1URQB

Crystal structure of neuronal q-snares in complex with r-snare motif of tomosyn
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
64
structure length
64
Chain Sequence
ETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Inhibitory Role of Tomosyn in Exocytosis
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords M-TOMOSYN ISOFORM
total genus 30
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2003-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1urqB00
2YMYA 1KILD 2KOGA 2NPSA 1URQC 4LGDE 1URQB 5KJ7A 5CCGD 3PP5A 1KILA 2XDJA 3RK2D 1SFCD 1GL2A 1L4AD 2NPSB 2HG5D 2N1TA 2N1TC 3P8CE 3HD7D 3RK3D 2N1TB 1GL2C 1L4AA 1SFCA 5CCHC 3RK2C 2N1TD 3VOPA 1JTHA 2PP6A 5CCHD 3RK2B 1SFCB 1JTHB 1L4AB 5KJ7C 4W80A 5CCHA 1SFCC 1T3JA 3HTKB 1L4AC 1N7SD 2NPSC 3B5NB 3RL0C 1GL2B 3RL0B 2H8PD 3B5ND 1URQD 1KILB 3RL0D 1KILC 3KYQA 4JF7A 1URQA 1N7SC 1HVVA 1GL2D 4WY4A 3RK3C 3B5NC 3HD7C 4W7YA 3HD7B 3RK3B 2WZ7A 5CCGA 4WY4B 4N78E 2NPSD 3B5NA 3HD7A 4WY4C 2HFED 4WY4D 4OH8B 4W7ZA 1N7SA 2M8RA 5KJ7D 3M0DC 1N7SB 3TSIA 1XTGB 5CCGC 1NHLA
chains in the Genus database with same CATH superfamily
5APTA 4HH2A 3AEAC 1LWUA 1QEXA 1VF5C 2J59M 2VRSA 3JCUE 1FS0E 1S3JA 1SQPJ 2QJPB 2QJYC 1PGPA 1VF5B 1SQPG 3II6A 4XE5B 1OFCX 4DT0A 3GHGC 2Z5HA 4YXDC 3L35A 1SP4A 1L0LK 1N2DC 2XZRA 3L74J 5B66E 1NU1E 1Y47A 1URQC 2IBZD 2E74C 2A06G 1EZVG 1JY3N 3TGUJ 2KP8A 2Z4EA 1LJ2A 4C7NA 1DH3A 2LXBA 2BCCG 3HUSA 5CCGD 2CK3H 2W90A 1LTBC 4I2LC 3PHLA 1FDMA 1RF1B 2AXTH 1EDLA 4D6TE 3WU2H 1BCCD 2GA1A 2WSSH 1KB9D 4D6TD 1GL2A 1HGVA 2HPCB 2E43A 4LLHA 4PV1B 3H1HD 1GMJA 2WSEH 1VQ5P 1MUUA 3CC4P 1EC5A 4LC1A 1L0NK 1U7MA 2M3BA 3TGUD 3CD6P 1BE3J 2BCCJ 2N1TC 1W2BO 3ZDMA 2HODA 1Y9BA 3L74D 2E5YA 2OYHA 1SQXJ 2Y9ZA 3GF7A 3RK3D 1JMMA 2E75B 1PP9G 3GF3A 3CCVP 2OYIC 1K73Q 3CXHI 3PRJA 4D6TG 1N73C 1MV8A 2HLOA 3L70G 2OTKE 4YXWH 3WUUA 4BRYA 3D6YA 1L0LJ 1IFDA 2KZJA 3ITKA 1M90Q 4XFJA 1RHZB 2XKMA 1SFCB 1Z56A 2D2CB 1EXIA 3G9RA 1L4AB 4L73A 1EZVE 2GUVA 3H1IE 4OGQC 3MHVA 4R4LA 1FZBA 1SFCC 1T3JA 3HTKB 4Y99C 2YXRB 4AQRD 3TK1A 1L4AC 2QVAA 3AEBC 1N7SD 1FDOA 2A06D 1S2EA 1J1DC 3L73E 1L0LE 3RBXA 4U3FE 3VMXA 1H88A 2L91A 1NTZD 1Q2NA 3H1JG 1KV4A 1ZXGA 3TGUG 1SQPE 1VQ9P 3EQ2A 1L0NE 3H1HG 3L72G 2IZ0A 1DD3A 3Q1MA 3CX5H 2PAJA 2WITA 3N4XA 1P84H 1GL2B 2N9YB 4OWFA 3A3YB 3TDKA 5K5GB 1H0TB 3CL3D 4ZMDA 1S4XA 1VQ7P 1NTMJ 4EYYQ 1VQ6P 1Q86Q 2ZVNB 2ZXEB 1RE4C 1J1EB 1RH5B 2B88A 2P58A 1ZP0C 3EFGA 1S9KE 1Q7YQ 2ZYDA 1PGOA 3L74E 3KDPB 2C9LY 1BGYJ 4DZOA 1NWQA 3V4QA 1X0TA 1BSNA 3TGUE 4DJGA 3BASA 1SQBJ 2E76B 3H1HE 3H1LD 5AVYB 2YXQB 3UIAA 3I55P 2OTJP 1N7SC 1HTLC 3H1JE 4U3FJ 2E76C 3B4SA 1BGYD 3I56P 3FX0A 1X79B 2PRRA 1HJ0A 1GL2D 1S1CX 1LTAC 1AA0A 3H1IG 2JP3A 3HD7C 3CLQA 3IR9A 3MD0A 3IN6A 3PJSK 4D6TJ 1BCCJ 1KFMA 5KLIC 3HD7B 4BWNA 2FYZA 2V7QH 5AVWB 1IO4A 1SQXK 2WSFJ 2WZ7A 4WB4A 1MFTA 1G2CA 3H32A 2W6JH 1ZLLA 4JPZB 1S9KD 2C0XA 1BE3E 2QM7A 3B5NA 2LKMA 1LGHB 2OTLP 2AEJA 1NTKJ 2XU6A 4DCKA 1FZCA 1BGYG 4NPEA 5BVZA 1N7SA 2M8RA 3L70J 3AE1C 5E79E 2CPBA 5KJ7D 2E74B 2FFDB 2Q7CA 3U1CA 1DX7A 1T3UA 2FXOA 1LT1A 1M56D 2ZFCA 3L36A 3MUDA 4I7ZB 3M06A 1K9MQ 2BASA 1JM0A 5CJ0A 4NPFX 2I8DA 1VQ4P 3HE5A 2W6BA 1NU1K 2B89A 1X22A 3H1IJ 3R4YA 1A02F 3KXDA 1OVUA 2FYUJ 5CCGC 2WWWA 4N3YB 1EZVI 2R5DA 1SQQG 3S4RA 2YMYA 3L73J 1SQVE 4H0LD 1YTZI 3L71E 4H44D 3SWFA 2JJLA 1AV1A 1QL2A 4GODA 2KSJA 2JO1A 4H44C 3B71A 1KILD 2YMKA 1PPJD 4H0LC 4L75A 5GTHH 3RBZA 1LNQA 2WSFH 4RJTA 2GM4A 3TNUA 5TISE 1HWTC 3H1KG 4NPDA 3G4SP 1BDCA 1NTMG 1IFIA 2KS1B 2ZT9C 2E75C 3FXEA 1OW7A 3MGNA 1VF5D 5AW2B 5DJUB 3S9OA 4ZKUA 1URQB 1LT9A 5KLVK 2YKPA 3AE2C 1SQVK 4EOTA 1D7MA 4L74A 2Q9IA 1KILA 3EFFK 1RF0C 1M57D 2KNCA 2Y0CA 1EDJA 1T2KC 1LTTC 2AEMA 2XDJA 4Z1MH 3BCCG 1SQBE 4WVZA 1IC2A 2R32A 2K1AA 4UB6H 4Y99B 1JY3O 3RL0g 2IYOA 2H89C 1SQQD 1SVFA 2HODB 2O1KA 4HYTB 3G6EP 1J1DB 1VQ8P 1GW3A 2NPSB 2N1TA 1KYOI 4PJ0E 1PPJG 1GK4A 1QLED 3H6PA 1HJBA 5AVXB 4HJGH 3CCQP 2K9YA 1ZR4A 3HD7D 2N1TB 1GL2C 1PIXA 2B9BA 4UB8E 4UB8H 3QH9A 4ZNCA 1BCCG 3SWYA 3RK2C 1KZUB 1MZ9A 2IBZG 2KXPB 4PJ0H 5GTHE 1G1IA 1YITP 3AE8C 2WTYA 1JTHB 5M1BA 1RY3A 1TU3F 3L70E 1QL1A 1S5LE 1LTIC 1T8ZA 1OIPA 2C0WA 4O9BA 5E79H 5KAIE 1YI2P 1H8AA 3E1RA 4OGQB 3L73D 1FDIA 1H0TA 1FAVA 3B8EB 4HKZH 1T2KD 4YTPC 4Y28J 2YKQA 3GHGA 3CWBG 2KS1A 1R8EA 3H1ID 1T6AA 1LWUB 1NH4A 1CSBA 3Q5SA 3LIEA 1LWUC 2Q1KA 2J58A 2YNYA 2R44A 4PD4E 1YIJP 1FOSF 1IZNB 3PLNA 1M1JC 2H8PD 1K05A 3B5ND 5APQA 4IFFA 3CMAP 2KIKA 1JMBA 2KNCB 3GW6A 2K9JB 1KILB 4U3FG 3L37A 1YJNP 1AJYA 3BVHA 1S5LH 1LT9B 1KILC 1OWAA 5TISH 2QE7H 3KYQA 4OGQD 4BXLA 1IFNA 1UIIA 2PFXA 2Q5UA 2ZYAA 1DD4A 2QEXP 1PGQA 1IFMA 1KFNA 3CCJP 1NTKD 3C8VA 3AEGC 4JF7A 1JY3P 3M9HA 1PFIA 1W2EA 1WT6A 1GZLA 3MIWA 3EWKA 4GOEA 5CHXA 5L8RJ 3VMZA 2H7HA 1W5CE 1ZOYC 5GTIH 3OA7A 5AW7B 1K8AQ 1NOHA 4XA4A 4H13B 3VP8A 3NXSA 2W8ZA 3B5NC 3CWBD 3LW5H 3RK3C 1NVOA 1EDIA 1KORA 3M91A 1NTKK 1NTKE 3P8MC 2YIUB 3RK3B 1BSHA 1SQXE 1SS1A 1YBKA 3KQGA 3CCEP 1G2CB 1JOCA 3H32B 3H1KD 2W83C 1SQBG 3SFDC 1MFZA 2AEFA 2O01N 2WQYC 1UIXA 3VMYA 2IBZE 1RF1A 3A0BE 3HD7A 2KLUA 5APVA 4RESB 4CPGA 1FZFA 2HFED 1USDA 2MKVA 2IBZI 2KB7P 1L0NG 3I5CA 3MUDC 4PD4I 3WUTA 3Q5RA 2FFDA 2WVRA 1JO5A 2AXCA 1FZCB 2WPSA 1OW6A 2CPSA 3ABVC 1HUCA 4HB1A 1E5WA 2FYUD 3L71D 3T97A 2RKLA 4EI2A 1SQVJ 2FFDC 1CZQA 3BCCD 1FZCC 3CX5D 1RE3A 2YO3A 1JUNA 3VTPC 1NTMD 2E74D 2R3SA 4RKUJ 1VL2A 1OZHA 1Q90D 2V7QJ 3TSIA 3L71G 5AVRB 1VQPP 1RF1C 3M9QA 3HRNA 2C9NY 1AQTA 3GLMA 4WBAA 1YYCA 2IFNA 1IFPA 2E76D 3V2NA 3A2AA 1NHLA 1EZVD 1OMIA 3CCMP 4C7RA 5CBNA 4ASWA 1LTGC 2GUSA 2POHA 1OVRA 3BATA 3CCLP 1HGZA 2O3JA 5KLVJ 1X9VA 4H44B 1NAFA 2KOGA 4K3AA 4EIJA 5KLVG 2NPSA 2HYNA 2Y0EA 1HBWA 4EDFA 3U1AA 2WT7B 1M1KQ 3CC2P 2FKWB 3M9BA 3L4FA 2JEEA 1NTMK 3FWNA 2M0BA 5TJHA 3H1KE 2P67A 4LGDE 1YQ4C 5AW8B 3V2QA 1KYOE 1PV3A 3CX5I 1FZEA 3V5BA 3D71A 1SQXD 1KMIZ 1ZN5A 1AVOA 2IZ1A 3H1LJ 3PP5A 1U7JA 1BE3G 4GOFA 1GW4A 1K04A 2D2CC 4U3FD 5APSA 1PGJA 1AVYA 3W68A 1NTKG 1WMKA 2QJYB 2ZT9D 2Q3EA 3WU2E 2QSIA 4AUWA 2H43A 1SQBD 1SFCD 1M1JA 2K9JA 3FGAD 3H1JJ 3L75E 1LTJB 1L4AD 1HH0A 1R5SA 1X8YA 1NU1G 3O8ZA 2QRXA 3H1LE 3VYIA 2OYIA 1VPCA 1LTSC 1M8OB 2HG5D 1LP1A 2IDBA 1KYOD 3JCUH 2YO2A 1VQMP 1YQ3C 2W27A 1KQGB 3V4WA 3FWLA 2Y9YA 2K3RA 1S5LX 4OVNF 1YHQP 1NU1D 3AEDC 2WT7A 1L4AA 1NTZJ 2HPCA 3KHUA 1SFCA 5CCHC 1KN7A 4JYCA 1GTWA 1IK9A 2N1TD 3D70A 2B87A 1KILE 1N73A 2WPVB 5C39A 1E79H 3Q5PA 2B87B 2DW3A 3E7KA 3RK2B 1GU4A 2KSEA 2O01H 1SQPD 3AEFC 1SQXG 2G8YA 2M5AA 2XNDH 3HUSC 1NTZE 3LIDA 3VN0A 5KJ7C 5KAFE 1FJKA 1JB0J 4WWIA 2OYHB 5AVVB 1L0LD 1BDDA 1KB9I 3BCCJ 3CMEP 4PV1C 2AXTE 3L71J 1NTME 1NYHA 1IFJA 2E75D 3KZIH 5KLVE 2KI7B 3JC22 3B5NB 4GT1A 5APXA 3RL0C 2E5TA 4IOIH 1VQLP 3L75G 2NRGA 2YIUC 3HE4B 4IFDK 3H1LG 2UWJE 3PH0A 3BRVB 4GDOA 3RK2D 3CXHD 3OJAB 4GKGA 5B66H 1NKNA 2YKOA 5H2FE 1URQD 5CMZA 1MKMA 3H1KJ 1FOSE 1ZW0A 3L72D 1BE3D 4GIFA 3RL0D 1RF0A 3P8CD 2Y0DA 5AVUB 1NU1J 5AW6B 3RGUA 1LT9C 1KTMA 2N9BA 3M0AA 1KYOH 1H89A 1URQA 2FY8A 2LXCB 4RO0A 2JR8A 3KZIE 3AE3C 1QX8A 1R5LA 2QIWA 4I7ZC 4JQ0D 2I1JA 3WMM0 2OGUA 1ZRTD 3D6ZA 5APUA 1BGYE 2RN0A 3NMDA 5KAIH 4WY4A 1OW8A 4L76A 1DEEG 1NTZG 3H1JD 1GK6A 2P7JA 2WSCH 3NTNA 3USSA 1KQFB 3TNUB 4H13C 1VDFA 3JSVC 2R5BA 4N6JA 5APYA 2XV5A 3SFEC 2PGDA 2O1JA 3IF4A 4JBZA 1EDKA 2SPZA 4WY4B 5CCGA 1SQVG 2JKVA 1FU1A 5GTIE 1J1EC 4I1LA 1KC8Q 2R3CA 3A0HH 3AE6C 1G1JA 3FXDA 3L72E 4H0LB 4WY4C 2IFMA 1IJDB 2JWAA 5KLVD 3V2PA 3VP9A 1FZGA 3CXHE 3C9IA 2JWDA 1CI6B 2FYUG 3HE5B 4W7ZA 3SWKA 2ZT9B 3P7KA 3M0DC 4PD4D 5APWA 3T97B 2KUBA 1FE6A 1L0ND 3E1IA 3HTKA 1CW5A 5AW1B 1P84D 1QVFO 4IL6E 3VMAA 2ITAA 4UB6E 2J5UA 5KKZB 2D2CD 1SQQK 3Q2YA 2BEZF 3V6IA 1NKZB 1XTGB 4KT0J 3CPWO 1KB9H 3AEEC 3BCCE 1ZR2A 4AYCA 1DIPA 1FJPA 1LTJC 2LR2A 2NZ2A 3F89A 3H25A 3A5TA 5AVSB 1JNMA 1NGMB 2BEQD 4IL6X 3NFQA 3SSUA 3WUVA 5BU5A 2ZXXA 5B5EH 1JY2P 2OARA 1KD1Q 2QJKB 3CCRP 2WSEJ 2A45H 4I6MC 1OXZA 2M5AB 2QJKC 1YTZT 2XNXA 1L0LG 3K5BA 3L73G 4N78D 5BU8B 1WRGA 2QA4P 5KJ7A 1FZAA 1SQPK 2KLVA 1YJWP 2FYNC 2V4HA 3F5HA 3L75J 2HR3A 5AVQB 2ZJSE 3S1KA 1RE4A 1SQQE 1FC2C 1M7LA 1PZQA 3HUSB 2BCCE 2O01J 1BCCE 2P1JA 2P2UA 1N8RQ 3CWBJ 2IX7C 2Z5IA 1S72P 2Q6QA 5AVTB 4C46A 1GD2E 4QMAA 1EXJA 1JY2N 1LP1B 2A45I 5AW3B 4A7PA 5AVZB 2QJPC 4TLFA 4B86A 2FYUK 1OVVA 3R2PA 3TF5A 2OYIB 3G71P 3GHGB 2RMZA 2WMMA 3AE5C 3P8CE 3A7OA 3P32A 1GU5A 1PP9J 2P10A 3CC7P 1IK7A 3AECC 1A02J 1N86A 5B5EE 2QG4A 5AW5B 3A0BH 4M3LA 3VOPA 3OW2O 2FXPA 1JTHA 2PP6A 1QGKB 2M3EA 3AE4C 5KLIB 3U59A 1EQ7A 5CCHD 5CBOA 3AE7C 1NTZK 3AE9C 1Q81Q 1SQVD 5CCHA 4U7JA 3G3ZA 4W80A 4ZKPA 2E42A 4BRYB 1KQLA 2IYPA 3QWOC 2A06E 1FBMA 2W6AA 3HE4A 2OYHC 2K88A 2NPSC 3MP7B 1PL5A 4YPCA 1L2PA 3L70D 3W67A 2FYUE 5EFWB 5AW4B 4R4MA 1RQVA 4KHXA 2WSCJ 3KPEA 1PP9D 3PTZA 3RL0B 3CXHH 1VQNP 3L74G 3O6QB 4PV1D 2IPPA 2KZIA 3GMAA 1SQBK 3RK3E 2WPRA 2I1KA 2OQQA 1YJ9P 2JDIH 1OX3A 1ZV8A 1RE3C 1N7LA 2L5GB 4JYBA 2Q3IA 3CCSP 3LW5J 5DJTB 1RQUA 1VQOP 3M0DA 3Q3DA 1JCCA 3L75D 1HVVA 3CWBE 4C7NB 1KB9E 2MJZA 1ZRTE 2ZAEB 2BCCD 1NAYA 1SQQJ 4IFMA 3N7NA 4IL6H 2K37A 2ZYGA 3H1HJ 2A45G 1N73B 1Y8AA 4W7YA 3O6QA 1LTJA 2OYOA 1Q82Q 3OAKA 5AW9B 1M1JB 3IAOA 1ZMEC 4MN4C 2H88C 3IFMA 1SLQA 1HF9A 2KYVA 4N78E 1DEBA 2NPSD 3TYYA 1JY2O 3A0HE 1U57A 5H2FH 4KJMA 2KK7A 2ZVOB 3MZWB 4ASVA 3CI9A 5KTBA 3BRTB 4WY4D 1AQ5A 1AFOA 3MTUE 4OH8B 2FXMA 2WPQA 1PP9E 1XTCC 1PPJE 2QM8A 5AW0B 1CI6A 4K35A 4PD4H 5CJ4A 4DOJA 5KAFH 1QVGO 4H13D 1N7SB 1J2JB 3L72J 2FBWC 3V2RA 2FYNB 1NJIQ 4TT3H 1USEA 1P84I 1GDTA 3GG2A 1NO4A 1JCDA 3C1LA 5KKZC 1KQSO 1L0NJ 2G3AA 2RH0A 3CCUP 1JEKA 1P84E 1VQKP 3CX5E
chains in the Genus database with same CATH topology
5APTA 4HH2A 1LWUA 2J59M 2VRSA 4XE5B 3II6A 3GHGC 2Z5HA 3L35A 1SP4A 1L0LK 1N2DC 2XZRA 1URQC 1JY3N 2KP8A 2Z4EA 4C7NA 1DH3A 3HUSA 5CCGD 1LTBC 4I2LC 1FDMA 1RF1B 1GL2A 1HGVA 2HPCB 2E43A 4LLHA 2WSEH 1MUUA 4LC1A 1L0NK 2M3BA 2N1TC 2HODA 2OYHA 3RK3D 1JMMA 2OYIC 1MV8A 2HLOA 1IFDA 2XKMA 1SFCB 1Z56A 1L4AB 2GUVA 1FZBA 1SFCC 1T3JA 3HTKB 4Y99C 4AQRD 5CCHA 1L4AC 1N7SD 1H88A 3VMXA 1J1DC 3EQ2A 2PAJA 2WITA 3N4XA 1GL2B 3A3YB 3CL3D 2ZXEB 1RE4C 1J1EB 3EFGA 1S9KE 3KDPB 2C9LY 4DZOA 1NWQA 3V4QA 3BASA 5AVYB 3UIAA 1N7SC 1HTLC 1X79B 1GL2D 4EOTA 1LTAC 3MD0A 3HD7C 3IR9A 3CLQA 1KFMA 3HD7B 2FYZA 1IO4A 5AVWB 1SQXK 2WZ7A 4WB4A 3H32A 1G2CA 1S9KD 1ZLLA 2C0XA 2QM7A 3B5NA 2LKMA 1LGHB 2XU6A 1FZCA 5BVZA 1N7SA 2M8RA 5KJ7D 2CPBA 2FFDB 2Q7CA 3U1CA 1DX7A 1T3UA 2ZFCA 3L36A 3MUDA 3M06A 2BASA 5CJ0A 3HE5A 2W6BA 1NU1K 1A02F 5CCGC 2WWWA 4N3YB 2R5DA 2YMYA 1YTZI 3SWFA 2JJLA 1QL2A 2KSJA 1KILD 2WSFH 2GM4A 3TNUA 1HWTC 1IFIA 3MGNA 5AW2B 4ZKUA 1URQB 1LT9A 5KLVK 2YKPA 1SQVK 1KILA 1RF0C 1T2KC 1LTTC 2XDJA 1IC2A 2R32A 4Y99B 1JY3O 2HODB 1SVFA 2O1KA 4HYTB 1J1DB 1GW3A 2NPSB 2N1TA 1GK4A 3H6PA 1HJBA 5AVXB 1ZR4A 3HD7D 2N1TB 1GL2C 3SWYA 3RK2C 1KZUB 1MZ9A 1G1IA 2WTYA 1JTHB 1RY3A 1QL1A 1LTIC 1T8ZA 2C0WA 4O9BA 1H8AA 1FAVA 3B8EB 1T2KD 2YKQA 3GHGA 1LWUB 1NH4A 1CSBA 3LIEA 1LWUC 1FOSF 2J58A 2YNYA 1M1JC 2H8PD 3B5ND 5APQA 4IFFA 1KILB 3L37A 3BVHA 1LT9B 1KILC 1OWAA 3KYQA 1IFNA 2Q5UA 1IFMA 1KFNA 4JF7A 1JY3P 3M9HA 1PFIA 1W2EA 1WT6A 1GZLA 3MIWA 5CHXA 3VMZA 2H7HA 3OA7A 5AW7B 1NOHA 4XA4A 3VP8A 3NXSA 3RK3C 3B5NC 3LW5H 2WT7A 3M91A 1NTKK 3P8MC 3RK3B 3KQGA 1G2CB 1JOCA 3H32B 1MFZA 3VMYA 1RF1A 3HD7A 5APVA 4RESB 1FZFA 2HFED 2KB7P 3I5CA 2FFDA 1JO5A 1FZCB 2WPSA 2CPSA 1HUCA 3T97A 1E5WA 2FFDC 1CZQA 1FZCC 1JUNA 1RE3A 2YO3A 3VTPC 3TSIA 5AVRB 1RF1C 3M9QA 3HRNA 2C9NY 4WBAA 2IFNA 1YYCA 3V2NA 3A2AA 1NHLA 4C7RA 1LTGC 2GUSA 2POHA 3BATA 1HGZA 1X9VA 1NAFA 2KOGA 4EIJA 1HBWA 2NPSA 2HYNA 3U1AA 2WT7B 2FKWB 3M9BA 3L4FA 2JEEA 1NTMK 2P67A 4LGDE 3V2QA 5AW8B 1FZEA 3V5BA 1ZN5A 3PP5A 1GW4A 5APSA 4AUWA 2H43A 3RK2D 1SFCD 1M1JA 1LTJB 1L4AD 1HH0A 3O8ZA 1X8YA 3VYIA 2OYIA 1VPCA 1LTSC 2HG5D 2YO2A 2W27A 3V4WA 1L4AA 2HPCA 1SFCA 5CCHC 4JYCA 1GTWA 1IK9A 2N1TD 3RK2B 1GU4A 2O01H 3HUSC 1CW5A 5KJ7C 3LIDA 3VN0A 1FJKA 2OYHB 5AVVB 1IFJA 5APXA 3B5NB 4GT1A 3RL0C 3HE4B 4IFDK 3BRVB 3OJAB 4GKGA 1NKNA 2YKOA 1FOSE 1URQD 5CMZA 4GIFA 3RL0D 1RF0A 3P8CD 5AVUB 5AW6B 1LT9C 2N9BA 3M0AA 1H89A 1URQA 3WMM0 2I1JA 5APUA 3NMDA 4WY4A 1N73C 3NTNA 1GK6A 2P7JA 2WSCH 3TNUB 1VDFA 2R5BA 4N6JA 5APYA 2XV5A 2O1JA 5CCGA 4WY4B 1FU1A 1J1EC 4I1LA 2R3CA 1G1JA 4WY4C 3VP9A 1N73A 2IFMA 1IJDB 3V2PA 1FZGA 3C9IA 1CI6B 3HE5B 4W7ZA 3TK1A 3P7KA 3M0DC 5APWA 3HTKA 3E1IA 5AW1B 1SQQK 1NKZB 1XTGB 1ZR2A 4AYCA 1FJPA 1LTJC 1JNMA 3A5TA 5AVSB 3NFQA 5BU5A 1JY2P 2OARA 2A45H 4I6MC 1OXZA 2XNXA 4N78D 1YTZT 5BU8B 1WRGA 5KJ7A 1FZAA 1SQPK 2KLVA 5AVQB 1RE4A 1M7LA 3HUSB 2P1JA 2P2UA 2IX7C 2Z5IA 4C46A 5AVTB 1GD2E 1JY2N 2A45I 5AW3B 4B86A 5AVZB 2FYUK 3R2PA 2OYIB 3GHGB 3P8CE 3A7OA 3P32A 1GU5A 1A02J 1N86A 5AW5B 4M3LA 3VOPA 1JTHA 2PP6A 3U59A 1EQ7A 5CCHD 1NTZK 4W80A 3G3ZA 4ZKPA 2E42A 1KQLA 1FBMA 2W6AA 3HE4A 2OYHC 2NPSC 5AW4B 4KHXA 3KPEA 3RL0B 2IPPA 1SQBK 2WPRA 2I1KA 1ZV8A 1RE3C 1N7LA 2L5GB 4JYBA 2Q3IA 3M0DA 1JCCA 1HVVA 4C7NB 2MJZA 4IFMA 3N7NA 2A45G 1N73B 4W7YA 1LTJA 3OAKA 5AW9B 1M1JB 3IFMA 1SLQA 2KYVA 4N78E 1DEBA 2NPSD 3TYYA 1JY2O 1AFOA 3CI9A 5KTBA 3BRTB 4WY4D 1AQ5A 3MTUE 4OH8B 2FXMA 2WPQA 1XTCC 5AW0B 2QM8A 1CI6A 5CJ4A 4DOJA 1N7SB 1J2JB 3V2RA 1GDTA 1NO4A 1JCDA 2Q9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YMY A;  1KIL D;  2KOG A;  2NPS A;  1URQ C;  4LGD E;  1URQ B;  5KJ7 A;  5CCG D;  3PP5 A;  1KIL A;  2XDJ A;  3RK2 D;  1SFC D;  1GL2 A;  1L4A D;  2NPS B;  2HG5 D;  2N1T A;  2N1T C;  3P8C E;  3HD7 D;  3RK3 D;  2N1T B;  1GL2 C;  1L4A A;  1SFC A;  5CCH C;  3RK2 C;  2N1T D;  3VOP A;  1JTH A;  2PP6 A;  5CCH D;  3RK2 B;  1SFC B;  1JTH B;  1L4A B;  5KJ7 C;  4W80 A;  5CCH A;  1SFC C;  1T3J A;  3HTK B;  1L4A C;  1N7S D;  2NPS C;  3B5N B;  3RL0 C;  1GL2 B;  3RL0 B;  2H8P D;  3B5N D;  1URQ D;  1KIL B;  3RL0 D;  1KIL C;  3KYQ A;  4JF7 A;  1URQ A;  1N7S C;  1HVV A;  1GL2 D;  4WY4 A;  3RK3 C;  3B5N C;  3HD7 C;  4W7Y A;  3HD7 B;  3RK3 B;  2WZ7 A;  5CCG A;  4WY4 B;  4N78 E;  2NPS D;  3B5N A;  3HD7 A;  4WY4 C;  2HFE D;  4WY4 D;  4OH8 B;  4W7Z A;  1N7S A;  2M8R A;  5KJ7 D;  3M0D C;  1N7S B;  3TSI A;  1XTG B;  5CCG C;  1NHL A; 
#chains in the Genus database with same CATH topology
 5APT A;  4HH2 A;  3AEA C;  1LWU A;  1QEX A;  1VF5 C;  2J59 M;  2VRS A;  3JCU E;  1FS0 E;  1S3J A;  1SQP J;  2QJP B;  2QJY C;  1PGP A;  1VF5 B;  1SQP G;  3II6 A;  4XE5 B;  1OFC X;  4DT0 A;  3GHG C;  2Z5H A;  4YXD C;  3L35 A;  1SP4 A;  1L0L K;  1N2D C;  2XZR A;  3L74 J;  5B66 E;  1NU1 E;  1Y47 A;  1URQ C;  2IBZ D;  2E74 C;  2A06 G;  1EZV G;  1JY3 N;  3TGU J;  2KP8 A;  2Z4E A;  1LJ2 A;  4C7N A;  1DH3 A;  2LXB A;  2BCC G;  3HUS A;  5CCG D;  2CK3 H;  2W90 A;  1LTB C;  4I2L C;  3PHL A;  1FDM A;  1RF1 B;  2AXT H;  1EDL A;  4D6T E;  3WU2 H;  1BCC D;  2GA1 A;  2WSS H;  1KB9 D;  4D6T D;  1GL2 A;  1HGV A;  2HPC B;  2E43 A;  4LLH A;  4PV1 B;  3H1H D;  1GMJ A;  2WSE H;  1VQ5 P;  1MUU A;  3CC4 P;  1EC5 A;  4LC1 A;  1L0N K;  1U7M A;  2M3B A;  3TGU D;  3CD6 P;  1BE3 J;  2BCC J;  2N1T C;  1W2B O;  3ZDM A;  2HOD A;  1Y9B A;  3L74 D;  2E5Y A;  2OYH A;  1SQX J;  2Y9Z A;  3GF7 A;  3RK3 D;  1JMM A;  2E75 B;  1PP9 G;  3GF3 A;  3CCV P;  2OYI C;  1K73 Q;  3CXH I;  3PRJ A;  4D6T G;  1N73 C;  1MV8 A;  2HLO A;  3L70 G;  2OTK E;  4YXW H;  3WUU A;  4BRY A;  3D6Y A;  1L0L J;  1IFD A;  2KZJ A;  3ITK A;  1M90 Q;  4XFJ A;  1RHZ B;  2XKM A;  1SFC B;  1Z56 A;  2D2C B;  1EXI A;  3G9R A;  1L4A B;  4L73 A;  1EZV E;  2GUV A;  3H1I E;  4OGQ C;  3MHV A;  4R4L A;  1FZB A;  1SFC C;  1T3J A;  3HTK B;  4Y99 C;  2YXR B;  4AQR D;  3TK1 A;  1L4A C;  2QVA A;  3AEB C;  1N7S D;  1FDO A;  2A06 D;  1S2E A;  1J1D C;  3L73 E;  1L0L E;  3RBX A;  4U3F E;  3VMX A;  1H88 A;  2L91 A;  1NTZ D;  1Q2N A;  3H1J G;  1KV4 A;  1ZXG A;  3TGU G;  1SQP E;  1VQ9 P;  3EQ2 A;  1L0N E;  3H1H G;  3L72 G;  2IZ0 A;  1DD3 A;  3Q1M A;  3CX5 H;  2PAJ A;  2WIT A;  3N4X A;  1P84 H;  1GL2 B;  2N9Y B;  4OWF A;  3A3Y B;  3TDK A;  5K5G B;  1H0T B;  3CL3 D;  4ZMD A;  1S4X A;  1VQ7 P;  1NTM J;  4EYY Q;  1VQ6 P;  1Q86 Q;  2ZVN B;  2ZXE B;  1RE4 C;  1J1E B;  1RH5 B;  2B88 A;  2P58 A;  1ZP0 C;  3EFG A;  1S9K E;  1Q7Y Q;  2ZYD A;  1PGO A;  3L74 E;  3KDP B;  2C9L Y;  1BGY J;  4DZO A;  1NWQ A;  3V4Q A;  1X0T A;  1BSN A;  3TGU E;  4DJG A;  3BAS A;  1SQB J;  2E76 B;  3H1H E;  3H1L D;  5AVY B;  2YXQ B;  3UIA A;  3I55 P;  2OTJ P;  1N7S C;  1HTL C;  3H1J E;  4U3F J;  2E76 C;  3B4S A;  1BGY D;  3I56 P;  3FX0 A;  1X79 B;  2PRR A;  1HJ0 A;  1GL2 D;  1S1C X;  1LTA C;  1AA0 A;  3H1I G;  2JP3 A;  3HD7 C;  3CLQ A;  3IR9 A;  3MD0 A;  3IN6 A;  3PJS K;  4D6T J;  1BCC J;  1KFM A;  5KLI C;  3HD7 B;  4BWN A;  2FYZ A;  2V7Q H;  5AVW B;  1IO4 A;  1SQX K;  2WSF J;  2WZ7 A;  4WB4 A;  1MFT A;  1G2C A;  3H32 A;  2W6J H;  1ZLL A;  4JPZ B;  1S9K D;  2C0X A;  1BE3 E;  2QM7 A;  3B5N A;  2LKM A;  1LGH B;  2OTL P;  2AEJ A;  1NTK J;  2XU6 A;  4DCK A;  1FZC A;  1BGY G;  4NPE A;  5BVZ A;  1N7S A;  2M8R A;  3L70 J;  3AE1 C;  5E79 E;  2CPB A;  5KJ7 D;  2E74 B;  2FFD B;  2Q7C A;  3U1C A;  1DX7 A;  1T3U A;  2FXO A;  1LT1 A;  1M56 D;  2ZFC A;  3L36 A;  3MUD A;  4I7Z B;  3M06 A;  1K9M Q;  2BAS A;  1JM0 A;  5CJ0 A;  4NPF X;  2I8D A;  1VQ4 P;  3HE5 A;  2W6B A;  1NU1 K;  2B89 A;  1X22 A;  3H1I J;  3R4Y A;  1A02 F;  3KXD A;  1OVU A;  2FYU J;  5CCG C;  2WWW A;  4N3Y B;  1EZV I;  2R5D A;  1SQQ G;  3S4R A;  2YMY A;  3L73 J;  1SQV E;  4H0L D;  1YTZ I;  3L71 E;  4H44 D;  3SWF A;  2JJL A;  1AV1 A;  1QL2 A;  4GOD A;  2KSJ A;  2JO1 A;  4H44 C;  3B71 A;  1KIL D;  2YMK A;  1PPJ D;  4H0L C;  4L75 A;  5GTH H;  3RBZ A;  1LNQ A;  2WSF H;  4RJT A;  2GM4 A;  3TNU A;  5TIS E;  1HWT C;  3H1K G;  4NPD A;  3G4S P;  1BDC A;  1NTM G;  1IFI A;  2KS1 B;  2ZT9 C;  2E75 C;  3FXE A;  1OW7 A;  3MGN A;  1VF5 D;  5AW2 B;  5DJU B;  3S9O A;  4ZKU A;  1URQ B;  1LT9 A;  5KLV K;  2YKP A;  3AE2 C;  1SQV K;  4EOT A;  1D7M A;  4L74 A;  2Q9I A;  1KIL A;  3EFF K;  1RF0 C;  1M57 D;  2KNC A;  2Y0C A;  1EDJ A;  1T2K C;  1LTT C;  2AEM A;  2XDJ A;  4Z1M H;  3BCC G;  1SQB E;  4WVZ A;  1IC2 A;  2R32 A;  2K1A A;  4UB6 H;  4Y99 B;  1JY3 O;  3RL0 g;  2IYO A;  2H89 C;  1SQQ D;  1SVF A;  2HOD B;  2O1K A;  4HYT B;  3G6E P;  1J1D B;  1VQ8 P;  1GW3 A;  2NPS B;  2N1T A;  1KYO I;  4PJ0 E;  1PPJ G;  1GK4 A;  1QLE D;  3H6P A;  1HJB A;  5AVX B;  4HJG H;  3CCQ P;  2K9Y A;  1ZR4 A;  3HD7 D;  2N1T B;  1GL2 C;  1PIX A;  2B9B A;  4UB8 E;  4UB8 H;  3QH9 A;  4ZNC A;  1BCC G;  3SWY A;  3RK2 C;  1KZU B;  1MZ9 A;  2IBZ G;  2KXP B;  4PJ0 H;  5GTH E;  1G1I A;  1YIT P;  3AE8 C;  2WTY A;  1JTH B;  5M1B A;  1RY3 A;  1TU3 F;  3L70 E;  1QL1 A;  1S5L E;  1LTI C;  1T8Z A;  1OIP A;  2C0W A;  4O9B A;  5E79 H;  5KAI E;  1YI2 P;  1H8A A;  3E1R A;  4OGQ B;  3L73 D;  1FDI A;  1H0T A;  1FAV A;  3B8E B;  4HKZ H;  1T2K D;  4YTP C;  4Y28 J;  2YKQ A;  3GHG A;  3CWB G;  2KS1 A;  1R8E A;  3H1I D;  1T6A A;  1LWU B;  1NH4 A;  1CSB A;  3Q5S A;  3LIE A;  1LWU C;  2Q1K A;  2J58 A;  2YNY A;  2R44 A;  4PD4 E;  1YIJ P;  1FOS F;  1IZN B;  3PLN A;  1M1J C;  2H8P D;  1K05 A;  3B5N D;  5APQ A;  4IFF A;  3CMA P;  2KIK A;  1JMB A;  2KNC B;  3GW6 A;  2K9J B;  1KIL B;  4U3F G;  3L37 A;  1YJN P;  1AJY A;  3BVH A;  1S5L H;  1LT9 B;  1KIL C;  1OWA A;  5TIS H;  2QE7 H;  3KYQ A;  4OGQ D;  4BXL A;  1IFN A;  1UII A;  2PFX A;  2Q5U A;  2ZYA A;  1DD4 A;  2QEX P;  1PGQ A;  1IFM A;  1KFN A;  3CCJ P;  1NTK D;  3C8V A;  3AEG C;  4JF7 A;  1JY3 P;  3M9H A;  1PFI A;  1W2E A;  1WT6 A;  1GZL A;  3MIW A;  3EWK A;  4GOE A;  5CHX A;  5L8R J;  3VMZ A;  2H7H A;  1W5C E;  1ZOY C;  5GTI H;  3OA7 A;  5AW7 B;  1K8A Q;  1NOH A;  4XA4 A;  4H13 B;  3VP8 A;  3NXS A;  2W8Z A;  3B5N C;  3CWB D;  3LW5 H;  3RK3 C;  1NVO A;  1EDI A;  1KOR A;  3M91 A;  1NTK K;  1NTK E;  3P8M C;  2YIU B;  3RK3 B;  1BSH A;  1SQX E;  1SS1 A;  1YBK A;  3KQG A;  3CCE P;  1G2C B;  1JOC A;  3H32 B;  3H1K D;  2W83 C;  1SQB G;  3SFD C;  1MFZ A;  2AEF A;  2O01 N;  2WQY C;  1UIX A;  3VMY A;  2IBZ E;  1RF1 A;  3A0B E;  3HD7 A;  2KLU A;  5APV A;  4RES B;  4CPG A;  1FZF A;  2HFE D;  1USD A;  2MKV A;  2IBZ I;  2KB7 P;  1L0N G;  3I5C A;  3MUD C;  4PD4 I;  3WUT A;  3Q5R A;  2FFD A;  2WVR A;  1JO5 A;  2AXC A;  1FZC B;  2WPS A;  1OW6 A;  2CPS A;  3ABV C;  1HUC A;  4HB1 A;  1E5W A;  2FYU D;  3L71 D;  3T97 A;  2RKL A;  4EI2 A;  1SQV J;  2FFD C;  1CZQ A;  3BCC D;  1FZC C;  3CX5 D;  1RE3 A;  2YO3 A;  1JUN A;  3VTP C;  1NTM D;  2E74 D;  2R3S A;  4RKU J;  1VL2 A;  1OZH A;  1Q90 D;  2V7Q J;  3TSI A;  3L71 G;  5AVR B;  1VQP P;  1RF1 C;  3M9Q A;  3HRN A;  2C9N Y;  1AQT A;  3GLM A;  4WBA A;  1YYC A;  2IFN A;  1IFP A;  2E76 D;  3V2N A;  3A2A A;  1NHL A;  1EZV D;  1OMI A;  3CCM P;  4C7R A;  5CBN A;  4ASW A;  1LTG C;  2GUS A;  2POH A;  1OVR A;  3BAT A;  3CCL P;  1HGZ A;  2O3J A;  5KLV J;  1X9V A;  4H44 B;  1NAF A;  2KOG A;  4K3A A;  4EIJ A;  5KLV G;  2NPS A;  2HYN A;  2Y0E A;  1HBW A;  4EDF A;  3U1A A;  2WT7 B;  1M1K Q;  3CC2 P;  2FKW B;  3M9B A;  3L4F A;  2JEE A;  1NTM K;  3FWN A;  2M0B A;  5TJH A;  3H1K E;  2P67 A;  4LGD E;  1YQ4 C;  5AW8 B;  3V2Q A;  1KYO E;  1PV3 A;  3CX5 I;  1FZE A;  3V5B A;  3D71 A;  1SQX D;  1KMI Z;  1ZN5 A;  1AVO A;  2IZ1 A;  3H1L J;  3PP5 A;  1U7J A;  1BE3 G;  4GOF A;  1GW4 A;  1K04 A;  2D2C C;  4U3F D;  5APS A;  1PGJ A;  1AVY A;  3W68 A;  1NTK G;  1WMK A;  2QJY B;  2ZT9 D;  2Q3E A;  3WU2 E;  2QSI A;  4AUW A;  2H43 A;  1SQB D;  1SFC D;  1M1J A;  2K9J A;  3FGA D;  3H1J J;  3L75 E;  1LTJ B;  1L4A D;  1HH0 A;  1R5S A;  1X8Y A;  1NU1 G;  3O8Z A;  2QRX A;  3H1L E;  3VYI A;  2OYI A;  1VPC A;  1LTS C;  1M8O B;  2HG5 D;  1LP1 A;  2IDB A;  1KYO D;  3JCU H;  2YO2 A;  1VQM P;  1YQ3 C;  2W27 A;  1KQG B;  3V4W A;  3FWL A;  2Y9Y A;  2K3R A;  1S5L X;  4OVN F;  1YHQ P;  1NU1 D;  3AED C;  2WT7 A;  1L4A A;  1NTZ J;  2HPC A;  3KHU A;  1SFC A;  5CCH C;  1KN7 A;  4JYC A;  1GTW A;  1IK9 A;  2N1T D;  3D70 A;  2B87 A;  1KIL E;  1N73 A;  2WPV B;  5C39 A;  1E79 H;  3Q5P A;  2B87 B;  2DW3 A;  3E7K A;  3RK2 B;  1GU4 A;  2KSE A;  2O01 H;  1SQP D;  3AEF C;  1SQX G;  2G8Y A;  2M5A A;  2XND H;  3HUS C;  1NTZ E;  3LID A;  3VN0 A;  5KJ7 C;  5KAF E;  1FJK A;  1JB0 J;  4WWI A;  2OYH B;  5AVV B;  1L0L D;  1BDD A;  1KB9 I;  3BCC J;  3CME P;  4PV1 C;  2AXT E;  3L71 J;  1NTM E;  1NYH A;  1IFJ A;  2E75 D;  3KZI H;  5KLV E;  2KI7 B;  3JC2 2;  3B5N B;  4GT1 A;  5APX A;  3RL0 C;  2E5T A;  4IOI H;  1VQL P;  3L75 G;  2NRG A;  2YIU C;  3HE4 B;  4IFD K;  3H1L G;  2UWJ E;  3PH0 A;  3BRV B;  4GDO A;  3RK2 D;  3CXH D;  3OJA B;  4GKG A;  5B66 H;  1NKN A;  2YKO A;  5H2F E;  1URQ D;  5CMZ A;  1MKM A;  3H1K J;  1FOS E;  1ZW0 A;  3L72 D;  1BE3 D;  4GIF A;  3RL0 D;  1RF0 A;  3P8C D;  2Y0D A;  5AVU B;  1NU1 J;  5AW6 B;  3RGU A;  1LT9 C;  1KTM A;  2N9B A;  3M0A A;  1KYO H;  1H89 A;  1URQ A;  2FY8 A;  2LXC B;  4RO0 A;  2JR8 A;  3KZI E;  3AE3 C;  1QX8 A;  1R5L A;  2QIW A;  4I7Z C;  4JQ0 D;  2I1J A;  3WMM 0;  2OGU A;  1ZRT D;  3D6Z A;  5APU A;  1BGY E;  2RN0 A;  3NMD A;  5KAI H;  4WY4 A;  1OW8 A;  4L76 A;  1DEE G;  1NTZ G;  3H1J D;  1GK6 A;  2P7J A;  2WSC H;  3NTN A;  3USS A;  1KQF B;  3TNU B;  4H13 C;  1VDF A;  3JSV C;  2R5B A;  4N6J A;  5APY A;  2XV5 A;  3SFE C;  2PGD A;  2O1J A;  3IF4 A;  4JBZ A;  1EDK A;  2SPZ A;  4WY4 B;  5CCG A;  1SQV G;  2JKV A;  1FU1 A;  5GTI E;  1J1E C;  4I1L A;  1KC8 Q;  2R3C A;  3A0H H;  3AE6 C;  1G1J A;  3FXD A;  3L72 E;  4H0L B;  4WY4 C;  2IFM A;  1IJD B;  2JWA A;  5KLV D;  3V2P A;  3VP9 A;  1FZG A;  3CXH E;  3C9I A;  2JWD A;  1CI6 B;  2FYU G;  3HE5 B;  4W7Z A;  3SWK A;  2ZT9 B;  3P7K A;  3M0D C;  4PD4 D;  5APW A;  3T97 B;  2KUB A;  1FE6 A;  1L0N D;  3E1I A;  3HTK A;  1CW5 A;  5AW1 B;  1P84 D;  1QVF O;  4IL6 E;  3VMA A;  2ITA A;  4UB6 E;  2J5U A;  5KKZ B;  2D2C D;  1SQQ K;  3Q2Y A;  2BEZ F;  3V6I A;  1NKZ B;  1XTG B;  4KT0 J;  3CPW O;  1KB9 H;  3AEE C;  3BCC E;  1ZR2 A;  4AYC A;  1DIP A;  1FJP A;  1LTJ C;  2LR2 A;  2NZ2 A;  3F89 A;  3H25 A;  3A5T A;  5AVS B;  1JNM A;  1NGM B;  2BEQ D;  4IL6 X;  3NFQ A;  3SSU A;  3WUV A;  5BU5 A;  2ZXX A;  5B5E H;  1JY2 P;  2OAR A;  1KD1 Q;  2QJK B;  3CCR P;  2WSE J;  2A45 H;  4I6M C;  1OXZ A;  2M5A B;  2QJK C;  1YTZ T;  2XNX A;  1L0L G;  3K5B A;  3L73 G;  4N78 D;  5BU8 B;  1WRG A;  2QA4 P;  5KJ7 A;  1FZA A;  1SQP K;  2KLV A;  1YJW P;  2FYN C;  2V4H A;  3F5H A;  3L75 J;  2HR3 A;  5AVQ B;  2ZJS E;  3S1K A;  1RE4 A;  1SQQ E;  1FC2 C;  1M7L A;  1PZQ A;  3HUS B;  2BCC E;  2O01 J;  1BCC E;  2P1J A;  2P2U A;  1N8R Q;  3CWB J;  2IX7 C;  2Z5I A;  1S72 P;  2Q6Q A;  5AVT B;  4C46 A;  1GD2 E;  4QMA A;  1EXJ A;  1JY2 N;  1LP1 B;  2A45 I;  5AW3 B;  4A7P A;  5AVZ B;  2QJP C;  4TLF A;  4B86 A;  2FYU K;  1OVV A;  3R2P A;  3TF5 A;  2OYI B;  3G71 P;  3GHG B;  2RMZ A;  2WMM A;  3AE5 C;  3P8C E;  3A7O A;  3P32 A;  1GU5 A;  1PP9 J;  2P10 A;  3CC7 P;  1IK7 A;  3AEC C;  1A02 J;  1N86 A;  5B5E E;  2QG4 A;  5AW5 B;  3A0B H;  4M3L A;  3VOP A;  3OW2 O;  2FXP A;  1JTH A;  2PP6 A;  1QGK B;  2M3E A;  3AE4 C;  5KLI B;  3U59 A;  1EQ7 A;  5CCH D;  5CBO A;  3AE7 C;  1NTZ K;  3AE9 C;  1Q81 Q;  1SQV D;  5CCH A;  4U7J A;  3G3Z A;  4W80 A;  4ZKP A;  2E42 A;  4BRY B;  1KQL A;  2IYP A;  3QWO C;  2A06 E;  1FBM A;  2W6A A;  3HE4 A;  2OYH C;  2K88 A;  2NPS C;  3MP7 B;  1PL5 A;  4YPC A;  1L2P A;  3L70 D;  3W67 A;  2FYU E;  5EFW B;  5AW4 B;  4R4M A;  1RQV A;  4KHX A;  2WSC J;  3KPE A;  1PP9 D;  3PTZ A;  3RL0 B;  3CXH H;  1VQN P;  3L74 G;  3O6Q B;  4PV1 D;  2IPP A;  2KZI A;  3GMA A;  1SQB K;  3RK3 E;  2WPR A;  2I1K A;  2OQQ A;  1YJ9 P;  2JDI H;  1OX3 A;  1ZV8 A;  1RE3 C;  1N7L A;  2L5G B;  4JYB A;  2Q3I A;  3CCS P;  3LW5 J;  5DJT B;  1RQU A;  1VQO P;  3M0D A;  3Q3D A;  1JCC A;  3L75 D;  1HVV A;  3CWB E;  4C7N B;  1KB9 E;  2MJZ A;  1ZRT E;  2ZAE B;  2BCC D;  1NAY A;  1SQQ J;  4IFM A;  3N7N A;  4IL6 H;  2K37 A;  2ZYG A;  3H1H J;  2A45 G;  1N73 B;  1Y8A A;  4W7Y A;  3O6Q A;  1LTJ A;  2OYO A;  1Q82 Q;  3OAK A;  5AW9 B;  1M1J B;  3IAO A;  1ZME C;  4MN4 C;  2H88 C;  3IFM A;  1SLQ A;  1HF9 A;  2KYV A;  4N78 E;  1DEB A;  2NPS D;  3TYY A;  1JY2 O;  3A0H E;  1U57 A;  5H2F H;  4KJM A;  2KK7 A;  2ZVO B;  3MZW B;  4ASV A;  3CI9 A;  5KTB A;  3BRT B;  4WY4 D;  1AQ5 A;  1AFO A;  3MTU E;  4OH8 B;  2FXM A;  2WPQ A;  1PP9 E;  1XTC C;  1PPJ E;  2QM8 A;  5AW0 B;  1CI6 A;  4K35 A;  4PD4 H;  5CJ4 A;  4DOJ A;  5KAF H;  1QVG O;  4H13 D;  1N7S B;  1J2J B;  3L72 J;  2FBW C;  3V2R A;  2FYN B;  1NJI Q;  4TT3 H;  1USE A;  1P84 I;  1GDT A;  3GG2 A;  1NO4 A;  1JCD A;  3C1L A;  5KKZ C;  1KQS O;  1L0N J;  2G3A A;  2RH0 A;  3CCU P;  1JEK A;  1P84 E;  1VQK P;  3CX5 E; 
#chains in the Genus database with same CATH homology
 5APT A;  4HH2 A;  1LWU A;  2J59 M;  2VRS A;  4XE5 B;  3II6 A;  3GHG C;  2Z5H A;  3L35 A;  1SP4 A;  1L0L K;  1N2D C;  2XZR A;  1URQ C;  1JY3 N;  2KP8 A;  2Z4E A;  4C7N A;  1DH3 A;  3HUS A;  5CCG D;  1LTB C;  4I2L C;  1FDM A;  1RF1 B;  1GL2 A;  1HGV A;  2HPC B;  2E43 A;  4LLH A;  2WSE H;  1MUU A;  4LC1 A;  1L0N K;  2M3B A;  2N1T C;  2HOD A;  2OYH A;  3RK3 D;  1JMM A;  2OYI C;  1MV8 A;  2HLO A;  1IFD A;  2XKM A;  1SFC B;  1Z56 A;  1L4A B;  2GUV A;  1FZB A;  1SFC C;  1T3J A;  3HTK B;  4Y99 C;  4AQR D;  5CCH A;  1L4A C;  1N7S D;  1H88 A;  3VMX A;  1J1D C;  3EQ2 A;  2PAJ A;  2WIT A;  3N4X A;  1GL2 B;  3A3Y B;  3CL3 D;  2ZXE B;  1RE4 C;  1J1E B;  3EFG A;  1S9K E;  3KDP B;  2C9L Y;  4DZO A;  1NWQ A;  3V4Q A;  3BAS A;  5AVY B;  3UIA A;  1N7S C;  1HTL C;  1X79 B;  1GL2 D;  4EOT A;  1LTA C;  3MD0 A;  3HD7 C;  3IR9 A;  3CLQ A;  1KFM A;  3HD7 B;  2FYZ A;  1IO4 A;  5AVW B;  1SQX K;  2WZ7 A;  4WB4 A;  3H32 A;  1G2C A;  1S9K D;  1ZLL A;  2C0X A;  2QM7 A;  3B5N A;  2LKM A;  1LGH B;  2XU6 A;  1FZC A;  5BVZ A;  1N7S A;  2M8R A;  5KJ7 D;  2CPB A;  2FFD B;  2Q7C A;  3U1C A;  1DX7 A;  1T3U A;  2ZFC A;  3L36 A;  3MUD A;  3M06 A;  2BAS A;  5CJ0 A;  3HE5 A;  2W6B A;  1NU1 K;  1A02 F;  5CCG C;  2WWW A;  4N3Y B;  2R5D A;  2YMY A;  1YTZ I;  3SWF A;  2JJL A;  1QL2 A;  2KSJ A;  1KIL D;  2WSF H;  2GM4 A;  3TNU A;  1HWT C;  1IFI A;  3MGN A;  5AW2 B;  4ZKU A;  1URQ B;  1LT9 A;  5KLV K;  2YKP A;  1SQV K;  1KIL A;  1RF0 C;  1T2K C;  1LTT C;  2XDJ A;  1IC2 A;  2R32 A;  4Y99 B;  1JY3 O;  2HOD B;  1SVF A;  2O1K A;  4HYT B;  1J1D B;  1GW3 A;  2NPS B;  2N1T A;  1GK4 A;  3H6P A;  1HJB A;  5AVX B;  1ZR4 A;  3HD7 D;  2N1T B;  1GL2 C;  3SWY A;  3RK2 C;  1KZU B;  1MZ9 A;  1G1I A;  2WTY A;  1JTH B;  1RY3 A;  1QL1 A;  1LTI C;  1T8Z A;  2C0W A;  4O9B A;  1H8A A;  1FAV A;  3B8E B;  1T2K D;  2YKQ A;  3GHG A;  1LWU B;  1NH4 A;  1CSB A;  3LIE A;  1LWU C;  1FOS F;  2J58 A;  2YNY A;  1M1J C;  2H8P D;  3B5N D;  5APQ A;  4IFF A;  1KIL B;  3L37 A;  3BVH A;  1LT9 B;  1KIL C;  1OWA A;  3KYQ A;  1IFN A;  2Q5U A;  1IFM A;  1KFN A;  4JF7 A;  1JY3 P;  3M9H A;  1PFI A;  1W2E A;  1WT6 A;  1GZL A;  3MIW A;  5CHX A;  3VMZ A;  2H7H A;  3OA7 A;  5AW7 B;  1NOH A;  4XA4 A;  3VP8 A;  3NXS A;  3RK3 C;  3B5N C;  3LW5 H;  2WT7 A;  3M91 A;  1NTK K;  3P8M C;  3RK3 B;  3KQG A;  1G2C B;  1JOC A;  3H32 B;  1MFZ A;  3VMY A;  1RF1 A;  3HD7 A;  5APV A;  4RES B;  1FZF A;  2HFE D;  2KB7 P;  3I5C A;  2FFD A;  1JO5 A;  1FZC B;  2WPS A;  2CPS A;  1HUC A;  3T97 A;  1E5W A;  2FFD C;  1CZQ A;  1FZC C;  1JUN A;  1RE3 A;  2YO3 A;  3VTP C;  3TSI A;  5AVR B;  1RF1 C;  3M9Q A;  3HRN A;  2C9N Y;  4WBA A;  2IFN A;  1YYC A;  3V2N A;  3A2A A;  1NHL A;  4C7R A;  1LTG C;  2GUS A;  2POH A;  3BAT A;  1HGZ A;  1X9V A;  1NAF A;  2KOG A;  4EIJ A;  1HBW A;  2NPS A;  2HYN A;  3U1A A;  2WT7 B;  2FKW B;  3M9B A;  3L4F A;  2JEE A;  1NTM K;  2P67 A;  4LGD E;  3V2Q A;  5AW8 B;  1FZE A;  3V5B A;  1ZN5 A;  3PP5 A;  1GW4 A;  5APS A;  4AUW A;  2H43 A;  3RK2 D;  1SFC D;  1M1J A;  1LTJ B;  1L4A D;  1HH0 A;  3O8Z A;  1X8Y A;  3VYI A;  2OYI A;  1VPC A;  1LTS C;  2HG5 D;  2YO2 A;  2W27 A;  3V4W A;  1L4A A;  2HPC A;  1SFC A;  5CCH C;  4JYC A;  1GTW A;  1IK9 A;  2N1T D;  3RK2 B;  1GU4 A;  2O01 H;  3HUS C;  1CW5 A;  5KJ7 C;  3LID A;  3VN0 A;  1FJK A;  2OYH B;  5AVV B;  1IFJ A;  5APX A;  3B5N B;  4GT1 A;  3RL0 C;  3HE4 B;  4IFD K;  3BRV B;  3OJA B;  4GKG A;  1NKN A;  2YKO A;  1FOS E;  1URQ D;  5CMZ A;  4GIF A;  3RL0 D;  1RF0 A;  3P8C D;  5AVU B;  5AW6 B;  1LT9 C;  2N9B A;  3M0A A;  1H89 A;  1URQ A;  3WMM 0;  2I1J A;  5APU A;  3NMD A;  4WY4 A;  1N73 C;  3NTN A;  1GK6 A;  2P7J A;  2WSC H;  3TNU B;  1VDF A;  2R5B A;  4N6J A;  5APY A;  2XV5 A;  2O1J A;  5CCG A;  4WY4 B;  1FU1 A;  1J1E C;  4I1L A;  2R3C A;  1G1J A;  4WY4 C;  3VP9 A;  1N73 A;  2IFM A;  1IJD B;  3V2P A;  1FZG A;  3C9I A;  1CI6 B;  3HE5 B;  4W7Z A;  3TK1 A;  3P7K A;  3M0D C;  5APW A;  3HTK A;  3E1I A;  5AW1 B;  1SQQ K;  1NKZ B;  1XTG B;  1ZR2 A;  4AYC A;  1FJP A;  1LTJ C;  1JNM A;  3A5T A;  5AVS B;  3NFQ A;  5BU5 A;  1JY2 P;  2OAR A;  2A45 H;  4I6M C;  1OXZ A;  2XNX A;  4N78 D;  1YTZ T;  5BU8 B;  1WRG A;  5KJ7 A;  1FZA A;  1SQP K;  2KLV A;  5AVQ B;  1RE4 A;  1M7L A;  3HUS B;  2P1J A;  2P2U A;  2IX7 C;  2Z5I A;  4C46 A;  5AVT B;  1GD2 E;  1JY2 N;  2A45 I;  5AW3 B;  4B86 A;  5AVZ B;  2FYU K;  3R2P A;  2OYI B;  3GHG B;  3P8C E;  3A7O A;  3P32 A;  1GU5 A;  1A02 J;  1N86 A;  5AW5 B;  4M3L A;  3VOP A;  1JTH A;  2PP6 A;  3U59 A;  1EQ7 A;  5CCH D;  1NTZ K;  4W80 A;  3G3Z A;  4ZKP A;  2E42 A;  1KQL A;  1FBM A;  2W6A A;  3HE4 A;  2OYH C;  2NPS C;  5AW4 B;  4KHX A;  3KPE A;  3RL0 B;  2IPP A;  1SQB K;  2WPR A;  2I1K A;  1ZV8 A;  1RE3 C;  1N7L A;  2L5G B;  4JYB A;  2Q3I A;  3M0D A;  1JCC A;  1HVV A;  4C7N B;  2MJZ A;  4IFM A;  3N7N A;  2A45 G;  1N73 B;  4W7Y A;  1LTJ A;  3OAK A;  5AW9 B;  1M1J B;  3IFM A;  1SLQ A;  2KYV A;  4N78 E;  1DEB A;  2NPS D;  3TYY A;  1JY2 O;  1AFO A;  3CI9 A;  5KTB A;  3BRT B;  4WY4 D;  1AQ5 A;  3MTU E;  4OH8 B;  2FXM A;  2WPQ A;  1XTC C;  5AW0 B;  2QM8 A;  1CI6 A;  5CJ4 A;  4DOJ A;  1N7S B;  1J2J B;  3V2R A;  1GDT A;  1NO4 A;  1JCD A;  2Q9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...