1URQB

Crystal structure of neuronal q-snares in complex with r-snare motif of tomosyn
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
64
structure length
64
Chain Sequence
b'ETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords M-TOMOSYN ISOFORM
molecule tags Transport protein
source organism Rattus norvegicus
publication title Structural Basis for the Inhibitory Role of Tomosyn in Exocytosis
pubmed doi rcsb
total genus 30
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2003-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1urqB00
1NHLA 5CCGC 3RL0B 1GL2C 2HG5D 5CCHD 2M8RA 4WY4D 2NPSA 4JF7A 1T3JA 4W7YA 2NPSC 1URQD 1JTHB 2NPSB 1L4AD 1N7SD 2KOGA 3RK3D 3RK3B 2PP6A 3HD7C 1L4AB 1N7SB 3TSIA 1KILB 3HD7A 2NPSD 3RL0C 1URQB 1N7SC 1GL2D 3M0DC 2N1TC 1URQC 1KILA 2YMYA 4WY4C 1URQA 3HTKB 3B5NC 3RK2C 3P8CE 1SFCB 1GL2A 2H8PD 2N1TD 1SFCC 3RK2B 1KILD 4W80A 3B5NB 1SFCA 1GL2B 3KYQA 5CCGA 5CCHC 5KJ7A 3VOPA 4LGDE 5CCHA 5KJ7C 1XTGB 2XDJA 4OH8B 4WY4A 4N78E 3B5ND 3RL0D 2N1TA 3RK3C 2WZ7A 5CCGD 1KILC 2N1TB 3HD7B 1HVVA 4WY4B 5KJ7D 2HFED 3RK2D 1SFCD 4W7ZA 1L4AA 1N7SA 1JTHA 3HD7D 3B5NA 3PP5A 1L4AC
chains in the Genus database with same CATH superfamily
3KDPB 1H89A 1CZQA 5APQA 1H88A 3C1LA 1FOSF 3H1KD 1NHLA 2G3AA 2WQYC 3L72J 1GL2C 3AEDC 3R4YA 4WB4A 3CCVP 3C9IA 1T8ZA 2M8RA 1WMKA 1FZEA 2YO3A 1NAYA 4PV1D 3SFDC 2K88A 3CCMP 1S3JA 3KPEA 4DJGA 5TISH 1U7JA 4H0LB 4W7YA 2Z4EA 1X0TA 1BGYJ 4RESB 1JTHB 1NTKD 1M56D 4YPCA 2HODA 2NPSB 1SQPE 3CI9A 3MUDA 1PGQA 5AW1B 2FYUG 3NXSA 5CBNA 2K3RA 1SQPD 3GMAA 2L91A 4ZKPA 4WBAA 3M9QA 2P67A 2KP8A 2J5UA 5AW0B 5KAFE 3SFEC 3VP8A 1FZCA 1IZNB 2P58A 3VMAA 4MN4C 1MKMA 4K35A 1KD1Q 2H43A 2KNCB 1NOHA 2WVRA 1NO4A 5APXA 3SWYA 3HD7C 1YITP 1YI2P 1YTZT 2HYNA 2QRXA 3L72E 4CPGA 2R5DA 3P8MC 1Q2NA 5KKZB 2AXTH 1KFNA 3AEFC 3HD7A 2O3JA 1X9VA 1VQOP 4RO0A 1HWTC 1URQB 1NTKK 3FXEA 4OWFA 3JC22 1PP9J 2A45I 2HPCB 3TGUJ 1OW8A 3NMDA 2HLOA 3AE3C 4WWIA 1SQQE 5CJ0A 3M0DC 5APYA 2J58A 5APVA 3HE5B 1SQQD 3GHGA 3P32A 4H13C 3V2QA 1YQ4C 1EZVD 5KLVJ 1JNMA 2AEMA 1URQC 3E7KA 1M7LA 5H2FH 4KT0J 2GUSA 3CXHD 5AW2B 1NTKG 3F5HA 4WY4C 1SQXG 1URQA 3G9RA 2J59M 1U7MA 2AXTE 2ZXEB 3HTKB 3L73J 5APTA 3T97A 1PGPA 1ZRTD 2OGUA 1YTZI 4IFMA 1EDIA 1AJYA 2B87B 3SWFA 1SQPG 5AVRB 1NTZG 1PV3A 2FYUE 1JMMA 2JWDA 1LTJA 4AUWA 1NTMK 3FWLA 4H44B 2Q1KA 2JEEA 3CC7P 2JO1A 1LTJB 1ZV8A 3USSA 2Q3EA 1FU1A 2FYUJ 2E76B 3B71A 1QL1A 2FXOA 4Y28J 1YQ3C 2NRGA 2YXQB 3B5NB 3E1RA 4R4MA 1YJ9P 1R8EA 1GMJA 1MUUA 5APUA 3H1KG 1NTME 2BCCD 1AQTA 1N86A 2RH0A 3O6QB 3L73E 3S9OA 1IFNA 2ZJSE 3VP9A 3Q3DA 3KYQA 1JY3P 2K37A 1VQPP 3BCCG 3CWBJ 4BXLA 1RQVA 5CCGA 2KLVA 1X8YA 1W5CE 1T6AA 3AEBC 5KLVD 5KJ7A 1FZFA 2E74B 1NTKJ 1JY2O 2D2CC 3WU2E 4EOTA 1JCDA 3A0HE 1M8OB 5KLVE 2POHA 1BE3G 4I1LA 5AVTB 1SVFA 1UIXA 4GOFA 2B9BA 4NPDA 4OH8B 5AVWB 2KXPB 3K5BA 5CHXA 1EDLA 2I1KA 4N78E 3ABVC 1WT6A 1ZRTE 1HBWA 1SQVE 1DD3A 1BCCJ 2Z5IA 3A7OA 4XFJA 4IL6X 1KZUB 1IFJA 1QVGO 1AQ5A 1M1JA 2FFDB 1KILC 5GTHE 1JMBA 1FZAA 1MFTA 1RH5B 1OVVA 2KYVA 3AE1C 3PHLA 5BU5A 3HD7B 1HVVA 3H32A 1OWAA 2CK3H 2E5YA 1HTLC 1KFMA 1KMIZ 1S5LX 2E42A 2V7QH 3RK2D 4OVNF 2IBZE 1SFCD 2ZXXA 4GT1A 3A0HH 4L76A 3GLMA 2FYUK 2XKMA 1X22A 2IBZG 3CL3D 2IBZI 1SQPJ 2IBZD 1W2BO 3L75J 2WSFJ 3HD7D 1NU1K 1BGYE 1PGJA 3HE5A 3IAOA 4QMAA 3S1KA 4ZMDA 1OIPA 1JOCA 3L74E 2ZT9C 3IF4A 2E5TA 1KC8Q 3L70D 2C9NY 1OW6A 3FWNA 2M5AA 1NH4A 1ZP0C 1WRGA 5GTHH 5CCGC 1S2EA 1J1EB 3RL0B 3OJAB 1SQXD 1MV8A 1BE3J 1ZXGA 3G6EP 2QA4P 1NU1G 1KB9I 2OTJP 3A5TA 4JF7A 1NTZE 1T3JA 2QEXP 1SQBG 2B87A 2NPSC 4DOJA 1RE3C 3L72D 3L75E 2YIUC 2O01N 3D6ZA 2Q7CA 2KSEA 1JY2P 3HTKA 1M57D 3LIDA 1HJBA 1L4AD 1N7SD 1PZQA 3A0BH 4L75A 3WUUA 1GDTA 2QJYC 3O8ZA 3VMXA 4HJGH 2Y9ZA 2KB7P 1YJNP 2G8YA 3JCUE 1FAVA 2KUBA 5AVYB 1OVRA 1LJ2A 1U57A 4RJTA 1YIJP 1K9MQ 4L73A 3M06A 4PD4H 2E74D 1KQFB 3U1AA 3U59A 1BCCE 2FKWB 1K73Q 2ZVNB 2WSCH 2FYZA 2YMKA 3VMYA 1GL2D 3CCLP 1USEA 1BGYD 2WTYA 3H1LG 1IFMA 5TJHA 1BGYG 1K05A 3L74D 4YTPC 2I1JA 1CSBA 3HE4A 3L70E 1LWUC 1PPJG 2E76D 2KNCA 3Q1MA 2Q9IA 1NTKE 2IYPA 4KJMA 2FYUD 1VQKP 1FZCB 1SQXE 4D6TJ 2OYHB 1QVFO 3C8VA 4I6MC 4OGQC 5AVVB 1T2KC 1DX7A 3L71J 1LTSC 1QGKB 3BRVB 2P10A 2CPSA 2WSCJ 3B5NC 3OW2O 1GU4A 1NTMJ 3BCCJ 1QL2A 2WITA 3CWBG 3CX5I 2KSJA 1L0LJ 4EDFA 1CW5A 1ZR2A 1Q90D 1EQ7A 2NZ2A 1KN7A 1FBMA 1KB9E 4UB6H 3VN0A 3TDKA 2FXMA 4Y99B 5M1BA 3TK1A 2OYIC 2C0WA 4GODA 1JUNA 2Y0DA 1Y8AA 3F89A 3L73D 1ZR4A 2N1TD 3E1IA 2YKOA 2QM8A 5B5EH 2B89A 1LP1B 1LT9C 1SP4A 3AEGC 3RK2B 2Y0CA 3FGAD 3L71D 4NPFX 4WVZA 1DIPA 3CMAP 1LP1A 2IX7C 4YXWH 3D70A 1N2DC 3AE6C 1L0NE 1VQ4P 4DZOA 2AEJA 3CCUP 1GW3A 4TT3H 1LTGC 2ITAA 2O1KA 3CC2P 1AA0A 1IFDA 3MIWA 4N78D 1L0NJ 1LT9B 1AVYA 2YNYA 3HUSA 1SLQA 1ZMEC 2FBWC 2O1JA 1RY3A 3H1HJ 4AYCA 1M1JC 1LNQA 2E43A 4BRYA 5AW9B 4LGDE 3MP7B 2OQQA 2E76C 3QH9A 4N6JA 5CCHA 2QIWA 5KAFH 2ZVOB 2JKVA 2Q3IA 5APSA 5AW4B 3V4QA 1EC5A 1DD4A 3LIEA 5GTIH 1YBKA 3MD0A 2KI7B 1SQVG 2KLUA 1OX3A 2PAJA 2YXRB 1BSHA 1FDIA 2O01J 1JEKA 1UIIA 3BATA 3U1CA 1S9KE 2N9BA 1A02J 2GM4A 3H1IG 1RHZB 2FYNB 4R4LA 2KS1A 3RL0D 2N1TA 2P7JA 3RK3C 1OFCX 3QWOC 1S9KD 2FFDC 1VQ9P 4H0LD 1NU1J 2N1TB 1TU3F 1NKNA 3L71G 1KORA 2WPSA 1SQVK 1SQBJ 2GUVA 2BCCG 3PRJA 1NJIQ 2FY8A 2LR2A 2W90A 3L70J 2WPRA 3EFFK 4HH2A 1L0LD 3TNUA 3V2PA 1HGVA 5KLIB 4W7ZA 1KB9H 4HYTB 4UB6E 2XZRA 3V2RA 3AE4C 3H1JD 1IJDB 2O01H 2OARA 1BE3D 1L0NG 1FS0E 4M3LA 1CI6B 2E74C 3H1JE 4PJ0E 3CX5D 5AVSB 3V5BA 1NYHA 2M0BA 2QSIA 1J1EC 1Q82Q 1J1DC 1DEBA 2HG5D 2K9YA 1S5LE 2IZ1A 2ZAEB 1RF0A 1KYOH 1SQVD 4WY4D 1NWQA 3H25A 2HODB 2NPSA 1L0NK 1QLED 4HKZH 1ZW0A 1GK6A 1SS1A 5H2FE 1Q86Q 3CXHH 4UB8H 1VQ6P 1JO5A 1KTMA 3L4FA 3H1IJ 4IL6H 2ZT9B 1EDJA 3M91A 3MGNA 3H1HD 4C7NA 4Z1MH 5B5EE 5BVZA 5CBOA 2A06G 5DJTB 2Y0EA 1PFIA 1CI6A 2OYIB 2KOGA 3PJSK 3W67A 1NTZJ 3M9BA 2LKMA 5AW5B 3RK3D 4C7RA 1EXIA 1VQ8P 1HF9A 3CLQA 3GHGC 3RK3B 3L35A 1KQLA 1LGHB 1HJ0A 3HE4B 1DEEG 3B8EB 2JP3A 2AEFA 2JJLA 2JR8A 1H0TA 2WPQA 3CCQP 2WSEJ 1FDMA 3L74J 1FC2C 3MUDC 2R3CA 3GHGB 3H1JJ 2C9LY 1VQ5P 3WUVA 1KQGB 1M1KQ 3H1KJ 4JYCA 4IFFA 2BCCJ 1KILE 1SQQK 1NTZD 3L72G 2WSFH 4Y99C 3N4XA 1GZLA 1L0LK 3MTUE 1KB9D 3VTPC 5TISE 1VQMP 1HGZA 1KILA 3WU2H 3OA7A 4N3YB 2HPCA 2B88A 2YMYA 3D71A 3CCSP 3CX5H 1JY3O 2AXCA 5AVQB 3V2NA 2OYHA 4I7ZB 2XNXA 4B86A 2KS1B 2WT7A 1ZN5A 3TGUD 1YHQP 3D6YA 1L2PA 3ZDMA 3P8CE 1SFCB 2IPPA 3I55P 1SQBK 2QG4A 1GL2A 2A45G 3P8CD 1N73A 2Z5HA 4ZKUA 1BCCD 2K9JB 5C39A 4L74A 1JY2N 2H8PD 1LT9A 3GF3A 3HUSB 2IYOA 5KAIE 3RK3E 3V6IA 5B66H 2W6BA 5APWA 2K9JA 1OZHA 1SFCC 4IL6E 1BDCA 1VL2A 4EIJA 4H0LC 1P84D 2D2CB 3CCJP 1SFCA 2CPBA 1PP9G 2C0XA 2KK7A 4GIFA 5L8RJ 1S72P 1J2JB 1VDFA 3WUTA 3A3YB 3FXDA 3TF5A 1AFOA 1KYOE 2M5AB 2QE7H 2HR3A 3L75G 3I5CA 3KZIE 1VF5B 4U3FJ 1FZCC 2R5BA 1LTJC 3FX0A 4U7JA 2QJYB 2QJPB 4YXDC 4I7ZC 3S4RA 2H89C 1LT1A 4EYYQ 4DT0A 4ASWA 5CCHC 3VOPA 2FFDA 5KLVK 4ZNCA 2R3SA 1GD2E 2K1AA 2VRSA 2Q6QA 1IFIA 1LTIC 1XTGB 2W6AA 1MFZA 3AE2C 3HRNA 2XDJA 3L73G 4RKUJ 3SSUA 1GTWA 3IFMA 3UIAA 5KLIC 2MJZA 3H1KE 4H13B 3AE8C 2IFMA 3AE9C 3B4SA 3KQGA 1SQPK 1RF1B 1FZBA 1GU5A 3H32B 1L0LE 1AV1A 1PL5A 1S1CX 2BEQD 3BCCE 1LWUA 4JBZA 1NAFA 5KLVG 2WSSH 1K04A 2P2UA 2L5GB 2V4HA 2WZ7A 2XU6A 3L71E 4OGQD 4JQ0D 3JSVC 5CCGD 3H1LJ 3II6A 3GW6A 1L0ND 3M0DA 1GK4A 2W83C 1SQXJ 3AEAC 4D6TE 1BSNA 1QX8A 2ZYAA 3KXDA 3IR9A 4HB1A 4LC1A 3TYYA 3CD6P 1KYOI 2HFED 3AEEC 5AW8B 1SQQJ 3EWKA 3GG2A 1LWUB 3PTZA 1L4AA 1N7SA 5GTIE 4H44D 5E79H 1RE3A 1JTHA 1PP9E 3TGUG 1FE6A 2W27A 3B5NA 1Q7YQ 1KYOD 4AQRD 1N7SC 1L4AC 1KV4A 1XTCC 1G2CA 4IFDK 1J1DB 3IN6A 1JY3N 4NPEA 4C7NB 5KTBA 2MKVA 1VF5C 1SQXK 1G2CB 3LW5H 3SWKA 2QJKB 5AW7B 3BASA 5CCHD 4GOEA 3CXHI 3CCRP 3Q2YA 2SPZA 1FDOA 3VMZA 2WWWA 3H1ID 1EZVI 4H13D 2QM7A 3ITKA 2KZJA 1NTZK 3G3ZA 4K3AA 1EZVE 2UWJE 1URQD 3M0AA 3R2PA 3AE5C 3W68A 1BCCG 1NKZB 3G71P 1KQSO 2GA1A 1HH0A 3CXHE 4UB8E 1NTMG 1N73C 2QVAA 2R32A 1L0LG 1HUCA 3BCCD 3RBXA 1EXJA 2Y9YA 1LTBC 1OXZA 4PD4E 3LW5J 1SQBE 1VF5D 3A2AA 2YKQA 3H1LD 1JCCA 3V4WA 4XE5B 1BE3E 1NU1E 1N7LA 2PP6A 2FXPA 2ZFCA 3H1LE 5DJUB 2OTKE 2E75D 4TLFA 1L4AB 1N7SB 3CX5E 4D6TD 5CMZA 3CPWO 2M3BA 2D2CD 2E75B 3TSIA 1KILB 2QJKC 1OVUA 4GDOA 2NPSD 2XV5A 3RL0C 5E79E 3I56P 2OYHC 1NVOA 1S4XA 3MHVA 1X79B 1H0TB 1P84I 1MZ9A 1PIXA 2PGDA 5AVZB 2WT7B 2Q5UA 1Y9BA 1FJPA 5AW3B 2N9YB 3OAKA 4PV1B 5KAIH 3Q5SA 2H7HA 5B66E 1N8RQ 1AVOA 1OW7A 4O9BA 2OYIA 2JDIH 2N1TC 2P1JA 1A02F 3H1HG 2M3EA 4EI2A 5BU8B 3NTNA 4BWNA 3T97B 3H1HE 4XA4A 4I2LC 3NFQA 2RN0A 3GF7A 2FYNC 1K8AQ 1BDDA 5EFWB 5KKZC 4U3FE 2KZIA 2LXBA 1FJKA 3G4SP 2A45H 4U3FG 3L70G 4U3FD 3WMM0 1FZGA 2YO2A 3RK2C 1SQVJ 1EZVG 4JPZB 1P84E 4ASVA 1RE4A 3A0BE 3JCUH 1RF1A 1EDKA 1USDA 2RKLA 1PPJE 3H1JG 3L74G 2PRRA 3HUSC 3RGUA 1RF0C 2H88C 2WPVB 2V7QJ 1PPJD 1N73B 4PD4D 2W6JH 2BASA 1IK7A 1IFPA 1SQBD 3O6QA 3PH0A 5AVUB 3TGUE 3VYIA 1NU1D 2PFXA 3PLNA 4IOIH 3RL0g 1T2KD 3CMEP 1R5SA 2WMMA 3KZIH 1PGOA 1IO4A 1KILD 4W80A 2W8ZA 4C46A 3CWBE 1Q81Q 2IZ0A 2OTLP 1G1IA 4BRYB 1S5LH 3Q5PA 2IDBA 3CWBD 1M90Q 3MZWB 2I8DA 1P84H 1VPCA 2A06E 2ZYDA 4OGQB 1GL2B 2LXCB 3KHUA 1JM0A 2IFNA 1H8AA 1FOSE 2RMZA 2WSEH 2A06D 1D7MA 1ZLLA 5AW6B 3RBZA 1E79H 1IK9A 3BRTB 3N7NA 4H44C 5CJ4A 3BVHA 3CC4P 4PV1C 1Y47A 2ZT9D 1SQQG 5AVXB 5KJ7C 1ZOYC 1VQ7P 1NTMD 2BCCE 1QEXA 4WY4A 2KIKA 3TNUB 1YYCA 3Q5RA 2JWAA 3EQ2A 2E75C 4DCKA 3EFGA 3M9HA 2OYOA 4GKGA 4JYBA 3B5ND 1YJWP 1M1JB 1NGMB 3CCEP 2QJPC 2YKPA 4LLHA 4A7PA 1RE4C 2XNDH 1VQLP 1G1JA 1PP9D 1T3UA 4D6TG 1R5LA 2R44A 1GW4A 3L37A 4KHXA 3L75D 3H6PA 2BEZF 3AE7C 1IC2A 4WY4B 4PJ0H 5KJ7D 1DH3A 1W2EA 3P7KA 4PD4I 1LTTC 1OMIA 3AECC 2DW3A 5K5GB 3H1IE 1VQNP 1LTAC 2ZYGA 1JB0J 1Z56A 1RF1C 3PP5A 1RQUA 2YIUB 1E5WA 3L36A
chains in the Genus database with same CATH topology
3KDPB 1H89A 1CZQA 5APQA 1H88A 1FOSF 1NHLA 1GL2C 4WB4A 3C9IA 1T8ZA 2M8RA 1FZEA 2YO3A 3KPEA 2Z4EA 4W7YA 4RESB 1JTHB 2HODA 2NPSB 3CI9A 3MUDA 5AW1B 3NXSA 4ZKPA 4WBAA 3M9QA 2P67A 2KP8A 5AW0B 3VP8A 1FJPA 1FZCA 2H43A 1NOHA 5APXA 1NO4A 3SWYA 3HD7C 1YTZT 2HYNA 2R5DA 3P8MC 1KFNA 3HD7A 1X9VA 1HWTC 1URQB 1NTKK 2A45I 2HPCB 3NMDA 2HLOA 5APYA 5CJ0A 3M0DC 2J58A 5APVA 3HE5B 3GHGA 3P32A 3V2QA 1JNMA 1URQC 1M7LA 2GUSA 5AW2B 4WY4C 1URQA 2J59M 2ZXEB 5APTA 3HTKB 3T97A 1YTZI 4IFMA 3SWFA 5AVRB 1JMMA 1LTJA 4AUWA 1NTMK 2JEEA 1LTJB 1ZV8A 1FU1A 1QL1A 3B5NB 1MUUA 5APUA 1N86A 3VP9A 1IFNA 3KYQA 1JY3P 5CCGA 2KLVA 1X8YA 5KJ7A 1FZFA 4EOTA 1JY2O 1JCDA 2POHA 4I1LA 5AVTB 1SVFA 5AVWB 4OH8B 5CHXA 2I1KA 4N78E 1WT6A 1HBWA 2Z5IA 3A7OA 1KZUB 1IFJA 1AQ5A 1M1JA 2FFDB 1KILC 1FZAA 2KYVA 5BU5A 3HD7B 1HVVA 3H32A 1OWAA 1HTLC 1KFMA 2E42A 3RK2D 1SFCD 4GT1A 2FYUK 2XKMA 3CL3D 3HD7D 1NU1K 3HE5A 1JO5A 1JOCA 2C9NY 1NH4A 1WRGA 5CCGC 3RL0B 1J1EB 3OJAB 1MV8A 3A5TA 4JF7A 1T3JA 2NPSC 4DOJA 1RE3C 2Q7CA 3LIDA 1JY2P 3HTKA 1HJBA 1L4AD 1N7SD 1GDTA 3O8ZA 3VMXA 2KB7P 1FAVA 5AVYB 3M06A 3U1AA 3U59A 2FKWB 2WSCH 2FYZA 3VMYA 1GL2D 2WTYA 1IFMA 2I1JA 1CSBA 3HE4A 1LWUC 2Q9IA 1FZCB 2OYHB 4I6MC 1T2KC 5AVVB 1DX7A 1LTSC 3BRVB 2CPSA 3B5NC 1GU4A 1QL2A 2WITA 2KSJA 1CW5A 1EQ7A 1FBMA 3VN0A 2FXMA 4Y99B 3TK1A 2OYIC 2C0WA 1JUNA 1ZR4A 2N1TD 3E1IA 2YKOA 2QM8A 1LT9C 1SP4A 3RK2B 2IX7C 1N2DC 4DZOA 1GW3A 1LTGC 2O1KA 1IFDA 3MIWA 4N78D 1LT9B 2YNYA 3HUSA 1SLQA 2O1JA 1RY3A 4AYCA 1M1JC 2E43A 5AW9B 4LGDE 4N6JA 5CCHA 3V4QA 2Q3IA 5APSA 5AW4B 3LIEA 3MD0A 2PAJA 1A02J 3BATA 3U1CA 1S9KE 2GM4A 2N9BA 3RL0D 2N1TA 2P7JA 3RK3C 2FFDC 2N1TB 1NKNA 2WPSA 1SQVK 2GUVA 4HH2A 1ZR2A 2WPRA 3TNUA 3V2PA 1HGVA 4W7ZA 4HYTB 3V2RA 2XZRA 1IJDB 2O01H 2OARA 4M3LA 1CI6B 5AVSB 3V5BA 1J1EC 1J1DC 1DEBA 2HG5D 1RF0A 4WY4D 1NWQA 2HODB 2NPSA 1L0NK 1GK6A 3L4FA 3M91A 3MGNA 4C7NA 5BVZA 1PFIA 1CI6A 2OYIB 2KOGA 3M9BA 2LKMA 5AW5B 3RK3D 4C7RA 3CLQA 3GHGC 3RK3B 3L35A 1KQLA 1LGHB 3HE4B 3B8EB 2JJLA 2WPQA 1FDMA 2R3CA 3GHGB 2C9LY 4JYCA 4IFFA 1SQQK 2WSFH 4Y99C 3N4XA 1L0LK 1GZLA 3MTUE 3VTPC 1HGZA 1KILA 3OA7A 4N3YB 2HPCA 2YMYA 1JY3O 3V2NA 5AVQB 2OYHA 2XNXA 4B86A 2WT7A 1ZN5A 3P8CE 1SFCB 2IPPA 1SQBK 1GL2A 2A45G 3P8CD 1N73A 2Z5HA 4ZKUA 1JY2N 2H8PD 1LT9A 3HUSB 1RF1C 2W6BA 5APWA 1SFCC 4EIJA 1SFCA 2CPBA 4GIFA 2C0XA 1J2JB 1VDFA 3A3YB 1AFOA 3I5CA 1FZCC 2R5BA 1LTJC 1S9KD 1GD2E 5CCHC 2FFDA 3VOPA 5KLVK 2VRSA 3HRNA 1IFIA 1LTIC 1XTGB 2W6AA 1MFZA 2XDJA 1GTWA 3IFMA 3UIAA 2MJZA 2IFMA 1RF1B 3KQGA 1SQPK 1FZBA 1GU5A 3H32B 1LWUA 1NAFA 2XU6A 2WZ7A 2P2UA 2L5GB 5CCGD 3II6A 3M0DA 1GK4A 4LC1A 3IR9A 3TYYA 2HFED 5AW8B 1LWUB 1L4AA 1N7SA 1JTHA 1RE3A 2W27A 3B5NA 4AQRD 1N7SC 1L4AC 1XTCC 1G2CA 4IFDK 1J1DB 1JY3N 4C7NB 5KTBA 1SQXK 1G2CB 3LW5H 5CCHD 5AW7B 3BASA 3VMZA 2WWWA 2QM7A 1NTZK 3G3ZA 3R2PA 1URQD 3M0AA 1NKZB 1HH0A 1N73C 2R32A 1HUCA 1LTBC 1OXZA 3V4WA 3A2AA 2YKQA 1JCCA 4XE5B 1N7LA 2PP6A 2ZFCA 1L4AB 1N7SB 5CMZA 2M3BA 3TSIA 1KILB 2NPSD 2XV5A 3RL0C 2OYHC 1X79B 1MZ9A 5AVZB 2WT7B 2Q5UA 5AW3B 3OAKA 2H7HA 4O9BA 2OYIA 2N1TC 2P1JA 1A02F 5BU8B 3NTNA 4XA4A 4I2LC 3NFQA 1FJKA 2A45H 3WMM0 1FZGA 3RK2C 1RE4A 1RF1A 3HUSC 1RF0C 1N73B 2BASA 5AVUB 3VYIA 1T2KD 1IO4A 1KILD 4W80A 4C46A 1G1IA 1VPCA 1GL2B 2IFNA 1H8AA 1FOSE 2WSEH 1ZLLA 5AW6B 1IK9A 3BRTB 3N7NA 5CJ4A 3BVHA 5KJ7C 5AVXB 4WY4A 3TNUB 1YYCA 3EQ2A 3EFGA 3M9HA 4GKGA 4JYBA 3B5ND 1M1JB 4LLHA 2YKPA 1RE4C 1G1JA 1T3UA 3L37A 1GW4A 4KHXA 3H6PA 1IC2A 4WY4B 5KJ7D 1DH3A 1W2EA 3P7KA 1LTTC 1LTAC 1Z56A 3PP5A 2YO2A 1E5WA 3L36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHL A;  5CCG C;  3RL0 B;  1GL2 C;  2HG5 D;  5CCH D;  2M8R A;  4WY4 D;  2NPS A;  4JF7 A;  1T3J A;  4W7Y A;  2NPS C;  1URQ D;  1JTH B;  2NPS B;  1L4A D;  1N7S D;  2KOG A;  3RK3 D;  3RK3 B;  2PP6 A;  3HD7 C;  1L4A B;  1N7S B;  3TSI A;  1KIL B;  3HD7 A;  2NPS D;  3RL0 C;  1URQ B;  1N7S C;  1GL2 D;  3M0D C;  2N1T C;  1URQ C;  1KIL A;  2YMY A;  4WY4 C;  1URQ A;  3HTK B;  3B5N C;  3RK2 C;  3P8C E;  1SFC B;  1GL2 A;  2H8P D;  2N1T D;  1SFC C;  3RK2 B;  1KIL D;  4W80 A;  3B5N B;  1SFC A;  1GL2 B;  3KYQ A;  5CCG A;  5CCH C;  5KJ7 A;  3VOP A;  4LGD E;  5CCH A;  5KJ7 C;  1XTG B;  2XDJ A;  4OH8 B;  4WY4 A;  4N78 E;  3B5N D;  3RL0 D;  2N1T A;  3RK3 C;  2WZ7 A;  5CCG D;  1KIL C;  2N1T B;  3HD7 B;  1HVV A;  4WY4 B;  5KJ7 D;  2HFE D;  3RK2 D;  1SFC D;  4W7Z A;  1L4A A;  1N7S A;  1JTH A;  3HD7 D;  3B5N A;  3PP5 A;  1L4A C; 
#chains in the Genus database with same CATH topology
 3KDP B;  1H89 A;  1CZQ A;  5APQ A;  1H88 A;  3C1L A;  1FOS F;  3H1K D;  1NHL A;  2G3A A;  2WQY C;  3L72 J;  1GL2 C;  3AED C;  3R4Y A;  4WB4 A;  3CCV P;  3C9I A;  1T8Z A;  2M8R A;  1WMK A;  1FZE A;  2YO3 A;  1NAY A;  4PV1 D;  3SFD C;  2K88 A;  3CCM P;  1S3J A;  3KPE A;  4DJG A;  5TIS H;  1U7J A;  4H0L B;  4W7Y A;  2Z4E A;  1X0T A;  1BGY J;  4RES B;  1JTH B;  1NTK D;  1M56 D;  4YPC A;  2HOD A;  2NPS B;  1SQP E;  3CI9 A;  3MUD A;  1PGQ A;  5AW1 B;  2FYU G;  3NXS A;  5CBN A;  2K3R A;  1SQP D;  3GMA A;  2L91 A;  4ZKP A;  4WBA A;  3M9Q A;  2P67 A;  2KP8 A;  2J5U A;  5AW0 B;  5KAF E;  3SFE C;  3VP8 A;  1FZC A;  1IZN B;  2P58 A;  3VMA A;  4MN4 C;  1MKM A;  4K35 A;  1KD1 Q;  2H43 A;  2KNC B;  1NOH A;  2WVR A;  1NO4 A;  5APX A;  3SWY A;  3HD7 C;  1YIT P;  1YI2 P;  1YTZ T;  2HYN A;  2QRX A;  3L72 E;  4CPG A;  2R5D A;  3P8M C;  1Q2N A;  5KKZ B;  2AXT H;  1KFN A;  3AEF C;  3HD7 A;  2O3J A;  1X9V A;  1VQO P;  4RO0 A;  1HWT C;  1URQ B;  1NTK K;  3FXE A;  4OWF A;  3JC2 2;  1PP9 J;  2A45 I;  2HPC B;  3TGU J;  1OW8 A;  3NMD A;  2HLO A;  3AE3 C;  4WWI A;  1SQQ E;  5CJ0 A;  3M0D C;  5APY A;  2J58 A;  5APV A;  3HE5 B;  1SQQ D;  3GHG A;  3P32 A;  4H13 C;  3V2Q A;  1YQ4 C;  1EZV D;  5KLV J;  1JNM A;  2AEM A;  1URQ C;  3E7K A;  1M7L A;  5H2F H;  4KT0 J;  2GUS A;  3CXH D;  5AW2 B;  1NTK G;  3F5H A;  4WY4 C;  1SQX G;  1URQ A;  3G9R A;  2J59 M;  1U7M A;  2AXT E;  2ZXE B;  3HTK B;  3L73 J;  5APT A;  3T97 A;  1PGP A;  1ZRT D;  2OGU A;  1YTZ I;  4IFM A;  1EDI A;  1AJY A;  2B87 B;  3SWF A;  1SQP G;  5AVR B;  1NTZ G;  1PV3 A;  2FYU E;  1JMM A;  2JWD A;  1LTJ A;  4AUW A;  1NTM K;  3FWL A;  4H44 B;  2Q1K A;  2JEE A;  3CC7 P;  2JO1 A;  1LTJ B;  1ZV8 A;  3USS A;  2Q3E A;  1FU1 A;  2FYU J;  2E76 B;  3B71 A;  1QL1 A;  2FXO A;  4Y28 J;  1YQ3 C;  2NRG A;  2YXQ B;  3B5N B;  3E1R A;  4R4M A;  1YJ9 P;  1R8E A;  1GMJ A;  1MUU A;  5APU A;  3H1K G;  1NTM E;  2BCC D;  1AQT A;  1N86 A;  2RH0 A;  3O6Q B;  3L73 E;  3S9O A;  1IFN A;  2ZJS E;  3VP9 A;  3Q3D A;  3KYQ A;  1JY3 P;  2K37 A;  1VQP P;  3BCC G;  3CWB J;  4BXL A;  1RQV A;  5CCG A;  2KLV A;  1X8Y A;  1W5C E;  1T6A A;  3AEB C;  5KLV D;  5KJ7 A;  1FZF A;  2E74 B;  1NTK J;  1JY2 O;  2D2C C;  3WU2 E;  4EOT A;  1JCD A;  3A0H E;  1M8O B;  5KLV E;  2POH A;  1BE3 G;  4I1L A;  5AVT B;  1SVF A;  1UIX A;  4GOF A;  2B9B A;  4NPD A;  4OH8 B;  5AVW B;  2KXP B;  3K5B A;  5CHX A;  1EDL A;  2I1K A;  4N78 E;  3ABV C;  1WT6 A;  1ZRT E;  1HBW A;  1SQV E;  1DD3 A;  1BCC J;  2Z5I A;  3A7O A;  4XFJ A;  4IL6 X;  1KZU B;  1IFJ A;  1QVG O;  1AQ5 A;  1M1J A;  2FFD B;  1KIL C;  5GTH E;  1JMB A;  1FZA A;  1MFT A;  1RH5 B;  1OVV A;  2KYV A;  3AE1 C;  3PHL A;  5BU5 A;  3HD7 B;  1HVV A;  3H32 A;  1OWA A;  2CK3 H;  2E5Y A;  1HTL C;  1KFM A;  1KMI Z;  1S5L X;  2E42 A;  2V7Q H;  3RK2 D;  4OVN F;  2IBZ E;  1SFC D;  2ZXX A;  4GT1 A;  3A0H H;  4L76 A;  3GLM A;  2FYU K;  2XKM A;  1X22 A;  2IBZ G;  3CL3 D;  2IBZ I;  1SQP J;  2IBZ D;  1W2B O;  3L75 J;  2WSF J;  3HD7 D;  1NU1 K;  1BGY E;  1PGJ A;  3HE5 A;  3IAO A;  4QMA A;  3S1K A;  4ZMD A;  1OIP A;  1JOC A;  3L74 E;  2ZT9 C;  3IF4 A;  2E5T A;  1KC8 Q;  3L70 D;  2C9N Y;  1OW6 A;  3FWN A;  2M5A A;  1NH4 A;  1ZP0 C;  1WRG A;  5GTH H;  5CCG C;  1S2E A;  1J1E B;  3RL0 B;  3OJA B;  1SQX D;  1MV8 A;  1BE3 J;  1ZXG A;  3G6E P;  2QA4 P;  1NU1 G;  1KB9 I;  2OTJ P;  3A5T A;  4JF7 A;  1NTZ E;  1T3J A;  2QEX P;  1SQB G;  2B87 A;  2NPS C;  4DOJ A;  1RE3 C;  3L72 D;  3L75 E;  2YIU C;  2O01 N;  3D6Z A;  2Q7C A;  2KSE A;  1JY2 P;  3HTK A;  1M57 D;  3LID A;  1HJB A;  1L4A D;  1N7S D;  1PZQ A;  3A0B H;  4L75 A;  3WUU A;  1GDT A;  2QJY C;  3O8Z A;  3VMX A;  4HJG H;  2Y9Z A;  2KB7 P;  1YJN P;  2G8Y A;  3JCU E;  1FAV A;  2KUB A;  5AVY B;  1OVR A;  1LJ2 A;  1U57 A;  4RJT A;  1YIJ P;  1K9M Q;  4L73 A;  3M06 A;  4PD4 H;  2E74 D;  1KQF B;  3U1A A;  3U59 A;  1BCC E;  2FKW B;  1K73 Q;  2ZVN B;  2WSC H;  2FYZ A;  2YMK A;  3VMY A;  1GL2 D;  3CCL P;  1USE A;  1BGY D;  2WTY A;  3H1L G;  1IFM A;  5TJH A;  1BGY G;  1K05 A;  3L74 D;  4YTP C;  2I1J A;  1CSB A;  3HE4 A;  3L70 E;  1LWU C;  1PPJ G;  2E76 D;  2KNC A;  3Q1M A;  2Q9I A;  1NTK E;  2IYP A;  4KJM A;  2FYU D;  1VQK P;  1FZC B;  1SQX E;  4D6T J;  2OYH B;  1QVF O;  3C8V A;  4I6M C;  4OGQ C;  5AVV B;  1T2K C;  1DX7 A;  3L71 J;  1LTS C;  1QGK B;  3BRV B;  2P10 A;  2CPS A;  2WSC J;  3B5N C;  3OW2 O;  1GU4 A;  1NTM J;  3BCC J;  1QL2 A;  2WIT A;  3CWB G;  3CX5 I;  2KSJ A;  1L0L J;  4EDF A;  1CW5 A;  1ZR2 A;  1Q90 D;  1EQ7 A;  2NZ2 A;  1KN7 A;  1FBM A;  1KB9 E;  4UB6 H;  3VN0 A;  3TDK A;  2FXM A;  4Y99 B;  5M1B A;  3TK1 A;  2OYI C;  2C0W A;  4GOD A;  1JUN A;  2Y0D A;  1Y8A A;  3F89 A;  3L73 D;  1ZR4 A;  2N1T D;  3E1I A;  2YKO A;  2QM8 A;  5B5E H;  2B89 A;  1LP1 B;  1LT9 C;  1SP4 A;  3AEG C;  3RK2 B;  2Y0C A;  3FGA D;  3L71 D;  4NPF X;  4WVZ A;  1DIP A;  3CMA P;  1LP1 A;  2IX7 C;  4YXW H;  3D70 A;  1N2D C;  3AE6 C;  1L0N E;  1VQ4 P;  4DZO A;  2AEJ A;  3CCU P;  1GW3 A;  4TT3 H;  1LTG C;  2ITA A;  2O1K A;  3CC2 P;  1AA0 A;  1IFD A;  3MIW A;  4N78 D;  1L0N J;  1LT9 B;  1AVY A;  2YNY A;  3HUS A;  1SLQ A;  1ZME C;  2FBW C;  2O1J A;  1RY3 A;  3H1H J;  4AYC A;  1M1J C;  1LNQ A;  2E43 A;  4BRY A;  5AW9 B;  4LGD E;  3MP7 B;  2OQQ A;  2E76 C;  3QH9 A;  4N6J A;  5CCH A;  2QIW A;  5KAF H;  2ZVO B;  2JKV A;  2Q3I A;  5APS A;  5AW4 B;  3V4Q A;  1EC5 A;  1DD4 A;  3LIE A;  5GTI H;  1YBK A;  3MD0 A;  2KI7 B;  1SQV G;  2KLU A;  1OX3 A;  2PAJ A;  2YXR B;  1BSH A;  1FDI A;  2O01 J;  1JEK A;  1UII A;  3BAT A;  3U1C A;  1S9K E;  2N9B A;  1A02 J;  2GM4 A;  3H1I G;  1RHZ B;  2FYN B;  4R4L A;  2KS1 A;  3RL0 D;  2N1T A;  2P7J A;  3RK3 C;  1OFC X;  3QWO C;  1S9K D;  2FFD C;  1VQ9 P;  4H0L D;  1NU1 J;  2N1T B;  1TU3 F;  1NKN A;  3L71 G;  1KOR A;  2WPS A;  1SQV K;  1SQB J;  2GUV A;  2BCC G;  3PRJ A;  1NJI Q;  2FY8 A;  2LR2 A;  2W90 A;  3L70 J;  2WPR A;  3EFF K;  4HH2 A;  1L0L D;  3TNU A;  3V2P A;  1HGV A;  5KLI B;  4W7Z A;  1KB9 H;  4HYT B;  4UB6 E;  2XZR A;  3V2R A;  3AE4 C;  3H1J D;  1IJD B;  2O01 H;  2OAR A;  1BE3 D;  1L0N G;  1FS0 E;  4M3L A;  1CI6 B;  2E74 C;  3H1J E;  4PJ0 E;  3CX5 D;  5AVS B;  3V5B A;  1NYH A;  2M0B A;  2QSI A;  1J1E C;  1Q82 Q;  1J1D C;  1DEB A;  2HG5 D;  2K9Y A;  1S5L E;  2IZ1 A;  2ZAE B;  1RF0 A;  1KYO H;  1SQV D;  4WY4 D;  1NWQ A;  3H25 A;  2HOD B;  2NPS A;  1L0N K;  1QLE D;  4HKZ H;  1ZW0 A;  1GK6 A;  1SS1 A;  5H2F E;  1Q86 Q;  3CXH H;  4UB8 H;  1VQ6 P;  1JO5 A;  1KTM A;  3L4F A;  3H1I J;  4IL6 H;  2ZT9 B;  1EDJ A;  3M91 A;  3MGN A;  3H1H D;  4C7N A;  4Z1M H;  5B5E E;  5BVZ A;  5CBO A;  2A06 G;  5DJT B;  2Y0E A;  1PFI A;  1CI6 A;  2OYI B;  2KOG A;  3PJS K;  3W67 A;  1NTZ J;  3M9B A;  2LKM A;  5AW5 B;  3RK3 D;  4C7R A;  1EXI A;  1VQ8 P;  1HF9 A;  3CLQ A;  3GHG C;  3RK3 B;  3L35 A;  1KQL A;  1LGH B;  1HJ0 A;  3HE4 B;  1DEE G;  3B8E B;  2JP3 A;  2AEF A;  2JJL A;  2JR8 A;  1H0T A;  2WPQ A;  3CCQ P;  2WSE J;  1FDM A;  3L74 J;  1FC2 C;  3MUD C;  2R3C A;  3GHG B;  3H1J J;  2C9L Y;  1VQ5 P;  3WUV A;  1KQG B;  1M1K Q;  3H1K J;  4JYC A;  4IFF A;  2BCC J;  1KIL E;  1SQQ K;  1NTZ D;  3L72 G;  2WSF H;  4Y99 C;  3N4X A;  1GZL A;  1L0L K;  3MTU E;  1KB9 D;  3VTP C;  5TIS E;  1VQM P;  1HGZ A;  1KIL A;  3WU2 H;  3OA7 A;  4N3Y B;  2HPC A;  2B88 A;  2YMY A;  3D71 A;  3CCS P;  3CX5 H;  1JY3 O;  2AXC A;  5AVQ B;  3V2N A;  2OYH A;  4I7Z B;  2XNX A;  4B86 A;  2KS1 B;  2WT7 A;  1ZN5 A;  3TGU D;  1YHQ P;  3D6Y A;  1L2P A;  3ZDM A;  3P8C E;  1SFC B;  2IPP A;  3I55 P;  1SQB K;  2QG4 A;  1GL2 A;  2A45 G;  3P8C D;  1N73 A;  2Z5H A;  4ZKU A;  1BCC D;  2K9J B;  5C39 A;  4L74 A;  1JY2 N;  2H8P D;  1LT9 A;  3GF3 A;  3HUS B;  2IYO A;  5KAI E;  3RK3 E;  3V6I A;  5B66 H;  2W6B A;  5APW A;  2K9J A;  1OZH A;  1SFC C;  4IL6 E;  1BDC A;  1VL2 A;  4EIJ A;  4H0L C;  1P84 D;  2D2C B;  3CCJ P;  1SFC A;  2CPB A;  1PP9 G;  2C0X A;  2KK7 A;  4GIF A;  5L8R J;  1S72 P;  1J2J B;  1VDF A;  3WUT A;  3A3Y B;  3FXD A;  3TF5 A;  1AFO A;  1KYO E;  2M5A B;  2QE7 H;  2HR3 A;  3L75 G;  3I5C A;  3KZI E;  1VF5 B;  4U3F J;  1FZC C;  2R5B A;  1LTJ C;  3FX0 A;  4U7J A;  2QJY B;  2QJP B;  4YXD C;  4I7Z C;  3S4R A;  2H89 C;  1LT1 A;  4EYY Q;  4DT0 A;  4ASW A;  5CCH C;  3VOP A;  2FFD A;  5KLV K;  4ZNC A;  2R3S A;  1GD2 E;  2K1A A;  2VRS A;  2Q6Q A;  1IFI A;  1LTI C;  1XTG B;  2W6A A;  1MFZ A;  3AE2 C;  3HRN A;  2XDJ A;  3L73 G;  4RKU J;  3SSU A;  1GTW A;  3IFM A;  3UIA A;  5KLI C;  2MJZ A;  3H1K E;  4H13 B;  3AE8 C;  2IFM A;  3AE9 C;  3B4S A;  3KQG A;  1SQP K;  1RF1 B;  1FZB A;  1GU5 A;  3H32 B;  1L0L E;  1AV1 A;  1PL5 A;  1S1C X;  2BEQ D;  3BCC E;  1LWU A;  4JBZ A;  1NAF A;  5KLV G;  2WSS H;  1K04 A;  2P2U A;  2L5G B;  2V4H A;  2WZ7 A;  2XU6 A;  3L71 E;  4OGQ D;  4JQ0 D;  3JSV C;  5CCG D;  3H1L J;  3II6 A;  3GW6 A;  1L0N D;  3M0D A;  1GK4 A;  2W83 C;  1SQX J;  3AEA C;  4D6T E;  1BSN A;  1QX8 A;  2ZYA A;  3KXD A;  3IR9 A;  4HB1 A;  4LC1 A;  3TYY A;  3CD6 P;  1KYO I;  2HFE D;  3AEE C;  5AW8 B;  1SQQ J;  3EWK A;  3GG2 A;  1LWU B;  3PTZ A;  1L4A A;  1N7S A;  5GTI E;  4H44 D;  5E79 H;  1RE3 A;  1JTH A;  1PP9 E;  3TGU G;  1FE6 A;  2W27 A;  3B5N A;  1Q7Y Q;  1KYO D;  4AQR D;  1N7S C;  1L4A C;  1KV4 A;  1XTC C;  1G2C A;  4IFD K;  1J1D B;  3IN6 A;  1JY3 N;  4NPE A;  4C7N B;  5KTB A;  2MKV A;  1VF5 C;  1SQX K;  1G2C B;  3LW5 H;  3SWK A;  2QJK B;  5AW7 B;  3BAS A;  5CCH D;  4GOE A;  3CXH I;  3CCR P;  3Q2Y A;  2SPZ A;  1FDO A;  3VMZ A;  2WWW A;  3H1I D;  1EZV I;  4H13 D;  2QM7 A;  3ITK A;  2KZJ A;  1NTZ K;  3G3Z A;  4K3A A;  1EZV E;  2UWJ E;  1URQ D;  3M0A A;  3R2P A;  3AE5 C;  3W68 A;  1BCC G;  1NKZ B;  3G71 P;  1KQS O;  2GA1 A;  1HH0 A;  3CXH E;  4UB8 E;  1NTM G;  1N73 C;  2QVA A;  2R32 A;  1L0L G;  1HUC A;  3BCC D;  3RBX A;  1EXJ A;  2Y9Y A;  1LTB C;  1OXZ A;  4PD4 E;  3LW5 J;  1SQB E;  1VF5 D;  3A2A A;  2YKQ A;  3H1L D;  1JCC A;  3V4W A;  4XE5 B;  1BE3 E;  1NU1 E;  1N7L A;  2PP6 A;  2FXP A;  2ZFC A;  3H1L E;  5DJU B;  2OTK E;  2E75 D;  4TLF A;  1L4A B;  1N7S B;  3CX5 E;  4D6T D;  5CMZ A;  3CPW O;  2M3B A;  2D2C D;  2E75 B;  3TSI A;  1KIL B;  2QJK C;  1OVU A;  4GDO A;  2NPS D;  2XV5 A;  3RL0 C;  5E79 E;  3I56 P;  2OYH C;  1NVO A;  1S4X A;  3MHV A;  1X79 B;  1H0T B;  1P84 I;  1MZ9 A;  1PIX A;  2PGD A;  5AVZ B;  2WT7 B;  2Q5U A;  1Y9B A;  1FJP A;  5AW3 B;  2N9Y B;  3OAK A;  4PV1 B;  5KAI H;  3Q5S A;  2H7H A;  5B66 E;  1N8R Q;  1AVO A;  1OW7 A;  4O9B A;  2OYI A;  2JDI H;  2N1T C;  2P1J A;  1A02 F;  3H1H G;  2M3E A;  4EI2 A;  5BU8 B;  3NTN A;  4BWN A;  3T97 B;  3H1H E;  4XA4 A;  4I2L C;  3NFQ A;  2RN0 A;  3GF7 A;  2FYN C;  1K8A Q;  1BDD A;  5EFW B;  5KKZ C;  4U3F E;  2KZI A;  2LXB A;  1FJK A;  3G4S P;  2A45 H;  4U3F G;  3L70 G;  4U3F D;  3WMM 0;  1FZG A;  2YO2 A;  3RK2 C;  1SQV J;  1EZV G;  4JPZ B;  1P84 E;  4ASV A;  1RE4 A;  3A0B E;  3JCU H;  1RF1 A;  1EDK A;  1USD A;  2RKL A;  1PPJ E;  3H1J G;  3L74 G;  2PRR A;  3HUS C;  3RGU A;  1RF0 C;  2H88 C;  2WPV B;  2V7Q J;  1PPJ D;  1N73 B;  4PD4 D;  2W6J H;  2BAS A;  1IK7 A;  1IFP A;  1SQB D;  3O6Q A;  3PH0 A;  5AVU B;  3TGU E;  3VYI A;  1NU1 D;  2PFX A;  3PLN A;  4IOI H;  3RL0 g;  1T2K D;  3CME P;  1R5S A;  2WMM A;  3KZI H;  1PGO A;  1IO4 A;  1KIL D;  4W80 A;  2W8Z A;  4C46 A;  3CWB E;  1Q81 Q;  2IZ0 A;  2OTL P;  1G1I A;  4BRY B;  1S5L H;  3Q5P A;  2IDB A;  3CWB D;  1M90 Q;  3MZW B;  2I8D A;  1P84 H;  1VPC A;  2A06 E;  2ZYD A;  4OGQ B;  1GL2 B;  2LXC B;  3KHU A;  1JM0 A;  2IFN A;  1H8A A;  1FOS E;  2RMZ A;  2WSE H;  2A06 D;  1D7M A;  1ZLL A;  5AW6 B;  3RBZ A;  1E79 H;  1IK9 A;  3BRT B;  3N7N A;  4H44 C;  5CJ4 A;  3BVH A;  3CC4 P;  4PV1 C;  1Y47 A;  2ZT9 D;  1SQQ G;  5AVX B;  5KJ7 C;  1ZOY C;  1VQ7 P;  1NTM D;  2BCC E;  1QEX A;  4WY4 A;  2KIK A;  3TNU B;  1YYC A;  3Q5R A;  2JWA A;  3EQ2 A;  2E75 C;  4DCK A;  3EFG A;  3M9H A;  2OYO A;  4GKG A;  4JYB A;  3B5N D;  1YJW P;  1M1J B;  1NGM B;  3CCE P;  2QJP C;  2YKP A;  4LLH A;  4A7P A;  1RE4 C;  2XND H;  1VQL P;  1G1J A;  1PP9 D;  1T3U A;  4D6T G;  1R5L A;  2R44 A;  1GW4 A;  3L37 A;  4KHX A;  3L75 D;  3H6P A;  2BEZ F;  3AE7 C;  1IC2 A;  4WY4 B;  4PJ0 H;  5KJ7 D;  1DH3 A;  1W2E A;  3P7K A;  4PD4 I;  1LTT C;  1OMI A;  3AEC C;  2DW3 A;  5K5G B;  3H1I E;  1VQN P;  1LTA C;  2ZYG A;  1JB0 J;  1Z56 A;  1RF1 C;  3PP5 A;  1RQU A;  2YIU B;  1E5W A;  3L36 A; 
#chains in the Genus database with same CATH homology
 3KDP B;  1H89 A;  1CZQ A;  5APQ A;  1H88 A;  1FOS F;  1NHL A;  1GL2 C;  4WB4 A;  3C9I A;  1T8Z A;  2M8R A;  1FZE A;  2YO3 A;  3KPE A;  2Z4E A;  4W7Y A;  4RES B;  1JTH B;  2HOD A;  2NPS B;  3CI9 A;  3MUD A;  5AW1 B;  3NXS A;  4ZKP A;  4WBA A;  3M9Q A;  2P67 A;  2KP8 A;  5AW0 B;  3VP8 A;  1FJP A;  1FZC A;  2H43 A;  1NOH A;  5APX A;  1NO4 A;  3SWY A;  3HD7 C;  1YTZ T;  2HYN A;  2R5D A;  3P8M C;  1KFN A;  3HD7 A;  1X9V A;  1HWT C;  1URQ B;  1NTK K;  2A45 I;  2HPC B;  3NMD A;  2HLO A;  5APY A;  5CJ0 A;  3M0D C;  2J58 A;  5APV A;  3HE5 B;  3GHG A;  3P32 A;  3V2Q A;  1JNM A;  1URQ C;  1M7L A;  2GUS A;  5AW2 B;  4WY4 C;  1URQ A;  2J59 M;  2ZXE B;  5APT A;  3HTK B;  3T97 A;  1YTZ I;  4IFM A;  3SWF A;  5AVR B;  1JMM A;  1LTJ A;  4AUW A;  1NTM K;  2JEE A;  1LTJ B;  1ZV8 A;  1FU1 A;  1QL1 A;  3B5N B;  1MUU A;  5APU A;  1N86 A;  3VP9 A;  1IFN A;  3KYQ A;  1JY3 P;  5CCG A;  2KLV A;  1X8Y A;  5KJ7 A;  1FZF A;  4EOT A;  1JY2 O;  1JCD A;  2POH A;  4I1L A;  5AVT B;  1SVF A;  5AVW B;  4OH8 B;  5CHX A;  2I1K A;  4N78 E;  1WT6 A;  1HBW A;  2Z5I A;  3A7O A;  1KZU B;  1IFJ A;  1AQ5 A;  1M1J A;  2FFD B;  1KIL C;  1FZA A;  2KYV A;  5BU5 A;  3HD7 B;  1HVV A;  3H32 A;  1OWA A;  1HTL C;  1KFM A;  2E42 A;  3RK2 D;  1SFC D;  4GT1 A;  2FYU K;  2XKM A;  3CL3 D;  3HD7 D;  1NU1 K;  3HE5 A;  1JO5 A;  1JOC A;  2C9N Y;  1NH4 A;  1WRG A;  5CCG C;  3RL0 B;  1J1E B;  3OJA B;  1MV8 A;  3A5T A;  4JF7 A;  1T3J A;  2NPS C;  4DOJ A;  1RE3 C;  2Q7C A;  3LID A;  1JY2 P;  3HTK A;  1HJB A;  1L4A D;  1N7S D;  1GDT A;  3O8Z A;  3VMX A;  2KB7 P;  1FAV A;  5AVY B;  3M06 A;  3U1A A;  3U59 A;  2FKW B;  2WSC H;  2FYZ A;  3VMY A;  1GL2 D;  2WTY A;  1IFM A;  2I1J A;  1CSB A;  3HE4 A;  1LWU C;  2Q9I A;  1FZC B;  2OYH B;  4I6M C;  1T2K C;  5AVV B;  1DX7 A;  1LTS C;  3BRV B;  2CPS A;  3B5N C;  1GU4 A;  1QL2 A;  2WIT A;  2KSJ A;  1CW5 A;  1EQ7 A;  1FBM A;  3VN0 A;  2FXM A;  4Y99 B;  3TK1 A;  2OYI C;  2C0W A;  1JUN A;  1ZR4 A;  2N1T D;  3E1I A;  2YKO A;  2QM8 A;  1LT9 C;  1SP4 A;  3RK2 B;  2IX7 C;  1N2D C;  4DZO A;  1GW3 A;  1LTG C;  2O1K A;  1IFD A;  3MIW A;  4N78 D;  1LT9 B;  2YNY A;  3HUS A;  1SLQ A;  2O1J A;  1RY3 A;  4AYC A;  1M1J C;  2E43 A;  5AW9 B;  4LGD E;  4N6J A;  5CCH A;  3V4Q A;  2Q3I A;  5APS A;  5AW4 B;  3LIE A;  3MD0 A;  2PAJ A;  1A02 J;  3BAT A;  3U1C A;  1S9K E;  2GM4 A;  2N9B A;  3RL0 D;  2N1T A;  2P7J A;  3RK3 C;  2FFD C;  2N1T B;  1NKN A;  2WPS A;  1SQV K;  2GUV A;  4HH2 A;  1ZR2 A;  2WPR A;  3TNU A;  3V2P A;  1HGV A;  4W7Z A;  4HYT B;  3V2R A;  2XZR A;  1IJD B;  2O01 H;  2OAR A;  4M3L A;  1CI6 B;  5AVS B;  3V5B A;  1J1E C;  1J1D C;  1DEB A;  2HG5 D;  1RF0 A;  4WY4 D;  1NWQ A;  2HOD B;  2NPS A;  1L0N K;  1GK6 A;  3L4F A;  3M91 A;  3MGN A;  4C7N A;  5BVZ A;  1PFI A;  1CI6 A;  2OYI B;  2KOG A;  3M9B A;  2LKM A;  5AW5 B;  3RK3 D;  4C7R A;  3CLQ A;  3GHG C;  3RK3 B;  3L35 A;  1KQL A;  1LGH B;  3HE4 B;  3B8E B;  2JJL A;  2WPQ A;  1FDM A;  2R3C A;  3GHG B;  2C9L Y;  4JYC A;  4IFF A;  1SQQ K;  2WSF H;  4Y99 C;  3N4X A;  1L0L K;  1GZL A;  3MTU E;  3VTP C;  1HGZ A;  1KIL A;  3OA7 A;  4N3Y B;  2HPC A;  2YMY A;  1JY3 O;  3V2N A;  5AVQ B;  2OYH A;  2XNX A;  4B86 A;  2WT7 A;  1ZN5 A;  3P8C E;  1SFC B;  2IPP A;  1SQB K;  1GL2 A;  2A45 G;  3P8C D;  1N73 A;  2Z5H A;  4ZKU A;  1JY2 N;  2H8P D;  1LT9 A;  3HUS B;  1RF1 C;  2W6B A;  5APW A;  1SFC C;  4EIJ A;  1SFC A;  2CPB A;  4GIF A;  2C0X A;  1J2J B;  1VDF A;  3A3Y B;  1AFO A;  3I5C A;  1FZC C;  2R5B A;  1LTJ C;  1S9K D;  1GD2 E;  5CCH C;  2FFD A;  3VOP A;  5KLV K;  2VRS A;  3HRN A;  1IFI A;  1LTI C;  1XTG B;  2W6A A;  1MFZ A;  2XDJ A;  1GTW A;  3IFM A;  3UIA A;  2MJZ A;  2IFM A;  1RF1 B;  3KQG A;  1SQP K;  1FZB A;  1GU5 A;  3H32 B;  1LWU A;  1NAF A;  2XU6 A;  2WZ7 A;  2P2U A;  2L5G B;  5CCG D;  3II6 A;  3M0D A;  1GK4 A;  4LC1 A;  3IR9 A;  3TYY A;  2HFE D;  5AW8 B;  1LWU B;  1L4A A;  1N7S A;  1JTH A;  1RE3 A;  2W27 A;  3B5N A;  4AQR D;  1N7S C;  1L4A C;  1XTC C;  1G2C A;  4IFD K;  1J1D B;  1JY3 N;  4C7N B;  5KTB A;  1SQX K;  1G2C B;  3LW5 H;  5CCH D;  5AW7 B;  3BAS A;  3VMZ A;  2WWW A;  2QM7 A;  1NTZ K;  3G3Z A;  3R2P A;  1URQ D;  3M0A A;  1NKZ B;  1HH0 A;  1N73 C;  2R32 A;  1HUC A;  1LTB C;  1OXZ A;  3V4W A;  3A2A A;  2YKQ A;  1JCC A;  4XE5 B;  1N7L A;  2PP6 A;  2ZFC A;  1L4A B;  1N7S B;  5CMZ A;  2M3B A;  3TSI A;  1KIL B;  2NPS D;  2XV5 A;  3RL0 C;  2OYH C;  1X79 B;  1MZ9 A;  5AVZ B;  2WT7 B;  2Q5U A;  5AW3 B;  3OAK A;  2H7H A;  4O9B A;  2OYI A;  2N1T C;  2P1J A;  1A02 F;  5BU8 B;  3NTN A;  4XA4 A;  4I2L C;  3NFQ A;  1FJK A;  2A45 H;  3WMM 0;  1FZG A;  3RK2 C;  1RE4 A;  1RF1 A;  3HUS C;  1RF0 C;  1N73 B;  2BAS A;  5AVU B;  3VYI A;  1T2K D;  1IO4 A;  1KIL D;  4W80 A;  4C46 A;  1G1I A;  1VPC A;  1GL2 B;  2IFN A;  1H8A A;  1FOS E;  2WSE H;  1ZLL A;  5AW6 B;  1IK9 A;  3BRT B;  3N7N A;  5CJ4 A;  3BVH A;  5KJ7 C;  5AVX B;  4WY4 A;  3TNU B;  1YYC A;  3EQ2 A;  3EFG A;  3M9H A;  4GKG A;  4JYB A;  3B5N D;  1M1J B;  4LLH A;  2YKP A;  1RE4 C;  1G1J A;  1T3U A;  3L37 A;  1GW4 A;  4KHX A;  3H6P A;  1IC2 A;  4WY4 B;  5KJ7 D;  1DH3 A;  1W2E A;  3P7K A;  1LTT C;  1LTA C;  1Z56 A;  3PP5 A;  2YO2 A;  1E5W A;  3L36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...