1URQB

Crystal structure of neuronal q-snares in complex with r-snare motif of tomosyn
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
64
structure length
64
Chain Sequence
ETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords M-TOMOSYN ISOFORM
publication title Structural Basis for the Inhibitory Role of Tomosyn in Exocytosis
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 30
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2003-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1urqB00
3RL0B 1KILA 3RK3C 3KYQA 5CCGA 3VOPA 4WY4D 2HG5D 1N7SD 1JTHB 4N78E 2YMYA 2NPSB 2N1TD 3B5NB 3HD7A 3P8CE 1T3JA 1L4AA 1SFCB 2HFED 4WY4B 1URQB 4LGDE 1N7SB 3RK2C 4OH8B 1NHLA 3RK3D 1KILD 1KILC 3RL0C 4W7ZA 2N1TB 1GL2B 5CCGC 4W80A 5KJ7A 5KJ7C 1JTHA 3HTKB 2KOGA 2NPSA 2XDJA 3RK3B 5CCHA 3PP5A 2WZ7A 2NPSC 3B5NA 5CCHC 3HD7C 2M8RA 1L4AC 1SFCA 4JF7A 3RK2D 4WY4A 1URQA 1SFCC 1N7SA 1URQC 3RL0D 5CCGD 2N1TA 1GL2A 5KJ7D 1GL2C 3RK2B 2H8PD 2NPSD 1KILB 5CCHD 3HD7D 3B5ND 1L4AD 3B5NC 3TSIA 1HVVA 1SFCD 1URQD 4WY4C 1XTGB 1N7SC 3M0DC 2N1TC 2PP6A 1GL2D 3HD7B 1L4AB 4W7YA
chains in the Genus database with same CATH superfamily
1KYOE 2I8DA 2P10A 1PGQA 3RK3C 1JM0A 1FZAA 1OFCX 5CCGA 2HG5D 1JTHB 1BE3G 2E74D 1CW5A 1SQPG 2WVRA 5DJTB 1SQXE 4L75A 3HD7A 2B9BA 1ZV8A 1KYOH 2WPQA 2E76C 2ZAEB 3RK2C 1YI2P 4K35A 2K3RA 1YIJP 2FYUJ 4AYCA 2KS1A 2M3BA 5TISE 3G71P 2J5UA 1PPJG 3CWBD 3NFQA 3IAOA 1P84D 5CCHA 4B86A 3QWOC 1BCCG 1S5LE 1R8EA 2XNDH 1SQBD 5TISH 2KI7B 3L74D 1GL2A 1FZCA 2WSCJ 1M90Q 1YQ3C 5BU8B 1NTZE 1S5LH 5CCHD 4QMAA 3G9RA 2W27A 3WUUA 2QM8A 4DCKA 1HVVA 3SWYA 1RE4C 3Q1MA 2M0BA 1N7SC 4A7PA 3C8VA 4U3FJ 2N1TC 3VYIA 1GL2D 3HD7B 1GW4A 1G1JA 1SQQJ 1LGHB 2M5AA 1PZQA 2KS1B 1NGMB 3G3ZA 3CXHD 3VOPA 2FFDA 1K8AQ 1JNMA 3G4SP 1SQVG 3U59A 1Q7YQ 4ZKPA 3AEFC 1NU1G 2QM7A 2WTYA 5CJ0A 4GOEA 5KAFE 5GTHE 2YIUC 2BEZF 3BCCD 2CPBA 1GK6A 1GL2B 2WQYC 3Q3DA 1FZCB 4DOJA 1IK9A 1KZUB 1NTKJ 5KLVK 4U3FG 3CMAP 3AE5C 5KAFH 1HTLC 5GTHH 5E79E 1L4AC 3M9BA 2IBZI 3A0HE 2PRRA 4YXWH 1SQQG 3M06A 2WSEH 3OJAB 3MTUE 4WVZA 3CCEP 3H1IG 3TNUA 1GZLA 5M1BA 5E79H 2M5AB 5APVA 5APQA 3WU2E 3A0HH 3PRJA 2FFDB 1Q81Q 3D70A 4L73A 4HB1A 3R4YA 1YJWP 1SQPK 3HE4A 1YYCA 4ZMDA 2ZYAA 1S4XA 5AVZB 3H1KD 3OW2O 4H13D 1EZVI 1VQOP 3WU2H 1AJYA 3KYQA 1L0LG 3TYYA 4WBAA 1KB9H 2JO1A 3V4QA 2Q5UA 3IR9A 4EIJA 5KLIC 3L72G 2FYNC 2PAJA 1SVFA 2OTKE 4MN4C 1JUNA 3RBZA 1N86A 5AVXB 3L73G 2KIKA 3TNUB 5KJ7A 4KT0J 4H13B 3L71J 5AVRB 3EFFK 3TDKA 2XDJA 3L75D 3Q2YA 1OW8A 2R3CA 1SS1A 2W8ZA 1T2KD 3VP8A 1CSBA 1PP9J 1OW7A 1URQA 3HE4B 2FYUK 2VRSA 1KFNA 1LWUA 2QRXA 2R44A 5KJ7D 2Q6QA 5AW2B 3VMYA 3RL0g 3S1KA 2JEEA 2E75D 1GMJA 3I5CA 3L35A 4GKGA 1URQD 1XTGB 1VQKP 1N2DC 1UIIA 1FOSE 3AEBC 2E74C 3KDPB 1YTZI 4C7NA 4D6TG 3L37A 5KAIE 3CD6P 1R5LA 4IFFA 4PV1B 3IF4A 1MV8A 4JYCA 1IK7A 2LR2A 1AA0A 1VQ7P 1KB9D 1SQQK 5KAIH 1URQB 1WT6A 4OH8B 2GUSA 2R5BA 1LWUB 4ZNCA 4CPGA 3H1LE 3LIEA 1R5SA 2QEXP 2ZJSE 1OVVA 1KQSO 2JWAA 2RH0A 1JY3P 5CCHC 1AVYA 1X0TA 3CC7P 1GK4A 3Q5RA 1RF1A 1L2PA 3RL0D 3BRVB 3VMXA 2A45G 1OVUA 1EDLA 1ZOYC 4C7NB 1NTKK 1GL2C 3A2AA 1BGYJ 1SQBG 1RY3A 1L0NJ 2KNCA 1DH3A 3B8EB 5KKZB 1SP4A 4K3AA 5K5GB 2XV5A 1XTCC 4XFJA 3FXDA 2P67A 4W7YA 1PV3A 1EDIA 3CCQP 2KSJA 5AVQB 2RMZA 3RL0B 1LT9C 1IFPA 3UIAA 3FWLA 3HUSA 2JP3A 2YXQB 2FFDC 2PGDA 4IFMA 1Y8AA 4I1LA 1QGKB 3NTNA 1PGJA 2H88C 3BRTB 1T3JA 3L70E 4OGQD 2Q3IA 1RF1B 2HLOA 1BGYG 1NWQA 3PHLA 2IZ1A 3AE7C 1NTKD 1FOSF 3G6EP 1T3UA 1L0NG 3CWBE 2KLVA 3MIWA 2KLUA 1P84E 5AW0B 2W83C 3OA7A 1E5WA 2QSIA 1SLQA 2O01N 3PP5A 1A02F 2M3EA 2CPSA 1YTZT 2KNCB 1DEEG 4JF7A 1NTMD 3L74E 4L76A 1K04A 3EFGA 2Q3EA 3S4RA 1NTZJ 4OGQB 1WRGA 1SQXG 3H1LD 1YJNP 1PIXA 4H13C 1FZFA 1NKNA 1IFDA 3HUSB 3Q5PA 1KQGB 4U7JA 5APXA 2IDBA 4L74A 3S9OA 2HPCA 1TU3F 2Y9YA 2BASA 1NO4A 3LW5H 1FJKA 4UB8E 1USDA 4C46A 3IN6A 2QJYB 2QJKB 1MZ9A 2YMYA 1VQ5P 1NTZG 1BCCJ 3OAKA 3TGUD 1AV1A 1T2KC 3BCCE 1OX3A 4UB8H 2KK7A 2JJLA 3L71D 3MP7B 4H44B 1Q2NA 4XE5B 1E79H 5KJ7C 1GTWA 1KMIZ 1PP9D 1JY2P 2NPSA 2E75C 4H0LD 2ZFCA 1KQLA 4OVNF 1URQC 3L70D 4EYYQ 3GMAA 1FBMA 3N7NA 5CCGD 3IFMA 2XU6A 1LWUC 2HPCB 2KYVA 2YMKA 2NPSD 4RKUJ 3HD7D 3KPEA 2FKWB 1SQVJ 3H1KE 1VL2A 2P7JA 2OYHA 1DD3A 2O01H 1NU1J 1JOCA 1S3JA 3VMZA 1NAFA 1GD2E 1J1EC 4H0LB 1RE3A 1JMBA 3B71A 2A45I 3MUDA 2GUVA 2MJZA 4NPDA 3KZIE 2Q1KA 1L0NK 2R32A 5AW9B 3CX5I 1UIXA 1ZW0A 2W6AA 2Q7CA 3II6A 2NPSB 5DJUB 2FYZA 5CBNA 4EI2A 4Y99B 4GT1A 2K88A 3KZIH 3CCRP 3ITKA 3P8CD 3RL0C 3H1IJ 2PFXA 1U57A 3L75E 4RESB 3KXDA 1KC8Q 5CHXA 4LC1A 1YITP 1HUCA 1GW3A 2JDIH 1IZNB 4ZKUA 4WY4A 3HE5A 2KXPB 2V7QJ 2L5GB 2OYHB 3CCLP 5AVSB 2J59M 3WUVA 3GF7A 2Z4EA 2SPZA 3CC4P 3B5NC 1L0LJ 2IBZD 2BCCJ 3A5TA 2C9LY 1KYOI 3M0DA 1W2EA 1NTZK 1X9VA 1PFIA 3L72J 3H1JD 2YKPA 1ZMEC 1DD4A 3WUTA 5BU5A 1KILA 3V2NA 3L73J 1J1DC 2OTJP 3HUSC 3P32A 1EDKA 3AECC 2NZ2A 2L91A 1LTGC 3AE8C 3H1HD 2FYUE 1KB9E 5CBOA 1W5CE 4TLFA 2LXCB 2ZT9B 4WY4B 1WMKA 3HE5B 1EZVD 2Y0EA 3AEGC 1JO5A 1KILD 4W7ZA 2O1JA 2J58A 4I7ZB 2BCCG 2RN0A 2A06E 5KLVD 2Y0DA 2AXTE 1H89A 4BXLA 2QJYC 4M3LA 3CPWO 2AXCA 2QJKC 2WZ7A 2W6JH 2QG4A 1QEXA 3VN0A 2WSFH 1HF9A 1AQTA 2AXTH 3EQ2A 4D6TJ 3P8MC 5APSA 3HTKA 3CCSP 3AE6C 2WSCH 1KILB 1G1IA 2Y9ZA 1BE3D 1SQPD 4IL6X 1SQQE 2OGUA 3CL3D 5CJ4A 4PV1D 1K73Q 5APTA 1PPJD 3JSVC 1S9KD 4HKZH 3L36A 1SQVK 3AEDC 2B87A 2FY8A 1NU1K 5AW5B 3CCVP 2YKOA 1H8AA 1PGOA 1RF0C 3CC2P 4N78D 2HFED 1NTKE 2E76D 2LKMA 3M0AA 4R4MA 3E1IA 1T6AA 1LTJB 2AEMA 3AE3C 1FZGA 5CCGC 1ZR4A 3HTKB 1ZXGA 1PGPA 1SQBJ 3L74J 1NTME 3RK3B 2NPSC 2K9JA 2FYUD 3HD7C 1LTSC 1RHZB 1VF5D 3C1LA 4O9BA 1RE4A 1JY2N 1N7SA 3GG2A 1S5LX 2N1TA 4YTPC 4Z1MH 2G3AA 2E76B 3RK2B 2A06D 3SFEC 2ZYDA 1S2EA 1LTBC 1ZR2A 4NPFX 3TSIA 3CWBG 2B87B 1EC5A 2OYHC 5C39A 2MKVA 5H2FE 1VF5B 1FZCC 2ZXXA 1RE3C 3D6ZA 4AUWA 1S1CX 3L74G 3VMAA 1L0LK 5APUA 4BWNA 1RH5B 4U3FD 2P1JA 5AW7B 3TGUE 1Q82Q 3BCCJ 1SQQD 5H2FH 2K9JB 3WMM0 1L4AA 2N9YB 3TK1A 3L71E 2E43A 3H1ID 2LXBA 1NKZB 1N7SB 5GTIE 1M56D 2H7HA 2D2CD 3CMEP 2N1TB 1USEA 1PP9E 2P58A 1SQXJ 5B5EE 1HWTC 4Y28J 5AW1B 1KFMA 1IFMA 1M1JA 2WSSH 3GHGA 2WMMA 1BDCA 1OZHA 3A0BE 1U7JA 2WPRA 3V2QA 5GTIH 1JCCA 2Y0CA 2B88A 3CI9A 3CCMP 2IX7C 1HJ0A 4HYTB 3VTPC 5B5EH 1MFZA 4I7ZC 2R3SA 1L0LD 3R2PA 2YO2A 1EDJA 2D2CB 3BCCG 2IFMA 3A0BH 4YPCA 1NAYA 3AEAC 4EOTA 4N6JA 3H1KJ 2FXPA 2KSEA 2JWDA 2C9NY 3M0DC 3NXSA 2W6BA 3SFDC 1L4AB 1QVFO 3L73D 1VQMP 1VQ8P 1IO4A 4I2LC 2IPPA 1EXIA 2IYOA 4UB6E 4RO0A 3PH0A 1DEBA 1M1KQ 2WPVB 1YQ4C 2IFNA 1KORA 1M1JB 3GHGB 4H44D 3M9HA 1NVOA 3RBXA 3P8CE 3BASA 3I55P 1JY3O 1IFJA 2YNYA 1IC2A 4UB6H 3W68A 2OYIA 2H89C 3V2RA 3H1KG 3LIDA 1GU5A 2H43A 4JQ0D 2KOGA 3JC22 2KZIA 4IL6E 1IFNA 2G8YA 2WSEJ 1SFCA 4PD4I 4I6MC 4D6TD 1FZBA 3V4WA 1LTIC 2YKQA 5KLIB 1NH4A 1VQ9P 2FYNB 4DZOA 2XZRA 1SQBK 2IBZE 2K9YA 2ZYGA 4IL6H 4PV1C 2I1JA 1FDIA 3P7KA 1EXJA 5APWA 3FX0A 1SFCD 2Z5HA 1K05A 5EFWB 3L75G 1HGVA 3H1JE 1T8ZA 3Q5SA 1MFTA 1OIPA 1X22A 4DT0A 3AE1C 2OYIB 3BATA 4KHXA 2E42A 1JMMA 1KN7A 4RJTA 3H1HE 2ZVOB 3U1AA 1OWAA 2WITA 2OQQA 1DX7A 2ZVNB 2QJPB 1EZVE 2Z5IA 1ZP0C 3JCUE 1P84I 2WSFJ 1KILE 4AQRD 1SFCB 3I56P 1VF5C 1ZN5A 1LJ2A 5KLVE 4JYBA 1J2JB 2E74B 3CX5D 2E5TA 1FS0E 5KKZC 3V5BA 1Z56A 3M9QA 4JPZB 1FZEA 3JCUH 3TF5A 1KD1Q 2RKLA 1VQPP 1ZRTD 2GM4A 3HRNA 2FYUG 3KQGA 1SQXK 1Q86Q 1BE3E 2BEQD 1SQPE 4IFDK 1LT9A 1GU4A 2V4HA 3T97A 1HJBA 2JKVA 5L8RJ 3CXHI 2A06G 1JY3N 1RF1C 3ZDMA 4GIFA 4N3YB 1FJPA 1CI6A 2XKMA 1BGYD 2IZ0A 2PP6A 1K9MQ 1PPJE 5BVZA 3RK3E 5AVTB 1S9KE 1L0ND 1GDTA 3SSUA 3BVHA 1BCCE 3O8ZA 5AVYB 2D2CC 1M8OB 2ZT9D 1KYOD 3CCUP 4WY4D 2WT7A 5AW4B 5AW8B 1YHQP 2HR3A 1CZQA 2Q9IA 1RQVA 4NPEA 4N78E 3FXEA 2OTLP 1JY2O 1A02J 4OGQC 3NMDA 1N73A 1SQXD 1NOHA 3SWKA 1NTMJ 4XA4A 2JR8A 1LT9B 1QL1A 1M1JC 4GODA 3T97B 1LT1A 3GHGC 3H1LJ 1FC2C 3N4XA 1Y9BA 1CI6B 4TT3H 1X79B 1IJDB 5AVVB 1SQVE 3AE4C 2OYOA 3AE9C 1NTKG 2C0XA 1OXZA 1NU1E 1NYHA 2FXOA 2WT7B 3CLQA 1NTZD 1H0TA 3CCJP 2P2UA 1LTJA 1NJIQ 2QE7H 1FDOA 1S72P 1NTMG 4H44C 3RGUA 1VQNP 2QA4P 3F89A 1N73B 4U3FE 5AW3B 3SWFA 3F5HA 2YXRB 3TGUJ 3H6PA 1QVGO 3GW6A 3H1LG 3MGNA 3KHUA 1LTTC 2O1KA 1FDMA 1LTAC 3H1IE 3VP9A 4GDOA 2DW3A 1BSNA 1DIPA 4LGDE 2K1AA 3RK3D 1M57D 1QX8A 3E1RA 2OYIC 2AEFA 1BCCD 2O3JA 3H25A 3B4SA 3FWNA 3A3YB 3L70J 1IFIA 3U1CA 4DJGA 1JEKA 2QJPC 1EQ7A 3CWBJ 4H0LC 1H0TB 3V6IA 3RK2D 1VQ6P 2K37A 1SFCC 2KZJA 3MD0A 1JCDA 3GF3A 5KTBA 1L0LE 3TGUG 2BCCE 2R5DA 4IOIH 5AVWB 2V7QH 1QLED 1VQ4P 4YXDC 2HYNA 3L71G 1OW6A 1KV4A 4WWIA 3L72E 2UWJE 1PP9G 4Y99C 2POHA 3E7KA 3A7OA 4R4LA 3GLMA 3FGAD 3L73E 1PL5A 1YBKA 1VDFA 1HH0A 1N8RQ 2E75B 3LW5J 3L70G 1KB9I 2IYPA 1SQVD 1AFOA 1NU1D 4BRYA 1N7SD 1ZLLA 2B89A 2N1TD 1FE6A 3PJSK 3MUDC 3PLNA 1NHLA 1M7LA 4GOFA 2WPSA 2CK3H 4HH2A 2N9BA 3H32A 4OWFA 5CMZA 1J1EB 4W80A 3O6QA 1YJ9P 4PD4E 1RQUA 5AW6B 3B5NA 4D6TE 5APYA 2M8RA 3EWKA 2ITAA 1AQ5A 2QIWA 2FXMA 2KB7P 3M91A 5AVUB 1VQLP 4ASVA 1NTMK 1H88A 1FU1A 4PJ0E 4KJMA 3MHVA 4PD4H 1JB0J 2YO3A 1LP1A 2HODA 3B5ND 3H1JJ 1L4AD 1BDDA 1X8YA 1OVRA 4BRYB 2ZT9C 2ZXEB 4WY4C 3USSA 2O01J 1VPCA 3ABVC 4PJ0H 1G2CA 4LLHA 1HGZA 1FAVA 2W90A 3D71A 2QVAA 3V2PA 2BCCD 2YIUB 1W2BO 3H1HJ 3AE2C 1U7MA 3H32B 1D7MA 3K5BA 3PTZA 3L72D 3O6QB 2KUBA 2C0WA 2IBZG 1BSHA 3B5NB 5KLVJ 5TJHA 3CX5E 1SQBE 2NRGA 2KP8A 1N73C 1KILC 3H1JG 1AVOA 1Q90D 1P84H 2WWWA 2A45H 4WB4A 3C9IA 4EDFA 1JTHA 2I1KA 4C7RA 1ZRTE 2FBWC 1LP1B 2GA1A 2HODB 1J1DB 3CX5H 1OMIA 3H1HG 3L75J 1Y47A 1N7LA 1KTMA 1BE3J 1G2CB 3D6YA 3AEEC 1SQPJ 1QL2A 2OARA 1EZVG 4ASWA 1MKMA 2XNXA 3QH9A 2H8PD 3CXHE 5B66E 5KLVG 2AEJA 2E5YA 1KQFB 4HJGH 4PD4D 1LNQA 1BGYE 3W67A 1L0NE 1LTJC 3L4FA 1RF0A 3MZWB 1HBWA 4JBZA 1MUUA 3CXHH 5B66H
chains in the Genus database with same CATH topology
5APTA 3BVHA 5AVQB 3RL0B 1LT9C 3O8ZA 1S9KD 5AVYB 3UIAA 3RK3C 3HUSA 1FZAA 5CCGA 3L36A 4WY4D 2HG5D 2WT7A 1SQVK 5AW4B 5AW8B 2FFDC 4IFMA 1JTHB 1CZQA 2Q9IA 1NU1K 1CW5A 4I1LA 4N78E 3NTNA 5AW5B 3BRTB 2YKOA 1H8AA 3HD7A 1JY2O 1ZV8A 1T3JA 1A02J 1RF0C 2Q3IA 2WPQA 4N78D 2HFED 2LKMA 3M0AA 1RF1B 3NMDA 1N73A 2HLOA 3E1IA 3RK2C 1NWQA 1LTJB 1FOSF 4AYCA 1T3UA 1NOHA 1FZGA 2M3BA 2KLVA 3MIWA 5CCGC 5AW0B 4XA4A 1ZR4A 3OA7A 1E5WA 3HTKB 1SLQA 1LT9B 3NFQA 3RK3B 5CCHA 4B86A 1QL1A 1M1JC 3PP5A 2NPSC 3GHGC 3HD7C 1A02F 1LTSC 2CPSA 1YTZT 4O9BA 1RE4A 4JF7A 1JY2N 3N4XA 1N7SA 3EFGA 1CI6B 1X79B 2N1TA 1IJDB 5AVVB 1GL2A 1FZCA 1WRGA 3RK2B 5BU8B 2C0XA 1FZFA 1OXZA 5CCHD 1NKNA 1IFDA 1LTBC 3HUSB 2W27A 1ZR2A 2QM8A 3TSIA 2WT7B 1HVVA 3CLQA 5APXA 3SWYA 1RE4C 2P2UA 1N7SC 1LTJA 2N1TC 3VYIA 1GL2D 3HD7B 2OYHC 1FZCC 2HPCA 1GW4A 1RE3C 1N73B 2BASA 4AUWA 1G1JA 1NO4A 5AW3B 1L0LK 1LGHB 3LW5H 5APUA 3SWFA 1FJKA 3H6PA 3G3ZA 3VOPA 4C46A 3MGNA 2FFDA 2P1JA 1JNMA 5AW7B 1LTTC 1MZ9A 2O1KA 2YMYA 1FDMA 1LTAC 3U59A 3VP9A 4ZKPA 3WMM0 2QM7A 2WTYA 3OAKA 5CJ0A 1L4AA 3TK1A 1T2KC 2E43A 4LGDE 1NKZB 1N7SB 2H7HA 3RK3D 2JJLA 2N1TB 2OYIC 2CPBA 1GK6A 1GL2B 1FZCB 4XE5B 4DOJA 3A3YB 1IK9A 5KJ7C 1GTWA 1HWTC 1KZUB 5AW1B 1IFIA 1KFMA 3U1CA 5KLVK 1IFMA 1M1JA 1JY2P 2NPSA 3GHGA 1HTLC 2WPRA 3V2QA 1L4AC 1EQ7A 2ZFCA 3M9BA 1JCCA 3RK2D 1KQLA 1SFCC 3M06A 1URQC 3CI9A 1JCDA 3MD0A 5KTBA 2IX7C 2WSEH 3OJAB 1FBMA 3MTUE 3N7NA 5CCGD 3IFMA 2R5DA 2XU6A 1LWUC 4HYTB 3VTPC 5AVWB 2HPCB 1MFZA 3TNUA 1GZLA 3R2PA 2KYVA 2YO2A 2HYNA 2NPSD 2IFMA 3HD7D 3KPEA 5APVA 5APQA 2FKWB 4EOTA 4N6JA 2FFDB 4Y99C 2POHA 3A7OA 1SQPK 3HE4A 1YYCA 2C9NY 3M0DC 2P7JA 3NXSA 2OYHA 2W6BA 2O01H 1VDFA 1JOCA 1HH0A 3VMZA 1NAFA 1GD2E 1J1EC 1L4AB 5AVZB 1RE3A 2A45I 3MUDA 2GUVA 1IO4A 2MJZA 4I2LC 2IPPA 1L0NK 3KYQA 2R32A 1AFOA 5AW9B 3TYYA 1DEBA 4WBAA 2W6AA 1N7SD 1ZLLA 2Q7CA 2IFNA 3V4QA 3II6A 1M1JB 2Q5UA 3IR9A 2NPSB 2N1TD 3GHGB 3M9HA 2FYZA 4EIJA 3P8CE 3BASA 4Y99B 2PAJA 4GT1A 1SVFA 1JY3O 1JUNA 1IFJA 2YNYA 1NHLA 1IC2A 3P8CD 1M7LA 2OYIA 1N86A 2WPSA 3RL0C 5AVXB 3V2RA 4HH2A 2N9BA 3H32A 5CMZA 3LIDA 1J1EB 1GU5A 4W80A 3TNUB 2H43A 5KJ7A 4RESB 5CHXA 5AVRB 2KOGA 4LC1A 1HUCA 2XDJA 1GW3A 2R3CA 3B5NA 5AW6B 1T2KD 3VP8A 5APYA 1CSBA 1IFNA 2M8RA 1SFCA 4ZKUA 1AQ5A 4WY4A 2FXMA 1URQA 2KB7P 3HE5A 3HE4B 2FYUK 3M91A 4I6MC 2VRSA 1KFNA 5AVUB 1FZBA 2L5GB 3V4WA 2OYHB 1LTIC 1LWUA 1NTMK 2YKQA 1FU1A 1H88A 1NH4A 5KJ7D 5AVSB 4DZOA 5AW2B 2J59M 1SQBK 2XZRA 3VMYA 2JEEA 2Z4EA 2YO3A 2I1JA 2HODA 3B5ND 3P7KA 1L4AD 3B5NC 3I5CA 5APWA 3L35A 2C9LY 3A5TA 1X8YA 1SFCD 2Z5HA 4GKGA 1URQD 2ZXEB 4WY4C 1XTGB 1N2DC 1VPCA 3M0DA 1HGVA 1T8ZA 1W2EA 1G2CA 1NTZK 1FOSE 3KDPB 1YTZI 1X9VA 4LLHA 1PFIA 1HGZA 1FAVA 4C7NA 3V2PA 3L37A 2YKPA 2OYIB 3BATA 4KHXA 1KILA 5BU5A 2E42A 1JMMA 4IFFA 3V2NA 1J1DC 3H32B 3U1AA 3HUSC 3P32A 1OWAA 1LTGC 2WITA 2C0WA 1DX7A 1MV8A 4JYCA 2Z5IA 3B5NB 4AQRD 1SFCB 4WY4B 1SQQK 1URQB 3HE5B 1WT6A 1ZN5A 1JO5A 4OH8B 2GUSA 2KP8A 2R5BA 1N73C 4JYBA 1J2JB 1KILD 1LWUB 1KILC 4W7ZA 2O1JA 2J58A 2WWWA 3LIEA 2A45H 1H89A 4WB4A 3C9IA 3V5BA 1JTHA 1Z56A 2I1KA 3M9QA 4C7RA 1FZEA 4M3LA 2HODB 2WZ7A 1J1DB 1JY3P 5CCHC 1GK4A 3VN0A 2WSFH 1RF1A 1N7LA 3RL0D 1G2CB 2GM4A 3HRNA 1QL2A 2OARA 3BRVB 3KQGA 3VMXA 2A45G 1SQXK 3EQ2A 4C7NB 1NTKK 1GL2C 3A2AA 3P8MC 2XNXA 5APSA 2H8PD 3HTKA 4IFDK 1LT9A 2WSCH 1KILB 1G1IA 1GU4A 3T97A 1HJBA 1RY3A 1DH3A 3B8EB 1JY3N 1RF1C 1SP4A 4GIFA 1LTJC 4N3YB 1FJPA 2XV5A 1CI6A 1XTCC 2XKMA 2PP6A 2P67A 3L4FA 4W7YA 1RF0A 5BVZA 1HBWA 1S9KE 5AVTB 3CL3D 1MUUA 2KSJA 1GDTA 5CJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RL0 B;  1KIL A;  3RK3 C;  3KYQ A;  5CCG A;  3VOP A;  4WY4 D;  2HG5 D;  1N7S D;  1JTH B;  4N78 E;  2YMY A;  2NPS B;  2N1T D;  3B5N B;  3HD7 A;  3P8C E;  1T3J A;  1L4A A;  1SFC B;  2HFE D;  4WY4 B;  1URQ B;  4LGD E;  1N7S B;  3RK2 C;  4OH8 B;  1NHL A;  3RK3 D;  1KIL D;  1KIL C;  3RL0 C;  4W7Z A;  2N1T B;  1GL2 B;  5CCG C;  4W80 A;  5KJ7 A;  5KJ7 C;  1JTH A;  3HTK B;  2KOG A;  2NPS A;  2XDJ A;  3RK3 B;  5CCH A;  3PP5 A;  2WZ7 A;  2NPS C;  3B5N A;  5CCH C;  3HD7 C;  2M8R A;  1L4A C;  1SFC A;  4JF7 A;  3RK2 D;  4WY4 A;  1URQ A;  1SFC C;  1N7S A;  1URQ C;  3RL0 D;  5CCG D;  2N1T A;  1GL2 A;  5KJ7 D;  1GL2 C;  3RK2 B;  2H8P D;  2NPS D;  1KIL B;  5CCH D;  3HD7 D;  3B5N D;  1L4A D;  3B5N C;  3TSI A;  1HVV A;  1SFC D;  1URQ D;  4WY4 C;  1XTG B;  1N7S C;  3M0D C;  2N1T C;  2PP6 A;  1GL2 D;  3HD7 B;  1L4A B;  4W7Y A; 
#chains in the Genus database with same CATH topology
 1KYO E;  2I8D A;  2P10 A;  1PGQ A;  3RK3 C;  1JM0 A;  1FZA A;  1OFC X;  5CCG A;  2HG5 D;  1JTH B;  1BE3 G;  2E74 D;  1CW5 A;  1SQP G;  2WVR A;  5DJT B;  1SQX E;  4L75 A;  3HD7 A;  2B9B A;  1ZV8 A;  1KYO H;  2WPQ A;  2E76 C;  2ZAE B;  3RK2 C;  1YI2 P;  4K35 A;  2K3R A;  1YIJ P;  2FYU J;  4AYC A;  2KS1 A;  2M3B A;  5TIS E;  3G71 P;  2J5U A;  1PPJ G;  3CWB D;  3NFQ A;  3IAO A;  1P84 D;  5CCH A;  4B86 A;  3QWO C;  1BCC G;  1S5L E;  1R8E A;  2XND H;  1SQB D;  5TIS H;  2KI7 B;  3L74 D;  1GL2 A;  1FZC A;  2WSC J;  1M90 Q;  1YQ3 C;  5BU8 B;  1NTZ E;  1S5L H;  5CCH D;  4QMA A;  3G9R A;  2W27 A;  3WUU A;  2QM8 A;  4DCK A;  1HVV A;  3SWY A;  1RE4 C;  3Q1M A;  2M0B A;  1N7S C;  4A7P A;  3C8V A;  4U3F J;  2N1T C;  3VYI A;  1GL2 D;  3HD7 B;  1GW4 A;  1G1J A;  1SQQ J;  1LGH B;  2M5A A;  1PZQ A;  2KS1 B;  1NGM B;  3G3Z A;  3CXH D;  3VOP A;  2FFD A;  1K8A Q;  1JNM A;  3G4S P;  1SQV G;  3U59 A;  1Q7Y Q;  4ZKP A;  3AEF C;  1NU1 G;  2QM7 A;  2WTY A;  5CJ0 A;  4GOE A;  5KAF E;  5GTH E;  2YIU C;  2BEZ F;  3BCC D;  2CPB A;  1GK6 A;  1GL2 B;  2WQY C;  3Q3D A;  1FZC B;  4DOJ A;  1IK9 A;  1KZU B;  1NTK J;  5KLV K;  4U3F G;  3CMA P;  3AE5 C;  5KAF H;  1HTL C;  5GTH H;  5E79 E;  1L4A C;  3M9B A;  2IBZ I;  3A0H E;  2PRR A;  4YXW H;  1SQQ G;  3M06 A;  2WSE H;  3OJA B;  3MTU E;  4WVZ A;  3CCE P;  3H1I G;  3TNU A;  1GZL A;  5M1B A;  5E79 H;  2M5A B;  5APV A;  5APQ A;  3WU2 E;  3A0H H;  3PRJ A;  2FFD B;  1Q81 Q;  3D70 A;  4L73 A;  4HB1 A;  3R4Y A;  1YJW P;  1SQP K;  3HE4 A;  1YYC A;  4ZMD A;  2ZYA A;  1S4X A;  5AVZ B;  3H1K D;  3OW2 O;  4H13 D;  1EZV I;  1VQO P;  3WU2 H;  1AJY A;  3KYQ A;  1L0L G;  3TYY A;  4WBA A;  1KB9 H;  2JO1 A;  3V4Q A;  2Q5U A;  3IR9 A;  4EIJ A;  5KLI C;  3L72 G;  2FYN C;  2PAJ A;  1SVF A;  2OTK E;  4MN4 C;  1JUN A;  3RBZ A;  1N86 A;  5AVX B;  3L73 G;  2KIK A;  3TNU B;  5KJ7 A;  4KT0 J;  4H13 B;  3L71 J;  5AVR B;  3EFF K;  3TDK A;  2XDJ A;  3L75 D;  3Q2Y A;  1OW8 A;  2R3C A;  1SS1 A;  2W8Z A;  1T2K D;  3VP8 A;  1CSB A;  1PP9 J;  1OW7 A;  1URQ A;  3HE4 B;  2FYU K;  2VRS A;  1KFN A;  1LWU A;  2QRX A;  2R44 A;  5KJ7 D;  2Q6Q A;  5AW2 B;  3VMY A;  3RL0 g;  3S1K A;  2JEE A;  2E75 D;  1GMJ A;  3I5C A;  3L35 A;  4GKG A;  1URQ D;  1XTG B;  1VQK P;  1N2D C;  1UII A;  1FOS E;  3AEB C;  2E74 C;  3KDP B;  1YTZ I;  4C7N A;  4D6T G;  3L37 A;  5KAI E;  3CD6 P;  1R5L A;  4IFF A;  4PV1 B;  3IF4 A;  1MV8 A;  4JYC A;  1IK7 A;  2LR2 A;  1AA0 A;  1VQ7 P;  1KB9 D;  1SQQ K;  5KAI H;  1URQ B;  1WT6 A;  4OH8 B;  2GUS A;  2R5B A;  1LWU B;  4ZNC A;  4CPG A;  3H1L E;  3LIE A;  1R5S A;  2QEX P;  2ZJS E;  1OVV A;  1KQS O;  2JWA A;  2RH0 A;  1JY3 P;  5CCH C;  1AVY A;  1X0T A;  3CC7 P;  1GK4 A;  3Q5R A;  1RF1 A;  1L2P A;  3RL0 D;  3BRV B;  3VMX A;  2A45 G;  1OVU A;  1EDL A;  1ZOY C;  4C7N B;  1NTK K;  1GL2 C;  3A2A A;  1BGY J;  1SQB G;  1RY3 A;  1L0N J;  2KNC A;  1DH3 A;  3B8E B;  5KKZ B;  1SP4 A;  4K3A A;  5K5G B;  2XV5 A;  1XTC C;  4XFJ A;  3FXD A;  2P67 A;  4W7Y A;  1PV3 A;  1EDI A;  3CCQ P;  2KSJ A;  5AVQ B;  2RMZ A;  3RL0 B;  1LT9 C;  1IFP A;  3UIA A;  3FWL A;  3HUS A;  2JP3 A;  2YXQ B;  2FFD C;  2PGD A;  4IFM A;  1Y8A A;  4I1L A;  1QGK B;  3NTN A;  1PGJ A;  2H88 C;  3BRT B;  1T3J A;  3L70 E;  4OGQ D;  2Q3I A;  1RF1 B;  2HLO A;  1BGY G;  1NWQ A;  3PHL A;  2IZ1 A;  3AE7 C;  1NTK D;  1FOS F;  3G6E P;  1T3U A;  1L0N G;  3CWB E;  2KLV A;  3MIW A;  2KLU A;  1P84 E;  5AW0 B;  2W83 C;  3OA7 A;  1E5W A;  2QSI A;  1SLQ A;  2O01 N;  3PP5 A;  1A02 F;  2M3E A;  2CPS A;  1YTZ T;  2KNC B;  1DEE G;  4JF7 A;  1NTM D;  3L74 E;  4L76 A;  1K04 A;  3EFG A;  2Q3E A;  3S4R A;  1NTZ J;  4OGQ B;  1WRG A;  1SQX G;  3H1L D;  1YJN P;  1PIX A;  4H13 C;  1FZF A;  1NKN A;  1IFD A;  3HUS B;  3Q5P A;  1KQG B;  4U7J A;  5APX A;  2IDB A;  4L74 A;  3S9O A;  2HPC A;  1TU3 F;  2Y9Y A;  2BAS A;  1NO4 A;  3LW5 H;  1FJK A;  4UB8 E;  1USD A;  4C46 A;  3IN6 A;  2QJY B;  2QJK B;  1MZ9 A;  2YMY A;  1VQ5 P;  1NTZ G;  1BCC J;  3OAK A;  3TGU D;  1AV1 A;  1T2K C;  3BCC E;  1OX3 A;  4UB8 H;  2KK7 A;  2JJL A;  3L71 D;  3MP7 B;  4H44 B;  1Q2N A;  4XE5 B;  1E79 H;  5KJ7 C;  1GTW A;  1KMI Z;  1PP9 D;  1JY2 P;  2NPS A;  2E75 C;  4H0L D;  2ZFC A;  1KQL A;  4OVN F;  1URQ C;  3L70 D;  4EYY Q;  3GMA A;  1FBM A;  3N7N A;  5CCG D;  3IFM A;  2XU6 A;  1LWU C;  2HPC B;  2KYV A;  2YMK A;  2NPS D;  4RKU J;  3HD7 D;  3KPE A;  2FKW B;  1SQV J;  3H1K E;  1VL2 A;  2P7J A;  2OYH A;  1DD3 A;  2O01 H;  1NU1 J;  1JOC A;  1S3J A;  3VMZ A;  1NAF A;  1GD2 E;  1J1E C;  4H0L B;  1RE3 A;  1JMB A;  3B71 A;  2A45 I;  3MUD A;  2GUV A;  2MJZ A;  4NPD A;  3KZI E;  2Q1K A;  1L0N K;  2R32 A;  5AW9 B;  3CX5 I;  1UIX A;  1ZW0 A;  2W6A A;  2Q7C A;  3II6 A;  2NPS B;  5DJU B;  2FYZ A;  5CBN A;  4EI2 A;  4Y99 B;  4GT1 A;  2K88 A;  3KZI H;  3CCR P;  3ITK A;  3P8C D;  3RL0 C;  3H1I J;  2PFX A;  1U57 A;  3L75 E;  4RES B;  3KXD A;  1KC8 Q;  5CHX A;  4LC1 A;  1YIT P;  1HUC A;  1GW3 A;  2JDI H;  1IZN B;  4ZKU A;  4WY4 A;  3HE5 A;  2KXP B;  2V7Q J;  2L5G B;  2OYH B;  3CCL P;  5AVS B;  2J59 M;  3WUV A;  3GF7 A;  2Z4E A;  2SPZ A;  3CC4 P;  3B5N C;  1L0L J;  2IBZ D;  2BCC J;  3A5T A;  2C9L Y;  1KYO I;  3M0D A;  1W2E A;  1NTZ K;  1X9V A;  1PFI A;  3L72 J;  3H1J D;  2YKP A;  1ZME C;  1DD4 A;  3WUT A;  5BU5 A;  1KIL A;  3V2N A;  3L73 J;  1J1D C;  2OTJ P;  3HUS C;  3P32 A;  1EDK A;  3AEC C;  2NZ2 A;  2L91 A;  1LTG C;  3AE8 C;  3H1H D;  2FYU E;  1KB9 E;  5CBO A;  1W5C E;  4TLF A;  2LXC B;  2ZT9 B;  4WY4 B;  1WMK A;  3HE5 B;  1EZV D;  2Y0E A;  3AEG C;  1JO5 A;  1KIL D;  4W7Z A;  2O1J A;  2J58 A;  4I7Z B;  2BCC G;  2RN0 A;  2A06 E;  5KLV D;  2Y0D A;  2AXT E;  1H89 A;  4BXL A;  2QJY C;  4M3L A;  3CPW O;  2AXC A;  2QJK C;  2WZ7 A;  2W6J H;  2QG4 A;  1QEX A;  3VN0 A;  2WSF H;  1HF9 A;  1AQT A;  2AXT H;  3EQ2 A;  4D6T J;  3P8M C;  5APS A;  3HTK A;  3CCS P;  3AE6 C;  2WSC H;  1KIL B;  1G1I A;  2Y9Z A;  1BE3 D;  1SQP D;  4IL6 X;  1SQQ E;  2OGU A;  3CL3 D;  5CJ4 A;  4PV1 D;  1K73 Q;  5APT A;  1PPJ D;  3JSV C;  1S9K D;  4HKZ H;  3L36 A;  1SQV K;  3AED C;  2B87 A;  2FY8 A;  1NU1 K;  5AW5 B;  3CCV P;  2YKO A;  1H8A A;  1PGO A;  1RF0 C;  3CC2 P;  4N78 D;  2HFE D;  1NTK E;  2E76 D;  2LKM A;  3M0A A;  4R4M A;  3E1I A;  1T6A A;  1LTJ B;  2AEM A;  3AE3 C;  1FZG A;  5CCG C;  1ZR4 A;  3HTK B;  1ZXG A;  1PGP A;  1SQB J;  3L74 J;  1NTM E;  3RK3 B;  2NPS C;  2K9J A;  2FYU D;  3HD7 C;  1LTS C;  1RHZ B;  1VF5 D;  3C1L A;  4O9B A;  1RE4 A;  1JY2 N;  1N7S A;  3GG2 A;  1S5L X;  2N1T A;  4YTP C;  4Z1M H;  2G3A A;  2E76 B;  3RK2 B;  2A06 D;  3SFE C;  2ZYD A;  1S2E A;  1LTB C;  1ZR2 A;  4NPF X;  3TSI A;  3CWB G;  2B87 B;  1EC5 A;  2OYH C;  5C39 A;  2MKV A;  5H2F E;  1VF5 B;  1FZC C;  2ZXX A;  1RE3 C;  3D6Z A;  4AUW A;  1S1C X;  3L74 G;  3VMA A;  1L0L K;  5APU A;  4BWN A;  1RH5 B;  4U3F D;  2P1J A;  5AW7 B;  3TGU E;  1Q82 Q;  3BCC J;  1SQQ D;  5H2F H;  2K9J B;  3WMM 0;  1L4A A;  2N9Y B;  3TK1 A;  3L71 E;  2E43 A;  3H1I D;  2LXB A;  1NKZ B;  1N7S B;  5GTI E;  1M56 D;  2H7H A;  2D2C D;  3CME P;  2N1T B;  1USE A;  1PP9 E;  2P58 A;  1SQX J;  5B5E E;  1HWT C;  4Y28 J;  5AW1 B;  1KFM A;  1IFM A;  1M1J A;  2WSS H;  3GHG A;  2WMM A;  1BDC A;  1OZH A;  3A0B E;  1U7J A;  2WPR A;  3V2Q A;  5GTI H;  1JCC A;  2Y0C A;  2B88 A;  3CI9 A;  3CCM P;  2IX7 C;  1HJ0 A;  4HYT B;  3VTP C;  5B5E H;  1MFZ A;  4I7Z C;  2R3S A;  1L0L D;  3R2P A;  2YO2 A;  1EDJ A;  2D2C B;  3BCC G;  2IFM A;  3A0B H;  4YPC A;  1NAY A;  3AEA C;  4EOT A;  4N6J A;  3H1K J;  2FXP A;  2KSE A;  2JWD A;  2C9N Y;  3M0D C;  3NXS A;  2W6B A;  3SFD C;  1L4A B;  1QVF O;  3L73 D;  1VQM P;  1VQ8 P;  1IO4 A;  4I2L C;  2IPP A;  1EXI A;  2IYO A;  4UB6 E;  4RO0 A;  3PH0 A;  1DEB A;  1M1K Q;  2WPV B;  1YQ4 C;  2IFN A;  1KOR A;  1M1J B;  3GHG B;  4H44 D;  3M9H A;  1NVO A;  3RBX A;  3P8C E;  3BAS A;  3I55 P;  1JY3 O;  1IFJ A;  2YNY A;  1IC2 A;  4UB6 H;  3W68 A;  2OYI A;  2H89 C;  3V2R A;  3H1K G;  3LID A;  1GU5 A;  2H43 A;  4JQ0 D;  2KOG A;  3JC2 2;  2KZI A;  4IL6 E;  1IFN A;  2G8Y A;  2WSE J;  1SFC A;  4PD4 I;  4I6M C;  4D6T D;  1FZB A;  3V4W A;  1LTI C;  2YKQ A;  5KLI B;  1NH4 A;  1VQ9 P;  2FYN B;  4DZO A;  2XZR A;  1SQB K;  2IBZ E;  2K9Y A;  2ZYG A;  4IL6 H;  4PV1 C;  2I1J A;  1FDI A;  3P7K A;  1EXJ A;  5APW A;  3FX0 A;  1SFC D;  2Z5H A;  1K05 A;  5EFW B;  3L75 G;  1HGV A;  3H1J E;  1T8Z A;  3Q5S A;  1MFT A;  1OIP A;  1X22 A;  4DT0 A;  3AE1 C;  2OYI B;  3BAT A;  4KHX A;  2E42 A;  1JMM A;  1KN7 A;  4RJT A;  3H1H E;  2ZVO B;  3U1A A;  1OWA A;  2WIT A;  2OQQ A;  1DX7 A;  2ZVN B;  2QJP B;  1EZV E;  2Z5I A;  1ZP0 C;  3JCU E;  1P84 I;  2WSF J;  1KIL E;  4AQR D;  1SFC B;  3I56 P;  1VF5 C;  1ZN5 A;  1LJ2 A;  5KLV E;  4JYB A;  1J2J B;  2E74 B;  3CX5 D;  2E5T A;  1FS0 E;  5KKZ C;  3V5B A;  1Z56 A;  3M9Q A;  4JPZ B;  1FZE A;  3JCU H;  3TF5 A;  1KD1 Q;  2RKL A;  1VQP P;  1ZRT D;  2GM4 A;  3HRN A;  2FYU G;  3KQG A;  1SQX K;  1Q86 Q;  1BE3 E;  2BEQ D;  1SQP E;  4IFD K;  1LT9 A;  1GU4 A;  2V4H A;  3T97 A;  1HJB A;  2JKV A;  5L8R J;  3CXH I;  2A06 G;  1JY3 N;  1RF1 C;  3ZDM A;  4GIF A;  4N3Y B;  1FJP A;  1CI6 A;  2XKM A;  1BGY D;  2IZ0 A;  2PP6 A;  1K9M Q;  1PPJ E;  5BVZ A;  3RK3 E;  5AVT B;  1S9K E;  1L0N D;  1GDT A;  3SSU A;  3BVH A;  1BCC E;  3O8Z A;  5AVY B;  2D2C C;  1M8O B;  2ZT9 D;  1KYO D;  3CCU P;  4WY4 D;  2WT7 A;  5AW4 B;  5AW8 B;  1YHQ P;  2HR3 A;  1CZQ A;  2Q9I A;  1RQV A;  4NPE A;  4N78 E;  3FXE A;  2OTL P;  1JY2 O;  1A02 J;  4OGQ C;  3NMD A;  1N73 A;  1SQX D;  1NOH A;  3SWK A;  1NTM J;  4XA4 A;  2JR8 A;  1LT9 B;  1QL1 A;  1M1J C;  4GOD A;  3T97 B;  1LT1 A;  3GHG C;  3H1L J;  1FC2 C;  3N4X A;  1Y9B A;  1CI6 B;  4TT3 H;  1X79 B;  1IJD B;  5AVV B;  1SQV E;  3AE4 C;  2OYO A;  3AE9 C;  1NTK G;  2C0X A;  1OXZ A;  1NU1 E;  1NYH A;  2FXO A;  2WT7 B;  3CLQ A;  1NTZ D;  1H0T A;  3CCJ P;  2P2U A;  1LTJ A;  1NJI Q;  2QE7 H;  1FDO A;  1S72 P;  1NTM G;  4H44 C;  3RGU A;  1VQN P;  2QA4 P;  3F89 A;  1N73 B;  4U3F E;  5AW3 B;  3SWF A;  3F5H A;  2YXR B;  3TGU J;  3H6P A;  1QVG O;  3GW6 A;  3H1L G;  3MGN A;  3KHU A;  1LTT C;  2O1K A;  1FDM A;  1LTA C;  3H1I E;  3VP9 A;  4GDO A;  2DW3 A;  1BSN A;  1DIP A;  4LGD E;  2K1A A;  3RK3 D;  1M57 D;  1QX8 A;  3E1R A;  2OYI C;  2AEF A;  1BCC D;  2O3J A;  3H25 A;  3B4S A;  3FWN A;  3A3Y B;  3L70 J;  1IFI A;  3U1C A;  4DJG A;  1JEK A;  2QJP C;  1EQ7 A;  3CWB J;  4H0L C;  1H0T B;  3V6I A;  3RK2 D;  1VQ6 P;  2K37 A;  1SFC C;  2KZJ A;  3MD0 A;  1JCD A;  3GF3 A;  5KTB A;  1L0L E;  3TGU G;  2BCC E;  2R5D A;  4IOI H;  5AVW B;  2V7Q H;  1QLE D;  1VQ4 P;  4YXD C;  2HYN A;  3L71 G;  1OW6 A;  1KV4 A;  4WWI A;  3L72 E;  2UWJ E;  1PP9 G;  4Y99 C;  2POH A;  3E7K A;  3A7O A;  4R4L A;  3GLM A;  3FGA D;  3L73 E;  1PL5 A;  1YBK A;  1VDF A;  1HH0 A;  1N8R Q;  2E75 B;  3LW5 J;  3L70 G;  1KB9 I;  2IYP A;  1SQV D;  1AFO A;  1NU1 D;  4BRY A;  1N7S D;  1ZLL A;  2B89 A;  2N1T D;  1FE6 A;  3PJS K;  3MUD C;  3PLN A;  1NHL A;  1M7L A;  4GOF A;  2WPS A;  2CK3 H;  4HH2 A;  2N9B A;  3H32 A;  4OWF A;  5CMZ A;  1J1E B;  4W80 A;  3O6Q A;  1YJ9 P;  4PD4 E;  1RQU A;  5AW6 B;  3B5N A;  4D6T E;  5APY A;  2M8R A;  3EWK A;  2ITA A;  1AQ5 A;  2QIW A;  2FXM A;  2KB7 P;  3M91 A;  5AVU B;  1VQL P;  4ASV A;  1NTM K;  1H88 A;  1FU1 A;  4PJ0 E;  4KJM A;  3MHV A;  4PD4 H;  1JB0 J;  2YO3 A;  1LP1 A;  2HOD A;  3B5N D;  3H1J J;  1L4A D;  1BDD A;  1X8Y A;  1OVR A;  4BRY B;  2ZT9 C;  2ZXE B;  4WY4 C;  3USS A;  2O01 J;  1VPC A;  3ABV C;  4PJ0 H;  1G2C A;  4LLH A;  1HGZ A;  1FAV A;  2W90 A;  3D71 A;  2QVA A;  3V2P A;  2BCC D;  2YIU B;  1W2B O;  3H1H J;  3AE2 C;  1U7M A;  3H32 B;  1D7M A;  3K5B A;  3PTZ A;  3L72 D;  3O6Q B;  2KUB A;  2C0W A;  2IBZ G;  1BSH A;  3B5N B;  5KLV J;  5TJH A;  3CX5 E;  1SQB E;  2NRG A;  2KP8 A;  1N73 C;  1KIL C;  3H1J G;  1AVO A;  1Q90 D;  1P84 H;  2WWW A;  2A45 H;  4WB4 A;  3C9I A;  4EDF A;  1JTH A;  2I1K A;  4C7R A;  1ZRT E;  2FBW C;  1LP1 B;  2GA1 A;  2HOD B;  1J1D B;  3CX5 H;  1OMI A;  3H1H G;  3L75 J;  1Y47 A;  1N7L A;  1KTM A;  1BE3 J;  1G2C B;  3D6Y A;  3AEE C;  1SQP J;  1QL2 A;  2OAR A;  1EZV G;  4ASW A;  1MKM A;  2XNX A;  3QH9 A;  2H8P D;  3CXH E;  5B66 E;  5KLV G;  2AEJ A;  2E5Y A;  1KQF B;  4HJG H;  4PD4 D;  1LNQ A;  1BGY E;  3W67 A;  1L0N E;  1LTJ C;  3L4F A;  1RF0 A;  3MZW B;  1HBW A;  4JBZ A;  1MUU A;  3CXH H;  5B66 H; 
#chains in the Genus database with same CATH homology
 5APT A;  3BVH A;  5AVQ B;  3RL0 B;  1LT9 C;  3O8Z A;  1S9K D;  5AVY B;  3UIA A;  3RK3 C;  3HUS A;  1FZA A;  5CCG A;  3L36 A;  4WY4 D;  2HG5 D;  2WT7 A;  1SQV K;  5AW4 B;  5AW8 B;  2FFD C;  4IFM A;  1JTH B;  1CZQ A;  2Q9I A;  1NU1 K;  1CW5 A;  4I1L A;  4N78 E;  3NTN A;  5AW5 B;  3BRT B;  2YKO A;  1H8A A;  3HD7 A;  1JY2 O;  1ZV8 A;  1T3J A;  1A02 J;  1RF0 C;  2Q3I A;  2WPQ A;  4N78 D;  2HFE D;  2LKM A;  3M0A A;  1RF1 B;  3NMD A;  1N73 A;  2HLO A;  3E1I A;  3RK2 C;  1NWQ A;  1LTJ B;  1FOS F;  4AYC A;  1T3U A;  1NOH A;  1FZG A;  2M3B A;  2KLV A;  3MIW A;  5CCG C;  5AW0 B;  4XA4 A;  1ZR4 A;  3OA7 A;  1E5W A;  3HTK B;  1SLQ A;  1LT9 B;  3NFQ A;  3RK3 B;  5CCH A;  4B86 A;  1QL1 A;  1M1J C;  3PP5 A;  2NPS C;  3GHG C;  3HD7 C;  1A02 F;  1LTS C;  2CPS A;  1YTZ T;  4O9B A;  1RE4 A;  4JF7 A;  1JY2 N;  3N4X A;  1N7S A;  3EFG A;  1CI6 B;  1X79 B;  2N1T A;  1IJD B;  5AVV B;  1GL2 A;  1FZC A;  1WRG A;  3RK2 B;  5BU8 B;  2C0X A;  1FZF A;  1OXZ A;  5CCH D;  1NKN A;  1IFD A;  1LTB C;  3HUS B;  2W27 A;  1ZR2 A;  2QM8 A;  3TSI A;  2WT7 B;  1HVV A;  3CLQ A;  5APX A;  3SWY A;  1RE4 C;  2P2U A;  1N7S C;  1LTJ A;  2N1T C;  3VYI A;  1GL2 D;  3HD7 B;  2OYH C;  1FZC C;  2HPC A;  1GW4 A;  1RE3 C;  1N73 B;  2BAS A;  4AUW A;  1G1J A;  1NO4 A;  5AW3 B;  1L0L K;  1LGH B;  3LW5 H;  5APU A;  3SWF A;  1FJK A;  3H6P A;  3G3Z A;  3VOP A;  4C46 A;  3MGN A;  2FFD A;  2P1J A;  1JNM A;  5AW7 B;  1LTT C;  1MZ9 A;  2O1K A;  2YMY A;  1FDM A;  1LTA C;  3U59 A;  3VP9 A;  4ZKP A;  3WMM 0;  2QM7 A;  2WTY A;  3OAK A;  5CJ0 A;  1L4A A;  3TK1 A;  1T2K C;  2E43 A;  4LGD E;  1NKZ B;  1N7S B;  2H7H A;  3RK3 D;  2JJL A;  2N1T B;  2OYI C;  2CPB A;  1GK6 A;  1GL2 B;  1FZC B;  4XE5 B;  4DOJ A;  3A3Y B;  1IK9 A;  5KJ7 C;  1GTW A;  1HWT C;  1KZU B;  5AW1 B;  1IFI A;  1KFM A;  3U1C A;  5KLV K;  1IFM A;  1M1J A;  1JY2 P;  2NPS A;  3GHG A;  1HTL C;  2WPR A;  3V2Q A;  1L4A C;  1EQ7 A;  2ZFC A;  3M9B A;  1JCC A;  3RK2 D;  1KQL A;  1SFC C;  3M06 A;  1URQ C;  3CI9 A;  1JCD A;  3MD0 A;  5KTB A;  2IX7 C;  2WSE H;  3OJA B;  1FBM A;  3MTU E;  3N7N A;  5CCG D;  3IFM A;  2R5D A;  2XU6 A;  1LWU C;  4HYT B;  3VTP C;  5AVW B;  2HPC B;  1MFZ A;  3TNU A;  1GZL A;  3R2P A;  2KYV A;  2YO2 A;  2HYN A;  2NPS D;  2IFM A;  3HD7 D;  3KPE A;  5APV A;  5APQ A;  2FKW B;  4EOT A;  4N6J A;  2FFD B;  4Y99 C;  2POH A;  3A7O A;  1SQP K;  3HE4 A;  1YYC A;  2C9N Y;  3M0D C;  2P7J A;  3NXS A;  2OYH A;  2W6B A;  2O01 H;  1VDF A;  1JOC A;  1HH0 A;  3VMZ A;  1NAF A;  1GD2 E;  1J1E C;  1L4A B;  5AVZ B;  1RE3 A;  2A45 I;  3MUD A;  2GUV A;  1IO4 A;  2MJZ A;  4I2L C;  2IPP A;  1L0N K;  3KYQ A;  2R32 A;  1AFO A;  5AW9 B;  3TYY A;  1DEB A;  4WBA A;  2W6A A;  1N7S D;  1ZLL A;  2Q7C A;  2IFN A;  3V4Q A;  3II6 A;  1M1J B;  2Q5U A;  3IR9 A;  2NPS B;  2N1T D;  3GHG B;  3M9H A;  2FYZ A;  4EIJ A;  3P8C E;  3BAS A;  4Y99 B;  2PAJ A;  4GT1 A;  1SVF A;  1JY3 O;  1JUN A;  1IFJ A;  2YNY A;  1NHL A;  1IC2 A;  3P8C D;  1M7L A;  2OYI A;  1N86 A;  2WPS A;  3RL0 C;  5AVX B;  3V2R A;  4HH2 A;  2N9B A;  3H32 A;  5CMZ A;  3LID A;  1J1E B;  1GU5 A;  4W80 A;  3TNU B;  2H43 A;  5KJ7 A;  4RES B;  5CHX A;  5AVR B;  2KOG A;  4LC1 A;  1HUC A;  2XDJ A;  1GW3 A;  2R3C A;  3B5N A;  5AW6 B;  1T2K D;  3VP8 A;  5APY A;  1CSB A;  1IFN A;  2M8R A;  1SFC A;  4ZKU A;  1AQ5 A;  4WY4 A;  2FXM A;  1URQ A;  2KB7 P;  3HE5 A;  3HE4 B;  2FYU K;  3M91 A;  4I6M C;  2VRS A;  1KFN A;  5AVU B;  1FZB A;  2L5G B;  3V4W A;  2OYH B;  1LTI C;  1LWU A;  1NTM K;  2YKQ A;  1FU1 A;  1H88 A;  1NH4 A;  5KJ7 D;  5AVS B;  4DZO A;  5AW2 B;  2J59 M;  1SQB K;  2XZR A;  3VMY A;  2JEE A;  2Z4E A;  2YO3 A;  2I1J A;  2HOD A;  3B5N D;  3P7K A;  1L4A D;  3B5N C;  3I5C A;  5APW A;  3L35 A;  2C9L Y;  3A5T A;  1X8Y A;  1SFC D;  2Z5H A;  4GKG A;  1URQ D;  2ZXE B;  4WY4 C;  1XTG B;  1N2D C;  1VPC A;  3M0D A;  1HGV A;  1T8Z A;  1W2E A;  1G2C A;  1NTZ K;  1FOS E;  3KDP B;  1YTZ I;  1X9V A;  4LLH A;  1PFI A;  1HGZ A;  1FAV A;  4C7N A;  3V2P A;  3L37 A;  2YKP A;  2OYI B;  3BAT A;  4KHX A;  1KIL A;  5BU5 A;  2E42 A;  1JMM A;  4IFF A;  3V2N A;  1J1D C;  3H32 B;  3U1A A;  3HUS C;  3P32 A;  1OWA A;  1LTG C;  2WIT A;  2C0W A;  1DX7 A;  1MV8 A;  4JYC A;  2Z5I A;  3B5N B;  4AQR D;  1SFC B;  4WY4 B;  1SQQ K;  1URQ B;  3HE5 B;  1WT6 A;  1ZN5 A;  1JO5 A;  4OH8 B;  2GUS A;  2KP8 A;  2R5B A;  1N73 C;  4JYB A;  1J2J B;  1KIL D;  1LWU B;  1KIL C;  4W7Z A;  2O1J A;  2J58 A;  2WWW A;  3LIE A;  2A45 H;  1H89 A;  4WB4 A;  3C9I A;  3V5B A;  1JTH A;  1Z56 A;  2I1K A;  3M9Q A;  4C7R A;  1FZE A;  4M3L A;  2HOD B;  2WZ7 A;  1J1D B;  1JY3 P;  5CCH C;  1GK4 A;  3VN0 A;  2WSF H;  1RF1 A;  1N7L A;  3RL0 D;  1G2C B;  2GM4 A;  3HRN A;  1QL2 A;  2OAR A;  3BRV B;  3KQG A;  3VMX A;  2A45 G;  1SQX K;  3EQ2 A;  4C7N B;  1NTK K;  1GL2 C;  3A2A A;  3P8M C;  2XNX A;  5APS A;  2H8P D;  3HTK A;  4IFD K;  1LT9 A;  2WSC H;  1KIL B;  1G1I A;  1GU4 A;  3T97 A;  1HJB A;  1RY3 A;  1DH3 A;  3B8E B;  1JY3 N;  1RF1 C;  1SP4 A;  4GIF A;  1LTJ C;  4N3Y B;  1FJP A;  2XV5 A;  1CI6 A;  1XTC C;  2XKM A;  2PP6 A;  2P67 A;  3L4F A;  4W7Y A;  1RF0 A;  5BVZ A;  1HBW A;  1S9K E;  5AVT B;  3CL3 D;  1MUU A;  2KSJ A;  1GDT A;  5CJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...