1URQB

Crystal structure of neuronal q-snares in complex with r-snare motif of tomosyn
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
64
structure length
64
Chain Sequence
ETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords M-TOMOSYN ISOFORM
publication title Structural Basis for the Inhibitory Role of Tomosyn in Exocytosis
pubmed doi rcsb
source organism Rattus norvegicus
total genus 30
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2003-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1urqB00
1N7SD 2NPSB 1SFCA 3RK3C 5CCHD 3RK3D 3HD7C 4WY4C 1XTGB 3HD7A 4OH8B 2HFED 4LGDE 3M0DC 3P8CE 2N1TC 4WY4D 3RK2D 2N1TA 1URQC 2HG5D 3B5ND 3TSIA 1KILD 1N7SA 1URQD 5CCGD 5CCHC 1SFCB 5CCHA 1JTHA 1T3JA 5KJ7C 1L4AD 3HD7B 3HTKB 3RK2C 2PP6A 4JF7A 4WY4A 5KJ7D 2N1TB 4W7ZA 2YMYA 3B5NC 2H8PD 3RL0D 1GL2C 3B5NA 1KILC 5CCGC 1KILA 5CCGA 1URQA 3KYQA 1N7SB 3VOPA 1GL2D 1NHLA 1JTHB 2NPSD 3RK3B 1L4AC 1L4AA 4WY4B 3RK2B 5KJ7A 3PP5A 3RL0C 3B5NB 1KILB 1URQB 1GL2A 1SFCC 4W80A 2NPSC 2NPSA 1SFCD 1L4AB 2WZ7A 1HVVA 2KOGA 2M8RA 4N78E 2XDJA 3HD7D 3RL0B 4W7YA 2N1TD 1N7SC 1GL2B
chains in the Genus database with same CATH superfamily
1CSBA 3CCQP 3A5TA 1K04A 1SQXK 4LC1A 3TDKA 1BCCJ 1PFIA 5KKZB 2HODB 2FFDC 4LGDE 3MTUE 3LW5J 2FYNB 3G4SP 3FX0A 2W6JH 2A45H 5E79H 1JY2P 1OW8A 2M3EA 1JTHA 2O3JA 2V7QH 1BE3D 3L73D 1M1JC 1BCCE 2HYNA 3HD7B 3FXEA 2IBZI 3USSA 4WY4A 2FYUK 1FZCB 3H1KJ 3B5NC 3V6IA 3ZDMA 1U57A 1JCDA 2KIKA 2JO1A 5CJ4A 2D2CC 1JY3P 1LWUA 2Q3EA 3BRTB 4RESB 2YIUC 2ZXEB 4PV1C 3RK3B 5BU8B 2FXPA 3O6QA 1EDJA 5KAFE 3AE1C 1IJDB 3LIEA 3U59A 2YO2A 2OGUA 1EC5A 1SP4A 2AXTH 3L74J 2YO3A 3HD7D 1SQBJ 1NTKE 3MUDC 1AQ5A 3AE6C 3GF7A 4JYCA 4HH2A 1QGKB 5KAIH 2IBZD 2WT7A 2ZJSE 2W90A 1KILE 2G8YA 3RK3D 1YIJP 1EDIA 3QWOC 5AVYB 1H89A 1SQPE 1SQBE 1NH4A 5B66H 3CCEP 4L76A 2QVAA 2IYOA 5TISE 1NYHA 5KLVJ 2A06G 3V5BA 1S5LX 4DOJA 1NU1D 3A7OA 3RK2C 4N3YB 3CCMP 5AVVB 1EXJA 2C0WA 3VOPA 4K35A 4Y99B 1BCCD 5KLVE 2OYIB 4EDFA 2J5UA 1LT9C 2RH0A 2KXPB 3L35A 2OQQA 1JEKA 1RF0A 2OYHA 2Q6QA 3BRVB 2O1KA 1EXIA 1KILB 3BATA 1VDFA 3ABVC 2Q1KA 3H1IE 4ZMDA 1FZFA 4IL6E 3SWKA 4JBZA 1G2CB 2HODA 1PL5A 3H1KD 1S9KD 1RF1C 3V2RA 4W7YA 3BVHA 5KTBA 4YXWH 5KLIC 5CJ0A 1T2KD 1DD3A 3Q1MA 5CCHD 1JM0A 3L72J 3HD7A 3CX5H 4U3FJ 1HUCA 4KJMA 2POHA 1FZCA 2KUBA 1QX8A 5K5GB 4XE5B 3CXHH 3HE5B 1ZXGA 3L74D 1KILD 5CCGD 1R8EA 3AE7C 2K9JB 3H1HJ 2Q5UA 1E79H 1SQBD 3L72E 2WSFJ 1NTKK 2SPZA 4DT0A 1QEXA 3M0DA 2FY8A 2YMYA 3B4SA 2BCCG 2Y9ZA 1N73C 3WU2H 1YQ4C 1L4AC 3M9QA 1SQPK 2R32A 3H1HE 1SQBK 1Q90D 1Y47A 1OFCX 3AEDC 3D6YA 4PD4I 5KLVD 2KNCB 1GDTA 1GU5A 1GW4A 3UIAA 4W80A 1M8OB 1L0LG 3AECC 3KZIE 1W5CE 1PPJG 3EFFK 2QM8A 1VQOP 1EZVG 3CLQA 3P8MC 2O01J 1HH0A 5H2FE 5KLVK 5GTIE 1PP9G 2MJZA 1JY3O 1MV8A 3OJAB 3HUSC 3L71G 2YKOA 1Q7YQ 2PGDA 3AEAC 4OH8B 5AW4B 2WSEH 1H8AA 1BSNA 1CZQA 2I1JA 1IO4A 3KQGA 1WMKA 2KSEA 3H32B 3PH0A 3CWBJ 5CCHA 3TGUJ 3H1LE 1GTWA 1OXZA 4PD4D 5AVUB 4JYBA 1LGHB 5L8RJ 5CHXA 1QL2A 4RJTA 1SQVG 3H1JG 3OA7A 2J58A 4H0LB 3L75G 3M0AA 2OYOA 1KILA 5CCGA 1L0NG 3L72D 3Q5SA 1QLED 1TU3F 1SQXJ 2WTYA 1SLQA 4U3FD 3TGUE 2FXMA 3RBXA 1Y9BA 1G2CA 3WMM0 3EQ2A 4M3LA 2XKMA 1KFNA 3BASA 3B5NB 1BDDA 1X8YA 1LTSC 2D2CB 3H1HD 3AE5C 3A0HE 3EFGA 5APVA 3VMAA 2P7JA 1ZRTE 3SSUA 2M3BA 4AQRD 1NKNA 1P84H 1PZQA 2FYUJ 3LW5H 5AVTB 2M0BA 4H0LD 3HE5A 3AEBC 3L36A 1IFMA 3NFQA 3BCCJ 1VF5B 3L70J 2K9JA 1FU1A 4H13B 2K1AA 1X9VA 1VQ4P 4I7ZB 5B5EH 2KS1B 1KB9I 3B5ND 1UIIA 2N9YB 2QG4A 1SFCB 3A2AA 4GODA 1IFJA 3BCCE 1FZAA 3L70E 3NTNA 1OVRA 5KJ7C 2V4HA 2Y0DA 4JF7A 4UB8E 1CW5A 3N4XA 1BDCA 2KNCA 3GW6A 1GZLA 1N7SB 4H44C 2Y9YA 2QIWA 1ZLLA 1NTMG 3MGNA 3JSVC 2CPBA 1ZMEC 1NO4A 1VQ6P 1M1KQ 3CC2P 1VF5D 4N6JA 2ZT9C 3A0BE 3RK2B 1JO5A 4H13D 3MZWB 3CWBD 1NTZG 3TGUD 1KQSO 1SFCD 4HJGH 2JKVA 3Q5RA 1LT9B 3M06A 4IL6X 3JCUE 5M1BA 3II6A 1KB9D 5EFWB 1FOSE 1FZGA 2KZJA 4MN4C 1GL2B 2BEQD 2YNYA 1ZRTD 3G6EP 3H32A 1SQXD 2IZ0A 3MHVA 1N7SD 1ZOYC 1N86A 3IN6A 1YHQP 5TJHA 4IFMA 2L91A 1NOHA 4IFFA 1RF1B 2ZYDA 4ASWA 3RK2D 4C7NB 1AA0A 5KLIB 1J1EC 1JOCA 5AVQB 1FZEA 2C9NY 2R44A 2P58A 1Y8AA 1EQ7A 1BE3G 3L73G 2FYUD 4GDOA 4IOIH 1FDIA 3IAOA 1LTIC 1LTJB 3NXSA 3B5NA 4WB4A 2IYPA 3BCCD 1GL2D 3L70D 1RE3C 1ZV8A 3PTZA 1IK7A 1AVYA 2Q3IA 3WUVA 5APSA 1AFOA 2PFXA 5AVXB 2Q9IA 4ZNCA 1D7MA 4JPZB 3N7NA 5GTHE 5DJTB 4PD4H 3AE4C 4I2LC 1MFTA 1PGPA 2A06E 1L4AB 2BASA 4OGQC 1VQNP 1JY2N 1NTKJ 3MUDA 2KS1A 2JWAA 1SQQJ 2O1JA 1SFCA 2E74B 1AVOA 3M9BA 2IBZG 3VP9A 1FE6A 4WY4C 1OW6A 1SQPJ 3P8CE 1VQPP 2H89C 2N1TC 1J1DB 1JY3N 1LWUC 3GHGB 2QSIA 1N7SA 1RY3A 1SQQE 2H7HA 1R5LA 4UB6H 1NU1G 1L4AD 1W2BO 4D6TJ 2LXBA 1NWQA 4EI2A 2XNXA 2JP3A 5GTIH 2ZVOB 2FXOA 4ASVA 2H43A 1BCCG 2E74D 3MP7B 5DJUB 1LT9A 3RL0C 1VPCA 2PAJA 4D6TE 2W6BA 3RL0g 2QJYC 3W67A 1URQB 1GL2A 2GM4A 4I6MC 2O01H 3H1IJ 1RE4C 1IFPA 1FJKA 2NZ2A 1KYOE 2Z5IA 3H1KG 1RF1A 5CBOA 4C7NA 2KB7P 1FBMA 1PGOA 5CMZA 4GOEA 1E5WA 4YTPC 1S5LH 4WWIA 3MIWA 4DJGA 2KP8A 1LT1A 1LTJA 2IPPA 2IX7C 1KB9H 1URQD 3CCVP 2HLOA 2G3AA 2P10A 1HBWA 3L74G 4OVNF 1Z56A 4NPEA 3P8CD 1DX7A 1PPJE 1NTKD 1HGVA 1RF0C 2OYHC 1KYOI 4C7RA 3IR9A 2AEFA 5E79E 1SQQD 1LTBC 2QJKC 2JWDA 1JNMA 4XA4A 2E76C 1SQPD 5KKZC 1L4AA 1BGYJ 1MUUA 3L71E 2WPQA 2FYNC 4PJ0H 3OW2O 4L73A 2OTJP 1LNQA 3OAKA 2C9LY 2KI7B 1SQQK 4H44B 2YXRB 2K88A 1JB0J 3D70A 2WZ7A 4D6TD 1HVVA 3CMEP 1BGYE 3U1AA 1KQLA 2A45I 2OTLP 2WPVB 1SQVE 1QVFO 3E1RA 1KN7A 3GHGA 3L75E 1JCCA 1KYOD 1PGQA 3RK3C 1ZW0A 2W27A 3C9IA 4AYCA 3VMZA 1ZP0C 1S3JA 1T8ZA 1PV3A 3M0DC 5APTA 2L5GB 3H1ID 3CCSP 5KAIE 3MD0A 4H44D 3FWLA 3H1LJ 3KDPB 4ZKPA 3Q3DA 2GA1A 5C39A 4HKZH 4GOFA 1QVGO 2ITAA 1FOSF 5B66E 1L2PA 2IFMA 2QA4P 2RKLA 1UIXA 2B9BA 5AVSB 3I56P 1URQA 3KYQA 2QE7H 1KFMA 2JEEA 1KQGB 3L72G 2OYIA 4U3FG 2FFDB 2OARA 3B8EB 1RQVA 1KORA 2AEMA 2LXCB 5AW0B 1EDLA 3H1HG 4TLFA 4WBAA 1M1JB 4OWFA 3CCLP 2KK7A 3D6ZA 2RMZA 2WPRA 1VQLP 1T2KC 3M91A 2WVRA 1OZHA 1GU4A 1DD4A 5BVZA 4C46A 2CK3H 1BGYD 2YIUB 4EOTA 4PV1B 2DW3A 3LIDA 1M7LA 5AVRB 4A7PA 2LKMA 3H6PA 1M56D 1ZR2A 3KPEA 3G3ZA 3V4QA 3V2PA 3VMYA 1DEBA 3PLNA 3CX5E 4RKUJ 1YJWP 1HWTC 4YXDC 3A3YB 2FKWB 1X22A 1SQVK 2N1TB 3CXHE 1DIPA 1VQ5P 5KAFH 1XTCC 1L0NK 1X0TA 3AE9C 2XZRA 1VQ8P 3FWNA 2D2CD 1K9MQ 3L4FA 1OW7A 1M90Q 1FS0E 1PGJA 4PV1D 3PP5A 3WU2E 1MKMA 2PRRA 1SVFA 3CWBG 3EWKA 3H1LD 2NPSC 2AEJA 3TGUG 3CD6P 1MFZA 2GUSA 1USEA 3C8VA 1OX3A 3CX5I 1GD2E 3L73E 1FDMA 3RL0B 3K5BA 2UWJE 2N1TD 1X79B 1GW3A 1WRGA 1H0TB 1Q81Q 3Q2YA 3ITKA 1NKZB 5TISH 1SQXG 1OVVA 3M9HA 3O8ZA 3VN0A 2QJPC 3PHLA 2HFED 2IFNA 1KV4A 3VMXA 1DH3A 2AXCA 2P2UA 2R5BA 4YPCA 1YBKA 5AW9B 5AVZB 1Q86Q 2R3SA 1IZNB 3V2NA 1T3JA 3TYYA 2WSCJ 2HR3A 3HTKB 2FFDA 1S2EA 2R5DA 2FYUG 3RL0D 2GUVA 2WSSH 3CX5D 1NTMK 3BCCG 1J2JB 4TT3H 3L70G 1LTAC 1HJ0A 3P7KA 4IL6H 4BRYB 3TK1A 2IBZE 1FZBA 2ZFCA 1NGMB 1A02J 1M1JA 1MZ9A 3RK3E 1YQ3C 4GKGA 2FBWC 1ZR4A 1Q82Q 1NTZK 1FAVA 2QJKB 2E76B 3SFDC 3VP8A 3KXDA 3F89A 2E43A 1YYCA 1M57D 1NU1E 3TNUB 4H0LC 3PRJA 1N2DC 1N73B 2XV5A 2W83C 1JUNA 1CI6B 3W68A 5APWA 1P84E 3AEEC 3F5HA 3CPWO 3RBZA 2KYVA 2E75C 1OVUA 2N1TA 4U7JA 1GMJA 5APQA 2HG5D 1S72P 3T97B 4NPFX 2E76D 1IK9A 4HB1A 2XNDH 4R4MA 3JC22 2C0XA 5B5EE 3H1KE 2WSFH 2N9BA 1LTTC 1S9KE 2H8PD 1IFNA 2E5YA 4JQ0D 3RGUA 1VF5C 2KZIA 1K05A 4DCKA 3KZIH 4B86A 3TF5A 2LR2A 3D71A 3HUSB 1LJ2A 1KMIZ 1P84I 4H13C 2KLVA 3R4YA 4I7ZC 2KSJA 5AW1B 3HRNA 3SWFA 1SFCC 1YTZI 1H0TA 2QM7A 1KQFB 5H2FH 3L74E 1RE4A 4N78E 1OMIA 5AW8B 3SWYA 2WWWA 1YTZT 1N7SC 2BCCJ 4EIJA 1G1JA 1RHZB 3U1CA 2YXQB 2WMMA 3HE4B 3AE3C 3CCJP 3HTKA 4IFDK 3S4RA 2P1JA 2A06D 2B87B 3TSIA 2BCCE 1P84D 1KD1Q 2ZVNB 1L0LJ 5AW7B 4BRYA 1NU1K 3CL3D 1AV1A 4Z1MH 1NTKG 1GK4A 4KT0J 3V4WA 2M5AB 1YJNP 1GL2C 1SQQG 3IFMA 3CC4P 2V7QJ 1PP9J 2Z4EA 1JMBA 1YITP 1L0LE 3A0HH 1IFDA 3E7KA 1SQPG 1SS1A 1AQTA 3L71J 4LLHA 1SQBG 4BXLA 2I1KA 3TNUA 3GF3A 3I5CA 4HYTB 1EZVE 3IF4A 1N73A 4RO0A 1N8RQ 1ZN5A 1CI6A 3PJSK 1U7JA 1PP9E 2FYZA 2M8RA 4D6TG 1KZUB 1RH5B 2W8ZA 1LTJC 4PD4E 3FXDA 1SQVJ 2WQYC 2Z5HA 3H1JJ 1GK6A 3VTPC 3L75J 5KLVG 1K73Q 2NPSB 1L0NJ 4N78D 2B89A 3Q5PA 3T97A 2K3RA 2R3CA 5APUA 4O9BA 1JMMA 3HD7C 1YJ9P 2JDIH 2ZT9B 4U3FE 1FZCC 3V2QA 2NRGA 2IDBA 1VQ7P 4UB8H 1EZVI 3H1JE 1G1IA 3H1IG 3R2PA 3NMDA 2HPCB 2AXTE 3CMAP 1L0NE 3AEGC 2P67A 2QJPB 2YMKA 5BU5A 1OIPA 3HUSA 2JR8A 2W6AA 2PP6A 3S1KA 5KJ7D 2BCCD 3A0BH 3FGAD 4BWNA 2J59M 1JY2O 2E74C 4UB6E 1AJYA 2XU6A 2NPSD 3B71A 2Y0EA 2I8DA 2QEXP 5AW5B 1PIXA 2A45G 3QH9A 4I1LA 1J1DC 3JCUH 3AE8C 5AW6B 2ZT9D 4GT1A 3GHGC 1NAYA 2VRSA 1L0LD 5CBNA 1LP1B 2K9YA 1J1EB 1PPJD 2WPSA 2Q7CA 3CC7P 3HE4A 2Y0CA 1EZVD 3GG2A 1RQUA 1VQKP 1PP9D 4ZKUA 3L37A 2B87A 4CPGA 1L0LK 2QRXA 3L71D 1NTMJ 1BGYG 1YI2P 4GIFA 3GMAA 1R5SA 3VYIA 2WSCH 2M5AA 2MKVA 1URQC 4WVZA 1S5LE 4Y99C 1VQMP 5CCHC 1NTZJ 3CWBE 2OYIC 5AW2B 2K37A 1NTME 3SFEC 1K8AQ 2JJLA 4OGQB 1A02F 1SQVD 3CI9A 3H1JD 5AW3B 1T3UA 3L75D 2E75B 5APXA 1KB9E 1U7MA 1KILC 5CCGC 1L0ND 3CCRP 5GTHH 4K3AA 3G71P 1NTZE 1JTHB 1NAFA 2IZ1A 5APYA 1SQXE 1KC8Q 1HJBA 3WUTA 3GLMA 1OWAA 1LTGC 2BEZF 4WY4B 2OTKE 5KJ7A 1HF9A 1S4XA 4R4LA 3C1LA 1LWUB 1HTLC 2NPSA 2B88A 3KHUA 3H1LG 4NPDA 1QL1A 2E42A 1FJPA 4PJ0E 2XDJA 1BE3J 3L73J 2ZXXA 3O6QB 4OGQD 1WT6A 4DZOA 2FYUE 2E75D 1IFIA 2HPCA 3E1IA 1NVOA 2H88C 2CPSA 2ZAEB 3P32A 4Y28J 1XTGB 1EDKA 1BE3E 4WY4D 2E5TA 4KHXA 1HGZA 3CXHI 2QJYB 3G9RA 3AEFC 2ZYGA 3CCUP 2WT7B 1DEEG 1VL2A 2ZYAA 2WSEJ 4W7ZA 2KLUA 4XFJA 3H25A 1W2EA 1NJIQ 1NTMD 1LP1A 2O01N 1NHLA 1N7LA 3S9OA 1VQ9P 4EYYQ 1USDA 3I55P 1Q2NA 1KYOH 3AE2C 1S1CX 2YKPA 1NTZD 1IC2A 4AUWA 1RE3A 2RN0A 1H88A 5AVWB 4L75A 1FDOA 2KOGA 1KTMA 4L74A 1T6AA 3CXHD 2YKQA 1NU1J 2OYHB 1BSHA 1FC2C 3WUUA 2WITA 4QMAA
chains in the Genus database with same CATH topology
3GHGA 3HE5A 1CSBA 1G1JA 1JCCA 3A5TA 1SQXK 3L36A 3RK3C 3U1CA 4LC1A 1IFMA 3NFQA 2W27A 3C9IA 4AYCA 3VMZA 1PFIA 2HODB 3HE4B 2FFDC 1FU1A 3HTKA 1T8ZA 4LGDE 3M0DC 5APTA 3MTUE 1X9VA 4IFDK 2A45H 2L5GB 2P1JA 3B5ND 1JY2P 3TSIA 3MD0A 1SFCB 3A2AA 1JTHA 5AW7B 3KDPB 1IFJA 4ZKPA 1FZAA 3NTNA 1M1JC 1NU1K 3CL3D 5KJ7C 2HYNA 3HD7B 4JF7A 1GK4A 4WY4A 3V4WA 1FOSF 2FYUK 2IFMA 1FZCB 1CW5A 3B5NC 1GL2C 3N4XA 5AVSB 1JCDA 1URQA 3KYQA 3IFMA 1GZLA 1N7SB 5CJ4A 1JY3P 1LWUA 3BRTB 1KFMA 4RESB 1ZLLA 3MGNA 2JEEA 2Z4EA 2CPBA 2ZXEB 3RK3B 5BU8B 2OYIA 1NO4A 1IFDA 4N6JA 4LLHA 3RK2B 2FFDB 1JO5A 2OARA 2I1KA 3TNUA 3B8EB 1IJDB 3LIEA 3I5CA 4HYTB 3U59A 2YO2A 1N73A 5AW0B 1SP4A 1ZN5A 1CI6A 1SFCD 2FYZA 1LT9B 2M8RA 3M06A 4WBAA 1M1JB 3II6A 2YO3A 1KZUB 3HD7D 1FOSE 1FZGA 1LTJC 2WPRA 1AQ5A 1T2KC 2Z5HA 1GK6A 3M91A 1GL2B 3VTPC 4JYCA 2YNYA 1GU4A 3H32A 4HH2A 1N7SD 2NPSB 4N78D 1N86A 5BVZA 4C46A 2WT7A 3T97A 4EOTA 2R3CA 5APUA 4O9BA 3RK3D 1JMMA 3HD7C 4IFMA 5AVYB 1H89A 3LIDA 1NOHA 1FZCC 4IFFA 1RF1B 3V2QA 1M7LA 3RK2D 5AVRB 1NH4A 2LKMA 4C7NB 3H6PA 1ZR2A 3KPEA 1G1IA 1J1EC 1JOCA 3R2PA 5AVQB 3G3ZA 3V4QA 3NMDA 1FZEA 2HPCB 3V2PA 3VMYA 2C9NY 3V5BA 4DOJA 1DEBA 1EQ7A 2P67A 3A7OA 5BU5A 1HWTC 3A3YB 3HUSA 2FKWB 2W6AA 2PP6A 3RK2C 4N3YB 5KJ7D 1LTIC 1SQVK 2N1TB 1LTJB 3NXSA 3B5NA 5AVVB 2J59M 4WB4A 1XTCC 2C0WA 1JY2O 1L0NK 3VOPA 4Y99B 1GL2D 1RE3C 2XZRA 2XU6A 2NPSD 2OYIB 1ZV8A 3L4FA 5AW5B 1LT9C 3L35A 2A45G 2Q3IA 5APSA 4I1LA 1J1DC 1AFOA 1RF0A 3PP5A 2OYHA 5AVXB 2Q9IA 5AW6B 4GT1A 3BRVB 2O1KA 3GHGC 3N7NA 1KILB 3BATA 2VRSA 1VDFA 1SVFA 4I2LC 1J1EB 2NPSC 1FZFA 1MFZA 2GUSA 2WPSA 1L4AB 2BASA 1G2CB 2HODA 2Q7CA 3HE4A 1S9KD 1GD2E 1RF1C 3V2RA 1JY2N 1FDMA 3RL0B 4W7YA 3MUDA 3BVHA 2N1TD 1X79B 5KTBA 4ZKUA 3L37A 1GW3A 5CJ0A 1T2KD 1WRGA 2O1JA 1L0LK 1NKZB 1SFCA 3M9HA 5CCHD 3M9BA 3O8ZA 3VN0A 3VP9A 4GIFA 4WY4C 3HD7A 2HFED 2IFNA 1HUCA 3P8CE 2POHA 2N1TC 2WSCH 1J1DB 3VYIA 3VMXA 1FZCA 1JY3N 1DH3A 1URQC 2P2UA 2R5BA 4XE5B 5AW9B 1LWUC 3GHGB 3HE5B 4Y99C 1KILD 1N7SA 5CCGD 5CCHC 5AVZB 1RY3A 3V2NA 2H7HA 2OYIC 1T3JA 5AW2B 2Q5UA 3TYYA 2JJLA 1L4AD 3HTKB 1NTKK 1A02F 3CI9A 2FFDA 2R5DA 5AW3B 1T3UA 3M0DA 2YMYA 3RL0D 5APXA 1NWQA 1KILC 5CCGC 1N73C 2GUVA 2XNXA 1NTMK 1J2JB 1JTHB 2H43A 1NAFA 1LTAC 5APYA 1L4AC 3M9QA 3P7KA 1HJBA 1SQPK 2R32A 3TK1A 1LT9A 1OWAA 1FZBA 1LTGC 2ZFCA 1A02J 1M1JA 4WY4B 5KJ7A 1SQBK 3RL0C 1MZ9A 1VPCA 2PAJA 2W6BA 4GKGA 1URQB 1ZR4A 1NTZK 1GL2A 1GDTA 2GM4A 1FAVA 1GU5A 1GW4A 1LWUB 4I6MC 4W80A 3UIAA 1HTLC 2O01H 2NPSA 2E42A 1QL1A 1RE4C 3VP8A 1FJPA 1FJKA 2E43A 1YYCA 2QM8A 2XDJA 2Z5IA 1WT6A 1RF1A 3TNUB 4DZOA 4C7NA 2KB7P 1FBMA 1N2DC 3CLQA 3P8MC 5CMZA 1HH0A 1N73B 1E5WA 2XV5A 5KLVK 2MJZA 1JUNA 1CI6B 1IFIA 1JY3O 2HPCA 3E1IA 1MV8A 3OJAB 5APWA 3MIWA 3HUSC 2CPSA 2YKOA 3P32A 1XTGB 2KP8A 4OH8B 5AW4B 2WSEH 4WY4D 1H8AA 2KYVA 1CZQA 2I1JA 2N1TA 1LTJA 1HGZA 4KHXA 5APQA 2HG5D 3KQGA 1IO4A 2IPPA 2IX7C 3H32B 1URQD 2HLOA 1HBWA 5CCHA 1Z56A 2WT7B 3P8CD 1DX7A 1GTWA 1IK9A 1HGVA 1OXZA 1RF0C 2OYHC 5AVUB 4JYBA 1LGHB 2C0XA 4C7RA 5CHXA 1QL2A 3IR9A 4W7ZA 2WSFH 2N9BA 1LTTC 3OA7A 1S9KE 2H8PD 2J58A 3M0AA 1W2EA 1IFNA 1KILA 5CCGA 1LTBC 1JNMA 4XA4A 1NHLA 1N7LA 2WTYA 1SLQA 4B86A 2FXMA 1L4AA 3HUSB 1G2CA 1MUUA 3WMM0 2KLVA 3EQ2A 4M3LA 2WPQA 2XKMA 1KFNA 3BASA 2YKPA 2KSJA 5AW1B 3HRNA 3B5NB 3OAKA 2C9LY 1SQQK 3SWFA 1X8YA 1SFCC 1YTZI 1LTSC 1IC2A 2QM7A 4AUWA 1RE3A 1H88A 3EFGA 5APVA 1RE4A 2P7JA 5AVWB 2WZ7A 1HVVA 2KOGA 4N78E 2M3BA 4AQRD 1NKNA 2YKQA 2OYHB 3U1AA 1KQLA 5AW8B 3SWYA 2A45I 2WWWA 1YTZT 2WITA 3LW5H 5AVTB 1N7SC 4EIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7S D;  2NPS B;  1SFC A;  3RK3 C;  5CCH D;  3RK3 D;  3HD7 C;  4WY4 C;  1XTG B;  3HD7 A;  4OH8 B;  2HFE D;  4LGD E;  3M0D C;  3P8C E;  2N1T C;  4WY4 D;  3RK2 D;  2N1T A;  1URQ C;  2HG5 D;  3B5N D;  3TSI A;  1KIL D;  1N7S A;  1URQ D;  5CCG D;  5CCH C;  1SFC B;  5CCH A;  1JTH A;  1T3J A;  5KJ7 C;  1L4A D;  3HD7 B;  3HTK B;  3RK2 C;  2PP6 A;  4JF7 A;  4WY4 A;  5KJ7 D;  2N1T B;  4W7Z A;  2YMY A;  3B5N C;  2H8P D;  3RL0 D;  1GL2 C;  3B5N A;  1KIL C;  5CCG C;  1KIL A;  5CCG A;  1URQ A;  3KYQ A;  1N7S B;  3VOP A;  1GL2 D;  1NHL A;  1JTH B;  2NPS D;  3RK3 B;  1L4A C;  1L4A A;  4WY4 B;  3RK2 B;  5KJ7 A;  3PP5 A;  3RL0 C;  3B5N B;  1KIL B;  1URQ B;  1GL2 A;  1SFC C;  4W80 A;  2NPS C;  2NPS A;  1SFC D;  1L4A B;  2WZ7 A;  1HVV A;  2KOG A;  2M8R A;  4N78 E;  2XDJ A;  3HD7 D;  3RL0 B;  4W7Y A;  2N1T D;  1N7S C;  1GL2 B; 
#chains in the Genus database with same CATH topology
 1CSB A;  3CCQ P;  3A5T A;  1K04 A;  1SQX K;  4LC1 A;  3TDK A;  1BCC J;  1PFI A;  5KKZ B;  2HOD B;  2FFD C;  4LGD E;  3MTU E;  3LW5 J;  2FYN B;  3G4S P;  3FX0 A;  2W6J H;  2A45 H;  5E79 H;  1JY2 P;  1OW8 A;  2M3E A;  1JTH A;  2O3J A;  2V7Q H;  1BE3 D;  3L73 D;  1M1J C;  1BCC E;  2HYN A;  3HD7 B;  3FXE A;  2IBZ I;  3USS A;  4WY4 A;  2FYU K;  1FZC B;  3H1K J;  3B5N C;  3V6I A;  3ZDM A;  1U57 A;  1JCD A;  2KIK A;  2JO1 A;  5CJ4 A;  2D2C C;  1JY3 P;  1LWU A;  2Q3E A;  3BRT B;  4RES B;  2YIU C;  2ZXE B;  4PV1 C;  3RK3 B;  5BU8 B;  2FXP A;  3O6Q A;  1EDJ A;  5KAF E;  3AE1 C;  1IJD B;  3LIE A;  3U59 A;  2YO2 A;  2OGU A;  1EC5 A;  1SP4 A;  2AXT H;  3L74 J;  2YO3 A;  3HD7 D;  1SQB J;  1NTK E;  3MUD C;  1AQ5 A;  3AE6 C;  3GF7 A;  4JYC A;  4HH2 A;  1QGK B;  5KAI H;  2IBZ D;  2WT7 A;  2ZJS E;  2W90 A;  1KIL E;  2G8Y A;  3RK3 D;  1YIJ P;  1EDI A;  3QWO C;  5AVY B;  1H89 A;  1SQP E;  1SQB E;  1NH4 A;  5B66 H;  3CCE P;  4L76 A;  2QVA A;  2IYO A;  5TIS E;  1NYH A;  5KLV J;  2A06 G;  3V5B A;  1S5L X;  4DOJ A;  1NU1 D;  3A7O A;  3RK2 C;  4N3Y B;  3CCM P;  5AVV B;  1EXJ A;  2C0W A;  3VOP A;  4K35 A;  4Y99 B;  1BCC D;  5KLV E;  2OYI B;  4EDF A;  2J5U A;  1LT9 C;  2RH0 A;  2KXP B;  3L35 A;  2OQQ A;  1JEK A;  1RF0 A;  2OYH A;  2Q6Q A;  3BRV B;  2O1K A;  1EXI A;  1KIL B;  3BAT A;  1VDF A;  3ABV C;  2Q1K A;  3H1I E;  4ZMD A;  1FZF A;  4IL6 E;  3SWK A;  4JBZ A;  1G2C B;  2HOD A;  1PL5 A;  3H1K D;  1S9K D;  1RF1 C;  3V2R A;  4W7Y A;  3BVH A;  5KTB A;  4YXW H;  5KLI C;  5CJ0 A;  1T2K D;  1DD3 A;  3Q1M A;  5CCH D;  1JM0 A;  3L72 J;  3HD7 A;  3CX5 H;  4U3F J;  1HUC A;  4KJM A;  2POH A;  1FZC A;  2KUB A;  1QX8 A;  5K5G B;  4XE5 B;  3CXH H;  3HE5 B;  1ZXG A;  3L74 D;  1KIL D;  5CCG D;  1R8E A;  3AE7 C;  2K9J B;  3H1H J;  2Q5U A;  1E79 H;  1SQB D;  3L72 E;  2WSF J;  1NTK K;  2SPZ A;  4DT0 A;  1QEX A;  3M0D A;  2FY8 A;  2YMY A;  3B4S A;  2BCC G;  2Y9Z A;  1N73 C;  3WU2 H;  1YQ4 C;  1L4A C;  3M9Q A;  1SQP K;  2R32 A;  3H1H E;  1SQB K;  1Q90 D;  1Y47 A;  1OFC X;  3AED C;  3D6Y A;  4PD4 I;  5KLV D;  2KNC B;  1GDT A;  1GU5 A;  1GW4 A;  3UIA A;  4W80 A;  1M8O B;  1L0L G;  3AEC C;  3KZI E;  1W5C E;  1PPJ G;  3EFF K;  2QM8 A;  1VQO P;  1EZV G;  3CLQ A;  3P8M C;  2O01 J;  1HH0 A;  5H2F E;  5KLV K;  5GTI E;  1PP9 G;  2MJZ A;  1JY3 O;  1MV8 A;  3OJA B;  3HUS C;  3L71 G;  2YKO A;  1Q7Y Q;  2PGD A;  3AEA C;  4OH8 B;  5AW4 B;  2WSE H;  1H8A A;  1BSN A;  1CZQ A;  2I1J A;  1IO4 A;  3KQG A;  1WMK A;  2KSE A;  3H32 B;  3PH0 A;  3CWB J;  5CCH A;  3TGU J;  3H1L E;  1GTW A;  1OXZ A;  4PD4 D;  5AVU B;  4JYB A;  1LGH B;  5L8R J;  5CHX A;  1QL2 A;  4RJT A;  1SQV G;  3H1J G;  3OA7 A;  2J58 A;  4H0L B;  3L75 G;  3M0A A;  2OYO A;  1KIL A;  5CCG A;  1L0N G;  3L72 D;  3Q5S A;  1QLE D;  1TU3 F;  1SQX J;  2WTY A;  1SLQ A;  4U3F D;  3TGU E;  2FXM A;  3RBX A;  1Y9B A;  1G2C A;  3WMM 0;  3EQ2 A;  4M3L A;  2XKM A;  1KFN A;  3BAS A;  3B5N B;  1BDD A;  1X8Y A;  1LTS C;  2D2C B;  3H1H D;  3AE5 C;  3A0H E;  3EFG A;  5APV A;  3VMA A;  2P7J A;  1ZRT E;  3SSU A;  2M3B A;  4AQR D;  1NKN A;  1P84 H;  1PZQ A;  2FYU J;  3LW5 H;  5AVT B;  2M0B A;  4H0L D;  3HE5 A;  3AEB C;  3L36 A;  1IFM A;  3NFQ A;  3BCC J;  1VF5 B;  3L70 J;  2K9J A;  1FU1 A;  4H13 B;  2K1A A;  1X9V A;  1VQ4 P;  4I7Z B;  5B5E H;  2KS1 B;  1KB9 I;  3B5N D;  1UII A;  2N9Y B;  2QG4 A;  1SFC B;  3A2A A;  4GOD A;  1IFJ A;  3BCC E;  1FZA A;  3L70 E;  3NTN A;  1OVR A;  5KJ7 C;  2V4H A;  2Y0D A;  4JF7 A;  4UB8 E;  1CW5 A;  3N4X A;  1BDC A;  2KNC A;  3GW6 A;  1GZL A;  1N7S B;  4H44 C;  2Y9Y A;  2QIW A;  1ZLL A;  1NTM G;  3MGN A;  3JSV C;  2CPB A;  1ZME C;  1NO4 A;  1VQ6 P;  1M1K Q;  3CC2 P;  1VF5 D;  4N6J A;  2ZT9 C;  3A0B E;  3RK2 B;  1JO5 A;  4H13 D;  3MZW B;  3CWB D;  1NTZ G;  3TGU D;  1KQS O;  1SFC D;  4HJG H;  2JKV A;  3Q5R A;  1LT9 B;  3M06 A;  4IL6 X;  3JCU E;  5M1B A;  3II6 A;  1KB9 D;  5EFW B;  1FOS E;  1FZG A;  2KZJ A;  4MN4 C;  1GL2 B;  2BEQ D;  2YNY A;  1ZRT D;  3G6E P;  3H32 A;  1SQX D;  2IZ0 A;  3MHV A;  1N7S D;  1ZOY C;  1N86 A;  3IN6 A;  1YHQ P;  5TJH A;  4IFM A;  2L91 A;  1NOH A;  4IFF A;  1RF1 B;  2ZYD A;  4ASW A;  3RK2 D;  4C7N B;  1AA0 A;  5KLI B;  1J1E C;  1JOC A;  5AVQ B;  1FZE A;  2C9N Y;  2R44 A;  2P58 A;  1Y8A A;  1EQ7 A;  1BE3 G;  3L73 G;  2FYU D;  4GDO A;  4IOI H;  1FDI A;  3IAO A;  1LTI C;  1LTJ B;  3NXS A;  3B5N A;  4WB4 A;  2IYP A;  3BCC D;  1GL2 D;  3L70 D;  1RE3 C;  1ZV8 A;  3PTZ A;  1IK7 A;  1AVY A;  2Q3I A;  3WUV A;  5APS A;  1AFO A;  2PFX A;  5AVX B;  2Q9I A;  4ZNC A;  1D7M A;  4JPZ B;  3N7N A;  5GTH E;  5DJT B;  4PD4 H;  3AE4 C;  4I2L C;  1MFT A;  1PGP A;  2A06 E;  1L4A B;  2BAS A;  4OGQ C;  1VQN P;  1JY2 N;  1NTK J;  3MUD A;  2KS1 A;  2JWA A;  1SQQ J;  2O1J A;  1SFC A;  2E74 B;  1AVO A;  3M9B A;  2IBZ G;  3VP9 A;  1FE6 A;  4WY4 C;  1OW6 A;  1SQP J;  3P8C E;  1VQP P;  2H89 C;  2N1T C;  1J1D B;  1JY3 N;  1LWU C;  3GHG B;  2QSI A;  1N7S A;  1RY3 A;  1SQQ E;  2H7H A;  1R5L A;  4UB6 H;  1NU1 G;  1L4A D;  1W2B O;  4D6T J;  2LXB A;  1NWQ A;  4EI2 A;  2XNX A;  2JP3 A;  5GTI H;  2ZVO B;  2FXO A;  4ASV A;  2H43 A;  1BCC G;  2E74 D;  3MP7 B;  5DJU B;  1LT9 A;  3RL0 C;  1VPC A;  2PAJ A;  4D6T E;  2W6B A;  3RL0 g;  2QJY C;  3W67 A;  1URQ B;  1GL2 A;  2GM4 A;  4I6M C;  2O01 H;  3H1I J;  1RE4 C;  1IFP A;  1FJK A;  2NZ2 A;  1KYO E;  2Z5I A;  3H1K G;  1RF1 A;  5CBO A;  4C7N A;  2KB7 P;  1FBM A;  1PGO A;  5CMZ A;  4GOE A;  1E5W A;  4YTP C;  1S5L H;  4WWI A;  3MIW A;  4DJG A;  2KP8 A;  1LT1 A;  1LTJ A;  2IPP A;  2IX7 C;  1KB9 H;  1URQ D;  3CCV P;  2HLO A;  2G3A A;  2P10 A;  1HBW A;  3L74 G;  4OVN F;  1Z56 A;  4NPE A;  3P8C D;  1DX7 A;  1PPJ E;  1NTK D;  1HGV A;  1RF0 C;  2OYH C;  1KYO I;  4C7R A;  3IR9 A;  2AEF A;  5E79 E;  1SQQ D;  1LTB C;  2QJK C;  2JWD A;  1JNM A;  4XA4 A;  2E76 C;  1SQP D;  5KKZ C;  1L4A A;  1BGY J;  1MUU A;  3L71 E;  2WPQ A;  2FYN C;  4PJ0 H;  3OW2 O;  4L73 A;  2OTJ P;  1LNQ A;  3OAK A;  2C9L Y;  2KI7 B;  1SQQ K;  4H44 B;  2YXR B;  2K88 A;  1JB0 J;  3D70 A;  2WZ7 A;  4D6T D;  1HVV A;  3CME P;  1BGY E;  3U1A A;  1KQL A;  2A45 I;  2OTL P;  2WPV B;  1SQV E;  1QVF O;  3E1R A;  1KN7 A;  3GHG A;  3L75 E;  1JCC A;  1KYO D;  1PGQ A;  3RK3 C;  1ZW0 A;  2W27 A;  3C9I A;  4AYC A;  3VMZ A;  1ZP0 C;  1S3J A;  1T8Z A;  1PV3 A;  3M0D C;  5APT A;  2L5G B;  3H1I D;  3CCS P;  5KAI E;  3MD0 A;  4H44 D;  3FWL A;  3H1L J;  3KDP B;  4ZKP A;  3Q3D A;  2GA1 A;  5C39 A;  4HKZ H;  4GOF A;  1QVG O;  2ITA A;  1FOS F;  5B66 E;  1L2P A;  2IFM A;  2QA4 P;  2RKL A;  1UIX A;  2B9B A;  5AVS B;  3I56 P;  1URQ A;  3KYQ A;  2QE7 H;  1KFM A;  2JEE A;  1KQG B;  3L72 G;  2OYI A;  4U3F G;  2FFD B;  2OAR A;  3B8E B;  1RQV A;  1KOR A;  2AEM A;  2LXC B;  5AW0 B;  1EDL A;  3H1H G;  4TLF A;  4WBA A;  1M1J B;  4OWF A;  3CCL P;  2KK7 A;  3D6Z A;  2RMZ A;  2WPR A;  1VQL P;  1T2K C;  3M91 A;  2WVR A;  1OZH A;  1GU4 A;  1DD4 A;  5BVZ A;  4C46 A;  2CK3 H;  1BGY D;  2YIU B;  4EOT A;  4PV1 B;  2DW3 A;  3LID A;  1M7L A;  5AVR B;  4A7P A;  2LKM A;  3H6P A;  1M56 D;  1ZR2 A;  3KPE A;  3G3Z A;  3V4Q A;  3V2P A;  3VMY A;  1DEB A;  3PLN A;  3CX5 E;  4RKU J;  1YJW P;  1HWT C;  4YXD C;  3A3Y B;  2FKW B;  1X22 A;  1SQV K;  2N1T B;  3CXH E;  1DIP A;  1VQ5 P;  5KAF H;  1XTC C;  1L0N K;  1X0T A;  3AE9 C;  2XZR A;  1VQ8 P;  3FWN A;  2D2C D;  1K9M Q;  3L4F A;  1OW7 A;  1M90 Q;  1FS0 E;  1PGJ A;  4PV1 D;  3PP5 A;  3WU2 E;  1MKM A;  2PRR A;  1SVF A;  3CWB G;  3EWK A;  3H1L D;  2NPS C;  2AEJ A;  3TGU G;  3CD6 P;  1MFZ A;  2GUS A;  1USE A;  3C8V A;  1OX3 A;  3CX5 I;  1GD2 E;  3L73 E;  1FDM A;  3RL0 B;  3K5B A;  2UWJ E;  2N1T D;  1X79 B;  1GW3 A;  1WRG A;  1H0T B;  1Q81 Q;  3Q2Y A;  3ITK A;  1NKZ B;  5TIS H;  1SQX G;  1OVV A;  3M9H A;  3O8Z A;  3VN0 A;  2QJP C;  3PHL A;  2HFE D;  2IFN A;  1KV4 A;  3VMX A;  1DH3 A;  2AXC A;  2P2U A;  2R5B A;  4YPC A;  1YBK A;  5AW9 B;  5AVZ B;  1Q86 Q;  2R3S A;  1IZN B;  3V2N A;  1T3J A;  3TYY A;  2WSC J;  2HR3 A;  3HTK B;  2FFD A;  1S2E A;  2R5D A;  2FYU G;  3RL0 D;  2GUV A;  2WSS H;  3CX5 D;  1NTM K;  3BCC G;  1J2J B;  4TT3 H;  3L70 G;  1LTA C;  1HJ0 A;  3P7K A;  4IL6 H;  4BRY B;  3TK1 A;  2IBZ E;  1FZB A;  2ZFC A;  1NGM B;  1A02 J;  1M1J A;  1MZ9 A;  3RK3 E;  1YQ3 C;  4GKG A;  2FBW C;  1ZR4 A;  1Q82 Q;  1NTZ K;  1FAV A;  2QJK B;  2E76 B;  3SFD C;  3VP8 A;  3KXD A;  3F89 A;  2E43 A;  1YYC A;  1M57 D;  1NU1 E;  3TNU B;  4H0L C;  3PRJ A;  1N2D C;  1N73 B;  2XV5 A;  2W83 C;  1JUN A;  1CI6 B;  3W68 A;  5APW A;  1P84 E;  3AEE C;  3F5H A;  3CPW O;  3RBZ A;  2KYV A;  2E75 C;  1OVU A;  2N1T A;  4U7J A;  1GMJ A;  5APQ A;  2HG5 D;  1S72 P;  3T97 B;  4NPF X;  2E76 D;  1IK9 A;  4HB1 A;  2XND H;  4R4M A;  3JC2 2;  2C0X A;  5B5E E;  3H1K E;  2WSF H;  2N9B A;  1LTT C;  1S9K E;  2H8P D;  1IFN A;  2E5Y A;  4JQ0 D;  3RGU A;  1VF5 C;  2KZI A;  1K05 A;  4DCK A;  3KZI H;  4B86 A;  3TF5 A;  2LR2 A;  3D71 A;  3HUS B;  1LJ2 A;  1KMI Z;  1P84 I;  4H13 C;  2KLV A;  3R4Y A;  4I7Z C;  2KSJ A;  5AW1 B;  3HRN A;  3SWF A;  1SFC C;  1YTZ I;  1H0T A;  2QM7 A;  1KQF B;  5H2F H;  3L74 E;  1RE4 A;  4N78 E;  1OMI A;  5AW8 B;  3SWY A;  2WWW A;  1YTZ T;  1N7S C;  2BCC J;  4EIJ A;  1G1J A;  1RHZ B;  3U1C A;  2YXQ B;  2WMM A;  3HE4 B;  3AE3 C;  3CCJ P;  3HTK A;  4IFD K;  3S4R A;  2P1J A;  2A06 D;  2B87 B;  3TSI A;  2BCC E;  1P84 D;  1KD1 Q;  2ZVN B;  1L0L J;  5AW7 B;  4BRY A;  1NU1 K;  3CL3 D;  1AV1 A;  4Z1M H;  1NTK G;  1GK4 A;  4KT0 J;  3V4W A;  2M5A B;  1YJN P;  1GL2 C;  1SQQ G;  3IFM A;  3CC4 P;  2V7Q J;  1PP9 J;  2Z4E A;  1JMB A;  1YIT P;  1L0L E;  3A0H H;  1IFD A;  3E7K A;  1SQP G;  1SS1 A;  1AQT A;  3L71 J;  4LLH A;  1SQB G;  4BXL A;  2I1K A;  3TNU A;  3GF3 A;  3I5C A;  4HYT B;  1EZV E;  3IF4 A;  1N73 A;  4RO0 A;  1N8R Q;  1ZN5 A;  1CI6 A;  3PJS K;  1U7J A;  1PP9 E;  2FYZ A;  2M8R A;  4D6T G;  1KZU B;  1RH5 B;  2W8Z A;  1LTJ C;  4PD4 E;  3FXD A;  1SQV J;  2WQY C;  2Z5H A;  3H1J J;  1GK6 A;  3VTP C;  3L75 J;  5KLV G;  1K73 Q;  2NPS B;  1L0N J;  4N78 D;  2B89 A;  3Q5P A;  3T97 A;  2K3R A;  2R3C A;  5APU A;  4O9B A;  1JMM A;  3HD7 C;  1YJ9 P;  2JDI H;  2ZT9 B;  4U3F E;  1FZC C;  3V2Q A;  2NRG A;  2IDB A;  1VQ7 P;  4UB8 H;  1EZV I;  3H1J E;  1G1I A;  3H1I G;  3R2P A;  3NMD A;  2HPC B;  2AXT E;  3CMA P;  1L0N E;  3AEG C;  2P67 A;  2QJP B;  2YMK A;  5BU5 A;  1OIP A;  3HUS A;  2JR8 A;  2W6A A;  2PP6 A;  3S1K A;  5KJ7 D;  2BCC D;  3A0B H;  3FGA D;  4BWN A;  2J59 M;  1JY2 O;  2E74 C;  4UB6 E;  1AJY A;  2XU6 A;  2NPS D;  3B71 A;  2Y0E A;  2I8D A;  2QEX P;  5AW5 B;  1PIX A;  2A45 G;  3QH9 A;  4I1L A;  1J1D C;  3JCU H;  3AE8 C;  5AW6 B;  2ZT9 D;  4GT1 A;  3GHG C;  1NAY A;  2VRS A;  1L0L D;  5CBN A;  1LP1 B;  2K9Y A;  1J1E B;  1PPJ D;  2WPS A;  2Q7C A;  3CC7 P;  3HE4 A;  2Y0C A;  1EZV D;  3GG2 A;  1RQU A;  1VQK P;  1PP9 D;  4ZKU A;  3L37 A;  2B87 A;  4CPG A;  1L0L K;  2QRX A;  3L71 D;  1NTM J;  1BGY G;  1YI2 P;  4GIF A;  3GMA A;  1R5S A;  3VYI A;  2WSC H;  2M5A A;  2MKV A;  1URQ C;  4WVZ A;  1S5L E;  4Y99 C;  1VQM P;  5CCH C;  1NTZ J;  3CWB E;  2OYI C;  5AW2 B;  2K37 A;  1NTM E;  3SFE C;  1K8A Q;  2JJL A;  4OGQ B;  1A02 F;  1SQV D;  3CI9 A;  3H1J D;  5AW3 B;  1T3U A;  3L75 D;  2E75 B;  5APX A;  1KB9 E;  1U7M A;  1KIL C;  5CCG C;  1L0N D;  3CCR P;  5GTH H;  4K3A A;  3G71 P;  1NTZ E;  1JTH B;  1NAF A;  2IZ1 A;  5APY A;  1SQX E;  1KC8 Q;  1HJB A;  3WUT A;  3GLM A;  1OWA A;  1LTG C;  2BEZ F;  4WY4 B;  2OTK E;  5KJ7 A;  1HF9 A;  1S4X A;  4R4L A;  3C1L A;  1LWU B;  1HTL C;  2NPS A;  2B88 A;  3KHU A;  3H1L G;  4NPD A;  1QL1 A;  2E42 A;  1FJP A;  4PJ0 E;  2XDJ A;  1BE3 J;  3L73 J;  2ZXX A;  3O6Q B;  4OGQ D;  1WT6 A;  4DZO A;  2FYU E;  2E75 D;  1IFI A;  2HPC A;  3E1I A;  1NVO A;  2H88 C;  2CPS A;  2ZAE B;  3P32 A;  4Y28 J;  1XTG B;  1EDK A;  1BE3 E;  4WY4 D;  2E5T A;  4KHX A;  1HGZ A;  3CXH I;  2QJY B;  3G9R A;  3AEF C;  2ZYG A;  3CCU P;  2WT7 B;  1DEE G;  1VL2 A;  2ZYA A;  2WSE J;  4W7Z A;  2KLU A;  4XFJ A;  3H25 A;  1W2E A;  1NJI Q;  1NTM D;  1LP1 A;  2O01 N;  1NHL A;  1N7L A;  3S9O A;  1VQ9 P;  4EYY Q;  1USD A;  3I55 P;  1Q2N A;  1KYO H;  3AE2 C;  1S1C X;  2YKP A;  1NTZ D;  1IC2 A;  4AUW A;  1RE3 A;  2RN0 A;  1H88 A;  5AVW B;  4L75 A;  1FDO A;  2KOG A;  1KTM A;  4L74 A;  1T6A A;  3CXH D;  2YKQ A;  1NU1 J;  2OYH B;  1BSH A;  1FC2 C;  3WUU A;  2WIT A;  4QMA A; 
#chains in the Genus database with same CATH homology
 3GHG A;  3HE5 A;  1CSB A;  1G1J A;  1JCC A;  3A5T A;  1SQX K;  3L36 A;  3RK3 C;  3U1C A;  4LC1 A;  1IFM A;  3NFQ A;  2W27 A;  3C9I A;  4AYC A;  3VMZ A;  1PFI A;  2HOD B;  3HE4 B;  2FFD C;  1FU1 A;  3HTK A;  1T8Z A;  4LGD E;  3M0D C;  5APT A;  3MTU E;  1X9V A;  4IFD K;  2A45 H;  2L5G B;  2P1J A;  3B5N D;  1JY2 P;  3TSI A;  3MD0 A;  1SFC B;  3A2A A;  1JTH A;  5AW7 B;  3KDP B;  1IFJ A;  4ZKP A;  1FZA A;  3NTN A;  1M1J C;  1NU1 K;  3CL3 D;  5KJ7 C;  2HYN A;  3HD7 B;  4JF7 A;  1GK4 A;  4WY4 A;  3V4W A;  1FOS F;  2FYU K;  2IFM A;  1FZC B;  1CW5 A;  3B5N C;  1GL2 C;  3N4X A;  5AVS B;  1JCD A;  1URQ A;  3KYQ A;  3IFM A;  1GZL A;  1N7S B;  5CJ4 A;  1JY3 P;  1LWU A;  3BRT B;  1KFM A;  4RES B;  1ZLL A;  3MGN A;  2JEE A;  2Z4E A;  2CPB A;  2ZXE B;  3RK3 B;  5BU8 B;  2OYI A;  1NO4 A;  1IFD A;  4N6J A;  4LLH A;  3RK2 B;  2FFD B;  1JO5 A;  2OAR A;  2I1K A;  3TNU A;  3B8E B;  1IJD B;  3LIE A;  3I5C A;  4HYT B;  3U59 A;  2YO2 A;  1N73 A;  5AW0 B;  1SP4 A;  1ZN5 A;  1CI6 A;  1SFC D;  2FYZ A;  1LT9 B;  2M8R A;  3M06 A;  4WBA A;  1M1J B;  3II6 A;  2YO3 A;  1KZU B;  3HD7 D;  1FOS E;  1FZG A;  1LTJ C;  2WPR A;  1AQ5 A;  1T2K C;  2Z5H A;  1GK6 A;  3M91 A;  1GL2 B;  3VTP C;  4JYC A;  2YNY A;  1GU4 A;  3H32 A;  4HH2 A;  1N7S D;  2NPS B;  4N78 D;  1N86 A;  5BVZ A;  4C46 A;  2WT7 A;  3T97 A;  4EOT A;  2R3C A;  5APU A;  4O9B A;  3RK3 D;  1JMM A;  3HD7 C;  4IFM A;  5AVY B;  1H89 A;  3LID A;  1NOH A;  1FZC C;  4IFF A;  1RF1 B;  3V2Q A;  1M7L A;  3RK2 D;  5AVR B;  1NH4 A;  2LKM A;  4C7N B;  3H6P A;  1ZR2 A;  3KPE A;  1G1I A;  1J1E C;  1JOC A;  3R2P A;  5AVQ B;  3G3Z A;  3V4Q A;  3NMD A;  1FZE A;  2HPC B;  3V2P A;  3VMY A;  2C9N Y;  3V5B A;  4DOJ A;  1DEB A;  1EQ7 A;  2P67 A;  3A7O A;  5BU5 A;  1HWT C;  3A3Y B;  3HUS A;  2FKW B;  2W6A A;  2PP6 A;  3RK2 C;  4N3Y B;  5KJ7 D;  1LTI C;  1SQV K;  2N1T B;  1LTJ B;  3NXS A;  3B5N A;  5AVV B;  2J59 M;  4WB4 A;  1XTC C;  2C0W A;  1JY2 O;  1L0N K;  3VOP A;  4Y99 B;  1GL2 D;  1RE3 C;  2XZR A;  2XU6 A;  2NPS D;  2OYI B;  1ZV8 A;  3L4F A;  5AW5 B;  1LT9 C;  3L35 A;  2A45 G;  2Q3I A;  5APS A;  4I1L A;  1J1D C;  1AFO A;  1RF0 A;  3PP5 A;  2OYH A;  5AVX B;  2Q9I A;  5AW6 B;  4GT1 A;  3BRV B;  2O1K A;  3GHG C;  3N7N A;  1KIL B;  3BAT A;  2VRS A;  1VDF A;  1SVF A;  4I2L C;  1J1E B;  2NPS C;  1FZF A;  1MFZ A;  2GUS A;  2WPS A;  1L4A B;  2BAS A;  1G2C B;  2HOD A;  2Q7C A;  3HE4 A;  1S9K D;  1GD2 E;  1RF1 C;  3V2R A;  1JY2 N;  1FDM A;  3RL0 B;  4W7Y A;  3MUD A;  3BVH A;  2N1T D;  1X79 B;  5KTB A;  4ZKU A;  3L37 A;  1GW3 A;  5CJ0 A;  1T2K D;  1WRG A;  2O1J A;  1L0L K;  1NKZ B;  1SFC A;  3M9H A;  5CCH D;  3M9B A;  3O8Z A;  3VN0 A;  3VP9 A;  4GIF A;  4WY4 C;  3HD7 A;  2HFE D;  2IFN A;  1HUC A;  3P8C E;  2POH A;  2N1T C;  2WSC H;  1J1D B;  3VYI A;  3VMX A;  1FZC A;  1JY3 N;  1DH3 A;  1URQ C;  2P2U A;  2R5B A;  4XE5 B;  5AW9 B;  1LWU C;  3GHG B;  3HE5 B;  4Y99 C;  1KIL D;  1N7S A;  5CCG D;  5CCH C;  5AVZ B;  1RY3 A;  3V2N A;  2H7H A;  2OYI C;  1T3J A;  5AW2 B;  2Q5U A;  3TYY A;  2JJL A;  1L4A D;  3HTK B;  1NTK K;  1A02 F;  3CI9 A;  2FFD A;  2R5D A;  5AW3 B;  1T3U A;  3M0D A;  2YMY A;  3RL0 D;  5APX A;  1NWQ A;  1KIL C;  5CCG C;  1N73 C;  2GUV A;  2XNX A;  1NTM K;  1J2J B;  1JTH B;  2H43 A;  1NAF A;  1LTA C;  5APY A;  1L4A C;  3M9Q A;  3P7K A;  1HJB A;  1SQP K;  2R32 A;  3TK1 A;  1LT9 A;  1OWA A;  1FZB A;  1LTG C;  2ZFC A;  1A02 J;  1M1J A;  4WY4 B;  5KJ7 A;  1SQB K;  3RL0 C;  1MZ9 A;  1VPC A;  2PAJ A;  2W6B A;  4GKG A;  1URQ B;  1ZR4 A;  1NTZ K;  1GL2 A;  1GDT A;  2GM4 A;  1FAV A;  1GU5 A;  1GW4 A;  1LWU B;  4I6M C;  4W80 A;  3UIA A;  1HTL C;  2O01 H;  2NPS A;  2E42 A;  1QL1 A;  1RE4 C;  3VP8 A;  1FJP A;  1FJK A;  2E43 A;  1YYC A;  2QM8 A;  2XDJ A;  2Z5I A;  1WT6 A;  1RF1 A;  3TNU B;  4DZO A;  4C7N A;  2KB7 P;  1FBM A;  1N2D C;  3CLQ A;  3P8M C;  5CMZ A;  1HH0 A;  1N73 B;  1E5W A;  2XV5 A;  5KLV K;  2MJZ A;  1JUN A;  1CI6 B;  1IFI A;  1JY3 O;  2HPC A;  3E1I A;  1MV8 A;  3OJA B;  5APW A;  3MIW A;  3HUS C;  2CPS A;  2YKO A;  3P32 A;  1XTG B;  2KP8 A;  4OH8 B;  5AW4 B;  2WSE H;  4WY4 D;  1H8A A;  2KYV A;  1CZQ A;  2I1J A;  2N1T A;  1LTJ A;  1HGZ A;  4KHX A;  5APQ A;  2HG5 D;  3KQG A;  1IO4 A;  2IPP A;  2IX7 C;  3H32 B;  1URQ D;  2HLO A;  1HBW A;  5CCH A;  1Z56 A;  2WT7 B;  3P8C D;  1DX7 A;  1GTW A;  1IK9 A;  1HGV A;  1OXZ A;  1RF0 C;  2OYH C;  5AVU B;  4JYB A;  1LGH B;  2C0X A;  4C7R A;  5CHX A;  1QL2 A;  3IR9 A;  4W7Z A;  2WSF H;  2N9B A;  1LTT C;  3OA7 A;  1S9K E;  2H8P D;  2J58 A;  3M0A A;  1W2E A;  1IFN A;  1KIL A;  5CCG A;  1LTB C;  1JNM A;  4XA4 A;  1NHL A;  1N7L A;  2WTY A;  1SLQ A;  4B86 A;  2FXM A;  1L4A A;  3HUS B;  1G2C A;  1MUU A;  3WMM 0;  2KLV A;  3EQ2 A;  4M3L A;  2WPQ A;  2XKM A;  1KFN A;  3BAS A;  2YKP A;  2KSJ A;  5AW1 B;  3HRN A;  3B5N B;  3OAK A;  2C9L Y;  1SQQ K;  3SWF A;  1X8Y A;  1SFC C;  1YTZ I;  1LTS C;  1IC2 A;  2QM7 A;  4AUW A;  1RE3 A;  1H88 A;  3EFG A;  5APV A;  1RE4 A;  2P7J A;  5AVW B;  2WZ7 A;  1HVV A;  2KOG A;  4N78 E;  2M3B A;  4AQR D;  1NKN A;  2YKQ A;  2OYH B;  3U1A A;  1KQL A;  5AW8 B;  3SWY A;  2A45 I;  2WWW A;  1YTZ T;  2WIT A;  3LW5 H;  5AVT B;  1N7S C;  4EIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...