1T3JA

Mitofusin domain hr2 v686m/i708m mutant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
62
structure length
62
Chain Sequence
ATTFARLCQQVDMTQKHLEEEIARLSKEIDQLEKMQNNSKLLRNKAVQLESELENFSKQFLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords mitofusin 1
publication title Structural basis of mitochondrial tethering by mitofusin complexes
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 28
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2004-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1t3jA00
1NHLA 1URQD 3HD7C 4WY4A 2XDJA 2WZ7A 3PP5A 5KJ7A 4W80A 1N7SC 3RK3C 1GL2A 1L4AC 1SFCC 3B5NA 2N1TA 2H8PD 4JF7A 1URQA 3B5NB 4W7YA 3RK2B 1URQB 5CCGD 3HD7D 3VOPA 4LGDE 3TSIA 4WY4B 1JTHA 3B5NC 2NPSD 1N7SD 3RK3D 5CCHD 3RK2C 1URQC 1JTHB 1L4AD 1SFCD 1KILD 1GL2B 2N1TB 3RL0D 3KYQA 4OH8B 5CCGA 1T3JA 3HD7A 2HG5D 4WY4C 2PP6A 4W7ZA 2NPSA 5KJ7C 5CCHA 2KOGA 1L4AA 1SFCA 1KILA 1GL2C 2NPSB 2N1TC 1HVVA 1KILB 3M0DC 3RL0B 5CCGC 3P8CE 2HFED 1XTGB 3HD7B 2NPSC 4WY4D 5CCHC 1N7SA 1KILC 5KJ7D 2M8RA 3RL0C 1N7SB 2YMYA 3RK3B 1GL2D 1L4AB 3B5ND 1SFCB 3HTKB 2N1TD 4N78E 3RK2D
chains in the Genus database with same CATH superfamily
3EQ2A 5APUA 2R32A 2I1KA 4C7RA 2WZ7A 1USEA 1KYOE 1PP9E 4OGQB 4YPCA 2WT7B 2D2CB 1NU1E 2JEEA 4JF7A 2B87A 3B5NB 2FFDB 1KB9I 4AYCA 3Q5PA 3RK2B 1URQB 2WPQA 4KT0J 1RH5B 4L74A 5CCGD 1LJ2A 4R4LA 3H1JE 1N73A 5TISH 1QL1A 1BE3E 2JKVA 1JMMA 5AVXB 1NO4A 1NTKE 5KLVJ 4RKUJ 4W7ZA 5AW0B 5KJ7C 1L4AA 2Y0DA 3SSUA 2A06E 1HVVA 3H1KD 3KZIE 1KILB 2OQQA 3CL3D 2PAJA 1IO4A 2AEMA 4Y28J 1RHZB 1DEBA 2FBWC 3EWKA 2M5AB 3AE1C 4MN4C 4Y99C 3H1IJ 1MUUA 1LTGC 1LTSC 1LWUB 1KB9D 1VF5C 3MUDC 3H32A 2YIUB 3WUUA 4U3FE 1U7JA 4RO0A 2H43A 2KZJA 4W80A 2LXBA 1SFCC 3RGUA 1J1DC 3MP7B 5H2FH 3BRVB 3RBXA 2E76D 1PZQA 1OMIA 1J1EB 1LTJB 1QX8A 3L71D 3TGUJ 2GM4A 3UIAA 3O8ZA 3MIWA 3AEBC 1WMKA 3BASA 1NTMK 1RQUA 3KHUA 2ITAA 2Q6QA 1N86A 1KQLA 3AEAC 2E75D 1SS1A 1Y8AA 4OGQD 1DH3A 3MTUE 3CXHE 2FYUK 3A0HH 1VQ5P 1IFIA 1NJIQ 5CBOA 1FAVA 3V2RA 2HFED 4C7NA 2RKLA 1PFIA 2IZ0A 1L0LG 1E5WA 3GF7A 2KXPB 2AEFA 1VQOP 1T3UA 1BCCE 5APWA 5KAIE 5CCHC 5B5EE 3PHLA 3IFMA 3LW5J 1AVYA 1FZAA 1JMBA 5B66E 2KNCB 5BVZA 1SQVG 2VRSA 1L0NG 4DJGA 2CPBA 1DX7A 1S1CX 1L4AC 3FWLA 3B5NA 3HUSA 3PRJA 1LP1B 3IF4A 1URQA 3GHGC 1JY3P 1NTMJ 1NU1K 2KLVA 4PD4E 2HODB 2POHA 2ZVOB 3CMAP 2QVAA 2HYNA 5K5GB 3H1HJ 1IFJA 2FYUJ 1ZXGA 4D6TD 4GOEA 2B9BA 3CCEP 3NMDA 1D7MA 3W68A 3A5TA 1HGVA 1ZOYC 1SQQE 4TLFA 1NTKK 2WTYA 1KILA 2Y0CA 4U7JA 4Y99B 3L72J 2XNDH 1PL5A 3CCJP 4IL6X 1VF5B 3L70J 1VQ8P 2M5AA 1FBMA 2AEJA 2WSCH 4HKZH 5AW4B 3BCCD 3HE4B 2G3AA 3CCVP 1SFCB 2IPPA 1J2JB 4L73A 3FX0A 3IAOA 5C39A 2P67A 1PP9J 5GTIE 1J1DB 2DW3A 2IBZI 1SQBD 3R2PA 1NU1J 4JQ0D 2O01J 1GU5A 1N7SC 2OYOA 1MZ9A 2SPZA 3H1LE 3CX5H 3L74D 3QWOC 1HGZA 1BGYD 1ZR2A 4IFFA 1VDFA 1LTJA 1X79B 3H1JJ 3CD6P 1EXJA 3U1CA 1JO5A 2WPRA 4IL6E 1K73Q 2PGDA 1FU1A 1NTKJ 1S4XA 1M8OB 2ZVNB 3G6EP 1T3JA 3JCUH 4Z1MH 2B87B 1EZVE 5APSA 1DEEG 4JBZA 2YNYA 2KB7P 1NGMB 2ZFCA 1EDIA 1K04A 3CI9A 2P7JA 3CWBG 3HUSC 5GTHH 1KB9E 1S9KD 1VQMP 5KAFE 2BCCD 2IBZD 3S9OA 2NPSC 2Z4EA 1OWAA 2KSEA 3M0AA 4U3FJ 5KJ7D 3L73G 1X9VA 2M3EA 3K5BA 1L4AB 1HJ0A 2QJKC 2RN0A 1T2KC 2KNCA 2K9YA 3GHGB 1NOHA 3VYIA 5AVQB 2R44A 4I7ZC 3A2AA 2PRRA 3L71E 3BATA 1YTZT 1LP1A 1GL2A 3C8VA 2Z5HA 2K9JB 2QE7H 4HH2A 3OAKA 2HODA 2GUSA 3BCCG 3HE5B 2BASA 3OJAB 5CJ4A 2Q1KA 3RK3E 1RY3A 1SFCD 3TYYA 2IFMA 1GW4A 1BE3G 3M9BA 5KTBA 4H44C 1GDTA 1NTME 2QM7A 1RQVA 2WITA 2J58A 3MUDA 1JY2P 1SQQK 3L75D 3M0DC 1E79H 1BCCJ 2A06G 1YIJP 1XTGB 1KMIZ 3Q5SA 2FYUE 2AXTE 1WT6A 1FOSE 2M3BA 1JEKA 3RL0C 1N7SB 1FJKA 2N9BA 2WMMA 1P84H 4WY4A 1QVGO 2BCCG 5AVVB 3A0BE 3L37A 4GODA 1JOCA 1JM0A 1CSBA 1GU4A 3CCMP 1MFTA 2OYIC 3LW5H 2WSEJ 2IDBA 1OVRA 1LTIC 1JTHB 1L4AD 3CCQP 3O6QB 2WVRA 4UB8H 3HUSB 4NPEA 3KYQA 1OXZA 2CK3H 2Q3IA 1SQQJ 1JB0J 2PP6A 4WWIA 3U1AA 2OTLP 3FGAD 5CCHA 2KOGA 1GL2C 2NPSB 3D6YA 2QJPC 3A3YB 2RH0A 1IFPA 5AVYB 1L0LD 1EDLA 3L35A 4R4MA 1PV3A 1H88A 1SQXG 2QJKB 1KD1Q 3AE4C 2E43A 1EQ7A 1PGPA 4I7ZB 4IFDK 4AUWA 2KYVA 1CI6B 3U59A 3AE6C 4BXLA 3L74E 3V6IA 3G71P 2P10A 2ZT9C 1BGYE 1P84I 1YJNP 3GHGA 1MKMA 4GKGA 1SQVD 4PJ0E 1L0ND 3H1LJ 3H6PA 3HRNA 2ZYAA 3CC2P 1DD3A 1FDIA 3L75G 4WBAA 4H0LC 3EFFK 4XA4A 3PLNA 2K9JA 2FKWB 2QA4P 2N1TA 3WU2H 2HLOA 1VQNP 3M9QA 1OVVA 3B71A 3HE5A 1JY3O 5AW8B 4W7YA 3E1RA 1L2PA 2XV5A 4I1LA 4H13D 3WMM0 3VOPA 3H1KJ 4DCKA 4H44B 3AE5C 1N7SD 3TGUD 1KYOH 2K37A 1KZUB 1FE6A 2C9LY 2NRGA 2IBZE 1FZCA 2Q7CA 1KORA 1SP4A 4OH8B 2O01H 3HD7A 5DJTB 4WY4C 3CMEP 1RE4C 1UIXA 4PV1D 1NTZE 1P84D 5APXA 2J59M 2Y9ZA 1PPJG 4ZKPA 1S2EA 4N3YB 2IX7C 3RL0B 4EOTA 3P8CE 4IFMA 4XE5B 3WUVA 4UB6E 2H89C 2KS1B 3VMYA 1VQKP 1N7SA 3I55P 4OWFA 2D2CD 3ABVC 2YMYA 3B5ND 3G9RA 4N78E 2C0XA 3L71J 4DOJA 5KLVG 3RK2D 1URQD 1LTTC 3AEEC 2WSSH 1ZRTD 1GD2E 1QGKB 2WSFJ 1YYCA 2YKQA 3CC7P 1H0TB 1GK4A 4AQRD 2OYIB 5KLIC 1SQPE 3I56P 2RMZA 1FOSF 1JNMA 2OTKE 1M90Q 2JR8A 3P7KA 1T2KD 3H1IG 4ZKUA 2KSJA 4EYYQ 5EFWB 3VN0A 1JTHA 3M9HA 1ZR4A 2IFNA 3O6QA 1KILD 2Y0EA 1GL2B 2E74C 2QJPB 4XFJA 3KQGA 3H1HD 2W6AA 1RF0A 1JY3N 3CWBD 2NPSA 1SVFA 4HYTB 1EC5A 4YXWH 3SWYA 2N1TC 1AV1A 1KFNA 3KPEA 1G1JA 1RF1C 1GZLA 2ZT9B 5CCGC 1U7MA 3TGUG 5APVA 3L73D 4KJMA 1CI6A 4LC1A 1PGOA 5KKZC 4H0LB 2KUBA 1IFNA 1FZCC 3TNUB 3GLMA 3HD7C 3B4SA 2L91A 3G4SP 1Z56A 4YXDC 3TK1A 1KYOD 1W2EA 4RJTA 3V2QA 5KAIH 3F5HA 5B5EH 4RESB 2R5BA 4N6JA 3N7NA 4WB4A 1OZHA 3CCRP 2YXQB 5B66H 3BRTB 1S5LX 1TU3F 1VQ7P 4WY4B 1VL2A 2L5GB 2I1JA 1BE3D 1PGJA 3M0DA 1LT1A 3A7OA 1OFCX 3CCLP 2FYNC 3Q2YA 5AVUB 1SLQA 4PD4H 1NAYA 5AW6B 2A06D 3AEDC 1JY2O 1NTMG 1PIXA 3H1KE 2JJLA 1DD4A 1NTZK 1T6AA 4ZMDA 2H88C 3VP9A 1DIPA 1Q7YQ 2KS1A 2O1JA 3L74J 1JUNA 1AJYA 1BGYJ 3FWNA 3H1HG 2FYUG 3JSVC 1NKNA 4BWNA 1GL2D 5KLIB 2Q9IA 2E75C 4U3FD 1NHLA 1S5LE 1GMJA 3E1IA 1W2BO 1HF9A 1H0TA 1RF0C 3GF3A 2IYPA 5DJUB 2OYIA 3MGNA 2W27A 3RK3C 3L72G 1GW3A 4B86A 2XZRA 3L70G 2ZT9D 3OW2O 4EIJA 5E79E 1LNQA 2E74B 1SQPK 3PTZA 5GTIH 3SWKA 3CX5I 3TSIA 2ZYGA 2XNXA 1IJDB 2K3RA 5AVZB 2E5YA 1PP9G 2NZ2A 2QJYC 4CPGA 1FZEA 2N1TB 1VF5D 1NU1G 1RF1B 1NTZJ 3WUTA 1Y9BA 4PD4I 3AE3C 1YQ3C 3IN6A 2OYHB 1SQXD 3ZDMA 1Q81Q 3L36A 5KKZB 3H1JG 4IL6H 1IK7A 2Y9YA 3W67A 2ZJSE 2H7HA 3N4XA 4C46A 4GIFA 1FZCB 1AA0A 1BCCD 2JDIH 3HD7B 1N8RQ 4WY4D 4O9BA 4EI2A 1NTKG 2WQYC 3AE8C 2AXCA 3HTKB 3TNUA 1VQ4P 1KB9H 2MJZA 1JY2N 5KAFH 2OARA 3CX5D 5AW2B 2N9YB 1SQPJ 5TISE 1MFZA 1G2CB 1Q86Q 1M1JA 1VQLP 4HB1A 1LGHB 1PGQA 4PD4D 1KQSO 5M1BA 2E42A 3CWBE 4LGDE 3E7KA 2JP3A 4U3FG 1RE4A 1YITP 2FYNB 1KQFB 5CCHD 2V7QJ 2K88A 3L4FA 1G1IA 2WSFH 1BSHA 4D6TE 1L0LK 3L73E 4L75A 2JWDA 1PPJD 1HWTC 2W8ZA 5CHXA 4IOIH 1ZLLA 1AVOA 2V4HA 3D70A 3LIEA 1M56D 1IZNB 2WPVB 1HUCA 4L76A 5L8RJ 1KV4A 2E74D 1QLED 2E75B 1EZVI 3VP8A 3TDKA 1Q2NA 1SQVK 1L0NK 5H2FE 1UIIA 4M3LA 5KLVD 5CJ0A 2A45G 3BCCE 3RK3B 2J5UA 2HPCB 1NAFA 2N1TD 3KXDA 2IYOA 1M7LA 1K9MQ 1NYHA 5AVWB 3T97B 1QL2A 2FXMA 1SQBE 2QG4A 1AFOA 2P1JA 3H1LD 5TJHA 1AQTA 1BSNA 5AVTB 2AXTH 1BCCG 1FC2C 1YJWP 3MD0A 4HJGH 3H1ID 2M0BA 2PFXA 1SQPG 2QJYB 3P32A 2MKVA 3HD7D 5APTA 1L0LJ 3A0HE 1FDOA 2C9NY 2LXCB 2W90A 3S4RA 1FZGA 2GA1A 3A0BH 1RF1A 1HH0A 1LT9A 5CCGA 1EZVD 1OW7A 2HG5D 2QM8A 3Q3DA 1FZBA 1S3JA 2OYHA 1CW5A 2UWJE 3SFDC 1SQVJ 1L0NJ 4QMAA 4BRYB 1M1JC 4KHXA 2JWAA 1S9KE 2BCCE 1OX3A 2I8DA 2W6JH 1YJ9P 2GUVA 2QSIA 3V2PA 4EDFA 4JYCA 2W6BA 2OGUA 2ZAEB 2B88A 1W5CE 3HTKA 1M57D 3MZWB 2M8RA 1SQQG 1USDA 3JC22 1YTZI 2P2UA 2E5TA 3OA7A 2Q3EA 3AE9C 1G2CA 3Q5RA 1QVFO 1N2DC 3NTNA 3M06A 4ASWA 1LTAC 2H8PD 5AW3B 3SWFA 3P8MC 3AE7C 1RE3A 3ITKA 3KZIH 1EXIA 4PJ0H 3EFGA 1R5LA 2QIWA 2OTJP 2NPSD 1Y47A 3RK3D 2FXOA 1MV8A 3V4WA 1SQXE 2KI7B 2YO2A 3H1LG 2KLUA 5AVSB 5AW5B 2FXPA 2C0WA 1R5SA 3RL0g 1IFDA 1NTMD 4NPFX 1ZN5A 1FZFA 3RBZA 1VQ6P 1KYOI 1N73C 2R5DA 5CMZA 1X0TA 2LKMA 4DZOA 3PH0A 3L75E 1NKZB 4K3AA 3H1KG 2FYUD 3CX5E 3H25A 1OVUA 2WT7A 4ASVA 3I5CA 1VQ9P 1EZVG 1U57A 4I2LC 2HPCA 2FFDA 1X8YA 3VMZA 1OIPA 1KC8Q 1LTBC 3T97A 1LT9C 3L72D 2BEQD 2XDJA 2ZXXA 5AW7B 3D71A 1IC2A 3L70D 2OYHC 4H44D 4UB6H 3NXSA 1HJBA 2A45H 1SQBK 3JCUE 5CBNA 2KIKA 1K8AQ 3IR9A 2YKPA 3CXHH 3CWBJ 1FJPA 2K1AA 3FXDA 5GTHE 1PP9D 1PPJE 4OVNF 3VMAA 2KP8A 3C9IA 1NU1D 1N7LA 3L71G 4D6TJ 1AQ5A 3FXEA 1JCCA 5BU8B 3R4YA 3L73J 3RL0D 1NVOA 1M1JB 5AVRB 1IFMA 1ZP0C 1LWUA 3H1JD 2FY8A 4BRYA 3CCUP 5KLVE 4YTPC 3KDPB 1L0LE 1S72P 1CZQA 4H13C 1NTKD 1RE3C 3VMXA 1M1KQ 3BCCJ 3S1KA 2HR3A 2V7QH 1FDMA 1HTLC 1A02F 4ZNCA 1BDDA 4JYBA 3V4QA 1SQBJ 2YMKA 3H1IE 1NH4A 2E76C 1SQVE 1L0NE 3AEGC 2Z5IA 1BDCA 4PV1C 2WSEH 1Q90D 1BE3J 1EDKA 3NFQA 3CPWO 1T8ZA 2A45I 1K05A 1VPCA 5AW9B 2W83C 2R3SA 3GG2A 3CXHI 2KK7A 3V5BA 2ZXEB 3MHVA 1YBKA 4OGQC 2XU6A 1GTWA 3B8EB 2D2CC 3GW6A 2IZ1A 2Q5UA 3B5NC 1ZMEC 2FFDC 3USSA 1KQGB 3RK2C 1URQC 3TGUE 4K35A 1A02J 1N73B 1YQ4C 1SQXK 3C1LA 1YI2P 3AECC 1QEXA 4D6TG 1NTZD 1WRGA 3AE2C 4JPZB 2BCCJ 1HBWA 1H89A 2FYZA 4H0LD 1P84E 2P58A 1YHQP 1X22A 3P8CD 3SFEC 1OW8A 2WWWA 3F89A 1LT9B 4GT1A 3V2NA 3Q1MA 3CXHD 1KILC 2JO1A 1OW6A 4N78D 3TF5A 3CC4P 1NWQA 2O1KA 4LLHA 4WVZA 3H32B 4GOFA 1ZRTE 3VTPC 3PP5A 5KJ7A 1LWUC 5AW1B 3G3ZA 3QH9A 1SQBG 4UB8E 2ZYDA 1SQPD 3GMAA 3AEFC 2YXRB 3PJSK 2YIUC 4I6MC 3CCSP 5BU5A 2R3CA 3L74G 5APQA 2B89A 1BGYG 1GK6A 1H8AA 2CPSA 1KTMA 1SQXJ 1S5LH 2O01N 2WSCJ 2QEXP 1R8EA 2QRXA 1KILE 2O3JA 1J1EC 1LTJC 1FS0E 1KN7A 3H1HE 4H13B 2G8YA 5E79H 2XKMA 3M91A 1ZW0A 3HE4A 3L75J 1SFCA 4NPDA 2YO3A 1Q82Q 3II6A 1EDJA 2KZIA 1IK9A 1VQPP 4TT3H 1ZV8A 2WPSA 2YKOA 5KLVK 5APYA 3BVHA 3CLQA 3L72E 2E76B 2IBZG 4C7NB 3WU2E 1SQQD 3L70E 4PV1B 1KFMA 3D6ZA 2LR2A 1XTCC 4A7PA 1JCDA 3LIDA 4DT0A 1NTZG 4GDOA 2BEZF
chains in the Genus database with same CATH topology
1YTZI 3EQ2A 5APUA 1T2KC 2P2UA 3TNUB 3HD7C 3GHGB 2R32A 1NOHA 2I1KA 3OA7A 4C7RA 3VYIA 2WZ7A 5AVQB 1Z56A 3TK1A 3A2AA 1G2CA 1W2EA 3BATA 1N2DC 1YTZT 3NTNA 3M06A 1GL2A 2WT7B 3V2QA 1LTAC 2H8PD 2JEEA 2Z5HA 4JF7A 5AW3B 4HH2A 3SWFA 3B5NB 3P8MC 4RESB 3OAKA 2FFDB 4AYCA 2HODA 3RK2B 2GUSA 1URQB 2R5BA 2WPQA 4N6JA 3HE5B 3N7NA 4WB4A 1RE3A 2BASA 3OJAB 5CCGD 3BRTB 5CJ4A 3EFGA 4WY4B 2L5GB 2NPSD 1N73A 2I1JA 3RK3D 1QL1A 1MV8A 3V4WA 1RY3A 1SFCD 3TYYA 2IFMA 2YO2A 1JMMA 5AVSB 3M0DA 5AW5B 2C0WA 1GW4A 3A7OA 3M9BA 5AVXB 1NO4A 5KTBA 1IFDA 4W7ZA 5AW0B 5AVUB 1ZN5A 1SLQA 5KJ7C 1GDTA 5AW6B 1FZFA 2QM7A 1L4AA 1N73C 2R5DA 2WITA 2J58A 1HVVA 1JY2O 1KILB 3MUDA 5CMZA 1JY2P 2LKMA 2JJLA 1SQQK 3M0DC 4DZOA 3CL3D 1NTZK 2PAJA 1IO4A 1NKZB 3VP9A 1XTGB 1DEBA 2O1JA 1JUNA 2WT7A 3I5CA 1WT6A 4Y99C 1MUUA 1LTGC 4I2LC 2HPCA 2FFDA 1FOSE 2M3BA 1LTSC 1X8YA 1LWUB 3VMZA 3RL0C 1N7SB 1NKNA 1FJKA 1GL2D 2N9BA 3H32A 2Q9IA 1LTBC 1NHLA 3T97A 1LT9C 3E1IA 4WY4A 2XDJA 2H43A 1RF0C 5AVVB 5AW7B 2OYIA 1IC2A 3L37A 3MGNA 4W80A 2W27A 3RK3C 2OYHC 1GW3A 3NXSA 1SFCC 4B86A 1HJBA 2A45H 1SQBK 1J1DC 1JOCA 2XZRA 3IR9A 2YKPA 3BRVB 1CSBA 1GU4A 1FJPA 4EIJA 1SQPK 1J1EB 1LTJB 2GM4A 2OYIC 3UIAA 3O8ZA 3MIWA 3TSIA 3LW5H 2XNXA 1IJDB 1LTIC 2KP8A 3C9IA 1N7LA 1AQ5A 3BASA 5AVZB 1JTHB 1L4AD 1JCCA 1NTMK 1FZEA 5BU8B 2N1TB 3HUSB 3RL0D 3KYQA 1OXZA 2Q3IA 1M1JB 1RF1B 1N86A 5AVRB 1KQLA 1IFMA 2PP6A 3U1AA 1LWUA 1DH3A 5CCHA 2KOGA 3MTUE 1GL2C 2NPSB 2OYHB 3A3YB 2FYUK 5AVYB 1IFIA 3KDPB 3L36A 1CZQA 3L35A 1FAVA 3V2RA 2HFED 1H88A 4C7NA 1PFIA 2H7HA 1E5WA 3N4XA 1RE3C 3VMXA 4C46A 4GIFA 1FZCB 3HD7B 1EQ7A 2E43A 1T3UA 5APWA 4WY4D 5CCHC 4O9BA 4IFDK 4AUWA 2KYVA 1FDMA 1CI6B 3U59A 1HTLC 1A02F 3IFMA 1FZAA 3HTKB 4JYBA 3TNUA 3V4QA 3GHGA 4GKGA 1NH4A 3H6PA 2MJZA 1JY2N 3HRNA 2OARA 2Z5IA 5AW2B 2WSEH 3NFQA 5BVZA 2VRSA 1MFZA 4WBAA 1T8ZA 2CPBA 4XA4A 1DX7A 2A45I 1G2CB 2FKWB 1VPCA 5AW9B 1L4AC 3B5NA 2N1TA 3HUSA 2HLOA 3V5BA 3M9QA 1URQA 1M1JA 3GHGC 3HE5A 2ZXEB 1JY3O 5AW8B 4W7YA 1JY3P 1LGHB 1NU1K 2KLVA 2HODB 2XV5A 2POHA 4I1LA 2XU6A 1GTWA 3WMM0 2E42A 3VOPA 3B8EB 4LGDE 1RE4A 2Q5UA 3B5NC 2FFDC 1N7SD 5CCHD 3RK2C 1URQC 1KZUB 2HYNA 1A02J 1N73B 1IFJA 2C9LY 3L4FA 1G1IA 1FZCA 2Q7CA 1SP4A 4OH8B 2WSFH 2O01H 3HD7A 1SQXK 1L0LK 4WY4C 3NMDA 3A5TA 1HGVA 1RE4C 1HWTC 1WRGA 5CHXA 1ZLLA 1HBWA 2WTYA 1NTKK 1H89A 1KILA 2FYZA 5APXA 2J59M 4Y99B 3LIEA 4ZKPA 4N3YB 2IX7C 3P8CD 1HUCA 3RL0B 4EOTA 3P8CE 4IFMA 4XE5B 2WWWA 1LT9B 3VP8A 1FBMA 4GT1A 2WSCH 3VMYA 1SQVK 3V2NA 1L0NK 1N7SA 5AW4B 1KILC 4M3LA 5CJ0A 2A45G 3HE4B 2YMYA 3RK3B 2HPCB 4N78D 3B5ND 1SFCB 2IPPA 1J2JB 1NAFA 2N1TD 4N78E 2C0XA 1NWQA 4DOJA 2O1KA 3RK2D 1URQD 1LTTC 2P67A 4LLHA 1J1DB 1M7LA 5AVWB 3H32B 1GD2E 1QL2A 3VTPC 3R2PA 2FXMA 1YYCA 3PP5A 1AFOA 1GU5A 2YKQA 2P1JA 5KJ7A 1LWUC 5AW1B 1GK4A 1N7SC 1MZ9A 3G3ZA 4AQRD 2OYIB 5AVTB 1HGZA 1ZR2A 4I6MC 4IFFA 3MD0A 5BU5A 2R3CA 1VDFA 1FOSF 5APQA 1LTJA 1X79B 1JNMA 1GK6A 3U1CA 1H8AA 3P7KA 3P32A 2CPSA 1T2KD 1JO5A 3HD7D 5APTA 4ZKUA 2KSJA 2C9NY 3VN0A 2WPRA 1JTHA 3M9HA 1ZR4A 2IFNA 1FZGA 1FU1A 1KILD 1GL2B 1RF1A 1J1EC 1HH0A 1LT9A 1LTJC 5CCGA 1T3JA 2HG5D 2QM8A 3KQGA 5APSA 2W6AA 1RF0A 2YNYA 1JY3N 2KB7P 1FZBA 2NPSA 2XKMA 3M91A 2OYHA 3HE4A 1CW5A 2ZFCA 1SVFA 4HYTB 1SFCA 2YO3A 3CI9A 3SWYA 3II6A 2P7JA 2N1TC 1KFNA 3HUSC 3KPEA 1IK9A 1S9KD 1M1JC 1G1JA 1RF1C 4KHXA 1GZLA 1S9KE 1ZV8A 2WPSA 5CCGC 2YKOA 5KLVK 5APYA 2GUVA 3BVHA 3CLQA 3V2PA 4JYCA 2W6BA 5APVA 4C7NB 1CI6A 2NPSC 2Z4EA 4LC1A 1KFMA 1OWAA 3M0AA 1XTCC 3HTKA 5KJ7D 1JCDA 2M8RA 3LIDA 1X9VA 1IFNA 1L4AB 1FZCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHL A;  1URQ D;  3HD7 C;  4WY4 A;  2XDJ A;  2WZ7 A;  3PP5 A;  5KJ7 A;  4W80 A;  1N7S C;  3RK3 C;  1GL2 A;  1L4A C;  1SFC C;  3B5N A;  2N1T A;  2H8P D;  4JF7 A;  1URQ A;  3B5N B;  4W7Y A;  3RK2 B;  1URQ B;  5CCG D;  3HD7 D;  3VOP A;  4LGD E;  3TSI A;  4WY4 B;  1JTH A;  3B5N C;  2NPS D;  1N7S D;  3RK3 D;  5CCH D;  3RK2 C;  1URQ C;  1JTH B;  1L4A D;  1SFC D;  1KIL D;  1GL2 B;  2N1T B;  3RL0 D;  3KYQ A;  4OH8 B;  5CCG A;  1T3J A;  3HD7 A;  2HG5 D;  4WY4 C;  2PP6 A;  4W7Z A;  2NPS A;  5KJ7 C;  5CCH A;  2KOG A;  1L4A A;  1SFC A;  1KIL A;  1GL2 C;  2NPS B;  2N1T C;  1HVV A;  1KIL B;  3M0D C;  3RL0 B;  5CCG C;  3P8C E;  2HFE D;  1XTG B;  3HD7 B;  2NPS C;  4WY4 D;  5CCH C;  1N7S A;  1KIL C;  5KJ7 D;  2M8R A;  3RL0 C;  1N7S B;  2YMY A;  3RK3 B;  1GL2 D;  1L4A B;  3B5N D;  1SFC B;  3HTK B;  2N1T D;  4N78 E;  3RK2 D; 
#chains in the Genus database with same CATH topology
 3EQ2 A;  5APU A;  2R32 A;  2I1K A;  4C7R A;  2WZ7 A;  1USE A;  1KYO E;  1PP9 E;  4OGQ B;  4YPC A;  2WT7 B;  2D2C B;  1NU1 E;  2JEE A;  4JF7 A;  2B87 A;  3B5N B;  2FFD B;  1KB9 I;  4AYC A;  3Q5P A;  3RK2 B;  1URQ B;  2WPQ A;  4KT0 J;  1RH5 B;  4L74 A;  5CCG D;  1LJ2 A;  4R4L A;  3H1J E;  1N73 A;  5TIS H;  1QL1 A;  1BE3 E;  2JKV A;  1JMM A;  5AVX B;  1NO4 A;  1NTK E;  5KLV J;  4RKU J;  4W7Z A;  5AW0 B;  5KJ7 C;  1L4A A;  2Y0D A;  3SSU A;  2A06 E;  1HVV A;  3H1K D;  3KZI E;  1KIL B;  2OQQ A;  3CL3 D;  2PAJ A;  1IO4 A;  2AEM A;  4Y28 J;  1RHZ B;  1DEB A;  2FBW C;  3EWK A;  2M5A B;  3AE1 C;  4MN4 C;  4Y99 C;  3H1I J;  1MUU A;  1LTG C;  1LTS C;  1LWU B;  1KB9 D;  1VF5 C;  3MUD C;  3H32 A;  2YIU B;  3WUU A;  4U3F E;  1U7J A;  4RO0 A;  2H43 A;  2KZJ A;  4W80 A;  2LXB A;  1SFC C;  3RGU A;  1J1D C;  3MP7 B;  5H2F H;  3BRV B;  3RBX A;  2E76 D;  1PZQ A;  1OMI A;  1J1E B;  1LTJ B;  1QX8 A;  3L71 D;  3TGU J;  2GM4 A;  3UIA A;  3O8Z A;  3MIW A;  3AEB C;  1WMK A;  3BAS A;  1NTM K;  1RQU A;  3KHU A;  2ITA A;  2Q6Q A;  1N86 A;  1KQL A;  3AEA C;  2E75 D;  1SS1 A;  1Y8A A;  4OGQ D;  1DH3 A;  3MTU E;  3CXH E;  2FYU K;  3A0H H;  1VQ5 P;  1IFI A;  1NJI Q;  5CBO A;  1FAV A;  3V2R A;  2HFE D;  4C7N A;  2RKL A;  1PFI A;  2IZ0 A;  1L0L G;  1E5W A;  3GF7 A;  2KXP B;  2AEF A;  1VQO P;  1T3U A;  1BCC E;  5APW A;  5KAI E;  5CCH C;  5B5E E;  3PHL A;  3IFM A;  3LW5 J;  1AVY A;  1FZA A;  1JMB A;  5B66 E;  2KNC B;  5BVZ A;  1SQV G;  2VRS A;  1L0N G;  4DJG A;  2CPB A;  1DX7 A;  1S1C X;  1L4A C;  3FWL A;  3B5N A;  3HUS A;  3PRJ A;  1LP1 B;  3IF4 A;  1URQ A;  3GHG C;  1JY3 P;  1NTM J;  1NU1 K;  2KLV A;  4PD4 E;  2HOD B;  2POH A;  2ZVO B;  3CMA P;  2QVA A;  2HYN A;  5K5G B;  3H1H J;  1IFJ A;  2FYU J;  1ZXG A;  4D6T D;  4GOE A;  2B9B A;  3CCE P;  3NMD A;  1D7M A;  3W68 A;  3A5T A;  1HGV A;  1ZOY C;  1SQQ E;  4TLF A;  1NTK K;  2WTY A;  1KIL A;  2Y0C A;  4U7J A;  4Y99 B;  3L72 J;  2XND H;  1PL5 A;  3CCJ P;  4IL6 X;  1VF5 B;  3L70 J;  1VQ8 P;  2M5A A;  1FBM A;  2AEJ A;  2WSC H;  4HKZ H;  5AW4 B;  3BCC D;  3HE4 B;  2G3A A;  3CCV P;  1SFC B;  2IPP A;  1J2J B;  4L73 A;  3FX0 A;  3IAO A;  5C39 A;  2P67 A;  1PP9 J;  5GTI E;  1J1D B;  2DW3 A;  2IBZ I;  1SQB D;  3R2P A;  1NU1 J;  4JQ0 D;  2O01 J;  1GU5 A;  1N7S C;  2OYO A;  1MZ9 A;  2SPZ A;  3H1L E;  3CX5 H;  3L74 D;  3QWO C;  1HGZ A;  1BGY D;  1ZR2 A;  4IFF A;  1VDF A;  1LTJ A;  1X79 B;  3H1J J;  3CD6 P;  1EXJ A;  3U1C A;  1JO5 A;  2WPR A;  4IL6 E;  1K73 Q;  2PGD A;  1FU1 A;  1NTK J;  1S4X A;  1M8O B;  2ZVN B;  3G6E P;  1T3J A;  3JCU H;  4Z1M H;  2B87 B;  1EZV E;  5APS A;  1DEE G;  4JBZ A;  2YNY A;  2KB7 P;  1NGM B;  2ZFC A;  1EDI A;  1K04 A;  3CI9 A;  2P7J A;  3CWB G;  3HUS C;  5GTH H;  1KB9 E;  1S9K D;  1VQM P;  5KAF E;  2BCC D;  2IBZ D;  3S9O A;  2NPS C;  2Z4E A;  1OWA A;  2KSE A;  3M0A A;  4U3F J;  5KJ7 D;  3L73 G;  1X9V A;  2M3E A;  3K5B A;  1L4A B;  1HJ0 A;  2QJK C;  2RN0 A;  1T2K C;  2KNC A;  2K9Y A;  3GHG B;  1NOH A;  3VYI A;  5AVQ B;  2R44 A;  4I7Z C;  3A2A A;  2PRR A;  3L71 E;  3BAT A;  1YTZ T;  1LP1 A;  1GL2 A;  3C8V A;  2Z5H A;  2K9J B;  2QE7 H;  4HH2 A;  3OAK A;  2HOD A;  2GUS A;  3BCC G;  3HE5 B;  2BAS A;  3OJA B;  5CJ4 A;  2Q1K A;  3RK3 E;  1RY3 A;  1SFC D;  3TYY A;  2IFM A;  1GW4 A;  1BE3 G;  3M9B A;  5KTB A;  4H44 C;  1GDT A;  1NTM E;  2QM7 A;  1RQV A;  2WIT A;  2J58 A;  3MUD A;  1JY2 P;  1SQQ K;  3L75 D;  3M0D C;  1E79 H;  1BCC J;  2A06 G;  1YIJ P;  1XTG B;  1KMI Z;  3Q5S A;  2FYU E;  2AXT E;  1WT6 A;  1FOS E;  2M3B A;  1JEK A;  3RL0 C;  1N7S B;  1FJK A;  2N9B A;  2WMM A;  1P84 H;  4WY4 A;  1QVG O;  2BCC G;  5AVV B;  3A0B E;  3L37 A;  4GOD A;  1JOC A;  1JM0 A;  1CSB A;  1GU4 A;  3CCM P;  1MFT A;  2OYI C;  3LW5 H;  2WSE J;  2IDB A;  1OVR A;  1LTI C;  1JTH B;  1L4A D;  3CCQ P;  3O6Q B;  2WVR A;  4UB8 H;  3HUS B;  4NPE A;  3KYQ A;  1OXZ A;  2CK3 H;  2Q3I A;  1SQQ J;  1JB0 J;  2PP6 A;  4WWI A;  3U1A A;  2OTL P;  3FGA D;  5CCH A;  2KOG A;  1GL2 C;  2NPS B;  3D6Y A;  2QJP C;  3A3Y B;  2RH0 A;  1IFP A;  5AVY B;  1L0L D;  1EDL A;  3L35 A;  4R4M A;  1PV3 A;  1H88 A;  1SQX G;  2QJK B;  1KD1 Q;  3AE4 C;  2E43 A;  1EQ7 A;  1PGP A;  4I7Z B;  4IFD K;  4AUW A;  2KYV A;  1CI6 B;  3U59 A;  3AE6 C;  4BXL A;  3L74 E;  3V6I A;  3G71 P;  2P10 A;  2ZT9 C;  1BGY E;  1P84 I;  1YJN P;  3GHG A;  1MKM A;  4GKG A;  1SQV D;  4PJ0 E;  1L0N D;  3H1L J;  3H6P A;  3HRN A;  2ZYA A;  3CC2 P;  1DD3 A;  1FDI A;  3L75 G;  4WBA A;  4H0L C;  3EFF K;  4XA4 A;  3PLN A;  2K9J A;  2FKW B;  2QA4 P;  2N1T A;  3WU2 H;  2HLO A;  1VQN P;  3M9Q A;  1OVV A;  3B71 A;  3HE5 A;  1JY3 O;  5AW8 B;  4W7Y A;  3E1R A;  1L2P A;  2XV5 A;  4I1L A;  4H13 D;  3WMM 0;  3VOP A;  3H1K J;  4DCK A;  4H44 B;  3AE5 C;  1N7S D;  3TGU D;  1KYO H;  2K37 A;  1KZU B;  1FE6 A;  2C9L Y;  2NRG A;  2IBZ E;  1FZC A;  2Q7C A;  1KOR A;  1SP4 A;  4OH8 B;  2O01 H;  3HD7 A;  5DJT B;  4WY4 C;  3CME P;  1RE4 C;  1UIX A;  4PV1 D;  1NTZ E;  1P84 D;  5APX A;  2J59 M;  2Y9Z A;  1PPJ G;  4ZKP A;  1S2E A;  4N3Y B;  2IX7 C;  3RL0 B;  4EOT A;  3P8C E;  4IFM A;  4XE5 B;  3WUV A;  4UB6 E;  2H89 C;  2KS1 B;  3VMY A;  1VQK P;  1N7S A;  3I55 P;  4OWF A;  2D2C D;  3ABV C;  2YMY A;  3B5N D;  3G9R A;  4N78 E;  2C0X A;  3L71 J;  4DOJ A;  5KLV G;  3RK2 D;  1URQ D;  1LTT C;  3AEE C;  2WSS H;  1ZRT D;  1GD2 E;  1QGK B;  2WSF J;  1YYC A;  2YKQ A;  3CC7 P;  1H0T B;  1GK4 A;  4AQR D;  2OYI B;  5KLI C;  1SQP E;  3I56 P;  2RMZ A;  1FOS F;  1JNM A;  2OTK E;  1M90 Q;  2JR8 A;  3P7K A;  1T2K D;  3H1I G;  4ZKU A;  2KSJ A;  4EYY Q;  5EFW B;  3VN0 A;  1JTH A;  3M9H A;  1ZR4 A;  2IFN A;  3O6Q A;  1KIL D;  2Y0E A;  1GL2 B;  2E74 C;  2QJP B;  4XFJ A;  3KQG A;  3H1H D;  2W6A A;  1RF0 A;  1JY3 N;  3CWB D;  2NPS A;  1SVF A;  4HYT B;  1EC5 A;  4YXW H;  3SWY A;  2N1T C;  1AV1 A;  1KFN A;  3KPE A;  1G1J A;  1RF1 C;  1GZL A;  2ZT9 B;  5CCG C;  1U7M A;  3TGU G;  5APV A;  3L73 D;  4KJM A;  1CI6 A;  4LC1 A;  1PGO A;  5KKZ C;  4H0L B;  2KUB A;  1IFN A;  1FZC C;  3TNU B;  3GLM A;  3HD7 C;  3B4S A;  2L91 A;  3G4S P;  1Z56 A;  4YXD C;  3TK1 A;  1KYO D;  1W2E A;  4RJT A;  3V2Q A;  5KAI H;  3F5H A;  5B5E H;  4RES B;  2R5B A;  4N6J A;  3N7N A;  4WB4 A;  1OZH A;  3CCR P;  2YXQ B;  5B66 H;  3BRT B;  1S5L X;  1TU3 F;  1VQ7 P;  4WY4 B;  1VL2 A;  2L5G B;  2I1J A;  1BE3 D;  1PGJ A;  3M0D A;  1LT1 A;  3A7O A;  1OFC X;  3CCL P;  2FYN C;  3Q2Y A;  5AVU B;  1SLQ A;  4PD4 H;  1NAY A;  5AW6 B;  2A06 D;  3AED C;  1JY2 O;  1NTM G;  1PIX A;  3H1K E;  2JJL A;  1DD4 A;  1NTZ K;  1T6A A;  4ZMD A;  2H88 C;  3VP9 A;  1DIP A;  1Q7Y Q;  2KS1 A;  2O1J A;  3L74 J;  1JUN A;  1AJY A;  1BGY J;  3FWN A;  3H1H G;  2FYU G;  3JSV C;  1NKN A;  4BWN A;  1GL2 D;  5KLI B;  2Q9I A;  2E75 C;  4U3F D;  1NHL A;  1S5L E;  1GMJ A;  3E1I A;  1W2B O;  1HF9 A;  1H0T A;  1RF0 C;  3GF3 A;  2IYP A;  5DJU B;  2OYI A;  3MGN A;  2W27 A;  3RK3 C;  3L72 G;  1GW3 A;  4B86 A;  2XZR A;  3L70 G;  2ZT9 D;  3OW2 O;  4EIJ A;  5E79 E;  1LNQ A;  2E74 B;  1SQP K;  3PTZ A;  5GTI H;  3SWK A;  3CX5 I;  3TSI A;  2ZYG A;  2XNX A;  1IJD B;  2K3R A;  5AVZ B;  2E5Y A;  1PP9 G;  2NZ2 A;  2QJY C;  4CPG A;  1FZE A;  2N1T B;  1VF5 D;  1NU1 G;  1RF1 B;  1NTZ J;  3WUT A;  1Y9B A;  4PD4 I;  3AE3 C;  1YQ3 C;  3IN6 A;  2OYH B;  1SQX D;  3ZDM A;  1Q81 Q;  3L36 A;  5KKZ B;  3H1J G;  4IL6 H;  1IK7 A;  2Y9Y A;  3W67 A;  2ZJS E;  2H7H A;  3N4X A;  4C46 A;  4GIF A;  1FZC B;  1AA0 A;  1BCC D;  2JDI H;  3HD7 B;  1N8R Q;  4WY4 D;  4O9B A;  4EI2 A;  1NTK G;  2WQY C;  3AE8 C;  2AXC A;  3HTK B;  3TNU A;  1VQ4 P;  1KB9 H;  2MJZ A;  1JY2 N;  5KAF H;  2OAR A;  3CX5 D;  5AW2 B;  2N9Y B;  1SQP J;  5TIS E;  1MFZ A;  1G2C B;  1Q86 Q;  1M1J A;  1VQL P;  4HB1 A;  1LGH B;  1PGQ A;  4PD4 D;  1KQS O;  5M1B A;  2E42 A;  3CWB E;  4LGD E;  3E7K A;  2JP3 A;  4U3F G;  1RE4 A;  1YIT P;  2FYN B;  1KQF B;  5CCH D;  2V7Q J;  2K88 A;  3L4F A;  1G1I A;  2WSF H;  1BSH A;  4D6T E;  1L0L K;  3L73 E;  4L75 A;  2JWD A;  1PPJ D;  1HWT C;  2W8Z A;  5CHX A;  4IOI H;  1ZLL A;  1AVO A;  2V4H A;  3D70 A;  3LIE A;  1M56 D;  1IZN B;  2WPV B;  1HUC A;  4L76 A;  5L8R J;  1KV4 A;  2E74 D;  1QLE D;  2E75 B;  1EZV I;  3VP8 A;  3TDK A;  1Q2N A;  1SQV K;  1L0N K;  5H2F E;  1UII A;  4M3L A;  5KLV D;  5CJ0 A;  2A45 G;  3BCC E;  3RK3 B;  2J5U A;  2HPC B;  1NAF A;  2N1T D;  3KXD A;  2IYO A;  1M7L A;  1K9M Q;  1NYH A;  5AVW B;  3T97 B;  1QL2 A;  2FXM A;  1SQB E;  2QG4 A;  1AFO A;  2P1J A;  3H1L D;  5TJH A;  1AQT A;  1BSN A;  5AVT B;  2AXT H;  1BCC G;  1FC2 C;  1YJW P;  3MD0 A;  4HJG H;  3H1I D;  2M0B A;  2PFX A;  1SQP G;  2QJY B;  3P32 A;  2MKV A;  3HD7 D;  5APT A;  1L0L J;  3A0H E;  1FDO A;  2C9N Y;  2LXC B;  2W90 A;  3S4R A;  1FZG A;  2GA1 A;  3A0B H;  1RF1 A;  1HH0 A;  1LT9 A;  5CCG A;  1EZV D;  1OW7 A;  2HG5 D;  2QM8 A;  3Q3D A;  1FZB A;  1S3J A;  2OYH A;  1CW5 A;  2UWJ E;  3SFD C;  1SQV J;  1L0N J;  4QMA A;  4BRY B;  1M1J C;  4KHX A;  2JWA A;  1S9K E;  2BCC E;  1OX3 A;  2I8D A;  2W6J H;  1YJ9 P;  2GUV A;  2QSI A;  3V2P A;  4EDF A;  4JYC A;  2W6B A;  2OGU A;  2ZAE B;  2B88 A;  1W5C E;  3HTK A;  1M57 D;  3MZW B;  2M8R A;  1SQQ G;  1USD A;  3JC2 2;  1YTZ I;  2P2U A;  2E5T A;  3OA7 A;  2Q3E A;  3AE9 C;  1G2C A;  3Q5R A;  1QVF O;  1N2D C;  3NTN A;  3M06 A;  4ASW A;  1LTA C;  2H8P D;  5AW3 B;  3SWF A;  3P8M C;  3AE7 C;  1RE3 A;  3ITK A;  3KZI H;  1EXI A;  4PJ0 H;  3EFG A;  1R5L A;  2QIW A;  2OTJ P;  2NPS D;  1Y47 A;  3RK3 D;  2FXO A;  1MV8 A;  3V4W A;  1SQX E;  2KI7 B;  2YO2 A;  3H1L G;  2KLU A;  5AVS B;  5AW5 B;  2FXP A;  2C0W A;  1R5S A;  3RL0 g;  1IFD A;  1NTM D;  4NPF X;  1ZN5 A;  1FZF A;  3RBZ A;  1VQ6 P;  1KYO I;  1N73 C;  2R5D A;  5CMZ A;  1X0T A;  2LKM A;  4DZO A;  3PH0 A;  3L75 E;  1NKZ B;  4K3A A;  3H1K G;  2FYU D;  3CX5 E;  3H25 A;  1OVU A;  2WT7 A;  4ASV A;  3I5C A;  1VQ9 P;  1EZV G;  1U57 A;  4I2L C;  2HPC A;  2FFD A;  1X8Y A;  3VMZ A;  1OIP A;  1KC8 Q;  1LTB C;  3T97 A;  1LT9 C;  3L72 D;  2BEQ D;  2XDJ A;  2ZXX A;  5AW7 B;  3D71 A;  1IC2 A;  3L70 D;  2OYH C;  4H44 D;  4UB6 H;  3NXS A;  1HJB A;  2A45 H;  1SQB K;  3JCU E;  5CBN A;  2KIK A;  1K8A Q;  3IR9 A;  2YKP A;  3CXH H;  3CWB J;  1FJP A;  2K1A A;  3FXD A;  5GTH E;  1PP9 D;  1PPJ E;  4OVN F;  3VMA A;  2KP8 A;  3C9I A;  1NU1 D;  1N7L A;  3L71 G;  4D6T J;  1AQ5 A;  3FXE A;  1JCC A;  5BU8 B;  3R4Y A;  3L73 J;  3RL0 D;  1NVO A;  1M1J B;  5AVR B;  1IFM A;  1ZP0 C;  1LWU A;  3H1J D;  2FY8 A;  4BRY A;  3CCU P;  5KLV E;  4YTP C;  3KDP B;  1L0L E;  1S72 P;  1CZQ A;  4H13 C;  1NTK D;  1RE3 C;  3VMX A;  1M1K Q;  3BCC J;  3S1K A;  2HR3 A;  2V7Q H;  1FDM A;  1HTL C;  1A02 F;  4ZNC A;  1BDD A;  4JYB A;  3V4Q A;  1SQB J;  2YMK A;  3H1I E;  1NH4 A;  2E76 C;  1SQV E;  1L0N E;  3AEG C;  2Z5I A;  1BDC A;  4PV1 C;  2WSE H;  1Q90 D;  1BE3 J;  1EDK A;  3NFQ A;  3CPW O;  1T8Z A;  2A45 I;  1K05 A;  1VPC A;  5AW9 B;  2W83 C;  2R3S A;  3GG2 A;  3CXH I;  2KK7 A;  3V5B A;  2ZXE B;  3MHV A;  1YBK A;  4OGQ C;  2XU6 A;  1GTW A;  3B8E B;  2D2C C;  3GW6 A;  2IZ1 A;  2Q5U A;  3B5N C;  1ZME C;  2FFD C;  3USS A;  1KQG B;  3RK2 C;  1URQ C;  3TGU E;  4K35 A;  1A02 J;  1N73 B;  1YQ4 C;  1SQX K;  3C1L A;  1YI2 P;  3AEC C;  1QEX A;  4D6T G;  1NTZ D;  1WRG A;  3AE2 C;  4JPZ B;  2BCC J;  1HBW A;  1H89 A;  2FYZ A;  4H0L D;  1P84 E;  2P58 A;  1YHQ P;  1X22 A;  3P8C D;  3SFE C;  1OW8 A;  2WWW A;  3F89 A;  1LT9 B;  4GT1 A;  3V2N A;  3Q1M A;  3CXH D;  1KIL C;  2JO1 A;  1OW6 A;  4N78 D;  3TF5 A;  3CC4 P;  1NWQ A;  2O1K A;  4LLH A;  4WVZ A;  3H32 B;  4GOF A;  1ZRT E;  3VTP C;  3PP5 A;  5KJ7 A;  1LWU C;  5AW1 B;  3G3Z A;  3QH9 A;  1SQB G;  4UB8 E;  2ZYD A;  1SQP D;  3GMA A;  3AEF C;  2YXR B;  3PJS K;  2YIU C;  4I6M C;  3CCS P;  5BU5 A;  2R3C A;  3L74 G;  5APQ A;  2B89 A;  1BGY G;  1GK6 A;  1H8A A;  2CPS A;  1KTM A;  1SQX J;  1S5L H;  2O01 N;  2WSC J;  2QEX P;  1R8E A;  2QRX A;  1KIL E;  2O3J A;  1J1E C;  1LTJ C;  1FS0 E;  1KN7 A;  3H1H E;  4H13 B;  2G8Y A;  5E79 H;  2XKM A;  3M91 A;  1ZW0 A;  3HE4 A;  3L75 J;  1SFC A;  4NPD A;  2YO3 A;  1Q82 Q;  3II6 A;  1EDJ A;  2KZI A;  1IK9 A;  1VQP P;  4TT3 H;  1ZV8 A;  2WPS A;  2YKO A;  5KLV K;  5APY A;  3BVH A;  3CLQ A;  3L72 E;  2E76 B;  2IBZ G;  4C7N B;  3WU2 E;  1SQQ D;  3L70 E;  4PV1 B;  1KFM A;  3D6Z A;  2LR2 A;  1XTC C;  4A7P A;  1JCD A;  3LID A;  4DT0 A;  1NTZ G;  4GDO A;  2BEZ F; 
#chains in the Genus database with same CATH homology
 1YTZ I;  3EQ2 A;  5APU A;  1T2K C;  2P2U A;  3TNU B;  3HD7 C;  3GHG B;  2R32 A;  1NOH A;  2I1K A;  3OA7 A;  4C7R A;  3VYI A;  2WZ7 A;  5AVQ B;  1Z56 A;  3TK1 A;  3A2A A;  1G2C A;  1W2E A;  3BAT A;  1N2D C;  1YTZ T;  3NTN A;  3M06 A;  1GL2 A;  2WT7 B;  3V2Q A;  1LTA C;  2H8P D;  2JEE A;  2Z5H A;  4JF7 A;  5AW3 B;  4HH2 A;  3SWF A;  3B5N B;  3P8M C;  4RES B;  3OAK A;  2FFD B;  4AYC A;  2HOD A;  3RK2 B;  2GUS A;  1URQ B;  2R5B A;  2WPQ A;  4N6J A;  3HE5 B;  3N7N A;  4WB4 A;  1RE3 A;  2BAS A;  3OJA B;  5CCG D;  3BRT B;  5CJ4 A;  3EFG A;  4WY4 B;  2L5G B;  2NPS D;  1N73 A;  2I1J A;  3RK3 D;  1QL1 A;  1MV8 A;  3V4W A;  1RY3 A;  1SFC D;  3TYY A;  2IFM A;  2YO2 A;  1JMM A;  5AVS B;  3M0D A;  5AW5 B;  2C0W A;  1GW4 A;  3A7O A;  3M9B A;  5AVX B;  1NO4 A;  5KTB A;  1IFD A;  4W7Z A;  5AW0 B;  5AVU B;  1ZN5 A;  1SLQ A;  5KJ7 C;  1GDT A;  5AW6 B;  1FZF A;  2QM7 A;  1L4A A;  1N73 C;  2R5D A;  2WIT A;  2J58 A;  1HVV A;  1JY2 O;  1KIL B;  3MUD A;  5CMZ A;  1JY2 P;  2LKM A;  2JJL A;  1SQQ K;  3M0D C;  4DZO A;  3CL3 D;  1NTZ K;  2PAJ A;  1IO4 A;  1NKZ B;  3VP9 A;  1XTG B;  1DEB A;  2O1J A;  1JUN A;  2WT7 A;  3I5C A;  1WT6 A;  4Y99 C;  1MUU A;  1LTG C;  4I2L C;  2HPC A;  2FFD A;  1FOS E;  2M3B A;  1LTS C;  1X8Y A;  1LWU B;  3VMZ A;  3RL0 C;  1N7S B;  1NKN A;  1FJK A;  1GL2 D;  2N9B A;  3H32 A;  2Q9I A;  1LTB C;  1NHL A;  3T97 A;  1LT9 C;  3E1I A;  4WY4 A;  2XDJ A;  2H43 A;  1RF0 C;  5AVV B;  5AW7 B;  2OYI A;  1IC2 A;  3L37 A;  3MGN A;  4W80 A;  2W27 A;  3RK3 C;  2OYH C;  1GW3 A;  3NXS A;  1SFC C;  4B86 A;  1HJB A;  2A45 H;  1SQB K;  1J1D C;  1JOC A;  2XZR A;  3IR9 A;  2YKP A;  3BRV B;  1CSB A;  1GU4 A;  1FJP A;  4EIJ A;  1SQP K;  1J1E B;  1LTJ B;  2GM4 A;  2OYI C;  3UIA A;  3O8Z A;  3MIW A;  3TSI A;  3LW5 H;  2XNX A;  1IJD B;  1LTI C;  2KP8 A;  3C9I A;  1N7L A;  1AQ5 A;  3BAS A;  5AVZ B;  1JTH B;  1L4A D;  1JCC A;  1NTM K;  1FZE A;  5BU8 B;  2N1T B;  3HUS B;  3RL0 D;  3KYQ A;  1OXZ A;  2Q3I A;  1M1J B;  1RF1 B;  1N86 A;  5AVR B;  1KQL A;  1IFM A;  2PP6 A;  3U1A A;  1LWU A;  1DH3 A;  5CCH A;  2KOG A;  3MTU E;  1GL2 C;  2NPS B;  2OYH B;  3A3Y B;  2FYU K;  5AVY B;  1IFI A;  3KDP B;  3L36 A;  1CZQ A;  3L35 A;  1FAV A;  3V2R A;  2HFE D;  1H88 A;  4C7N A;  1PFI A;  2H7H A;  1E5W A;  3N4X A;  1RE3 C;  3VMX A;  4C46 A;  4GIF A;  1FZC B;  3HD7 B;  1EQ7 A;  2E43 A;  1T3U A;  5APW A;  4WY4 D;  5CCH C;  4O9B A;  4IFD K;  4AUW A;  2KYV A;  1FDM A;  1CI6 B;  3U59 A;  1HTL C;  1A02 F;  3IFM A;  1FZA A;  3HTK B;  4JYB A;  3TNU A;  3V4Q A;  3GHG A;  4GKG A;  1NH4 A;  3H6P A;  2MJZ A;  1JY2 N;  3HRN A;  2OAR A;  2Z5I A;  5AW2 B;  2WSE H;  3NFQ A;  5BVZ A;  2VRS A;  1MFZ A;  4WBA A;  1T8Z A;  2CPB A;  4XA4 A;  1DX7 A;  2A45 I;  1G2C B;  2FKW B;  1VPC A;  5AW9 B;  1L4A C;  3B5N A;  2N1T A;  3HUS A;  2HLO A;  3V5B A;  3M9Q A;  1URQ A;  1M1J A;  3GHG C;  3HE5 A;  2ZXE B;  1JY3 O;  5AW8 B;  4W7Y A;  1JY3 P;  1LGH B;  1NU1 K;  2KLV A;  2HOD B;  2XV5 A;  2POH A;  4I1L A;  2XU6 A;  1GTW A;  3WMM 0;  2E42 A;  3VOP A;  3B8E B;  4LGD E;  1RE4 A;  2Q5U A;  3B5N C;  2FFD C;  1N7S D;  5CCH D;  3RK2 C;  1URQ C;  1KZU B;  2HYN A;  1A02 J;  1N73 B;  1IFJ A;  2C9L Y;  3L4F A;  1G1I A;  1FZC A;  2Q7C A;  1SP4 A;  4OH8 B;  2WSF H;  2O01 H;  3HD7 A;  1SQX K;  1L0L K;  4WY4 C;  3NMD A;  3A5T A;  1HGV A;  1RE4 C;  1HWT C;  1WRG A;  5CHX A;  1ZLL A;  1HBW A;  2WTY A;  1NTK K;  1H89 A;  1KIL A;  2FYZ A;  5APX A;  2J59 M;  4Y99 B;  3LIE A;  4ZKP A;  4N3Y B;  2IX7 C;  3P8C D;  1HUC A;  3RL0 B;  4EOT A;  3P8C E;  4IFM A;  4XE5 B;  2WWW A;  1LT9 B;  3VP8 A;  1FBM A;  4GT1 A;  2WSC H;  3VMY A;  1SQV K;  3V2N A;  1L0N K;  1N7S A;  5AW4 B;  1KIL C;  4M3L A;  5CJ0 A;  2A45 G;  3HE4 B;  2YMY A;  3RK3 B;  2HPC B;  4N78 D;  3B5N D;  1SFC B;  2IPP A;  1J2J B;  1NAF A;  2N1T D;  4N78 E;  2C0X A;  1NWQ A;  4DOJ A;  2O1K A;  3RK2 D;  1URQ D;  1LTT C;  2P67 A;  4LLH A;  1J1D B;  1M7L A;  5AVW B;  3H32 B;  1GD2 E;  1QL2 A;  3VTP C;  3R2P A;  2FXM A;  1YYC A;  3PP5 A;  1AFO A;  1GU5 A;  2YKQ A;  2P1J A;  5KJ7 A;  1LWU C;  5AW1 B;  1GK4 A;  1N7S C;  1MZ9 A;  3G3Z A;  4AQR D;  2OYI B;  5AVT B;  1HGZ A;  1ZR2 A;  4I6M C;  4IFF A;  3MD0 A;  5BU5 A;  2R3C A;  1VDF A;  1FOS F;  5APQ A;  1LTJ A;  1X79 B;  1JNM A;  1GK6 A;  3U1C A;  1H8A A;  3P7K A;  3P32 A;  2CPS A;  1T2K D;  1JO5 A;  3HD7 D;  5APT A;  4ZKU A;  2KSJ A;  2C9N Y;  3VN0 A;  2WPR A;  1JTH A;  3M9H A;  1ZR4 A;  2IFN A;  1FZG A;  1FU1 A;  1KIL D;  1GL2 B;  1RF1 A;  1J1E C;  1HH0 A;  1LT9 A;  1LTJ C;  5CCG A;  1T3J A;  2HG5 D;  2QM8 A;  3KQG A;  5APS A;  2W6A A;  1RF0 A;  2YNY A;  1JY3 N;  2KB7 P;  1FZB A;  2NPS A;  2XKM A;  3M91 A;  2OYH A;  3HE4 A;  1CW5 A;  2ZFC A;  1SVF A;  4HYT B;  1SFC A;  2YO3 A;  3CI9 A;  3SWY A;  3II6 A;  2P7J A;  2N1T C;  1KFN A;  3HUS C;  3KPE A;  1IK9 A;  1S9K D;  1M1J C;  1G1J A;  1RF1 C;  4KHX A;  1GZL A;  1S9K E;  1ZV8 A;  2WPS A;  5CCG C;  2YKO A;  5KLV K;  5APY A;  2GUV A;  3BVH A;  3CLQ A;  3V2P A;  4JYC A;  2W6B A;  5APV A;  4C7N B;  1CI6 A;  2NPS C;  2Z4E A;  4LC1 A;  1KFM A;  1OWA A;  3M0A A;  1XTC C;  3HTK A;  5KJ7 D;  1JCD A;  2M8R A;  3LID A;  1X9V A;  1IFN A;  1L4A B;  1FZC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...