYAA 2R5DA 4ZNCA 2M3EA 2K37A 4U3FG 1CI6A 2ZVOB 4W7YA 2KI7B 4OWFA 1URQB 3LW5J 1J2JB 1GW4A 2YMKA 1Q90D 1AV1A 5AVTB 1SVFA 3RBXA 3AE7C 2IBZG 2Q3EA 1U7MA 3W67A 3KZIE 1U57A 2KIKA 2A06E 2R5BA 2IYOA 1OMIA 3B5NA 1KQFB 3CCJP 1L0LJ 4L75A 5CJ4A 1SQXD 1NU1G 2YXRB 2PAJA 1DX7A 3KXDA 2KP8A 1CW5A 3LIDA 2RN0A 1DEBA 4Y28J 3V6IA 3TDKA 1IK9A 3MGNA 3CWBE 3E1IA 2Z5HA 1AFOA 2YIUB 1Y8AA 3OAKA 3GHGB 1IJDB 3M9QA 4DT0A 1FAVA 4PJ0H 4R4LA 1VF5C 5APYA 1Y9BA 2Q6QA 5CCGD 5KLVJ 5AW5B 2P2UA 4IL6E 2MKVA 2FYUE 2Y0DA 1EDKA 1P84H 1H0TA 2E74B 3VP8A 2LXBA 2GA1A 1LT9B 4GDOA 4XA4A 1ZP0C 3MUDC 2FYUK 3A0BE 4U3FJ 2FFDB 1HGZA 1NH4A 3L70E 1Q81Q 4UB8E 1KYOD 1FJPA 2QA4P 1FU1A 3U1AA 4WWIA 1FOSF 1CSBA 4XE5B 3ITKA 1RE4C 1SQBD 1PP9D 4RESB 1L0NE 1NTKD 3M9BA 1OZHA 2E76D 3NTNA 1N2DC 1YBKA 3L73G 1QL2A 3TSIA 2Q9IA 2WSCJ 1L0NK 1S3JA 3I55P 1NU1J 2HPCA 1UIXA 3AEDC 4BWNA 1DD4A 2RH0A 1J1DC 2YO2A 2KNCA 5AW6B 1N8RQ 1XTCC 3BRTB 3VP9A 2WSEH 1ZLLA 4CPGA 1PGOA 3LIEA 4HB1A 1GD2E 1HUCA 2YIUC 3GHGC 1LTIC 2Q7CA 3TNUB 4L76A 2E75C 2WQYC 1T8ZA 1M1JC 3GMAA 2A06D 3M0DC 1MFTA 1RF1A 3P8CE 3P8MC 1OWAA 4IL6X 1NTZG 2KS1B 5DJUB 3VMZA 2KLVA 1PGJA 2FFDC 5AVUB 1K04A 3K5BA 3L75D 1Q2NA 1KB9E 3B4SA 1VQ7P 4UB6E 5AW9B 5CBNA 3GW6A 2YO3A 1G1IA 3BCCE 5KLIB 1S1CX 4JF7A 2QEXP 4TLFA 3D71A 3WUVA 1OIPA 1ZR2A 4C7RA 1Y47A 3AECC 2WT7A 1JY2P 3IN6A 3CWBD 1S2EA 5GTIH 1PPJG 3L73J 1UIIA 4N6JA 1KILE 3H1IE 2OYHA 4GODA 3G6EP 3HUSB 1HJ0A 3A2AA 3V5BA 4ZKUA 2M8RA 1BSHA 4WB4A 1S9KE 1S4XA 2AEJA 5K5GB 3Q5RA 2FYUD 2UWJE 5E79E 3H1JE 3PP5A 4PV1D 2K3RA 1GU5A 2IPPA 3HTKB 5CCGA 1PV3A 3E7KA 3CX5I 3TK1A 3L70D 3TYYA 1WT6A 1VL2A 3H1KJ 1CZQA 3SWYA 2WZ7A 1H88A 2Y0EA 1NVOA 2K9JB 2A45G 2M5AA 4D6TE 2KB7P 4RO0A 1RY3A 1NTMK 2E42A 2G8YA 1L0ND 4AYCA 1SFCD 1SLQA 2ITAA 2OGUA 3MZWB 1VQOP 1K05A 2ZFCA 4WY4B 2I8DA 1DEEG 3KQGA 1NOHA 1RH5B 1IFDA 3P32A 3CCVP 3V2RA 1KV4A 5KKZB 1QLED 1NTZJ 1K73Q 1T6AA 2J5UA 2BCCD 3H1HE 1VQ6P 2YKPA 3G9RA 1ZW0A 5EFWB 4ZMDA 2KSEA 1SQVJ 3V2NA 3MIWA 1KYOH 3L71E 3A0HH 3NXSA 3RK3E 4ASWA 3HD7A 4Y99B 1M1KQ 1KZUB 2I1JA 3AEBC 3O6QA 1JMBA 1KFMA 3CCUP 2QJKB 3AE2C 1N7SD 4YTPC 1KQGB 3TGUE 4PV1C 1BCCG 3WUTA 5AVQB 2K1AA 4HJGH 2ZXEB 2KYVA 1JY2O 3B8EB 3P8CD 4L74A 2O1JA 2H7HA 1A02F 2WITA 4JBZA 2D2CD 2NPSD 2M3BA 4H44B 1S5LE 2LXCB 2OYIB 1PP9G 2XV5A 2RMZA 5KAFE 3BCCD 2V7QH 3CCSP 2WPSA 4MN4C 1SQXJ 3H1LD 4ZKPA 3JCUE 1H0TB 5AVWB 3C8VA 4YXWH 3B71A 3H1ID 1IFMA 3L74E 4H13D 3BVHA 4IFMA 3T97B 1SQQE 1BE3G 3KZIH 3VN0A 2HYNA 3EWKA 3OA7A 2OTJP 5C39A 1SQQK 5B5EE 3H1JD 3PRJA 1A02J 2B9BA 1N73A 1YHQP 1GK6A 2KZIA 1VQMP 2NZ2A 1HVVA 5CCHC 5TJHA 1EXJA 1NTMD 5BVZA 1FS0E 1GZLA 1FDIA 1LTTC 2POHA 2QJKC 1JEKA 1FZEA 4D6TD 2W6AA 1LTJA 1JMMA 2KK7A 2JWDA 2HPCB 1W2BO 1L4AA 5AVXB 1BCCJ 1HTLC 2NPSC 4BXLA 3AEEC 2Y9ZA 3L75G 1LWUB 2QIWA 1LP1B 5APTA 1J1EC 1SFCA 1X8YA 1MZ9A 2OYIC 2WMMA 3CX5D 4Z1MH 1PP9J 1S5LX 1EDJA 3RK3B 1VQPP 2Y0CA 3A0BH 4UB8H 1KILC 1IC2A 3L72D 1EZVD 4H13C 1URQD 1FZFA 3NMDA 2KOGA 1GL2C 1L0LE 3TF5A 3H25A 1W5CE 1AJYA 3QWOC 4LC1A 4HH2A 3TGUD 2WWWA 3CXHI 3CCMP 1L0LK 3PTZA 2O1KA 4K35A 1BE3J 2P10A 1Z56A 2V7QJ 3HE5A 2BEQD 1BGYG 4QMAA 1N7SA 2R44A 2B89A 5AW1B 3Q3DA 3IR9A 2QJPC 1SQPG 1ZRTE 2FY8A 1VQ9P 1OXZA 3CLQA 5GTHE 5AVRB 1YQ4C 4B86A 2IBZI 1GTWA 5KLVE 3M0AA 4TT3H 3H32B 3U59A 3CXHE 2B87B 1R8EA 1X9VA 2KZJA 2P7JA 5KLVK 2BCCG 1FZBA 1FDMA 3HE4A 1IZNB 1LWUC 1VQ4P 1RQUA 3L75J 3L74D 4U3FE 1T2KD 1SQQD 3V2QA 4IOIH 5TISE 2E75D 1ZV8A 1YI2P 3SWFA 4HKZH 2XZRA 1NO4A 1OW8A 2QJYB 1OVVA 3RK3C 1URQC 1JY3N 3CWBJ 5M1BA 2FYNB 2IBZE 4M3LA 4R4MA 1QX8A 1Q86Q 3U1CA 4UB6H 4KHXA 5AW0B 3USSA 2WSFH 2XNDH 3SFEC 4YPCA 2O01J 1IK7A 1NU1E 2HODA 2FYUJ 2MJZA 2VRSA 5AVSB 3FWNA 1Q7YQ 3D70A 1NU1K 4GIFA 5KJ7D 3H6PA 4K3AA 2RKLA 3SSUA 1BGYJ 2KUBA 5APSA 1OW7A 5H2FH 1T3JA 1JNMA 4H0LB 5E79H 3HD7B 1SQPJ 2H8PD 4EOTA 3H1LG 2M0BA 2DW3A 3H1KG 3KPEA 1NAYA 1IO4A 1KB9I 3AE1C 1YIJP 1KFNA 5AVYB 4WVZA 1T2KC 3IF4A 3V4WA 1MFZA 1LTSC 1QVGO 1JTHA 1FDOA 1M8OB 1ZOYC 2BCCJ 2W6BA 3S9OA 3GG2A 5B66H 3V4QA 3PHLA 2E74C 3MUDA 3AEGC 1LT9C 2YNYA 1NTMG 3VMXA 2LKMA 3EQ2A 4N3YB 4A7PA 4NPDA 4BRYB 2FYZA 3S1KA 1KORA 1RE4A 3CX5H 1SQVG 3O8ZA 3BATA 3L73E 1YYCA 1KTMA 4C7NB 1YJWP 3L4FA 3F5HA 3M9HA 2E5TA 3UIAA 5KJ7C 5KLVD 1KQLA 1GW3A 1MKMA 2IZ0A 2WVRA 2N1TB 4EI2A 2Q3IA 1FZCB 3HRNA 3SWKA 2JKVA 1T3UA 1AQTA 2IZ1A 1H89A 1N73B 3G3ZA 1VQLP 2CK3H 3AE5C 4U3FD 2R32A 2R3CA 3RK2B 1VDFA 1BSNA 3H1KE 1HGVA 2WSFJ 3I5CA 1RF0C 4H0LC 2OTLP 1MV8A 3L72G 1EZVG 3VTPC 1AQ5A 2G3AA 4U7JA 3GHGA 1K8AQ 1S5LH 3H1LJ 2E43A 5APQA 2E5YA 2ZT9B 5AW2B 1L4AB 3H1IJ 3RL0B 1GMJA 1ZXGA 1M1JA 1LGHB 4PD4I 1SQXG 3M0DA 1NU1D 1NTZE 1LT9A 1NJIQ 1SFCB 1OVRA 2W6JH 4OGQB 1QVFO 1ZN5A 2WSEJ 2FFDA 1NTZK 1FZAA 1VQKP 4DOJA 4RKUJ 1CI6B 4WY4D 1NTMJ 2QG4A 2AXTE 2K88A 1VQ5P 2XNXA 3EFGA 3WMM0 5KLIC 1NGMB 5KJ7A 2A45I 1RE3C 1PPJE 1KQSO 5AW4B 1NYHA 4PD4E 3RL0g 3WU2H 1LTAC 3FGAD 3CD6P 1RHZB 4I7ZB 5CCHD 3B5NB 4W80A 5DJTB 3HUSC 3HE5B 2K9YA 3SFDC 1N7SB 2W8ZA 4GKGA 1DH3A 4LGDE 3M91A 1G1JA 3JSVC 2JP3A 1QGKB 3L72J 1JB0J 3IFMA 4KT0J 1SQBG 5KTBA 2C0WA 1FJKA 2J59M 1NTKG 3AE4C 1OVUA 1ZR4A 1SQXE 3TNUA 1KB9D 2WPRA 1L2PA 2V4HA 2C9NY 3L73D 3TGUJ 1BDCA 1G2CA 1JUNA 1D7MA 1EXIA 3AEFC 4WBAA 1LTBC 4WY4C 2KS1A 4OGQC 1KILD 3ABVC 3A5TA 1JY3P 1EQ7A 1YQ3C 1NKNA 5KKZC 3CCEP 1GL2D 1M7LA 3AE6C 3OW2O 1S9KD 5APUA 1YTZI 2N9BA 3CC2P 2H43A 3CCQP 2I1KA 4YXDC 2LR2A 3L36A 4NPEA 4Y99C 1BCCE 2HR3A 5GTHH 2A06G 3B5NC 3L74J 1PZQA 2ZAEB 1M56D 1AA0A 3MHVA 1S72P 3A0HE 3CXHH 2AEFA 1MUUA 1SP4A 4EIJA 3D6ZA 1PP9E 3HTKA 2KNCB 1X22A 4KJMA 1E79H 4H44C 4IL6H 5CMZA 2B88A 2KSJA 5APVA 1SQBJ 2XDJA 3H1HD 2OYOA 1NTKJ 1VF5B 3CWBG 1VPCA 2ZYGA 2P1JA 2FXOA 2Q1KA 1PPJD 2PRRA 4WY4A 1JTHB 3L71D 2ZVNB 3FX0A 3RK3D 1SS1A 3MD0A 1NWQA 2WSCH 1BE3E 3I56P 1RF1B 3VMAA 2JEEA 2FYUG 3PH0A 2Z4EA 2AXCA 1NKZB 2FXPA 1YJ9P 4N78E 3L35A 2JR8A 2SPZA 3A3YB 3L70G 1HWTC 1H8AA 3CCRP 5CCHA 3BRVB 5KAIE 1EDIA 2PP6A 4DCKA 2C0XA 1HJBA 3G71P 1JY3O 5L8RJ 2YKOA 3FXEA 2WT7B 4XFJA 1L0NG 1LT1A 3N4XA 2QVAA 1JCDA 4EDFA 2OYHB 2NPSA 3L75E 1J1DB 2IYPA 3AE8C 1VQNP 2OYIA 2XU6A 4RJTA 3CMAP 2KXPB 1LJ2A 3II6A 2E75B 2C9LY 1KILA 1KN7A 4I1LA 2M5AB 1YJNP 4I2LC 1M1JB 2E74D 4NPFX 1GL2A 2FXMA 3MTUE 3QH9A 4LLHA 3FWLA 1KB9H 1M57D 2WTYA 3Q5SA 1BCCD 2W83C 2L5GB 3T97A 3WUUA 1RF1C 4IFDK 3F89A 3R2PA 1XTGB 4W7ZA 3G4SP 1BGYE 2E76B 2ZXXA 2QM8A 1JM0A 5BU8B 3PLNA 1SQPE 1PIXA 3OJAB 3L70J 3BCCG 3S4RA 4JYBA 2BASA 1SQPK 1FOSE 1WMKA 3MP7B 2WPQA 2WSSH 1L0NJ 3W68A 3O6QB 2OYHC 1P84I 4H0LD 1R5LA 2BCCE 3H1IG 3HD7D 1FBMA 2JJLA 5AW3B 1OX3A 3AE3C 2L91A 1LWUA 4AQRD 3IAOA 1LP1A 1BE3D 1FC2C 1L0LD 5AW7B 2H89C 1TU3F 3H1JG 2BEZF 4N78D 5CCGC 2OARA 1URQA 1AVOA 2PFXA 5CHXA 4PJ0E 2N9YB 2QJYC 2W90A 2Z5IA 4I6MC 2GM4A 1Q82Q 3RGUA 2FYNC 1P84E 2AXTH 4D6TG 1G2CB 3VYIA 3R4YA 1ZRTD 1FZGA 2P67A 5CJ0A 2FBWC 1JO5A 3KHUA 3CC7P 2IX7C 3M06A 4PD4H 3A7OA 2E76C 4OH8B 3CI9A 3CXHD 4JYCA 1IFNA 1DD3A 1GU4A 3H1HG 3BASA 4JQ0D 1KMIZ 2N1TD 3NFQA 4DJGA 3CPWO 1N86A 3BCCJ 4C46A 3H1LE 5APWA 2WPVB 2P58A 3L71G 3HD7C 3Q5PA 5CBOA 1JCCA 4PV1B 3D6YA 5H2FE 3RK2D 3H32A 2A45H 2B87A 1LTJB 2IBZD 2YMYA 3TGUG 5KAFH 1RQVA 3CC4P 3AE9C 1PGQA 2CPSA 2ZT9D 1BDDA 1NTME 1L4AD 1KD1Q 1BGYD 3RL0D 3ZDMA 3H1JJ 1PGPA 4GOFA 1PL5A 3JCUH
chains in the Genus database with same CATH topology
1ZLLA 1WRGA 2QM7A 3IR9A 2N9BA 3LIEA 1GD2E 3KYQA 2H43A 2HLOA 4AUWA 3N7NA 1IFIA 1HUCA 1OXZA 3CLQA 2I1KA 3GHGC 5AVRB 2W27A 1LTGC 1LTIC 4B86A 3L36A 2Q7CA 3TNUB 1SQVK 1GTWA 3M0AA 2CPBA 4Y99C 3H32B 3U59A 1T8ZA 1M1JC 1X9VA 3B5NC 2P7JA 5AVZB 3M0DC 1PFIA 5KLVK 1RF1A 3P8CE 1FZBA 3P8MC 1OWAA 1FDMA 3HE4A 3V2PA 1LWUC 3L37A 3VMZA 1T2KD 2N1TC 3V2QA 3C9IA 2KLVA 1FZCC 1MUUA 1SP4A 4EIJA 2FFDC 1N7LA 5AVUB 3HTKA 2Q5UA 1ZV8A 3SWFA 1GK4A 2XZRA 5AW9B 1N73C 1NO4A 1RF0A 2YO3A 2IFMA 1G1IA 3CL3D 5BU5A 3RK3C 2FKWB 1URQC 3B5ND 4JF7A 1JY3N 3RK2C 5CMZA 1NAFA 2KSJA 5APVA 4M3LA 1ZR2A 4C7RA 2HFED 2XDJA 2WT7A 1JY2P 3U1CA 1GDTA 1VPCA 1W2EA 3LW5H 2P1JA 4KHXA 5AW0B 2WSFH 4HYTB 2YKQA 4WY4A 2NPSB 4N6JA 1JTHB 1LTJC 2OYHA 3HUSB 2HODA 1L4AC 3A2AA 2MJZA 3RK3D 3MD0A 2VRSA 3V5BA 3RL0C 1NWQA 4ZKUA 2M8RA 2WSCH 4WB4A 5AVSB 1RF1B 1S9KE 1J1EB 2JEEA 1SQXK 3KDPB 3HE4B 2Z4EA 1NU1K 4GIFA 1NKZB 1JOCA 5KJ7D 2HG5D 3PP5A 4IFFA 4N78E 3H6PA 3VMYA 3L35A 2XKMA 1SFCC 5APSA 1GU5A 2IPPA 3HTKB 5CCGA 3A3YB 1NHLA 1HWTC 1T3JA 1H8AA 3TK1A 3TYYA 1WT6A 1JNMA 5CCHA 3BRVB 4DZOA 2PP6A 1KILB 3HD7B 1CZQA 3SWYA 4O9BA 2WZ7A 2C0XA 2H8PD 1HJBA 1H88A 2A45G 1JY3O 4EOTA 2YKOA 3KPEA 1GL2B 2KB7P 5APXA 1RE3A 1NTMK 1RY3A 3P7KA 4C7NA 2WT7B 1IO4A 2E42A 1YTZT 3N4XA 3VOPA 4AYCA 1SFCD 2J58A 1KFNA 1SLQA 5AVYB 1JCDA 2ZFCA 1T2KC 4WY4B 3KQGA 2OYHB 3V4WA 1JY2N 1MFZA 1LTSC 1NOHA 2N1TA 1IFDA 3P32A 2HODB 2NPSA 1JTHA 1FZCA 3HUSA 1J1DB 3V2RA 5AVVB 1HBWA 2W6BA 4GT1A 1X79B 3V4QA 3MUDA 5AW8B 2OYIA 2XU6A 1LT9C 2YNYA 1N7SC 2YKPA 3VMXA 2GUVA 2LKMA 1E5WA 3EQ2A 4N3YB 1QL1A 3V2NA 3MIWA 2FYZA 1HH0A 1RE4A 3II6A 3O8ZA 2C9LY 2GUSA 3BATA 3NXSA 1KILA 3HD7A 4Y99B 4I1LA 1KZUB 1YYCA 1SQBK 4C7NB 2I1JA 4I2LC 1M1JB 3L4FA 1KFMA 1NTKK 3M9HA 3UIAA 1GL2A 2FXMA 3MTUE 1N7SD 5KJ7C 4LLHA 1KQLA 1GW3A 2WTYA 5AVQB 2L5GB 3T97A 1RF1C 2N1TB 2ZXEB 2KYVA 2O01H 2Q3IA 1JY2O 1FZCB 3HRNA 4IFDK 3B8EB 2IFNA 3R2PA 1XTGB 1IFJA 3P8CD 1T3UA 4W7ZA 2R5DA 2O1JA 2H7HA 1H89A 1N73B 3G3ZA 1A02F 2WITA 1CI6A 2QM8A 4W7YA 2NPSD 2R3CA 2R32A 1URQB 5BU8B 2M3BA 1J2JB 3RK2B 1VDFA 2OYIB 1GW4A 1HGVA 2XV5A 3I5CA 1RF0C 3OJAB 1MV8A 5AVTB 1SVFA 3VTPC 4JYBA 2BASA 1AQ5A 1SQPK 3GHGA 1FOSE 2E43A 2WPQA 5APQA 2WPSA 5AW2B 1L4AB 3RL0B 2OYHC 4ZKPA 1M1JA 2R5BA 5AVWB 3B5NA 1LGHB 3HD7D 1FBMA 2JJLA 3M0DA 5CJ4A 1IFMA 2PAJA 5AW3B 3BVHA 1DX7A 4IFMA 1LT9A 1LWUA 1SFCB 4AQRD 2KP8A 3VN0A 5AW7B 2HYNA 1CW5A 1ZN5A 2FFDA 3OA7A 1NTZK 1FZAA 4DOJA 1SQQK 3LIDA 1DEBA 1CI6B 1A02J 4N78D 4WY4D 5CCGC 1N73A 1GK6A 2OARA 1HVVA 1URQA 5CCHC 5CHXA 2XNXA 1IK9A 2Z5IA 3EFGA 3MGNA 3WMM0 3E1IA 1GZLA 4I6MC 2Z5HA 5BVZA 1AFOA 2GM4A 1LTTC 5KJ7A 2A45I 3GHGB 1RE3C 1IJDB 3OAKA 3M9QA 2POHA 1G2CB 3VYIA 1FZEA 1FAVA 5AW4B 2W6AA 1LTJA 1JMMA 1LTAC 5APYA 5CCGD 1FZGA 2HPCB 1L4AA 2P67A 5AW5B 5CJ0A 2P2UA 5CCHD 5AVXB 1HTLC 2NPSC 3B5NB 4W80A 1JO5A 3HUSC 3HE5B 3VP8A 2IX7C 3M06A 1LT9B 4XA4A 1LWUB 1N7SB 3A7OA 4OH8B 4GKGA 5APTA 3CI9A 1J1EC 2FYUK 1SFCA 1X8YA 4JYCA 1MZ9A 2FFDB 2OYIC 1DH3A 1HGZA 1NH4A 1IFNA 4LGDE 1FJPA 1GU4A 1FU1A 3U1AA 3BASA 3M91A 1G1JA 1FOSF 1CSBA 2N1TD 3NFQA 3RK3B 1N86A 3IFMA 4XE5B 4C46A 1RE4C 5APWA 5KTBA 2C0WA 1FJKA 2J59M 4RESB 1ZR4A 1KILC 3HD7C 3TNUA 1IC2A 3M9BA 2WPRA 1JCCA 3NTNA 1N2DC 1URQD 2C9NY 1FZFA 3NMDA 3RK2D 3H32A 1QL2A 2KOGA 1GL2C 3TSIA 2A45H 2Q9IA 1L0NK 1G2CA 1LTJB 1JUNA 4WBAA 4LC1A 2YMYA 4HH2A 1LTBC 2WWWA 4WY4C 2HPCA 1L0LK 2O1KA 1KILD 3A5TA 1JY3P 2CPSA 1J1DC 1Z56A 1EQ7A 1L4AD 1NKNA 2YO2A 3HE5A 3RL0D 5AW6B 1XTCC 1N7SA 1GL2D 1M7LA 3BRTB 5AW1B 1S9KD 3VP9A 2WSEH 5APUA 1YTZI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HG5 D;  3PP5 A;  4N78 E;  3KYQ A;  1SFC C;  2N1T B;  3HTK B;  5CCG A;  1XTG B;  5CCG D;  4W7Z A;  1NHL A;  1T3J A;  1L4A A;  5CCH A;  2PP6 A;  5CCH D;  1KIL B;  2NPS C;  3B5N B;  3HD7 B;  4W80 A;  4W7Y A;  2NPS D;  2WZ7 A;  1URQ B;  2H8P D;  3RK2 B;  1GL2 B;  1N7S B;  4OH8 B;  3B5N C;  3M0D C;  3P8C E;  1SFC A;  3VOP A;  1SFC D;  4LGD E;  4WY4 B;  2N1T C;  2N1T A;  2NPS A;  2N1T D;  3RK3 B;  1JTH A;  1L4A B;  3RL0 B;  1KIL C;  3HD7 C;  3B5N A;  3RK3 C;  3B5N D;  1URQ C;  3HD7 D;  4JF7 A;  3RK2 C;  1URQ D;  3RK2 D;  2KOG A;  1GL2 C;  3TSI A;  1N7S C;  1SFC B;  2HFE D;  2XDJ A;  2YMY A;  4WY4 C;  4WY4 A;  2NPS B;  1JTH B;  4WY4 D;  5CCG C;  1KIL A;  3HD7 A;  1KIL D;  1L4A C;  1HVV A;  1URQ A;  3RK3 D;  5CCH C;  1L4A D;  3RL0 C;  2M8R A;  3RL0 D;  1GL2 A;  1N7S A;  1GL2 D;  1N7S D;  5KJ7 C;  5KJ7 A;  5KJ7 D; 
#chains in the Genus database with same CATH topology
 1WRG A;  2QM7 A;  1YIT P;  1SQV E;  1SQP D;  3KYQ A;  2HLO A;  4AUW A;  1EZV I;  3N7N A;  1IFI A;  3GLM A;  1USE A;  4OGQ D;  5B66 E;  2W27 A;  1LTG C;  2OTK E;  4L73 A;  1SQV K;  4D6T J;  2CPB A;  3E1R A;  5B5E H;  2O3J A;  5AVZ B;  1PFI A;  4EYY Q;  2NRG A;  3CX5 E;  3V2P A;  3L74 G;  3L37 A;  1SQQ G;  3Q2Y A;  2N1T C;  3C9I A;  1FZC C;  4GOE A;  1N7L A;  2Q5U A;  1GK4 A;  3L72 E;  1N73 C;  1RF0 A;  1LNQ A;  1EZV E;  2IFM A;  1ZME C;  3CL3 D;  3H1H J;  5BU5 A;  5GTI E;  2FKW B;  3B5N D;  1FE6 A;  3RK2 C;  1NAF A;  2OQQ A;  4ASV A;  2HFE D;  3L71 J;  1GDT A;  1W2E A;  3LW5 H;  2IDB A;  3CCL P;  4HYT B;  2D2C B;  2YKQ A;  2NPS B;  2ZJS E;  1LTJ C;  1P84 D;  2YXQ B;  1R5S A;  2ZT9 C;  2R3S A;  1L4A C;  1QEX A;  2QSI A;  4H44 D;  3RL0 C;  3CME P;  1OFC X;  1J1E B;  1USD A;  1SQX K;  3KDP B;  3HE4 B;  2AEM A;  1JOC A;  2HG5 D;  4IFF A;  3VMY A;  2H88 C;  2PGD A;  1OW6 A;  2XKM A;  1X0T A;  1SFC C;  3C1L A;  4JPZ B;  1KYO I;  1NHL A;  4DZO A;  4BRY A;  1KIL B;  4O9B A;  3Q1M A;  4H13 B;  1U7J A;  4C7N A;  1GL2 B;  5APX A;  1RE3 A;  3P7K A;  3H1K D;  1EC5 A;  1DIP A;  1YTZ T;  3VOP A;  5KAI H;  2KLU A;  2J58 A;  3GF7 A;  1L0L G;  1JY2 N;  4OVN F;  2N1T A;  2HOD B;  1KC8 Q;  1FZC A;  3HUS A;  5AVV B;  1HBW A;  4I7Z C;  4GT1 A;  3RBZ A;  1X79 B;  1SQQ J;  1KYO E;  2JDI H;  5AW8 B;  1K9M Q;  2QJP B;  3WU2 E;  2O01 N;  1N7S C;  1IFP A;  1HF9 A;  2GUV A;  1NTZ D;  1E5W A;  1QL1 A;  3PJS K;  2JWA A;  1SQB E;  2ZYD A;  1NTK E;  3AEA C;  3JC2 2;  1HH0 A;  2GUS A;  1SQV D;  1VQ8 P;  2QRX A;  1EDL A;  2QE7 H;  1AVY A;  1SQB K;  2K9J A;  2D2C C;  5TIS H;  1NTK K;  3EFF K;  2JO1 A;  5KLV G;  1M90 Q;  3FXD A;  2O01 H;  2IFN A;  2Y9Y A;  3GF3 A;  4PD4 D;  1IFJ A;  1VF5 D;  2ZYA A;  2R5D A;  4ZNC A;  2M3E A;  2K37 A;  4U3F G;  1CI6 A;  2ZVO B;  4W7Y A;  2KI7 B;  4OWF A;  1URQ B;  3LW5 J;  1J2J B;  1GW4 A;  2YMK A;  1Q90 D;  1AV1 A;  5AVT B;  1SVF A;  3RBX A;  3AE7 C;  2IBZ G;  2Q3E A;  1U7M A;  3W67 A;  3KZI E;  1U57 A;  2KIK A;  2A06 E;  2R5B A;  2IYO A;  1OMI A;  3B5N A;  1KQF B;  3CCJ P;  1L0L J;  4L75 A;  5CJ4 A;  1SQX D;  1NU1 G;  2YXR B;  2PAJ A;  1DX7 A;  3KXD A;  2KP8 A;  1CW5 A;  3LID A;  2RN0 A;  1DEB A;  4Y28 J;  3V6I A;  3TDK A;  1IK9 A;  3MGN A;  3CWB E;  3E1I A;  2Z5H A;  1AFO A;  2YIU B;  1Y8A A;  3OAK A;  3GHG B;  1IJD B;  3M9Q A;  4DT0 A;  1FAV A;  4PJ0 H;  4R4L A;  1VF5 C;  5APY A;  1Y9B A;  2Q6Q A;  5CCG D;  5KLV J;  5AW5 B;  2P2U A;  4IL6 E;  2MKV A;  2FYU E;  2Y0D A;  1EDK A;  1P84 H;  1H0T A;  2E74 B;  3VP8 A;  2LXB A;  2GA1 A;  1LT9 B;  4GDO A;  4XA4 A;  1ZP0 C;  3MUD C;  2FYU K;  3A0B E;  4U3F J;  2FFD B;  1HGZ A;  1NH4 A;  3L70 E;  1Q81 Q;  4UB8 E;  1KYO D;  1FJP A;  2QA4 P;  1FU1 A;  3U1A A;  4WWI A;  1FOS F;  1CSB A;  4XE5 B;  3ITK A;  1RE4 C;  1SQB D;  1PP9 D;  4RES B;  1L0N E;  1NTK D;  3M9B A;  1OZH A;  2E76 D;  3NTN A;  1N2D C;  1YBK A;  3L73 G;  1QL2 A;  3TSI A;  2Q9I A;  2WSC J;  1L0N K;  1S3J A;  3I55 P;  1NU1 J;  2HPC A;  1UIX A;  3AED C;  4BWN A;  1DD4 A;  2RH0 A;  1J1D C;  2YO2 A;  2KNC A;  5AW6 B;  1N8R Q;  1XTC C;  3BRT B;  3VP9 A;  2WSE H;  1ZLL A;  4CPG A;  1PGO A;  3LIE A;  4HB1 A;  1GD2 E;  1HUC A;  2YIU C;  3GHG C;  1LTI C;  2Q7C A;  3TNU B;  4L76 A;  2E75 C;  2WQY C;  1T8Z A;  1M1J C;  3GMA A;  2A06 D;  3M0D C;  1MFT A;  1RF1 A;  3P8C E;  3P8M C;  1OWA A;  4IL6 X;  1NTZ G;  2KS1 B;  5DJU B;  3VMZ A;  2KLV A;  1PGJ A;  2FFD C;  5AVU B;  1K04 A;  3K5B A;  3L75 D;  1Q2N A;  1KB9 E;  3B4S A;  1VQ7 P;  4UB6 E;  5AW9 B;  5CBN A;  3GW6 A;  2YO3 A;  1G1I A;  3BCC E;  5KLI B;  1S1C X;  4JF7 A;  2QEX P;  4TLF A;  3D71 A;  3WUV A;  1OIP A;  1ZR2 A;  4C7R A;  1Y47 A;  3AEC C;  2WT7 A;  1JY2 P;  3IN6 A;  3CWB D;  1S2E A;  5GTI H;  1PPJ G;  3L73 J;  1UII A;  4N6J A;  1KIL E;  3H1I E;  2OYH A;  4GOD A;  3G6E P;  3HUS B;  1HJ0 A;  3A2A A;  3V5B A;  4ZKU A;  2M8R A;  1BSH A;  4WB4 A;  1S9K E;  1S4X A;  2AEJ A;  5K5G B;  3Q5R A;  2FYU D;  2UWJ E;  5E79 E;  3H1J E;  3PP5 A;  4PV1 D;  2K3R A;  1GU5 A;  2IPP A;  3HTK B;  5CCG A;  1PV3 A;  3E7K A;  3CX5 I;  3TK1 A;  3L70 D;  3TYY A;  1WT6 A;  1VL2 A;  3H1K J;  1CZQ A;  3SWY A;  2WZ7 A;  1H88 A;  2Y0E A;  1NVO A;  2K9J B;  2A45 G;  2M5A A;  4D6T E;  2KB7 P;  4RO0 A;  1RY3 A;  1NTM K;  2E42 A;  2G8Y A;  1L0N D;  4AYC A;  1SFC D;  1SLQ A;  2ITA A;  2OGU A;  3MZW B;  1VQO P;  1K05 A;  2ZFC A;  4WY4 B;  2I8D A;  1DEE G;  3KQG A;  1NOH A;  1RH5 B;  1IFD A;  3P32 A;  3CCV P;  3V2R A;  1KV4 A;  5KKZ B;  1QLE D;  1NTZ J;  1K73 Q;  1T6A A;  2J5U A;  2BCC D;  3H1H E;  1VQ6 P;  2YKP A;  3G9R A;  1ZW0 A;  5EFW B;  4ZMD A;  2KSE A;  1SQV J;  3V2N A;  3MIW A;  1KYO H;  3L71 E;  3A0H H;  3NXS A;  3RK3 E;  4ASW A;  3HD7 A;  4Y99 B;  1M1K Q;  1KZU B;  2I1J A;  3AEB C;  3O6Q A;  1JMB A;  1KFM A;  3CCU P;  2QJK B;  3AE2 C;  1N7S D;  4YTP C;  1KQG B;  3TGU E;  4PV1 C;  1BCC G;  3WUT A;  5AVQ B;  2K1A A;  4HJG H;  2ZXE B;  2KYV A;  1JY2 O;  3B8E B;  3P8C D;  4L74 A;  2O1J A;  2H7H A;  1A02 F;  2WIT A;  4JBZ A;  2D2C D;  2NPS D;  2M3B A;  4H44 B;  1S5L E;  2LXC B;  2OYI B;  1PP9 G;  2XV5 A;  2RMZ A;  5KAF E;  3BCC D;  2V7Q H;  3CCS P;  2WPS A;  4MN4 C;  1SQX J;  3H1L D;  4ZKP A;  3JCU E;  1H0T B;  5AVW B;  3C8V A;  4YXW H;  3B71 A;  3H1I D;  1IFM A;  3L74 E;  4H13 D;  3BVH A;  4IFM A;  3T97 B;  1SQQ E;  1BE3 G;  3KZI H;  3VN0 A;  2HYN A;  3EWK A;  3OA7 A;  2OTJ P;  5C39 A;  1SQQ K;  5B5E E;  3H1J D;  3PRJ A;  1A02 J;  2B9B A;  1N73 A;  1YHQ P;  1GK6 A;  2KZI A;  1VQM P;  2NZ2 A;  1HVV A;  5CCH C;  5TJH A;  1EXJ A;  1NTM D;  5BVZ A;  1FS0 E;  1GZL A;  1FDI A;  1LTT C;  2POH A;  2QJK C;  1JEK A;  1FZE A;  4D6T D;  2W6A A;  1LTJ A;  1JMM A;  2KK7 A;  2JWD A;  2HPC B;  1W2B O;  1L4A A;  5AVX B;  1BCC J;  1HTL C;  2NPS C;  4BXL A;  3AEE C;  2Y9Z A;  3L75 G;  1LWU B;  2QIW A;  1LP1 B;  5APT A;  1J1E C;  1SFC A;  1X8Y A;  1MZ9 A;  2OYI C;  2WMM A;  3CX5 D;  4Z1M H;  1PP9 J;  1S5L X;  1EDJ A;  3RK3 B;  1VQP P;  2Y0C A;  3A0B H;  4UB8 H;  1KIL C;  1IC2 A;  3L72 D;  1EZV D;  4H13 C;  1URQ D;  1FZF A;  3NMD A;  2KOG A;  1GL2 C;  1L0L E;  3TF5 A;  3H25 A;  1W5C E;  1AJY A;  3QWO C;  4LC1 A;  4HH2 A;  3TGU D;  2WWW A;  3CXH I;  3CCM P;  1L0L K;  3PTZ A;  2O1K A;  4K35 A;  1BE3 J;  2P10 A;  1Z56 A;  2V7Q J;  3HE5 A;  2BEQ D;  1BGY G;  4QMA A;  1N7S A;  2R44 A;  2B89 A;  5AW1 B;  3Q3D A;  3IR9 A;  2QJP C;  1SQP G;  1ZRT E;  2FY8 A;  1VQ9 P;  1OXZ A;  3CLQ A;  5GTH E;  5AVR B;  1YQ4 C;  4B86 A;  2IBZ I;  1GTW A;  5KLV E;  3M0A A;  4TT3 H;  3H32 B;  3U59 A;  3CXH E;  2B87 B;  1R8E A;  1X9V A;  2KZJ A;  2P7J A;  5KLV K;  2BCC G;  1FZB A;  1FDM A;  3HE4 A;  1IZN B;  1LWU C;  1VQ4 P;  1RQU A;  3L75 J;  3L74 D;  4U3F E;  1T2K D;  1SQQ D;  3V2Q A;  4IOI H;  5TIS E;  2E75 D;  1ZV8 A;  1YI2 P;  3SWF A;  4HKZ H;  2XZR A;  1NO4 A;  1OW8 A;  2QJY B;  1OVV A;  3RK3 C;  1URQ C;  1JY3 N;  3CWB J;  5M1B A;  2FYN B;  2IBZ E;  4M3L A;  4R4M A;  1QX8 A;  1Q86 Q;  3U1C A;  4UB6 H;  4KHX A;  5AW0 B;  3USS A;  2WSF H;  2XND H;  3SFE C;  4YPC A;  2O01 J;  1IK7 A;  1NU1 E;  2HOD A;  2FYU J;  2MJZ A;  2VRS A;  5AVS B;  3FWN A;  1Q7Y Q;  3D70 A;  1NU1 K;  4GIF A;  5KJ7 D;  3H6P A;  4K3A A;  2RKL A;  3SSU A;  1BGY J;  2KUB A;  5APS A;  1OW7 A;  5H2F H;  1T3J A;  1JNM A;  4H0L B;  5E79 H;  3HD7 B;  1SQP J;  2H8P D;  4EOT A;  3H1L G;  2M0B A;  2DW3 A;  3H1K G;  3KPE A;  1NAY A;  1IO4 A;  1KB9 I;  3AE1 C;  1YIJ P;  1KFN A;  5AVY B;  4WVZ A;  1T2K C;  3IF4 A;  3V4W A;  1MFZ A;  1LTS C;  1QVG O;  1JTH A;  1FDO A;  1M8O B;  1ZOY C;  2BCC J;  2W6B A;  3S9O A;  3GG2 A;  5B66 H;  3V4Q A;  3PHL A;  2E74 C;  3MUD A;  3AEG C;  1LT9 C;  2YNY A;  1NTM G;  3VMX A;  2LKM A;  3EQ2 A;  4N3Y B;  4A7P A;  4NPD A;  4BRY B;  2FYZ A;  3S1K A;  1KOR A;  1RE4 A;  3CX5 H;  1SQV G;  3O8Z A;  3BAT A;  3L73 E;  1YYC A;  1KTM A;  4C7N B;  1YJW P;  3L4F A;  3F5H A;  3M9H A;  2E5T A;  3UIA A;  5KJ7 C;  5KLV D;  1KQL A;  1GW3 A;  1MKM A;  2IZ0 A;  2WVR A;  2N1T B;  4EI2 A;  2Q3I A;  1FZC B;  3HRN A;  3SWK A;  2JKV A;  1T3U A;  1AQT A;  2IZ1 A;  1H89 A;  1N73 B;  3G3Z A;  1VQL P;  2CK3 H;  3AE5 C;  4U3F D;  2R32 A;  2R3C A;  3RK2 B;  1VDF A;  1BSN A;  3H1K E;  1HGV A;  2WSF J;  3I5C A;  1RF0 C;  4H0L C;  2OTL P;  1MV8 A;  3L72 G;  1EZV G;  3VTP C;  1AQ5 A;  2G3A A;  4U7J A;  3GHG A;  1K8A Q;  1S5L H;  3H1L J;  2E43 A;  5APQ A;  2E5Y A;  2ZT9 B;  5AW2 B;  1L4A B;  3H1I J;  3RL0 B;  1GMJ A;  1ZXG A;  1M1J A;  1LGH B;  4PD4 I;  1SQX G;  3M0D A;  1NU1 D;  1NTZ E;  1LT9 A;  1NJI Q;  1SFC B;  1OVR A;  2W6J H;  4OGQ B;  1QVF O;  1ZN5 A;  2WSE J;  2FFD A;  1NTZ K;  1FZA A;  1VQK P;  4DOJ A;  4RKU J;  1CI6 B;  4WY4 D;  1NTM J;  2QG4 A;  2AXT E;  2K88 A;  1VQ5 P;  2XNX A;  3EFG A;  3WMM 0;  5KLI C;  1NGM B;  5KJ7 A;  2A45 I;  1RE3 C;  1PPJ E;  1KQS O;  5AW4 B;  1NYH A;  4PD4 E;  3RL0 g;  3WU2 H;  1LTA C;  3FGA D;  3CD6 P;  1RHZ B;  4I7Z B;  5CCH D;  3B5N B;  4W80 A;  5DJT B;  3HUS C;  3HE5 B;  2K9Y A;  3SFD C;  1N7S B;  2W8Z A;  4GKG A;  1DH3 A;  4LGD E;  3M91 A;  1G1J A;  3JSV C;  2JP3 A;  1QGK B;  3L72 J;  1JB0 J;  3IFM A;  4KT0 J;  1SQB G;  5KTB A;  2C0W A;  1FJK A;  2J59 M;  1NTK G;  3AE4 C;  1OVU A;  1ZR4 A;  1SQX E;  3TNU A;  1KB9 D;  2WPR A;  1L2P A;  2V4H A;  2C9N Y;  3L73 D;  3TGU J;  1BDC A;  1G2C A;  1JUN A;  1D7M A;  1EXI A;  3AEF C;  4WBA A;  1LTB C;  4WY4 C;  2KS1 A;  4OGQ C;  1KIL D;  3ABV C;  3A5T A;  1JY3 P;  1EQ7 A;  1YQ3 C;  1NKN A;  5KKZ C;  3CCE P;  1GL2 D;  1M7L A;  3AE6 C;  3OW2 O;  1S9K D;  5APU A;  1YTZ I;  2N9B A;  3CC2 P;  2H43 A;  3CCQ P;  2I1K A;  4YXD C;  2LR2 A;  3L36 A;  4NPE A;  4Y99 C;  1BCC E;  2HR3 A;  5GTH H;  2A06 G;  3B5N C;  3L74 J;  1PZQ A;  2ZAE B;  1M56 D;  1AA0 A;  3MHV A;  1S72 P;  3A0H E;  3CXH H;  2AEF A;  1MUU A;  1SP4 A;  4EIJ A;  3D6Z A;  1PP9 E;  3HTK A;  2KNC B;  1X22 A;  4KJM A;  1E79 H;  4H44 C;  4IL6 H;  5CMZ A;  2B88 A;  2KSJ A;  5APV A;  1SQB J;  2XDJ A;  3H1H D;  2OYO A;  1NTK J;  1VF5 B;  3CWB G;  1VPC A;  2ZYG A;  2P1J A;  2FXO A;  2Q1K A;  1PPJ D;  2PRR A;  4WY4 A;  1JTH B;  3L71 D;  2ZVN B;  3FX0 A;  3RK3 D;  1SS1 A;  3MD0 A;  1NWQ A;  2WSC H;  1BE3 E;  3I56 P;  1RF1 B;  3VMA A;  2JEE A;  2FYU G;  3PH0 A;  2Z4E A;  2AXC A;  1NKZ B;  2FXP A;  1YJ9 P;  4N78 E;  3L35 A;  2JR8 A;  2SPZ A;  3A3Y B;  3L70 G;  1HWT C;  1H8A A;  3CCR P;  5CCH A;  3BRV B;  5KAI E;  1EDI A;  2PP6 A;  4DCK A;  2C0X A;  1HJB A;  3G71 P;  1JY3 O;  5L8R J;  2YKO A;  3FXE A;  2WT7 B;  4XFJ A;  1L0N G;  1LT1 A;  3N4X A;  2QVA A;  1JCD A;  4EDF A;  2OYH B;  2NPS A;  3L75 E;  1J1D B;  2IYP A;  3AE8 C;  1VQN P;  2OYI A;  2XU6 A;  4RJT A;  3CMA P;  2KXP B;  1LJ2 A;  3II6 A;  2E75 B;  2C9L Y;  1KIL A;  1KN7 A;  4I1L A;  2M5A B;  1YJN P;  4I2L C;  1M1J B;  2E74 D;  4NPF X;  1GL2 A;  2FXM A;  3MTU E;  3QH9 A;  4LLH A;  3FWL A;  1KB9 H;  1M57 D;  2WTY A;  3Q5S A;  1BCC D;  2W83 C;  2L5G B;  3T97 A;  3WUU A;  1RF1 C;  4IFD K;  3F89 A;  3R2P A;  1XTG B;  4W7Z A;  3G4S P;  1BGY E;  2E76 B;  2ZXX A;  2QM8 A;  1JM0 A;  5BU8 B;  3PLN A;  1SQP E;  1PIX A;  3OJA B;  3L70 J;  3BCC G;  3S4R A;  4JYB A;  2BAS A;  1SQP K;  1FOS E;  1WMK A;  3MP7 B;  2WPQ A;  2WSS H;  1L0N J;  3W68 A;  3O6Q B;  2OYH C;  1P84 I;  4H0L D;  1R5L A;  2BCC E;  3H1I G;  3HD7 D;  1FBM A;  2JJL A;  5AW3 B;  1OX3 A;  3AE3 C;  2L91 A;  1LWU A;  4AQR D;  3IAO A;  1LP1 A;  1BE3 D;  1FC2 C;  1L0L D;  5AW7 B;  2H89 C;  1TU3 F;  3H1J G;  2BEZ F;  4N78 D;  5CCG C;  2OAR A;  1URQ A;  1AVO A;  2PFX A;  5CHX A;  4PJ0 E;  2N9Y B;  2QJY C;  2W90 A;  2Z5I A;  4I6M C;  2GM4 A;  1Q82 Q;  3RGU A;  2FYN C;  1P84 E;  2AXT H;  4D6T G;  1G2C B;  3VYI A;  3R4Y A;  1ZRT D;  1FZG A;  2P67 A;  5CJ0 A;  2FBW C;  1JO5 A;  3KHU A;  3CC7 P;  2IX7 C;  3M06 A;  4PD4 H;  3A7O A;  2E76 C;  4OH8 B;  3CI9 A;  3CXH D;  4JYC A;  1IFN A;  1DD3 A;  1GU4 A;  3H1H G;  3BAS A;  4JQ0 D;  1KMI Z;  2N1T D;  3NFQ A;  4DJG A;  3CPW O;  1N86 A;  3BCC J;  4C46 A;  3H1L E;  5APW A;  2WPV B;  2P58 A;  3L71 G;  3HD7 C;  3Q5P A;  5CBO A;  1JCC A;  4PV1 B;  3D6Y A;  5H2F E;  3RK2 D;  3H32 A;  2A45 H;  2B87 A;  1LTJ B;  2IBZ D;  2YMY A;  3TGU G;  5KAF H;  1RQV A;  3CC4 P;  3AE9 C;  1PGQ A;  2CPS A;  2ZT9 D;  1BDD A;  1NTM E;  1L4A D;  1KD1 Q;  1BGY D;  3RL0 D;  3ZDM A;  3H1J J;  1PGP A;  4GOF A;  1PL5 A;  3JCU H; 
#chains in the Genus database with same CATH homology
 1ZLL A;  1WRG A;  2QM7 A;  3IR9 A;  2N9B A;  3LIE A;  1GD2 E;  3KYQ A;  2H43 A;  2HLO A;  4AUW A;  3N7N A;  1IFI A;  1HUC A;  1OXZ A;  3CLQ A;  2I1K A;  3GHG C;  5AVR B;  2W27 A;  1LTG C;  1LTI C;  4B86 A;  3L36 A;  2Q7C A;  3TNU B;  1SQV K;  1GTW A;  3M0A A;  2CPB A;  4Y99 C;  3H32 B;  3U59 A;  1T8Z A;  1M1J C;  1X9V A;  3B5N C;  2P7J A;  5AVZ B;  3M0D C;  1PFI A;  5KLV K;  1RF1 A;  3P8C E;  1FZB A;  3P8M C;  1OWA A;  1FDM A;  3HE4 A;  3V2P A;  1LWU C;  3L37 A;  3VMZ A;  1T2K D;  2N1T C;  3V2Q A;  3C9I A;  2KLV A;  1FZC C;  1MUU A;  1SP4 A;  4EIJ A;  2FFD C;  1N7L A;  5AVU B;  3HTK A;  2Q5U A;  1ZV8 A;  3SWF A;  1GK4 A;  2XZR A;  5AW9 B;  1N73 C;  1NO4 A;  1RF0 A;  2YO3 A;  2IFM A;  1G1I A;  3CL3 D;  5BU5 A;  3RK3 C;  2FKW B;  1URQ C;  3B5N D;  4JF7 A;  1JY3 N;  3RK2 C;  5CMZ A;  1NAF A;  2KSJ A;  5APV A;  4M3L A;  1ZR2 A;  4C7R A;  2HFE D;  2XDJ A;  2WT7 A;  1JY2 P;  3U1C A;  1GDT A;  1VPC A;  1W2E A;  3LW5 H;  2P1J A;  4KHX A;  5AW0 B;  2WSF H;  4HYT B;  2YKQ A;  4WY4 A;  2NPS B;  4N6J A;  1JTH B;  1LTJ C;  2OYH A;  3HUS B;  2HOD A;  1L4A C;  3A2A A;  2MJZ A;  3RK3 D;  3MD0 A;  2VRS A;  3V5B A;  3RL0 C;  1NWQ A;  4ZKU A;  2M8R A;  2WSC H;  4WB4 A;  5AVS B;  1RF1 B;  1S9K E;  1J1E B;  2JEE A;  1SQX K;  3KDP B;  3HE4 B;  2Z4E A;  1NU1 K;  4GIF A;  1NKZ B;  1JOC A;  5KJ7 D;  2HG5 D;  3PP5 A;  4IFF A;  4N78 E;  3H6P A;  3VMY A;  3L35 A;  2XKM A;  1SFC C;  5APS A;  1GU5 A;  2IPP A;  3HTK B;  5CCG A;  3A3Y B;  1NHL A;  1HWT C;  1T3J A;  1H8A A;  3TK1 A;  3TYY A;  1WT6 A;  1JNM A;  5CCH A;  3BRV B;  4DZO A;  2PP6 A;  1KIL B;  3HD7 B;  1CZQ A;  3SWY A;  4O9B A;  2WZ7 A;  2C0X A;  2H8P D;  1HJB A;  1H88 A;  2A45 G;  1JY3 O;  4EOT A;  2YKO A;  3KPE A;  1GL2 B;  2KB7 P;  5APX A;  1RE3 A;  1NTM K;  1RY3 A;  3P7K A;  4C7N A;  2WT7 B;  1IO4 A;  2E42 A;  1YTZ T;  3N4X A;  3VOP A;  4AYC A;  1SFC D;  2J58 A;  1KFN A;  1SLQ A;  5AVY B;  1JCD A;  2ZFC A;  1T2K C;  4WY4 B;  3KQG A;  2OYH B;  3V4W A;  1JY2 N;  1MFZ A;  1LTS C;  1NOH A;  2N1T A;  1IFD A;  3P32 A;  2HOD B;  2NPS A;  1JTH A;  1FZC A;  3HUS A;  1J1D B;  3V2R A;  5AVV B;  1HBW A;  2W6B A;  4GT1 A;  1X79 B;  3V4Q A;  3MUD A;  5AW8 B;  2OYI A;  2XU6 A;  1LT9 C;  2YNY A;  1N7S C;  2YKP A;  3VMX A;  2GUV A;  2LKM A;  1E5W A;  3EQ2 A;  4N3Y B;  1QL1 A;  3V2N A;  3MIW A;  2FYZ A;  1HH0 A;  1RE4 A;  3II6 A;  3O8Z A;  2C9L Y;  2GUS A;  3BAT A;  3NXS A;  1KIL A;  3HD7 A;  4Y99 B;  4I1L A;  1KZU B;  1YYC A;  1SQB K;  4C7N B;  2I1J A;  4I2L C;  1M1J B;  3L4F A;  1KFM A;  1NTK K;  3M9H A;  3UIA A;  1GL2 A;  2FXM A;  3MTU E;  1N7S D;  5KJ7 C;  4LLH A;  1KQL A;  1GW3 A;  2WTY A;  5AVQ B;  2L5G B;  3T97 A;  1RF1 C;  2N1T B;  2ZXE B;  2KYV A;  2O01 H;  2Q3I A;  1JY2 O;  1FZC B;  3HRN A;  4IFD K;  3B8E B;  2IFN A;  3R2P A;  1XTG B;  1IFJ A;  3P8C D;  1T3U A;  4W7Z A;  2R5D A;  2O1J A;  2H7H A;  1H89 A;  1N73 B;  3G3Z A;  1A02 F;  2WIT A;  1CI6 A;  2QM8 A;  4W7Y A;  2NPS D;  2R3C A;  2R32 A;  1URQ B;  5BU8 B;  2M3B A;  1J2J B;  3RK2 B;  1VDF A;  2OYI B;  1GW4 A;  1HGV A;  2XV5 A;  3I5C A;  1RF0 C;  3OJA B;  1MV8 A;  5AVT B;  1SVF A;  3VTP C;  4JYB A;  2BAS A;  1AQ5 A;  1SQP K;  3GHG A;  1FOS E;  2E43 A;  2WPQ A;  5APQ A;  2WPS A;  5AW2 B;  1L4A B;  3RL0 B;  2OYH C;  4ZKP A;  1M1J A;  2R5B A;  5AVW B;  3B5N A;  1LGH B;  3HD7 D;  1FBM A;  2JJL A;  3M0D A;  5CJ4 A;  1IFM A;  2PAJ A;  5AW3 B;  3BVH A;  1DX7 A;  4IFM A;  1LT9 A;  1LWU A;  1SFC B;  4AQR D;  2KP8 A;  3VN0 A;  5AW7 B;  2HYN A;  1CW5 A;  1ZN5 A;  2FFD A;  3OA7 A;  1NTZ K;  1FZA A;  4DOJ A;  1SQQ K;  3LID A;  1DEB A;  1CI6 B;  1A02 J;  4N78 D;  4WY4 D;  5CCG C;  1N73 A;  1GK6 A;  2OAR A;  1HVV A;  1URQ A;  5CCH C;  5CHX A;  2XNX A;  1IK9 A;  2Z5I A;  3EFG A;  3MGN A;  3WMM 0;  3E1I A;  1GZL A;  4I6M C;  2Z5H A;  5BVZ A;  1AFO A;  2GM4 A;  1LTT C;  5KJ7 A;  2A45 I;  3GHG B;  1RE3 C;  1IJD B;  3OAK A;  3M9Q A;  2POH A;  1G2C B;  3VYI A;  1FZE A;  1FAV A;  5AW4 B;  2W6A A;  1LTJ A;  1JMM A;  1LTA C;  5APY A;  5CCG D;  1FZG A;  2HPC B;  1L4A A;  2P67 A;  5AW5 B;  5CJ0 A;  2P2U A;  5CCH D;  5AVX B;  1HTL C;  2NPS C;  3B5N B;  4W80 A;  1JO5 A;  3HUS C;  3HE5 B;  3VP8 A;  2IX7 C;  3M06 A;  1LT9 B;  4XA4 A;  1LWU B;  1N7S B;  3A7O A;  4OH8 B;  4GKG A;  5APT A;  3CI9 A;  1J1E C;  2FYU K;  1SFC A;  1X8Y A;  4JYC A;  1MZ9 A;  2FFD B;  2OYI C;  1DH3 A;  1HGZ A;  1NH4 A;  1IFN A;  4LGD E;  1FJP A;  1GU4 A;  1FU1 A;  3U1A A;  3BAS A;  3M91 A;  1G1J A;  1FOS F;  1CSB A;  2N1T D;  3NFQ A;  3RK3 B;  1N86 A;  3IFM A;  4XE5 B;  4C46 A;  1RE4 C;  5APW A;  5KTB A;  2C0W A;  1FJK A;  2J59 M;  4RES B;  1ZR4 A;  1KIL C;  3HD7 C;  3TNU A;  1IC2 A;  3M9B A;  2WPR A;  1JCC A;  3NTN A;  1N2D C;  1URQ D;  2C9N Y;  1FZF A;  3NMD A;  3RK2 D;  3H32 A;  1QL2 A;  2KOG A;  1GL2 C;  3TSI A;  2A45 H;  2Q9I A;  1L0N K;  1G2C A;  1LTJ B;  1JUN A;  4WBA A;  4LC1 A;  2YMY A;  4HH2 A;  1LTB C;  2WWW A;  4WY4 C;  2HPC A;  1L0L K;  2O1K A;  1KIL D;  3A5T A;  1JY3 P;  2CPS A;  1J1D C;  1Z56 A;  1EQ7 A;  1L4A D;  1NKN A;  2YO2 A;  3HE5 A;  3RL0 D;  5AW6 B;  1XTC C;  1N7S A;  1GL2 D;  1M7L A;  3BRT B;  5AW1 B;  1S9K D;  3VP9 A;  2WSE H;  5APU A;  1YTZ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...