3M9QA

Drosophila msl3 chromodomain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
b'LRDETPLFHKGEIVLCYEPDKSKARVLYTSKVLNVFERRNEHGLRFYEYKIHFQGWRPSYDRAVRATVLLKDTEENRQLQRELAEAAKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein male-specific lethal-3
publication title Corecognition of DNA and a methylated histone tail by the MSL3 chromodomain.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 22
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3m9qA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3m9qA01
2RHIA 5D6XA 3L2QA 3DB4A 4BACA 4E7KA 3FEOA 5J39A 3OQ5A 3P8DA 3PMIA 4RG2A 3OYIA 4A4HA 2B8AA 2M1HA 4IURA 2EQJA 2RI2A 2XK0A 3UT1A 2LRQA 3H6ZA 3OYGA 2EQKA 2YRVA 2JTFA 2EFIA 3OYAA 3LGFA 3CEYA 4EDUA 1WJSA 4E7LA 1WJRA 2QQSA 2WSCH 3OYHA 4C5EA 3DB3A 4BDYA 4E7JA 4OVAA 2LCCA 2EKOA 2K3XA 2X4YA 3NTHA 4FL6A 5CIUA 4PLLA 3S3MA 3OYEA 2K3YA 3OYMA 1NU1K 2BIVA 2R5MA 3PMTA 2RJFA 3MP1A 3S6WA 2RJEA 3QKJA 3QBYA 3ZEHA 3OS0A 2LKMA 2IG0A 5C0MA 2D9TA 3Q1JA 4BE2A 5KH6A 3S3NA 1SSFA 5D6WA 2JZ2A 3MEAA 3L2UA 3F70A 2M16A 2G3RA 4Z02A 2F5KA 1L0NK 2RJDA 5IAYA 1SQVK 3OYKA 4HCZA 4PL6A 3FLGA 2RO0A 4UC4A 4ZTFA 3L2WA 5FROA 1MHNA 2BKDN 4B9WA 3OS1A 1OI1A 1RI0A 2L3RA 2L89A 4PLIA 5IN1A 1SQPK 3MEWA 4IKFA 3LYIA 3OYBA 3PFSA 3ASKA 2J59M 3LLRA 1OZ2A 5KE3A 3PNWC 4BE1A 2GFUA 2PQWA 3MEUA 2GFAA 4A4EA 2M0OA 2EQUA 3OYNA 3OY9A 3L42A 3LW5H 4IFDK 3EAEA 3ME9A 2DIQA 3QJ6A 2FHDA 1SQBK 4QQDA 2BUDA 2RHYA 2X4XA 4C5IA 3OYLA 2R58A 4L59A 2MWOA 5KCHA 3OYJA 3DLMA 1OZ3A 2VYTA 3BDLA 4IUPA 3L2RA 2RI3A 2FYUK 5C6SA 1NTKK 1NTMK 2P0KA 2XDPA 3OB9A 4N4HA 2DIGA 2DAQA 2O4XB 3S3OA 3OYCA 3E9GA 4IUVA 1SQQK 3OYDA 5KE2A 4E7HA 3H8ZA 2WSFH 2E6NA 4QQ6A 3OA6A 4IUTA 3OMGA 2QQRA 3P8HA 1XNIA 3MP8A 3META 3MO8A 2HQXA 2OARA 2E5QA 4IUUA 3L2VA 3LH0A 3UWNA 4QQGA 2GF7A 2RHXA 3FDRA 3OS2A 3CLQA 3QIIA 1WJQA 4A4FA 3FC3A 2LDMA 4ZTJA 2R57A 2RHZA 5FRMA 1N27A 5FRNA 2EQMA 2MWPA 4II1A 1SQXK 4IUQA 2HQEA 4X34A 5J26A 2WACA 3KUFA 3O8VA 5M9OA 4QW2A 4BDZA 3G3ZA 2X35A 4E7IA 1H3ZA 1OYXA 3M9QA 2X4WA 4Q5WA 2O4XA 1G5VA 4C5HA 5D6YA 2LTOA 3SD4A 3NTIA 4GY5A 2LVMA 2RJCA 4FU6A 2RI5A 4QVZA 4LD6A 2CKKA 2WSEH 3MP6A 3GOXA 2NLUA 2RHUA 3C4SA 4BD3A 3MEVA 1NTZK 1WGSA 3E9FA 4A4GA 3NTKA 4CRIA 1L0LK 4NS5A 5KCOA 2L8DA 3LGLA 3OMCA 4C5GA 3OYFA 4BE0A 4B9XA 5KLVK 1KHCA 3LX7A 2R5AA 2O01H 4N4GA 4N4IA
chains in the Genus database with same CATH superfamily
2PVDB 1OVUA 2RK2A 2VWFA 5KJ7A 1M90Q 3P8DA 2HKQB 3CCQT 1KB9E 1LTIC 4XTVA 2F1LA 3CMAQ 3CXHD 1VF5D 2JTFA 2EFIA 1KQ2A 3Q5SA 2CZ7B 2OTJQ 1YTZI 2ZT9D 4PJ0H 2HBWA 4BRYA 4PLLA 4QT7A 2QG9B 3HP9A 1QKWA 3MUDA 2RJFA 2HYNA 3L73D 4BI3A 1NU1J 2BZ8A 3H1IG 3TGUG 5LL6S 1X22A 1DD3A 1PSEA 2AZSA 4OMLA 3CCVA 1HYOA 1PKTA 4RJTA 5GMKj 3BE3A 1UUEA 2SEMA 5DY9A 3GW6A 2RQWA 1OMIA 4XU0A 2KS1B 2LMJA 1YHQP 4NL3A 1YI2A 4RTWA 1VQKQ 2IPPA 3MEWA 5AYFA 1UGQB 1VIEA 1X43A 2QDYB 2CP0A 1VL2A 3FWLA 3F5HA 5FW9A 1N7SC 2BEZF 3L2ZA 3G9RA 4LE9A 3V7RA 3H1IE 1U7MA 3SWYA 5KYUB 5AW5B 3TGUE 3OY9A 1BBZA 1JY3O 4QVDA 2W6JH 3L75E 3BASA 3CPWA 1QCNA 1VQ7A 3DLMA 2DZ9A 2ABLA 2PVGB 2RMZA 4A53A 1BE3E 3JCMg 2DAQA 4K35A 2HQHA 4UB8H 1X79B 2F69A 4TVRA 1IC2A 1N73B 4FM4B 1QLYA 1N7SA 3B5ND 2KROA 3OMGA 3NMZC 2LCLA 2P2UA 4IUUA 3RBZA 2Q7CA 3FDRA 2WMMA 1BCMA 3QIIA 3L74E 1OW7A 1W70A 1GTWA 2RHZA 3PRJA 3HD7C 5KLIB 4DT0A 2OQQA 5GAMf 1I1JA 2M5AA 2OTLP 4X34A 4DQ2A 3VS4A 3G4ST 4M4ZA 3KPEA 3PTAA 1U1TA 2YUNA 2LXBA 4PJOG 3M0TA 3GIBA 1N8RC 2FYNC 2X4WA 3RL0D 1N6AA 2KI7A 1NTKJ 4RCBA 3PJSK 2D6FA 2QM8A 2FRWA 2KMTA 3PIOA 1BGYG 3EHRA 3H41A 2KY9A 1YJ9A 2M9UA 3HD7A 1LT9B 5KAFE 4JLGA 1EZVG 5CR2A 3P7KA 4OMMA 3CCUP 3FB9A 2OGUA 1BI1A 1ZSZB 1JY2O 3M55A 5CBNA 2DFUA 2J6KA 2ENMA 1WXBA 3OMCA 4M7DC 1S9KE 4HCKA 2ZPGB 3HRNA 4PJOE 1UHCA 2BE7D 1MNDA 5HCKA 3HFOA 1HXDA 5IHIA 1GL2D 2IBZI 4A4HA 2B8AA 4PJNA 3D7SB 1QVFA 5I2MA 4M75C 2EGEA 1AHJB 1IFJA 5AW7B 2CUBA 2K88A 1WXTA 1PIXA 3EGDA 3JCMb 2G6FX 4OVAA 5CCGC 1WT6A 2J6OA 2K3XA 4ZN3A 1K04A 4M7DA 1BCCG 1L0LD 2FVUA 3VS1A 2M8RA 1RUWA 4FYXB 1JMMA 1P84E 2VASA 4F14A 1UHFA 1Y9BA 3HE4A 4M75A 2QDLA 1YIJQ 2DJQA 4Z02A 2CT3A 3GG2A 1BKBA 1N8RU 3KBGA 2HPCA 2WSCE 2CSQA 2WPRA 3DLLA 2JOYA 2A28A 1MMAA 3OYMA 1HBWA 1SQPK 2A45H 1HWTC 3OYBA 1FC2C 4FW1A 5LJ5f 3LLRA 1OZ2A 3H1IJ 3PNWC 2XD0A 3TGUJ 2EQUA 1VQOQ 1BDCA 3L75J 4RTXA 1ZUUA 2PRRA 4KHXA 2X4XA 4C5IA 2BASA 1QVGS 3SHWA 1BE3J 1L0LG 2E12A 4F7UF 3CWBG 2FYUK 3LH5A 1D0XA 4OH8B 1TTHB 3CPFA 4CC7A 1SQQK 1H8KA 3CMAP 3I55Q 2EPDA 1NM7A 1K1ZA 3G6EQ 5LJ3j 5DJTB 1QL2A 1NH4A 1G3YA 1X2QA 3L74J 1WA7A 4C92C 4I6MC 3TK1A 5KAIE 2KBTA 3M9BA 2R57A 2CH4A 1BSHA 4F7UB 3L71G 1KTMA 2J6FA 4JS4A 4WY4B 1I07A 1JXOA 4C8QC 1I5LA 3VMYA 3M5AA 5LJ3d 5GAN3 1SG5A 4C92A 1VQKP 2KE9A 3CC2T 1XTGB 3TNUA 3D70A 2D1XA 2C0TA 1HJDA 2DLPA 3QWXX 3EFOA 2KB7P 4H44D 4F04B 3BCCD 1WQ7A 4H13C 1PGOA 4U3FD 5AW3B 3TSZA 2JS2A 4C8QA 1WX6A 1KILB 1UIIA 1ZUKA 1SQXD 3SWKA 3GLXA 4MMLA 3QO3A 4M77E 2O31A 1IFNA 2E6ZA 3HFNA 2M0BA 2M1HA 3UT1A 2LRQA 3B71A 3EFFK 1FOSE 3WVDB 1MNEA 4M78C 1GRIA 3RMSA 5FLXE 1M4ZA 5KJ7D 1P92A 2ZJSE 2NPSB 3NTHA 3U1AA 2K3YA 1R77A 3PMTA 2IPOB 4FYWB 3LWIA 1WHJA 2COZA 2ECZA 3ZEHA 1YI2T 3VUBA 3V6IA 4HA8A 4J6YA 2G3AA 3BCCG 3MEAA 4O5VA 4F17A 1TUGB 2IIMA 4EYYQ 1KD1C 1WHHA 2O3JA 1FJKA 4EMGA 5GAN7 3D6ZA 1AVZC 5GAN5 1RI0A 2L89A 5M1BA 2WT7B 1I81A 1T8ZA 1VQ7T 4JF7A 4WWIA 4A4EA 2E1HA 5EC7A 2DVJA 4XFJA 4DEYA 2BZYA 1OQKA 2Z0WA 3R2PA 5L8RE 2ZPBB 2DILA 2HBPA 4PJJA 5FWCA 3RESA 2DE0X 3VRYA 3GNFB 3BDLA 1U1SA 4KH0B 1SQBE 4LDVA 1AWJA 4N0AC 2YXYA 5KYXB 1S4XA 3T97B 4EIJA 5GAN8 1RE3C 1ZR2A 1NTME 2FBWC 2A06G 4IUTA 3JC22 3CCEA 3CL3D 3VJPA 2P10A 2LR2A 3G7ZA 5K5GB 4FYYB 2HR3A 5IT9E 4OMQA 2JTMA 1VF5B 1N7SD 3M4YA 3MHXA 1Q81Q 3JB9J 5FRNA 1IREB 3J81E 2XZRA 2LJ3A 2HQEA 2ZT9B 2MYSA 4M7AE 3L35A 1R8EA 3JCMe 3B8EB 1KD1U 5GTHH 2DZCA 2O9VA 2FY8A 3MD0A 2D2CD 2O1KA 3L72E 4Q5WA 5CQYA 1G5VA 2LTOA 1BI0A 3RNJA 2XG8D 3MCAB 2LVMA 1KHIA 4PJOF 3HKSA 2RI5A 1Q86Q 1G3TA 3K5BA 5GMKh 4PJLA 1NEGA 3G71Q 2PGDA 3H1LD 1GCQC 2QM7A 1VQOP 2L8DA 1PL5A 1FJPA 1YJNA 4PNOA 4R4LA 4X9DA 3QZ9B 2R44A 5EG2A 2HAXA 3RL0g 3SFDC 2LCSA 3HD7D 1GD2E 3SDZA 3ZL7C 3MIWA 2CZ0B 2KSEA 1LNXA 1IO6A 1JCCA 1QVGA 3JV3A 2R3SA 3GHGB 2DK3A 4FSSA 1WNLA 2RI2A 2XK0A 1PP9D 4UB6H 1HSQA 1ZBJA 1Q82R 2DMOA 2HG5D 3I55P 5GTIE 1GCQA 3OYHA 2CP3A 2ZPIB 3G6EP 1RAGB 2O01E 1NTZD 1RF0C 4YXWH 1HJBA 3S6WA 5APUA 3QKJA 3FXEA 2NZ2A 2LNVA 1FZCB 3B5NB 2JP3A 1B34B 2E74C 2Z5HA 2W6AA 2JZ2A 3VS6A 2X51A 5AW1B 4M7DD 2PZ1A 1AZEA 3QWYA 3L2WA 4XTWA 4I2LC 1UIXA 1OI1A 3EGXB 1M1KQ 1TSFA 1JTHA 3I56Q 3QZ5B 4KUIA 3NPFA 2QJYC 5APYA 1QQJA 4M75D 3HUSB 2ESWA 3ABVC 1T6AA 5L8RJ 1OVRA 5CCGD 3ME9A 3RL0B 1OU8A 3H9NA 3OW2S 1LTTC 1SQBJ 2EKHA 3JSVC 1E7OA 4C7RA 1VQ5Q 2LZ6B 2QG4A 1L0ND 2P0KA 4OP0A 4L74A 2O4XB 1MV8A 1NTMJ 2IZ1A 4IUVA 2WSFH 4PFZA 3Q1MA 5TISE 4EDFA 1WQWA 4M7DG 5GAMg 1SRMA 1VQMQ 1KC8Q 2HQXA 2OARA 2DTIA 3OS2A 3CCMP 2OYIB 1ZW0A 3FC3A 4MZTA 4KRTA 4M75G 2COWA 2P4RA 5CCHC 1MUZA 2EQMA 5I2SA 3Q3DA 2IVWA 3CX5I 1IFPA 3H1KE 1PM3A 4Y99B 1KD1R 3H32A 1OXZA 3L72J 3BDUA 5IXFA 1M8OB 3OW2P 3B4SA 4D6TG 4DOJA 4KGZB 3CCJQ 1PD0A 2MIOA 1A02J 3CCLA 1C0MA 2F5TX 1K73C 3FWNA 4OB1B 2M02A 3OSSC 5A0LA 3H1JE 2AIRB 2MAMA 5CCHA 1W2BS 2L2PA 1KFZA 1YQ3C 4DOVA 1P84I 4DJGA 1L0LK 1R0CB 1FOSF 1WFWA 1NOHA 2CP2A 2V1QA 2ZPFB 4OVNF 4JBZA 4ZNXA 4C92D 3HTKA 5CKHA 3BVHA 2FPFA 4J6XA 2DERA 2QA4A 5AVVB 5GANf 1NLOC 4JDSA 4MZPA 5FU7B 3RK2C 3FEOA 1MFZA 3OQ5A 3FJPA 1YJWA 2EYXA 1M3CA 2BCCG 2JDIH 4J5YA 3VRZA 3CC7A 5A2QE 3JCUH 3ITKA 3RUXA 1QP2A 2H8PD 4EPCA 2KDSA 2EQKA 2YRVA 4RTVA 4W7ZA 4IIOA 4C8QD 1GW4A 2L0AA 2HKNA 2O01J 4FCYA 4EMKC 1SP4A 4HT8A 2DL3A 1X6BA 2DF6A 2K5LA 1PC0A 1SQPG 4YTPC 1FZAA 1GL2A 1EZZB 2LKMA 1SF9A 4H13D 3M59A 1HK9A 5LJ3h 3JCMQ 3A0HE 1VQ9A 3CD6Q 5LJ5g 2NUPB 2K7AA 3AE5C 4C92G 5AW8B 1ZP0C 5KLVE 2MPXC 4HKEA 4EMKA 1R5LA 3EFGA 3M0DC 5FROA 2RB6A 2YDLA 4B9WA 1K73U 1H0TA 3VP8A 2LT1A 2LQNA 2FYUG 1GK4A 3FXDA 2RQTA 3TDKA 4LNPA 4M78D 2GUSA 3G71P 3VS5A 1SQQG 2IZ0A 3QWOC 3L42A 3EAEA 2D0QB 4ZN1A 2QEXA 3JB9I 1GFDA 1USDA 1T0HA 4HVWA 2EYWA 3LWHA 1FX7A 1Q82Q 3JCUE 3M0DA 5CKBA 3CCET 1NKZB 3TF5A 3CMEQ 1JO8A 1AOJA 1RACB 4H44B 4KT0E 2XNDH 3QXEB 1S2EA 3V4WA 2C9NY 4QQ6A 1IK9A 1L4AC 1SQVE 1ZA2B 3BATA 2K6DA 3M0PA 5FWBA 4C0DC 2A7YA 3CCSQ 3NMDA 2K2VA 3A1PA 5KYYA 2LDMA 1FE6A 3CMAT 2WPQA 3WUUA 3H1KJ 1BCOA 3GF7A 1SQXK 1UG1A 2J5UA 2WACA 9ATCB 3KXTA 1NTKD 1L4AA 2JWDA 2XV5A 2O2OA 1M27C 3AE6C 3H1JJ 4GY5A 2N9BA 3M54A 4LUEA 3I56P 1YITA 4AFQC 2H8HA 4L6V5 4BRYB 2DXUA 2KXDA 1VQNQ 3CCMA 1VQ6Q 4FIBA 1G2CB 1FBMA 2EAYA 3EH1A 2C0XA 4F7UE 2E75C 4WTOB 4I7ZB 1UJ0A 1OZHA 1YQ4C 1OPLA 2ZAEB 1KB9D 1LTJC 1O9SA 4C5GA 1VQKT 2X4JA 4A54A 2OX7A 3UATA 4MDWA 4N4IA 3QHSA 5GAOl 3OW2A 1KQSO 4RG2A 1RAFB 4X9CA 2E5TA 3JAME 2DTHA 4R56A 2QIWA 2JKVA 1M1FA 3M56A 2E10A 1C6VX 2EYQA 3VYGA 3JCMJ 1LTJA 2SPZA 1VQMP 1V76A 1H92A 1KILE 1VA7A 1ZUYA 3EQ2A 2CH4W 1KIKA 3CC2A 4C0GA 3CBMA 3F70A 3L2UA 1MMNA 1BB9A 5KLVJ 3JCMc 2CK3H 3M91A 4JJDA 1N9SA 4DBQA 2AXCA 4C46A 3CCRP 4KH1B 2HODA 1BSNA 3CCJP 1N7SB 3FIFA 1K73R 2E4HA 2JEEA 1Q2NA 2ZCFB 1NPRA 3ASKA 2RN0A 3AHUA 4PD4I 1PGQA 3QH9A 2VC8A 5IHKA 1GW3A 2FXMA 2Y9ZA 1CW5A 1W2BA 1BE3D 2BUDA 3VV0A 2M5AB 1CSBA 4L59A 5KCHA 2ATCB 4OMNA 4D6WA 3OA7A 2F2VA 1M2VA 3H0FA 4JJBA 4E7ZA 2E74D 1YWOA 2DO3A 3P8MC 4B86A 1SQVJ 2KRMA 2JS0A 4AFSC 3SB2A 3J7AF 2DNUA 1SHFA 1JJ2P 1T3JA 1PGJA 1S1NA 3HD7B 3G71A 4ASVA 2PNIA 3KHUA 1JXMA 1OW6A 2QXFA 4FT2A 4OWFA 4JRQA 4A4FA 1NBEB 3RK3C 1LTSC 1OX8A 1VQ4Q 3HPWA 5AVQB 4IL6E 3V2PA 2FYNB 3CCLT 4L5GA 5KAFH 3CD6P 2RPNA 3JCMP 3V7CA 4OB0B 4RG8A 3WU2E 3L73G 2D2CC 4DCKA 5GAN6 6AT1B 1OYXA 3U23A 1LWUC 4Y28E 1LGHB 1YBKA 1RQUA 4OGQC 3H25A 2E3HA 2JMAA 3SD4A 5GAMe 1NAFA 3E19A 1USEA 2QGFB 2QA4T 3CX5H 1L2PA 3CXHE 3M0SA 2QJKB 4GBQA 4D8KA 2W6BA 5GMKm 3N7NA 3C4SA 4M7DB 1J1DC 1NTZK 1TS9A 1S1CX 1VQLA 4P5NA 2K9JA 2V8IA 4ME7A 2CSIA 1YJWT 3CC7T 3VKIA 1FXXA 1QX8A 5AW6B 3H1HD 3HE4B 2R5AA 1K8AQ 4M75B 3C12A 5CCHD 3NXSA 1S72Q 5B5EE 2RK1A 2HPCB 5GJWB 3CMEP 1IHVA 3NFCA 4MZMA 2PAJA 1ZR4A 1P84H 3IAOA 4XTXA 3R6NA 1NYHA 1VQOT 1KMIZ 3H6ZA 1OEBA 3UF4A 4XU1A 2ZXXA 1D09B 1Q7YC 2WWWA 1VQ9T 1WJRA 3FGAD 2WSCH 4E7JA 3CCQQ 1J2JB 3L36A 3S3MA 2YO2A 3X26B 5HKCA 4J9DA 1SS1A 3CCSP 1W5CE 2B87A 2XI9A 2JR8A 2FPDA 3I55T 1W6XA 1SSFA 1CKAA 1Y47A 4B6MA 1MFTA 3RDVA 1L0NK 4A7PA 3FLGA 3VN0A 4J7FA 3H1HG 3RK2D 4ZTFA 1VUBA 3CX5E 2GCXA 5BU5A 3NFQA 2JW4A 2QEXT 4IKFA 1KQFB 1BGYE 3RBXA 3CQTA 3JRZA 2ED0A 2NRGA 1Y71A 1EZVE 2GFAA 1H88A 1U3OA 2Y4XA 1VQNP 1DEEG 1VQ6P 1NKNA 1ZA1B 4JRKA 3PH0A 4AT1B 1D0YA 3JCMd 3T9NA 3II6A 3RR6A 5LJ5e 3CXCP 3OYLA 1OZ3A 4HCBA 1K4US 1FZGA 5KAIH 3CCRA 1OFCX 1KQSP 1RAIB 2Q6QA 1JY3N 5CCGA 3H8ZA 4C92B 1Z9ZA 1Q7YU 3JB9H 5C39A 3TNUB 2X3XD 1OU9A 1U06A 3BRVB 2OTKE 3EFOB 3S4RA 4K3AA 3X20B 1SLQA 2D8JA 1BCCE 2M0YA 5GAN2 2FRYA 3A98A 3JSCA 2MF2A 1AV1A 2FB7A 2KYMA 1UEBA 1AQTA 3O6QA 2MWPA 4MN4C 3PGGA 1Z9QA 3KUFA 1YITT 2HL5C 5M9OA 4Y28J 3CCMT 4C7NA 1ZQ1A 5IHNA 1E5WA 1AVOA 2K5FA 4WB4A 1YHQA 3W67A 4JRPA 3M4GA 2P0QA 2DYBA 3AE4C 4NOYA 3G4SQ 2V26A 1VQPQ 5GANg 5GAOp 3HRUA 1VYTA 2OTJP 2VUBA 1Y07A 1L4AD 2JNGA 3MEVA 1MMDA 1EDJA 2JWAA 4FSXA 4J8OA 1J1EB 4TT3H 2QQBA 2XHCA 4FYVB 1NYFA 4N4GA 3CD6A 2VXEA 2WITA 1X01A 1L0LE 4KGXB 2HNIA 3CWBE 2A37A 1D3BA 2CZ6B 4VUBA 2AEFA 1ZBXA 2A45G 3EG2A 3E1SA 2Q5UA 4YXDC 2KNCA 1LTAC 1QCFA 1YWPA 4JZ3A 2K57A 2H88C 2HDAA 4E7LA 4MDXA 3ZFJA 1VQ8Q 4ZGEB 1OOTA 4XU3A 2RJEA 1F1BB 1CI6A 2MOXA 2VVKA 2CP7A 4XQ3A 5CCAA 2XU8A 1VQ4P 5C0MA 2E75D 3L71E 2I2LA 5DLQE 2B89A 2LQKA 1N7LA 2OTLA 2LX9A 2PP6A 1JY3P 1S5LE 3MKDA 2F5KA 1QL1A 3GBQA 1NJIC 1JO5A 2CUDA 1D1AA 5LJ5h 2EJ9A 1BGYJ 1CZQA 3R4YA 2BKDN 8AT1B 1M5Q1 3OS1A 1YN8A 3V8KA 4Z1MH 2V7QJ 2JTEA 1MZ9A 2V8KA 1YTZT 5KE3A 4R4MA 1VYVA 2P4TA 2ZZDA 1KORA 2H89C 3CCUA 1QLED 3RMQA 4LDWA 3WUVA 1KYOI 1TH7A 1SEMA 3KQGA 1HJ0A 1SFCB 4YPCA 1PWTA 3OYJA 2WSCJ 3QDFA 4U3FG 1NTKK 2QK0A 2XDPA 4M78A 4PD4H 1S72P 5HY6A 2GM4A 3G71T 1N8RR 1RH5B 1RF1C 1I8FA 4BWNA 1Q7YR 1EDIA 1SQXG 3KZIH 1GU5A 1N86A 1LT1A 2PFXA 1N5ZA 1BCCJ 5HK3A 1K9MC 1HGZA 4HJGH 3CCQP 2Y4YA 5D7UA 3VMXA 2RHXA 1PGPA 3M0QA 2GTOA 2DETA 4RO0A 2Q3EA 1LOJA 5FRMA 1N27A 1G2BA 3CC4Q 4N78E 3L72D 1JY2P 1ZXGA 3BCCE 3GLMA 1RF1A 4ZKUA 1TXQA 4DOWA 1ACMB 1PZQA 2CPBA 2FZCB 4CPGA 2QYZA 1OW8A 1I0CA 1NJIU 2E5YA 4JLIA 1M1GA 1EX4A 1VQLT 1KILC 3TQ7P 1KJWA 4C5HA 1URQC 3GMAA 1TWBA 1M8MA 2DVEA 3WUTA 4FU6A 3AEAC 1M90C 3L70D 1ABQA 1ABOA 4QVZA 3EG0A 1FZFA 2L3PA 2HD0A 1WLPB 2E5KA 4A4GA 4EIKA 1IB8A 5GTIH 3CBOA 4GLMA 2CP6A 2C9LY 2P1JA 1L0LJ 1FS0E 4GT1A 4N0AA 3CWBJ 2NUTA 4B9XA 4PD4E 4BE0A 2Q9IA 2H3JA 2DL4A 2O01H 1KILA 3I56T 3RK3D 2Z5IA 2RQRA 1AT1B 1EIFA 1R0BG 1URQA 5J39A 3KZIE 4RTUA 1RE3A 5FU6C 1YIJP 5CHXA 3WMM0 1SHGA 2J7IA 1YNZA 3M57A 2PUKB 1JTHB 3CMAA 1PPJD 2A06E 2AXTE 1EDLA 2QAZA 1K9MU 4OGQD 4BDYA 4C5EA 2OTJA 1XJWB 1M57D 4O6JA 2E74B 4HVVA 1JEKA 1V1CA 3GF5A 2JO1A 3L70G 3L71J 2D8HA 4PV1C 3OS0A 4GDOA 3CCVQ 2Q1KA 4BE2A 2M16A 1Y8AA 1JRIA 4RTZA 4Y91A 2GA1A 2QJYB 3V2NA 2JM8A 2X9HA 3E1IA 1YI2Q 2VXFA 3ER0A 3I5CA 1QVPA 1AEYA 1MHNA 2YHTA 2CP5A 4BY6C 1TU3F 1VQKA 3V8JA 4BB7A 4LLHA 1VQPP 1K76A 2C06A 4QVCA 1FMKA 1DEBA 1K0SA 1PPJG 3QYHB 3OYNA 3CCRT 5GAOr 2FKWB 3F89A 3P32A 5TISH 1G3WA 3KFVA 2MK5A 3CPWO 1VQ7Q 4W7YA 3PLNA 3BY7A 1X6OA 3REBB 1E6GA 4JRIA 2MWOA 3M53A 3QSUA 3H32B 5CKDA 2K3RA 3Q5PA 3H1LG 3AT1B 1LPLA 2IBZD 3G1JA 5KE2A 3CXHI 1WHLA 2E6NA 1RF0A 1BIBA 1OULA 3EHQA 2YKQA 3TU4K 2GF7A 4HB1A 4A63B 3QPHA 2V1RA 1VQ8P 1PP9G 3I5SA 3OSVA 3HE5A 4ZTJA 3BCCJ 3HTKB 1YHQT 4NL2A 1DIPA 2X3WD 4JJCA 1RY3A 1HGVA 1NTZG 3KXDA 3VMZA 3VTPC 2CYZB 1NJIR 1QMCA 3G3ZA 2K5IA 3H1JD 3M9QA 3AEFC 5H2FE 2EWNA 2RMOA 3JCMh 5E79E 1RI9A 1YJ9Q 2IBZG 3CD6T 2FZKB 3S1KA 5J3BA 4PJOC 1CSKA 3RIRA 3NTKA 5GMKi 4W80A 3RK2B 4LGDE 1GL2B 3Q5RA 1PHTA 1MV3A 1N8RQ 1NVOA 4LDXA 3O8ZA 3A8HB 2QQAA 2RHIA 1X9VA 3X28B 2LP5A 2QVAA 1PFIA 5LJ3f 1FZCC 1Q95G 3QUIA 1QVFO 4J9CA 5AVXB 4EMKB 7AT1B 2KIKA 2H7HA 3A0HH 2WSEE 3OA6A 3OYGA 3SWFA 3OYYA 1GBQA 2JJ9A 1H0TB 4PJOA 5GANe 2LXCB 4M7DE 1EZVI 4OGEA 2MKVA 1BK2A 1L0NG 2KT1A 2OTLT 3A0BE 4EI2A 2KYBA 3RBBB 2ZYGA 3MP1A 2DXBA 4M75E 2M3BA 2JJLA 3HUSC 3P8CE 1M2OA 1QWFA 2IG0A 2E76C 5KLVD 3V7SA 4Z89A 2EGAA 1SRLA 3CC4P 2EYYA 4D6TE 1YIJA 5CJ0A 2HL3A 1PV3A 4UC4A 5KKZC 2Y0EA 3CCUT 2O01N 3CCST 1NZ9A 2LQ8A 3INZA 5GAMj 2L3RA 4IOIH 2GUVA 3M0AA 2W0ZA 1TUDA 2IX7C 2J59M 3HUSA 2JUFA 2Y9YA 4BE1A 2GFUA 3C1LA 2JMCA 2XIDA 2M0OA 1NU1D 1NWQA 5KYYB 1RADB 5IXBA 3QJ6A 1U8RA 1VQOA 2FXPA 1NO4A 3OBWA 2YO3A 3FJ5A 3D71A 1ZV8A 1OX3A 1J3TA 1L4AB 2J58A 2FL7A 2KR3A 2BCCE 5GAMd 3VS3A 1SQVD 1VQNT 1VQ6T 1WZOA 1ZX6A 3S3OA 4K11A 3VU3C 1QCOA 2COYA 2MCNA 4Y99C 1KYOH 2JN0A 2HSPA 1XQHA 3I55A 3UPUA 1UGPB 3G6EA 3URGA 1UDLA 1M56D 5CO7A 3M0RA 2FFDC 1U5SA 2YNYA 3EG9A 1QGKB 1FMVA 1K9AA 3QDRB 1SQPE 2ROLA 2WZ7A 3I5RA 4C8QG 1H3HA 3U1CA 5APSA 4BXLA 2DL5A 2NUZA 1NU1G 3CCVP 4PFOA 4OF1A 4C92E 5B66H 1IJDB 4QW2A 1NLPC 2RKLA 2QJPC 1H641 3M0UA 1YI2P 2XNXA 4TLFA 1N2DC 2FFDA 5FU7C 2KLUA 2EBPA 2E75B 2FYUE 2VRSA 2YXQB 3IFMA 2FZGB 1E79H 2IYPA 5I11A 1T3UA 4ANJA 1LTJB 4GIFA 1X8YA 3AE1C 4RKUE 3MP6A 1SQQE 2DTOA 3GOXA 5HK0A 1PNJA 4M77C 4U7JA 1AFOA 4XTZA 2ZYDA 1M1JC 2VGMA 2DL7A 2E43A 5LJ5j 4M78G 1KHCA 4ELZC 3CPWP 1VQ7P 1KV4A 1JEGA 1UGSB 1EDKA 3THKA 2OTJT 2WSEJ 1KYOE 2KP8A 1DD4A 4IFMA 1DX7A 4BI8B 2HODB 4L76A 3ZDMA 3SWNC 3VYHB 2YIUC 1W1FA 3UDCA 2EVRA 2I8DA 2QQ9A 3LGFA 4M77A 1KILD 1WJSA 1AWWA 3FX0A 4BI4A 1URQD 2CT4A 1M1JA 2GQIA 3HRTA 2BEQD 2EKOA 4FL6A 2WPSA 2L3QA 1Y57A 2BIVA 5DJUB 2KYVA 5LJ5d 4EOTA 1C1AA 1FZBA 1WYXA 4J9BA 3SSUA 2CREA 5B66E 1OVVA 1BI2A 2LNHB 4D6TJ 1VDFA 3SWNA 1MV0B 1M2VB 3EH2A 3IR9A 1GBRA 1VQ5P 2RJDA 4KJMA 4PL6A 2P58A 1UFFA 3AEGC 5CK9A 2OYHC 2F2XA 1LP1A 4ZKPA 4PLIA 4N3YB 3PHLA 1VQ4T 1VOMA 2K1AA 3UA6A 1M7LA 1LJOA 1NTKG 2XMFA 1YJ9P 3MPUB 2YMYA 1GK6A 4JPBW 4JUVA 3QG1A 1AWXA 1KD1Q 4QQDA 2EJFA 1NPPA 4DBRA 2OYHA 2BCCJ 2DA9A 4PV1D 3A8LB 2K4YA 3TYYA 4XE5B 2JT4A 4MMKA 1PCXA 1ZLMA 4IL6H 1Q81C 1JJ2S 1Q90D 1QVFP 3CCEQ 2C0WA 3WU2H 2N1TC 3H1ID 3RK3B 3AE7C 3PIPA 1ZRTE 3TGUD 3META 3SEMA 1YBYA 1SQPJ 4M7AC 3UWNA 2QRXA 2K9JB 1S72T 2E3IA 3L75D 2V8JA 4CC2A 3X24B 2D2CB 1WDXA 1V29B 4GOEA 3CXHH 1KG1A 1Y96A 3MUDC 1Q86C 4OGQB 4D8DA 3EG3A 5AVZB 3TREA 4I7ZC 1HH0A 4KT0J 2MMPA 1RE4C 2N1TA 3IQLA 2FYUJ 2KI7B 4LC1A 1K0XA 1J1DB 4M7AA 1EFNA 2RNAA 5B5EH 4RKUJ 2R5BA 1SQQJ 3L74D 1R8OB 4BD3A 1T2KC 1G2CA 1A0NB 4IFFA 1OV3A 2JVVA 3CI9A 3E9FA 4H0LC 1YJNQ 3HL8A 2RF0A 1R5SA 4M7DF 2B87B 2K9YA 1IZNB 1IRXA 3A5TA 1RE4A 2ZAEA 3RGUA 1FDIA 3LX7A 3L75G 1QVGO 4BACA 1G1IA 4AG2C 2HCKA 3DKMA 4M75F 3PMIA 1Q81U 3VOPA 5KYWA 1BE3G 1YP5A 3WXMB 5GMKl 2XDJA 2QQSA 3EGDB 4J9HA 3DB3A 5APVA 2VV5A 4JJNK 2L5GB 4XU2A 2CS7A 2CZ1B 1YIJT 2XICA 2R5DA 1M1KC 3V5BA 1S9KD 1XOVA 2KNBB 4KUDK 4PJOD 1IFMA 3L74G 1Q86U 4ZMDA 3VS0A 2V7QH 5KH6A 3CX5D 4AQRD 4GODA 3TVTA 1LWUA 2PUOB 4DEXA 3L73E 4OMOA 4LD9K 1AVYA 1BGYD 4ATOA 5APTA 5AVUB 3TSIA 2OAUA 4HCZA 3TSWA 3A8GB 4PJ0E 2A08A 2VB6A 1EZVD 3GF3A 4PJMA 1JOCA 5GAOn 4JYBA 5AW4B 2MJZA 2M3EA 1JQQA 3I56A 1QW1A 5APXA 4J9FA 1EC5A 2L3SA 2YLBA 4LDYA 2PQWA 3MEUA 4J9IA 3VP9A 1P84D 1LCKA 2YLCA 2DRMA 1UE9A 3CXCS 2DBMA 1G3SA 4RTYA 3O6QB 2QE7H 1KC8C 1NG2A 3C94A 4R0KA 3WVEB 1VQPT 1KQSS 1VQ5A 2E76D 4C7NB 3G6ET 4E6RA 2XKMA 2KVQG 5AVTB 3E9GA 2KS1A 1YFNA 1BCCD 1S3JA 4PKCC 2RN8A 1SKUB 2XKOC 5AW2B 1N9RA 3P8HA 2KUBA 3AEEC 4AMCA 4C92F 3A2AA 1AQ5A 3OAKA 1VQMA 2M51A 3L2VA 3LH0A 1M1KU 2E41A 1N73C 1WJQA 1KFMA 4AFUC 5GJVB 5KYUA 3U59A 3V2QA 1U7JA 2QJKC 5A0DA 4UB8E 1X0TA 3NHNA 1JM0A 4II1A 1D3BB 3UA7A 4C8QF 2WVRA 1U57A 1Y7XA 2O9SA 4AUWA 2WSSH 3H1HE 1VQ8T 1BDDA 1H3ZA 1RLPC 5KLIC 2DKGA 2KNCB 2POHA 3CCLQ 5KTBA 1GDTA 3CCJA 1DH3A 1N73A 2PU9B 1AZGB 3MP7B 2KGTA 1ARKA 2CKKA 1LTBC 2NLUA 5LJ3g 4J9EA 2HMAA 1WPYA 2AZVA 3CWBD 2PTKA 2YUQA 4CRIA 1CI6B 1QWEA 5GAMh 3AE9C 2O88A 3JB9D 1KC8U 1JBMA 2ED1A 3V2RA 2QA4Q 5KLVK 4C8QB 3MZWB 2XDBA 2KEAA 3L1AA 1LT9C 2QTVA 2B9BA 1IO4A 1K73Q 4YTLA 3L37A 2J05A 3ZBDA 3L2QA 3VMAA 1ZSZC 4E7KA 1YJWQ 3CC7Q 1Q81R 3R6OA 4M78F 2QASA 2ZGWA 4J6WA 2QSIA 1HUCA 1H8AA 4IURA 2EQIA 1S5LH 3PP5A 1FYNA 2OAWA 4HKZH 4H13B 1JJ2A 3CCEP 1EXIA 4ESRA 5CIUA 2IYOA 3L71D 1NU1K 1LT9A 4HXJA 5DLOA 4HYTB 2YRDA 2QTXA 3M9HA 1ZSZA 3QBYA 1Q86R 4M77D 1VQ9Q 3TCJA 3L73J 1M3BA 3AE3C 5D6WA 5AVYB 2FPEA 4M78B 3JB9G 2PVOB 2JXBA 1SQVK 2G8YA 1ZSGA 2DXCA 1AA0A 2RO0A 1JY2N 3EGUA 5TJHA 5GAN4 1Q82C 3A8MB 1FWZA 3O5ZA 1LNQA 2DXTA 3CC4T 1HF9A 4Y92A 2VKNA 2KQWA 2QEXQ 4FT4A 4WF2A 2K3BA 2RM4A 4E7SA 2DPPB 1YJNP 1ZMEC 2CPSA 5CKFA 1RF1B 1YCSB 1MMGA 2WQYC 2LJ1A 1RAHB 2HEQA 2VYTA 1FMWA 3L2RA 2F2WA 1NEBA 3CMEA 2J06A 4M77G 1QVGP 2DIGA 3I9QA 3RKXA 1UGVA 2D0NA 3OYDA 1KQGB 2XU6A 5GANj 4LN2A 3PTZA 2DM1A 3IN6A 1MKMA 3MO8A 2GTJA 4QQGA 2KK7A 1NYGA 2P7JA 4N78D 5A0GA 1M1KR 2YRCA 4C0FA 5CAIA 3JCMV 3CCSA 3FRNA 1SQBD 2NUTB 1HTLC 4HH2A 1KN7A 1AWOA 4DZOA 1M9SA 2A36A 4X1VA 1URQB 2GGRA 1J1EC 3LIDA 1EQ7A 3H1HJ 2WTYA 2DJZA 1T3SA 5GMKe 1YCYA 5AVWB 1NTMD 1TUCA 5GANd 2X35A 4E7IA 2QI2A 1Q82U 5ECAA 3C0CA 1YITQ 3CCMQ 3CCVT 4WY4C 2E42A 2ZPEB 3IF4A 2RD1A 4PD4D 2N1TD 3JCMX 4V2SA 1VQNA 1VQ6A 2AXTH 4QKUA 4WCIA 3MJXA 4NS5A 4M7AD 2FXOA 3LGLA 5CMZA 1KC8R 5FU6B 2DD5A 1IGQA 5CJ4A 4EMHA 3CXCA 2GQVA 2AKLA 1Y0MA 3OW2O 2KZIA 1ZN5A 1X2KA 4F7UA 5D6XA 4M3LA 4U3FE 2A06D 2E70A 2K2MA 2KT8A 3H0IA 1SQBG 1RL2A 4WY4A 1KQSA 1SQXE 3BRTB 1PRMC 4O9BA 2KLVA 4WBAA 2QGGA 3RKWA 3OYAA 4EDUA 3CEYA 1RABB 4LDUA 3HRSA 1NTMG 4PV1B 1JNMA 4NPFX 2EYZA 1GL5A 1QEXA 2K9GA 5DM7R 2ITAA 2EW3A 1WRGA 1GU4A 2R5MA 3VS2A 3UIAA 1ZLLA 1T2KD 3CC2Q 3N5BB 1T3LA 4H0LD 2NPSC 2RH2A 4BY6B 2YT6A 3KYQA 2I0NA 2YUPA 1D1CA 4M7AG 2LT4A 3X25B 2RA2A 3OYKA 5AT1B 4JQ0D 1XTCC 3P8BB 2AEJA 1JB0E 1SFCC 3I35A 2YSQA 2R32A 1WHKA 4J9GA 3L72G 5IN1A 2WPVB 3CCLP 3LYIA 5L23A 1LJ2A 2HSEB 4KULA 1GMJA 2DYIA 4AFZC 3AEBC 1XTDA 1VQ5T 2NPSA 2KRNA 1W2BO 1D0ZA 4JS5A 3HE5B 1B7TA 1NAYA 2ZVNB 4ZNCA 2FHDA 3QJYA 1EXJA 1LVKA 1KB9I 2EJGA 2RQVA 2QA4P 1SFCA 2P0PA 2KXPB 3E7KA 3L4FA 4IUPA 1HVVA 2L91A 1YJ9T 3KDPB 1PKSA 1VQMT 1UECA 3C8VA 1YJWP 4R55A 3CC7P 1BYMA 3OYCA 1RAAB 2BE9B 2DW3A 4QMAA 3J80E 1WHGA 1LTGC 3W68A 1SPKA 1M90U 1G1JA 3EFSA 2B86A 2WT7A 3OS5A 1TU0B 2HZYA 3G4SP 3BFMA 2W27A 5H2FH 3AE8C 2YXRB 3JCMf 3CLQA 3NGPA 1WHMA 3L70E 2P67A 4XTYA 2CGHA 5E79H 1IZ6A 3AECC 1FZEA 3CCJT 2NWMA 1VQ4A 1VQ9P 1AJYA 2K37A 4IUQA 1B3QA 1W2EA 3VYIA 1VF5C 2W8ZA 3RK3E 5KYXA 5BU8B 3T97A 4PJOB 2KSJA 3NTIA 1K8AC 2ZT9C 4OMPA 4JYCA 3E1RA 1JUNA 4ASWA 2RJCA 1IFDA 3EWKA 1OPKA 2LX7A 1FDOA 2WSEH 1VQLQ 1PPJE 2W83C 1KK7A 3VUZA 1AD5A 3H1KD 1CKBA 1BI3A 5GTHE 2QEXP 3A3YB 2IDBA 3AEDC 3V8LA 3A0BH 2R3CA 4GOFA 4U3FJ 2SRCA 3C95A 3H1LE 3DB4A 4PFPA 4RUGA 2FG0A 2AK5A 4RTTA 1S72A 1SQXJ 4NPEA 1X69A 3OYIA 1RLQC 5APWA 2EQJA 1QP3A 1RQVA 5LJ3e 2C0OA 3P8CD 3GHGC 2E76B 1KQLA 2ZVOB 2LCCA 2YUOA 3CCQA 1VPCA 1PP9E 4DA4A 2KZJA 3Q2YA 4XAXB 4HCCA 1W4SA 2I1JA 4D6TD 2E64A 4WVZA 1I4K1 1PRLC 5KKZB 3S3NA 1NTZE 3N4XA 4NPDA 1QKXA 5I22A 4UB6E 1Q7YQ 4HVUA 4JPZB 3H1KG 1B07A 2C0IA 1JB0J 4OB2B 2DD4A 1IXDA 1TOVA 1X27A 1T0JA 2JM9A 2OYOA 4XTUA 2YKOA 3B5NC 1K8AU 3LIEA 3GHGA 2I1KA 4J83A 1YYCA 3JB9F 1UB4A 2IBZE 1YITP 1K9MR 2IFMA 3MHVA 3H1JG 3EG9B 3RKYA 1BIAA 3A8OB 3HHTB 5KYNA 3RERA 2O1JA 2ZFCA 5AW0B 3CMET 1ZHIA 3LW5H 2Z4EA 1K05A 2DIQA 3TEEA 2FYKA 4IL6X 2BCCD 2RHYA 1DJ7B 1FZCA 3B5NA 5IH2A 3M06A 3H0HA 4E47A 1JCDA 1WI7A 1B34A 3CCRQ 3PVQA 2RI3A 1KSWA 4DBFA 3RL0C 2NYSA 2AT1B 3OB9A 4Z8AA 3AE2C 4L75A 2EGCA 3OBYA 1G8XA 1E6HA 4L73A 2EIFA 4BUGA 2FFDB 4E7HA 1VYUA 2LQWA 1SQPD 3EGXA 4JZ4A 1FDMA 4OB3B 1L0NE 4M77F 2BTTA 3GP8A 1M90R 2QQRA 1XNIA 4ORZA 2E5QA 3L70J 3V4QA 2KK4A 1M8VA 2RH0A 1UTIA 4RMOA 2V4HA 1HD3A 2AKKA 2KOGA 4F16A 2CDTA 2QJPB 3CC2P 3PE0A 2YMKA 1I5OB 3E2UA 2WSFE 1GL2C 3PT9A 2YKPA 2OYIC 4BDZA 2FYUD 1M3AA 4Z88A 4IIMA 1GCPA 1YHQQ 2GNCA 3GNGA 4AYCA 1NGMB 5KLVG 1SQQD 2O4XA 3A5ZB 4M77B 1FU1A 4C0DB 4I1LA 2W10A 1M1JB 3OJAB 3LW5E 4RCCA 4HT9A 3USSA 3G4SA 1VQPA 1OX9A 2DX1A 1GXIE 2DL8A 2A0FB 3CPWS 5I21A 2H3EB 2OYIA 1KYOD 1W2BP 1D7MA 3VS7A 3H1LJ 2L5QA 3SWNB 4LD6A 2YIUB 1WMKA 2VGNA 1LP1B 1BU1A 4J7IA 1TG0A 5AVRB 1X6GA 2DRKA 1GZLA 3QYGB 1M30A 8ATCB 1UGRB 2GBQA 1PP9J 2Y90A 1SQVG 2X4YA 3C9IA 1GFCA 3BW1A 3OYEA 1VQ8A 4C8QE 4DBHA 4E2FB 4WY4D 1RHZB 4CC3A 5GANh 1NTZJ 4N6JA 4GLKA 5CQXA 3M58A 2A45I 4FW2A 2OTLQ 1IFIA 1NU1E 2OYHB 5BVZA 2D9TA 3Q1JA 1WIEA 2Q3IA 5CVIA 2KAFA 2G3RA 4ZGDB 3HTRA 5IAYA 3GPLA 5AW9B 1JMBA 2FYZA 2KRSA 1K8AR 1SSHA 5GAOq 4KBMB 4PK4A 4M7AF 1KZUB 3PFSA 2HLOA 3MTUE 2AHJB 2ZPHB 2FEIA 3CCUQ 1VQLP 1UJYA 2K79A 3HSBA 1KFNA 2Y0CA 4XA4A 2AEMA 2IFNA 4IFDK 1MGQA 2ZXEB 1SQBK 2LC4A 4A4KA 1A02F 4CC4B 4F7UG 1Y96B 1JU5C 4M78E 1NJIQ 5EFWB 1O75A 4ELYC 4LUDA 2R58A 2A3LA 2KXCA 2DEQA 4OGCA 5CKEA 1ZOYC 2ROTA 2LJ0A 1H89A 2NPSD 2N1TB 4AG1C 5C6SA 1QVFS 1NTMK 1Z56A 1PG5B 2NUPA 4N4HA 1OWAA 1ZRTD 1RAEB 4M7AB 2N9YB 1L0NJ 1YJNT 1D1BA 2DEUA 2BZXA 1KB9H 1SFCD 4OMFB 2W90A 4ZGJB 4H44C 3MP8A 3NTNA 4XK8E 2Y0DA 4C0ZA 1X75C 3ULRB 2XDDA 1FAVA 5APQA 2RQUA 3SFMA 4CI0C 1SVFA 3PVLA 2B88A 2WSFJ 3H6PA 1MUUA 3A7OA 3CBPA 2OI3A 1OIPA 2HFED 3JCMW 3CC4A 3MGNA 5J26A 3O8VA 2DBKA 4KGVB 5KYWB 1K9MQ 1G83A 2UWJE 2FO0A 5AVSB 5GAOm 5D6YA 5CBOA 4RESB 3LW5J 1IHWA 5KJ7C 2P84A 4H0LB 1NHLA 4GKGA 1NTKE 3S9OA 2MI6A 1IGUA 2H43A 1KQ1A 3EFRA 3EG1A 3REAB 2RHUA 1PSFA 3D6YA 1WGSA 2ZYAA 1VIFA 5KCOA 1IK7A 3OYFA 4LXCA 1NE8A 1PD1A 1WXUA 2E65A 1S5LX 2KSSA 1LWUB 2OJ2A 3SFEC 2YWWA
chains in the Genus database with same CATH topology
2PVDB 2RK2A 5KJ7A 3P8DA 3CCQT 1LTIC 4XTVA 2JTFA 2EFIA 1KQ2A 2CZ7B 1YTZI 4PLLA 3HP9A 3MUDA 2RJFA 2HYNA 4BI3A 5LL6S 1PSEA 3CCVA 5GMKj 5DY9A 4XU0A 4NL3A 1YI2A 2IPPA 3MEWA 5AYFA 1UGQB 1VIEA 2QDYB 1N7SC 3L2ZA 3J80E 3UPUA 3OY9A 3V7RA 3SWYA 5AW5B 1JY3O 4QVDA 3BASA 3CPWA 1VQ7A 3DLMA 2DZ9A 2PVGB 4A53A 3JCMg 2DAQA 1X79B 2F69A 4TVRA 1IC2A 1N73B 4FM4B 1N7SA 3B5ND 3OMGA 2LCLA 2P2UA 4IUUA 2Q7CA 3FDRA 3QIIA 1GTWA 2RHZA 3HD7C 5GAMf 4X34A 4DQ2A 3G4ST 3KPEA 3PTAA 1U1TA 4PJOG 3GIBA 1N8RC 2X4WA 3RL0D 1N6AA 4RCBA 2D6FA 2QM8A 2KMTA 3PIOA 2KY9A 1YJ9A 2M9UA 3HD7A 1LT9B 4JLGA 5CR2A 3P7KA 3M55A 3FB9A 1BI1A 1JY2O 3OMCA 4M7DC 1S9KE 2ZPGB 3HRNA 4PJOE 3HFOA 1HXDA 1GL2D 4A4HA 2B8AA 1QVFA 5I2MA 4M75C 1AHJB 1IFJA 5AW7B 3JCMb 4OVAA 5CCGC 1WT6A 2K3XA 4ZN3A 4M7DA 2FVUA 2M8RA 1JMMA 3HE4A 4M75A 4Z02A 1BKBA 1N8RU 3KBGA 2HPCA 2WSCE 2WPRA 3DLLA 2JOYA 3OYMA 1HBWA 1SQPK 2A45H 1HWTC 3OYBA 5LJ5f 3LLRA 1OZ2A 3PNWC 2XD0A 2EQUA 4KHXA 2X4XA 4C5IA 2BASA 1QVGS 2E12A 4F7UF 2FYUK 4OH8B 3CPFA 1SQQK 5LJ3j 1QL2A 1NH4A 1G3YA 4C92C 4I6MC 3TK1A 3M9BA 2R57A 4F7UB 4JS4A 4WY4B 4C8QC 1I5LA 3VMYA 3M5AA 5LJ3d 5GAN3 4C92A 3CC2T 1XTGB 3TNUA 2KB7P 1WQ7A 5AW3B 4C8QA 1KILB 3GLXA 4MMLA 3QO3A 4M77E 1IFNA 2E6ZA 3HFNA 2M1HA 3UT1A 2LRQA 3WVDB 1FOSE 4M78C 3RMSA 5FLXE 1M4ZA 5KJ7D 1P92A 2NPSB 3NTHA 3U1AA 2K3YA 3PMTA 3LWIA 3ZEHA 1YI2T 3VUBA 4HA8A 4J6YA 3MEAA 4O5VA 1KD1C 1FJKA 4EMGA 5GAN7 5GAN5 1RI0A 2L89A 2WT7B 1I81A 1T8ZA 1VQ7T 4JF7A 4A4EA 2E1HA 5L8RE 3R2PA 2ZPBB 2HBPA 3RESA 3GNFB 3BDLA 1U1SA 4LDVA 4N0AC 4EIJA 5GAN8 1RE3C 1ZR2A 4IUTA 3CCEA 3CL3D 3VJPA 3G7ZA 5IT9E 2JTMA 1N7SD 3M4YA 3MHXA 3JB9J 5FRNA 1IREB 3J81E 2XZRA 2HQEA 4M7AE 3L35A 3JCMe 3B8EB 1KD1U 2DZCA 3MD0A 2O1KA 4Q5WA 1G5VA 5CQYA 2LTOA 1BI0A 2XG8D 3MCAB 2LVMA 1KHIA 4PJOF 3HKSA 2RI5A 1G3TA 5GMKh 2QM7A 2L8DA 1FJPA 1YJNA 4PNOA 4X9DA 3QZ9B 5EG2A 2HAXA 3HD7D 1GD2E 3SDZA 3MIWA 2CZ0B 1LNXA 1JCCA 1QVGA 3GHGB 2DK3A 1WNLA 2RI2A 2XK0A 2HG5D 3OYHA 2ZPIB 2O01E 1RF0C 1HJBA 3S6WA 5APUA 3QKJA 2LNVA 1FZCB 3B5NB 1B34B 2Z5HA 2W6AA 2JZ2A 5AW1B 4M7DD 3L2WA 4XTWA 4I2LC 1OI1A 1JTHA 3QZ5B 4KUIA 5APYA 4M75D 3HUSB 5CCGD 3ME9A 3RL0B 3OW2S 1LTTC 4C7RA 2P0KA 4OP0A 2O4XB 1MV8A 4IUVA 2WSFH 1WQWA 4M7DG 5GAMg 2HQXA 2OARA 2DTIA 3OS2A 2OYIB 3FC3A 4MZTA 4M75G 5CCHC 2EQMA 5I2SA 2IVWA 4Y99B 3H32A 1OXZA 3BDUA 4DOJA 1A02J 3CCLA 2F5TX 1K73C 4OB1B 3OSSC 5A0LA 2MAMA 5CCHA 1W2BS 4DOVA 1L0LK 1FOSF 1NOHA 2ZPFB 4C92D 3HTKA 5CKHA 3BVHA 4J6XA 2QA4A 5AVVB 5GANf 4JDSA 4MZPA 5FU7B 3RK2C 3FEOA 1MFZA 3OQ5A 3FJPA 1YJWA 3CC7A 4J5YA 5A2QE 3RUXA 1QP2A 2H8PD 4EPCA 2KDSA 2EQKA 2YRVA 4W7ZA 4C8QD 1GW4A 4EMKC 1SP4A 4HT8A 2K5LA 1FZAA 1GL2A 3M59A 2LKMA 1VQ9A 5LJ3h 1HK9A 3JCMQ 5LJ5g 4C92G 5AW8B 4HKEA 4EMKA 3EFGA 3M0DC 5FROA 2RB6A 4B9WA 1K73U 3VP8A 2LT1A 1GK4A 4M78D 2GUSA 3L42A 3EAEA 2D0QB 4ZN1A 2QEXA 3JB9I 3LWHA 1FX7A 3M0DA 3CCET 5CKBA 1NKZB 4KT0E 3QXEB 3V4WA 2C9NY 4QQ6A 1IK9A 1L4AC 3BATA 4C0DC 2A7YA 3NMDA 2K2VA 2LDMA 3CMAT 2WPQA 1SQXK 2WACA 3KXTA 1L4AA 2XV5A 4GY5A 2N9BA 3M54A 1YITA 4L6V5 2DXUA 3CCMA 4FIBA 1G2CB 1FBMA 2EAYA 2C0XA 4F7UE 1O9SA 1LTJC 4C5GA 1VQKT 2X4JA 4A54A 4MDWA 4N4IA 3QHSA 5GAOl 3OW2A 4RG2A 4X9CA 3JAME 2DTHA 4R56A 1M1FA 3M56A 2E10A 2EYQA 3VYGA 3JCMJ 1LTJA 3EQ2A 3CC2A 4C0GA 3CBMA 3F70A 3L2UA 3JCMc 3M91A 1N9SA 4C46A 2HODA 1N7SB 3FIFA 2JEEA 2ZCFB 1NPRA 3ASKA 3AHUA 2VC8A 1GW3A 2FXMA 1W2BA 1CW5A 3VV0A 2BUDA 1CSBA 4L59A 5KCHA 4D6WA 3OA7A 2DO3A 3P8MC 4B86A 3J7AF 3SB2A 1T3JA 3HD7B 3G71A 2QXFA 4FT2A 4JRQA 4A4FA 3RK3C 1LTSC 3HPWA 5AVQB 3V2PA 3CCLT 4L5GA 3JCMP 3V7CA 4OB0B 4RG8A 5GAN6 1OYXA 1LWUC 4Y28E 1LGHB 3SD4A 5GAMe 1NAFA 3E19A 2QA4T 5GMKm 2W6BA 3N7NA 3C4SA 4M7DB 1J1DC 1NTZK 1VQLA 4P5NA 2V8IA 4ME7A 1YJWT 3CC7T 3VKIA 1FXXA 5AW6B 3HE4B 2R5AA 4M75B 3C12A 5CCHD 3NXSA 2RK1A 2HPCB 4MZMA 3NFCA 2PAJA 1ZR4A 4XTXA 1VQOT 3H6ZA 4XU1A 1Q7YC 2WWWA 1VQ9T 1WJRA 2WSCH 4E7JA 1J2JB 3L36A 3S3MA 2YO2A 3X26B 5HKCA 2XI9A 3I55T 1SSFA 1L0NK 3FLGA 3VN0A 4J7FA 3RK2D 4ZTFA 1VUBA 2GCXA 5BU5A 3NFQA 2QEXT 4IKFA 3JRZA 1Y71A 2GFAA 1H88A 2Y4XA 1NKNA 4JRKA 3JCMd 3T9NA 3II6A 5LJ5e 3OYLA 1OZ3A 4HCBA 1FZGA 3CCRA 1JY3N 5CCGA 3H8ZA 4C92B 1Q7YU 3JB9H 3TNUB 3BRVB 3X20B 1SLQA 5GAN2 3JSCA 2MF2A 2FB7A 1UEBA 2MWPA 3PGGA 3KUFA 1YITT 5M9OA 3CCMT 4C7NA 1ZQ1A 1E5WA 2K5FA 4WB4A 1YHQA 4JRPA 3M4GA 2P0QA 4NOYA 5GANg 5GAOp 3HRUA 2VUBA 1Y07A 1L4AD 2JNGA 3MEVA 4FSXA 4J8OA 1J1EB 2QQBA 2XHCA 4N4GA 3CD6A 2VXEA 2WITA 1X01A 2HNIA 1D3BA 2CZ6B 4VUBA 1ZBXA 2A45G 3E1SA 2Q5UA 1LTAC 2K57A 4E7LA 4MDXA 3ZFJA 4ZGEB 4XU3A 2RJEA 1CI6A 4XQ3A 5CCAA 2XU8A 5C0MA 5DLQE 2I2LA 2LQKA 1N7LA 2OTLA 2LX9A 2PP6A 1JY3P 2F5KA 1QL1A 1NJIC 1JO5A 5LJ5h 2EJ9A 2BKDN 1CZQA 3OS1A 1M5Q1 3V8KA 1MZ9A 2V8KA 1YTZT 5KE3A 2P4TA 2ZZDA 3CCUA 3RMQA 4LDWA 1TH7A 3KQGA 1SFCB 3OYJA 3G71T 1NTKK 2XDPA 5HY6A 4M78A 2GM4A 1RF1C 1I8FA 1GU5A 1N86A 5HK3A 1K9MC 1HGZA 2Y4YA 3VMXA 2RHXA 1LOJA 5FRMA 1N27A 1JY2P 4N78E 4ZKUA 1RF1A 4DOWA 2CPBA 1NJIU 4JLIA 1M1GA 1VQLT 1KILC 4C5HA 1URQC 2DVEA 4FU6A 1M90C 4QVZA 1FZFA 2HD0A 4A4GA 3CBOA 2C9LY 2P1JA 4N0AA 4GT1A 4BE0A 4B9XA 2Q9IA 2H3JA 2O01H 1KILA 3I56T 3RK3D 2Z5IA 1EIFA 1URQA 5J39A 1RE3A 5FU6C 5CHXA 3WMM0 3M57A 2PUKB 1JTHB 3CMAA 1K9MU 4BDYA 4C5EA 2OTJA 4O6JA 3GF5A 3OS0A 4BE2A 2M16A 1JRIA 4Y91A 3V2NA 3E1IA 2VXFA 3ER0A 3I5CA 1QVPA 1MHNA 2YHTA 4BY6C 1VQKA 3V8JA 4BB7A 4LLHA 2C06A 4QVCA 1DEBA 3QYHB 3OYNA 3CCRT 5GAOr 2FKWB 3P32A 1G3WA 4W7YA 3BY7A 1X6OA 4JRIA 2MWOA 3M53A 3QSUA 3H32B 5CKDA 5KE2A 2E6NA 1RF0A 1BIBA 2YKQA 3TU4K 2GF7A 3QPHA 3OSVA 3HE5A 4ZTJA 3HTKB 1YHQT 4NL2A 1RY3A 1HGVA 3VMZA 3VTPC 2CYZB 3G3ZA 2K5IA 3M9QA 2EWNA 3JCMh 3CD6T 5J3BA 4PJOC 3RIRA 3NTKA 5GMKi 4W80A 3RK2B 4LGDE 1GL2B 4LDXA 3O8ZA 3A8HB 2QQAA 2RHIA 1X9VA 3X28B 5LJ3f 1PFIA 1FZCC 3QUIA 5AVXB 4EMKB 2H7HA 2WSEE 3OA6A 3OYGA 3SWFA 3OYYA 4PJOA 5GANe 4M7DE 4OGEA 2OTLT 3MP1A 2DXBA 4M75E 2M3BA 2JJLA 3HUSC 3P8CE 2IG0A 3V7SA 1YIJA 5CJ0A 4UC4A 3CCUT 3CCST 1NZ9A 2LQ8A 3INZA 5GAMj 2L3RA 2GUVA 3M0AA 2IX7C 2J59M 3HUSA 2JUFA 4BE1A 2GFUA 2XIDA 2M0OA 1NWQA 3QJ6A 1U8RA 1VQOA 3OBWA 1NO4A 2YO3A 1ZV8A 1L4AB 2J58A 2FL7A 5GAMd 1VQNT 1VQ6T 3S3OA 3VU3C 4Y99C 2JN0A 1XQHA 3I55A 1UGPB 3G6EA 3URGA 5CO7A 2FFDC 2YNYA 3QDRB 2WZ7A 4C8QG 3U1CA 5APSA 4OF1A 4C92E 1IJDB 4QW2A 1H641 2XNXA 1N2DC 2FFDA 5FU7C 2VRSA 3IFMA 1T3UA 1LTJB 1X8YA 4GIFA 4RKUE 3MP6A 3GOXA 2DTOA 5HK0A 4M77C 1AFOA 4XTZA 1M1JC 2VGMA 2E43A 5LJ5j 4M78G 1KHCA 4ELZC 1UGSB 2OTJT 2KP8A 4IFMA 1DX7A 4BI8B 2HODB 3SWNC 3VYHB 3UDCA 2QQ9A 3LGFA 4M77A 1KILD 1WJSA 4BI4A 1URQD 1M1JA 3HRTA 2EKOA 4FL6A 2WPSA 2BIVA 2KYVA 5LJ5d 4EOTA 1FZBA 1BI2A 1VDFA 3SWNA 3IR9A 2RJDA 4PL6A 5CK9A 2OYHC 4ZKPA 4PLIA 4N3YB 1VQ4T 1M7LA 1LJOA 2YMYA 1GK6A 4JUVA 3QG1A 4QQDA 2EJFA 1NPPA 2OYHA 3A8LB 2K4YA 3TYYA 4XE5B 4MMKA 1Q81C 1JJ2S 2C0WA 2N1TC 3RK3B 3PIPA 3META 1YBYA 4M7AC 3UWNA 1S72T 2V8JA 3X24B 1V29B 1KG1A 1Y96A 1Q86C 5AVZB 3TREA 1HH0A 2MMPA 1RE4C 2N1TA 4LC1A 1J1DB 4M7AA 2R5BA 1R8OB 4BD3A 1T2KC 1G2CA 4IFFA 3E9FA 2JVVA 3CI9A 3HL8A 4M7DF 3A5TA 1RE4A 3LX7A 4BACA 1G1IA 3DKMA 4M75F 1Q81U 3PMIA 3VOPA 3WXMB 5GMKl 2XDJA 2QQSA 3DB3A 5APVA 2VV5A 4JJNK 2L5GB 4XU2A 2CS7A 2CZ1B 1YIJT 2XICA 2R5DA 1M1KC 3V5BA 1S9KD 1XOVA 4KUDK 4PJOD 1IFMA 1Q86U 5KH6A 4AQRD 1LWUA 2PUOB 4LD9K 4ATOA 5APTA 5AVUB 3TSIA 2OAUA 4HCZA 3A8GB 1JOCA 5GAOn 4JYBA 5AW4B 2MJZA 3I56A 1QW1A 5APXA 2YLBA 4LDYA 2PQWA 3MEUA 3VP9A 2YLCA 3CXCS 1G3SA 1KC8C 3C94A 3WVEB 1VQPT 1KQSS 1VQ5A 3G6ET 4C7NB 2XKMA 2KVQG 5AVTB 3E9GA 4PKCC 2XKOC 5AW2B 1N9RA 3P8HA 4C92F 3A2AA 1AQ5A 3OAKA 1VQMA 3L2VA 3LH0A 1M1KU 2E41A 1N73C 1WJQA 1KFMA 3U59A 3V2QA 5A0DA 4II1A 1D3BB 4C8QF 1Y7XA 4AUWA 1VQ8T 1H3ZA 2DKGA 2POHA 5KTBA 1GDTA 3CCJA 1DH3A 1N73A 2PU9B 2CKKA 1LTBC 2NLUA 5LJ3g 1WPYA 4CRIA 1CI6B 5GAMh 3JB9D 1KC8U 1JBMA 3V2RA 5KLVK 4C8QB 2XDBA 3L1AA 1LT9C 1IO4A 4YTLA 3L2QA 4E7KA 3L37A 3ZBDA 3R6OA 4M78F 2ZGWA 4J6WA 4IURA 1HUCA 1H8AA 3PP5A 1JJ2A 5CIUA 1NU1K 1LT9A 5DLOA 4HYTB 2QTXA 3M9HA 3QBYA 4M77D 3TCJA 5D6WA 5AVYB 4M78B 3JB9G 2PVOB 1SQVK 2DXCA 2RO0A 1JY2N 5GAN4 1Q82C 3A8MB 1FWZA 2DXTA 3CC4T 2KQWA 4FT4A 4WF2A 2RM4A 2DPPB 2CPSA 5CKFA 1RF1B 2VYTA 3L2RA 3CMEA 4M77G 2DIGA 3RKXA 3OYDA 2XU6A 5GANj 3MO8A 4QQGA 2P7JA 4N78D 5A0GA 4C0FA 5CAIA 3JCMV 3CCSA 3FRNA 1HTLC 4HH2A 4DZOA 1M9SA 1URQB 1J1EC 3LIDA 1EQ7A 2WTYA 2DJZA 5GMKe 1YCYA 5AVWB 5GANd 2X35A 4E7IA 2QI2A 1Q82U 3CCVT 4WY4C 2E42A 2ZPEB 2RD1A 2N1TD 3JCMX 4V2SA 1VQNA 1VQ6A 4NS5A 4M7AD 3LGLA 5CMZA 5FU6B 2DD5A 5CJ4A 4EMHA 3CXCA 2GQVA 1ZN5A 4F7UA 5D6XA 4M3LA 2E70A 1RL2A 4WY4A 1KQSA 3BRTB 4O9BA 2KLVA 4WBAA 3RKWA 3OYAA 4EDUA 3CEYA 4LDUA 3HRSA 1JNMA 5DM7R 1WRGA 1GU4A 2R5MA 3UIAA 1ZLLA 1T2KD 3N5BB 2NPSC 2RH2A 4BY6B 3KYQA 4M7AG 2LT4A 3X25B 2RA2A 3OYKA 1XTCC 3P8BB 1JB0E 1SFCC 2R32A 5IN1A 3LYIA 4KULA 1XTDA 1VQ5T 2NPSA 4JS5A 3HE5B 3QJYA 2FHDA 2EJGA 2P0PA 1SFCA 3L4FA 4IUPA 1HVVA 1YJ9T 3KDPB 1VQMT 4R55A 1BYMA 3OYCA 1LTGC 1M90U 1G1JA 3EFSA 2WT7A 3OS5A 3BFMA 2W27A 3JCMf 3CLQA 4XTYA 2P67A 2CGHA 1IZ6A 1FZEA 3CCJT 1VQ4A 4IUQA 1W2EA 3VYIA 5BU8B 3T97A 4PJOB 2KSJA 3NTIA 1K8AC 4JYCA 1JUNA 2RJCA 1IFDA 2WSEH 3VUZA 1BI3A 3A3YB 3V8LA 2R3CA 3C95A 3DB4A 1S72A 3OYIA 5APWA 2EQJA 1QP3A 5LJ3e 2LCCA 3P8CD 3GHGC 1KQLA 3CCQA 1VPCA 4DA4A 4XAXB 4HCCA 1W4SA 2I1JA 2E64A 1I4K1 3S3NA 3N4XA 4OB2B 2DD4A 4XTUA 2YKOA 3B5NC 1K8AU 3LIEA 3GHGA 2I1KA 4J83A 1YYCA 3JB9F 1UB4A 2IFMA 3RKYA 1BIAA 3A8OB 3HHTB 3RERA 2O1JA 2ZFCA 5AW0B 3CMET 1ZHIA 3LW5H 2Z4EA 2DIQA 3TEEA 2FYKA 2RHYA 1DJ7B 1FZCA 3B5NA 3M06A 4E47A 1JCDA 1B34A 2RI3A 3RL0C 3OB9A 3OBYA 2EIFA 4BUGA 2FFDB 4E7HA 4OB3B 1FDMA 3GP8A 4M77F 2QQRA 1XNIA 2E5QA 3V4QA 2KK4A 1M8VA 4RMOA 2KOGA 2WSFE 1GL2C 3PT9A 2YKPA 2OYIC 4BDZA 3GNGA 4AYCA 2O4XA 3A5ZB 4M77B 1FU1A 4C0DB 4I1LA 1M1JB 3OJAB 3LW5E 4RCCA 4HT9A 3G4SA 1VQPA 1GXIE 3CPWS 5I21A 2OYIA 2L5QA 3SWNB 4LD6A 2VGNA 4J7IA 5AVRB 3QYGB 1GZLA 1UGRB 2Y90A 2X4YA 3C9IA 3BW1A 3OYEA 1VQ8A 4C8QE 4WY4D 5GANh 4N6JA 4GLKA 5CQXA 3M58A 2A45I 1IFIA 2OYHB 5BVZA 2D9TA 3Q1JA 2Q3IA 5CVIA 2KAFA 2G3RA 4ZGDB 5IAYA 3GPLA 5AW9B 2FYZA 5GAOq 4KBMB 4M7AF 1KZUB 3PFSA 2HLOA 3MTUE 2AHJB 2ZPHB 3HSBA 1KFNA 4XA4A 4IFDK 2IFNA 1MGQA 2ZXEB 1SQBK 2LC4A 4A4KA 1A02F 4F7UG 1Y96B 4M78E 1O75A 4ELYC 2R58A 2A3LA 2DEQA 4OGCA 5CKEA 2NPSD 1H89A 2N1TB 5C6SA 1QVFS 1NTMK 4N4HA 1Z56A 1OWAA 4M7AB 1YJNT 1SFCD 4OMFB 4ZGJB 3MP8A 3NTNA 4XK8E 4C0ZA 1X75C 2XDDA 1FAVA 5APQA 3SFMA 4CI0C 1SVFA 3H6PA 1MUUA 3A7OA 3CBPA 2HFED 3JCMW 3CC4A 3MGNA 5J26A 3O8VA 5AVSB 5GAOm 5D6YA 4RESB 5KJ7C 1NHLA 4GKGA 2MI6A 2H43A 1KQ1A 3EFRA 2RHUA 1PSFA 1WGSA 1VIFA 5KCOA 3OYFA 1NE8A 2KSSA 2E65A 1LWUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHI A;  5D6X A;  3L2Q A;  3DB4 A;  4BAC A;  4E7K A;  3FEO A;  5J39 A;  3OQ5 A;  3P8D A;  3PMI A;  4RG2 A;  3OYI A;  4A4H A;  2B8A A;  2M1H A;  4IUR A;  2EQJ A;  2RI2 A;  2XK0 A;  3UT1 A;  2LRQ A;  3H6Z A;  3OYG A;  2EQK A;  2YRV A;  2JTF A;  2EFI A;  3OYA A;  3LGF A;  3CEY A;  4EDU A;  1WJS A;  4E7L A;  1WJR A;  2QQS A;  2WSC H;  3OYH A;  4C5E A;  3DB3 A;  4BDY A;  4E7J A;  4OVA A;  2LCC A;  2EKO A;  2K3X A;  2X4Y A;  3NTH A;  4FL6 A;  5CIU A;  4PLL A;  3S3M A;  3OYE A;  2K3Y A;  3OYM A;  1NU1 K;  2BIV A;  2R5M A;  3PMT A;  2RJF A;  3MP1 A;  3S6W A;  2RJE A;  3QKJ A;  3QBY A;  3ZEH A;  3OS0 A;  2LKM A;  2IG0 A;  5C0M A;  2D9T A;  3Q1J A;  4BE2 A;  5KH6 A;  3S3N A;  1SSF A;  5D6W A;  2JZ2 A;  3MEA A;  3L2U A;  3F70 A;  2M16 A;  2G3R A;  4Z02 A;  2F5K A;  1L0N K;  2RJD A;  5IAY A;  1SQV K;  3OYK A;  4HCZ A;  4PL6 A;  3FLG A;  2RO0 A;  4UC4 A;  4ZTF A;  3L2W A;  5FRO A;  1MHN A;  2BKD N;  4B9W A;  3OS1 A;  1OI1 A;  1RI0 A;  2L3R A;  2L89 A;  4PLI A;  5IN1 A;  1SQP K;  3MEW A;  4IKF A;  3LYI A;  3OYB A;  3PFS A;  3ASK A;  2J59 M;  3LLR A;  1OZ2 A;  5KE3 A;  3PNW C;  4BE1 A;  2GFU A;  2PQW A;  3MEU A;  2GFA A;  4A4E A;  2M0O A;  2EQU A;  3OYN A;  3OY9 A;  3L42 A;  3LW5 H;  4IFD K;  3EAE A;  3ME9 A;  2DIQ A;  3QJ6 A;  2FHD A;  1SQB K;  4QQD A;  2BUD A;  2RHY A;  2X4X A;  4C5I A;  3OYL A;  2R58 A;  4L59 A;  2MWO A;  5KCH A;  3OYJ A;  3DLM A;  1OZ3 A;  2VYT A;  3BDL A;  4IUP A;  3L2R A;  2RI3 A;  2FYU K;  5C6S A;  1NTK K;  1NTM K;  2P0K A;  2XDP A;  3OB9 A;  4N4H A;  2DIG A;  2DAQ A;  2O4X B;  3S3O A;  3OYC A;  3E9G A;  4IUV A;  1SQQ K;  3OYD A;  5KE2 A;  4E7H A;  3H8Z A;  2WSF H;  2E6N A;  4QQ6 A;  3OA6 A;  4IUT A;  3OMG A;  2QQR A;  3P8H A;  1XNI A;  3MP8 A;  3MET A;  3MO8 A;  2HQX A;  2OAR A;  2E5Q A;  4IUU A;  3L2V A;  3LH0 A;  3UWN A;  4QQG A;  2GF7 A;  2RHX A;  3FDR A;  3OS2 A;  3CLQ A;  3QII A;  1WJQ A;  4A4F A;  3FC3 A;  2LDM A;  4ZTJ A;  2R57 A;  2RHZ A;  5FRM A;  1N27 A;  5FRN A;  2EQM A;  2MWP A;  4II1 A;  1SQX K;  4IUQ A;  2HQE A;  4X34 A;  5J26 A;  2WAC A;  3KUF A;  3O8V A;  5M9O A;  4QW2 A;  4BDZ A;  3G3Z A;  2X35 A;  4E7I A;  1H3Z A;  1OYX A;  3M9Q A;  2X4W A;  4Q5W A;  2O4X A;  1G5V A;  4C5H A;  5D6Y A;  2LTO A;  3SD4 A;  3NTI A;  4GY5 A;  2LVM A;  2RJC A;  4FU6 A;  2RI5 A;  4QVZ A;  4LD6 A;  2CKK A;  2WSE H;  3MP6 A;  3GOX A;  2NLU A;  2RHU A;  3C4S A;  4BD3 A;  3MEV A;  1NTZ K;  1WGS A;  3E9F A;  4A4G A;  3NTK A;  4CRI A;  1L0L K;  4NS5 A;  5KCO A;  2L8D A;  3LGL A;  3OMC A;  4C5G A;  3OYF A;  4BE0 A;  4B9X A;  5KLV K;  1KHC A;  3LX7 A;  2R5A A;  2O01 H;  4N4G A;  4N4I A; 
#chains in the Genus database with same CATH topology
 2PVD B;  1OVU A;  2RK2 A;  2VWF A;  5KJ7 A;  1M90 Q;  3P8D A;  2HKQ B;  3CCQ T;  1KB9 E;  1LTI C;  4XTV A;  2F1L A;  3CMA Q;  3CXH D;  1VF5 D;  2JTF A;  2EFI A;  1KQ2 A;  3Q5S A;  2CZ7 B;  2OTJ Q;  1YTZ I;  2ZT9 D;  4PJ0 H;  2HBW A;  4BRY A;  4PLL A;  4QT7 A;  2QG9 B;  3HP9 A;  1QKW A;  3MUD A;  2RJF A;  2HYN A;  3L73 D;  4BI3 A;  1NU1 J;  2BZ8 A;  3H1I G;  3TGU G;  5LL6 S;  1X22 A;  1DD3 A;  1PSE A;  2AZS A;  4OML A;  3CCV A;  1HYO A;  1PKT A;  4RJT A;  5GMK j;  3BE3 A;  1UUE A;  2SEM A;  5DY9 A;  3GW6 A;  2RQW A;  1OMI A;  4XU0 A;  2KS1 B;  2LMJ A;  1YHQ P;  4NL3 A;  1YI2 A;  4RTW A;  1VQK Q;  2IPP A;  3MEW A;  5AYF A;  1UGQ B;  1VIE A;  1X43 A;  2QDY B;  2CP0 A;  1VL2 A;  3FWL A;  3F5H A;  5FW9 A;  1N7S C;  2BEZ F;  3L2Z A;  3G9R A;  4LE9 A;  3V7R A;  3H1I E;  1U7M A;  3SWY A;  5KYU B;  5AW5 B;  3TGU E;  3OY9 A;  1BBZ A;  1JY3 O;  4QVD A;  2W6J H;  3L75 E;  3BAS A;  3CPW A;  1QCN A;  1VQ7 A;  3DLM A;  2DZ9 A;  2ABL A;  2PVG B;  2RMZ A;  4A53 A;  1BE3 E;  3JCM g;  2DAQ A;  4K35 A;  2HQH A;  4UB8 H;  1X79 B;  2F69 A;  4TVR A;  1IC2 A;  1N73 B;  4FM4 B;  1QLY A;  1N7S A;  3B5N D;  2KRO A;  3OMG A;  3NMZ C;  2LCL A;  2P2U A;  4IUU A;  3RBZ A;  2Q7C A;  3FDR A;  2WMM A;  1BCM A;  3QII A;  3L74 E;  1OW7 A;  1W70 A;  1GTW A;  2RHZ A;  3PRJ A;  3HD7 C;  5KLI B;  4DT0 A;  2OQQ A;  5GAM f;  1I1J A;  2M5A A;  2OTL P;  4X34 A;  4DQ2 A;  3VS4 A;  3G4S T;  4M4Z A;  3KPE A;  3PTA A;  1U1T A;  2YUN A;  2LXB A;  4PJO G;  3M0T A;  3GIB A;  1N8R C;  2FYN C;  2X4W A;  3RL0 D;  1N6A A;  2KI7 A;  1NTK J;  4RCB A;  3PJS K;  2D6F A;  2QM8 A;  2FRW A;  2KMT A;  3PIO A;  1BGY G;  3EHR A;  3H41 A;  2KY9 A;  1YJ9 A;  2M9U A;  3HD7 A;  1LT9 B;  5KAF E;  4JLG A;  1EZV G;  5CR2 A;  3P7K A;  4OMM A;  3CCU P;  3FB9 A;  2OGU A;  1BI1 A;  1ZSZ B;  1JY2 O;  3M55 A;  5CBN A;  2DFU A;  2J6K A;  2ENM A;  1WXB A;  3OMC A;  4M7D C;  1S9K E;  4HCK A;  2ZPG B;  3HRN A;  4PJO E;  1UHC A;  2BE7 D;  1MND A;  5HCK A;  3HFO A;  1HXD A;  5IHI A;  1GL2 D;  2IBZ I;  4A4H A;  2B8A A;  4PJN A;  3D7S B;  1QVF A;  5I2M A;  4M75 C;  2EGE A;  1AHJ B;  1IFJ A;  5AW7 B;  2CUB A;  2K88 A;  1WXT A;  1PIX A;  3EGD A;  3JCM b;  2G6F X;  4OVA A;  5CCG C;  1WT6 A;  2J6O A;  2K3X A;  4ZN3 A;  1K04 A;  4M7D A;  1BCC G;  1L0L D;  2FVU A;  3VS1 A;  2M8R A;  1RUW A;  4FYX B;  1JMM A;  1P84 E;  2VAS A;  4F14 A;  1UHF A;  1Y9B A;  3HE4 A;  4M75 A;  2QDL A;  1YIJ Q;  2DJQ A;  4Z02 A;  2CT3 A;  3GG2 A;  1BKB A;  1N8R U;  3KBG A;  2HPC A;  2WSC E;  2CSQ A;  2WPR A;  3DLL A;  2JOY A;  2A28 A;  1MMA A;  3OYM A;  1HBW A;  1SQP K;  2A45 H;  1HWT C;  3OYB A;  1FC2 C;  4FW1 A;  5LJ5 f;  3LLR A;  1OZ2 A;  3H1I J;  3PNW C;  2XD0 A;  3TGU J;  2EQU A;  1VQO Q;  1BDC A;  3L75 J;  4RTX A;  1ZUU A;  2PRR A;  4KHX A;  2X4X A;  4C5I A;  2BAS A;  1QVG S;  3SHW A;  1BE3 J;  1L0L G;  2E12 A;  4F7U F;  3CWB G;  2FYU K;  3LH5 A;  1D0X A;  4OH8 B;  1TTH B;  3CPF A;  4CC7 A;  1SQQ K;  1H8K A;  3CMA P;  3I55 Q;  2EPD A;  1NM7 A;  1K1Z A;  3G6E Q;  5LJ3 j;  5DJT B;  1QL2 A;  1NH4 A;  1G3Y A;  1X2Q A;  3L74 J;  1WA7 A;  4C92 C;  4I6M C;  3TK1 A;  5KAI E;  2KBT A;  3M9B A;  2R57 A;  2CH4 A;  1BSH A;  4F7U B;  3L71 G;  1KTM A;  2J6F A;  4JS4 A;  4WY4 B;  1I07 A;  1JXO A;  4C8Q C;  1I5L A;  3VMY A;  3M5A A;  5LJ3 d;  5GAN 3;  1SG5 A;  4C92 A;  1VQK P;  2KE9 A;  3CC2 T;  1XTG B;  3TNU A;  3D70 A;  2D1X A;  2C0T A;  1HJD A;  2DLP A;  3QWX X;  3EFO A;  2KB7 P;  4H44 D;  4F04 B;  3BCC D;  1WQ7 A;  4H13 C;  1PGO A;  4U3F D;  5AW3 B;  3TSZ A;  2JS2 A;  4C8Q A;  1WX6 A;  1KIL B;  1UII A;  1ZUK A;  1SQX D;  3SWK A;  3GLX A;  4MML A;  3QO3 A;  4M77 E;  2O31 A;  1IFN A;  2E6Z A;  3HFN A;  2M0B A;  2M1H A;  3UT1 A;  2LRQ A;  3B71 A;  3EFF K;  1FOS E;  3WVD B;  1MNE A;  4M78 C;  1GRI A;  3RMS A;  5FLX E;  1M4Z A;  5KJ7 D;  1P92 A;  2ZJS E;  2NPS B;  3NTH A;  3U1A A;  2K3Y A;  1R77 A;  3PMT A;  2IPO B;  4FYW B;  3LWI A;  1WHJ A;  2COZ A;  2ECZ A;  3ZEH A;  1YI2 T;  3VUB A;  3V6I A;  4HA8 A;  4J6Y A;  2G3A A;  3BCC G;  3MEA A;  4O5V A;  4F17 A;  1TUG B;  2IIM A;  4EYY Q;  1KD1 C;  1WHH A;  2O3J A;  1FJK A;  4EMG A;  5GAN 7;  3D6Z A;  1AVZ C;  5GAN 5;  1RI0 A;  2L89 A;  5M1B A;  2WT7 B;  1I81 A;  1T8Z A;  1VQ7 T;  4JF7 A;  4WWI A;  4A4E A;  2E1H A;  5EC7 A;  2DVJ A;  4XFJ A;  4DEY A;  2BZY A;  1OQK A;  2Z0W A;  3R2P A;  5L8R E;  2ZPB B;  2DIL A;  2HBP A;  4PJJ A;  5FWC A;  3RES A;  2DE0 X;  3VRY A;  3GNF B;  3BDL A;  1U1S A;  4KH0 B;  1SQB E;  4LDV A;  1AWJ A;  4N0A C;  2YXY A;  5KYX B;  1S4X A;  3T97 B;  4EIJ A;  5GAN 8;  1RE3 C;  1ZR2 A;  1NTM E;  2FBW C;  2A06 G;  4IUT A;  3JC2 2;  3CCE A;  3CL3 D;  3VJP A;  2P10 A;  2LR2 A;  3G7Z A;  5K5G B;  4FYY B;  2HR3 A;  5IT9 E;  4OMQ A;  2JTM A;  1VF5 B;  1N7S D;  3M4Y A;  3MHX A;  1Q81 Q;  3JB9 J;  5FRN A;  1IRE B;  3J81 E;  2XZR A;  2LJ3 A;  2HQE A;  2ZT9 B;  2MYS A;  4M7A E;  3L35 A;  1R8E A;  3JCM e;  3B8E B;  1KD1 U;  5GTH H;  2DZC A;  2O9V A;  2FY8 A;  3MD0 A;  2D2C D;  2O1K A;  3L72 E;  4Q5W A;  5CQY A;  1G5V A;  2LTO A;  1BI0 A;  3RNJ A;  2XG8 D;  3MCA B;  2LVM A;  1KHI A;  4PJO F;  3HKS A;  2RI5 A;  1Q86 Q;  1G3T A;  3K5B A;  5GMK h;  4PJL A;  1NEG A;  3G71 Q;  2PGD A;  3H1L D;  1GCQ C;  2QM7 A;  1VQO P;  2L8D A;  1PL5 A;  1FJP A;  1YJN A;  4PNO A;  4R4L A;  4X9D A;  3QZ9 B;  2R44 A;  5EG2 A;  2HAX A;  3RL0 g;  3SFD C;  2LCS A;  3HD7 D;  1GD2 E;  3SDZ A;  3ZL7 C;  3MIW A;  2CZ0 B;  2KSE A;  1LNX A;  1IO6 A;  1JCC A;  1QVG A;  3JV3 A;  2R3S A;  3GHG B;  2DK3 A;  4FSS A;  1WNL A;  2RI2 A;  2XK0 A;  1PP9 D;  4UB6 H;  1HSQ A;  1ZBJ A;  1Q82 R;  2DMO A;  2HG5 D;  3I55 P;  5GTI E;  1GCQ A;  3OYH A;  2CP3 A;  2ZPI B;  3G6E P;  1RAG B;  2O01 E;  1NTZ D;  1RF0 C;  4YXW H;  1HJB A;  3S6W A;  5APU A;  3QKJ A;  3FXE A;  2NZ2 A;  2LNV A;  1FZC B;  3B5N B;  2JP3 A;  1B34 B;  2E74 C;  2Z5H A;  2W6A A;  2JZ2 A;  3VS6 A;  2X51 A;  5AW1 B;  4M7D D;  2PZ1 A;  1AZE A;  3QWY A;  3L2W A;  4XTW A;  4I2L C;  1UIX A;  1OI1 A;  3EGX B;  1M1K Q;  1TSF A;  1JTH A;  3I56 Q;  3QZ5 B;  4KUI A;  3NPF A;  2QJY C;  5APY A;  1QQJ A;  4M75 D;  3HUS B;  2ESW A;  3ABV C;  1T6A A;  5L8R J;  1OVR A;  5CCG D;  3ME9 A;  3RL0 B;  1OU8 A;  3H9N A;  3OW2 S;  1LTT C;  1SQB J;  2EKH A;  3JSV C;  1E7O A;  4C7R A;  1VQ5 Q;  2LZ6 B;  2QG4 A;  1L0N D;  2P0K A;  4OP0 A;  4L74 A;  2O4X B;  1MV8 A;  1NTM J;  2IZ1 A;  4IUV A;  2WSF H;  4PFZ A;  3Q1M A;  5TIS E;  4EDF A;  1WQW A;  4M7D G;  5GAM g;  1SRM A;  1VQM Q;  1KC8 Q;  2HQX A;  2OAR A;  2DTI A;  3OS2 A;  3CCM P;  2OYI B;  1ZW0 A;  3FC3 A;  4MZT A;  4KRT A;  4M75 G;  2COW A;  2P4R A;  5CCH C;  1MUZ A;  2EQM A;  5I2S A;  3Q3D A;  2IVW A;  3CX5 I;  1IFP A;  3H1K E;  1PM3 A;  4Y99 B;  1KD1 R;  3H32 A;  1OXZ A;  3L72 J;  3BDU A;  5IXF A;  1M8O B;  3OW2 P;  3B4S A;  4D6T G;  4DOJ A;  4KGZ B;  3CCJ Q;  1PD0 A;  2MIO A;  1A02 J;  3CCL A;  1C0M A;  2F5T X;  1K73 C;  3FWN A;  4OB1 B;  2M02 A;  3OSS C;  5A0L A;  3H1J E;  2AIR B;  2MAM A;  5CCH A;  1W2B S;  2L2P A;  1KFZ A;  1YQ3 C;  4DOV A;  1P84 I;  4DJG A;  1L0L K;  1R0C B;  1FOS F;  1WFW A;  1NOH A;  2CP2 A;  2V1Q A;  2ZPF B;  4OVN F;  4JBZ A;  4ZNX A;  4C92 D;  3HTK A;  5CKH A;  3BVH A;  2FPF A;  4J6X A;  2DER A;  2QA4 A;  5AVV B;  5GAN f;  1NLO C;  4JDS A;  4MZP A;  5FU7 B;  3RK2 C;  3FEO A;  1MFZ A;  3OQ5 A;  3FJP A;  1YJW A;  2EYX A;  1M3C A;  2BCC G;  2JDI H;  4J5Y A;  3VRZ A;  3CC7 A;  5A2Q E;  3JCU H;  3ITK A;  3RUX A;  1QP2 A;  2H8P D;  4EPC A;  2KDS A;  2EQK A;  2YRV A;  4RTV A;  4W7Z A;  4IIO A;  4C8Q D;  1GW4 A;  2L0A A;  2HKN A;  2O01 J;  4FCY A;  4EMK C;  1SP4 A;  4HT8 A;  2DL3 A;  1X6B A;  2DF6 A;  2K5L A;  1PC0 A;  1SQP G;  4YTP C;  1FZA A;  1GL2 A;  1EZZ B;  2LKM A;  1SF9 A;  4H13 D;  3M59 A;  1HK9 A;  5LJ3 h;  3JCM Q;  3A0H E;  1VQ9 A;  3CD6 Q;  5LJ5 g;  2NUP B;  2K7A A;  3AE5 C;  4C92 G;  5AW8 B;  1ZP0 C;  5KLV E;  2MPX C;  4HKE A;  4EMK A;  1R5L A;  3EFG A;  3M0D C;  5FRO A;  2RB6 A;  2YDL A;  4B9W A;  1K73 U;  1H0T A;  3VP8 A;  2LT1 A;  2LQN A;  2FYU G;  1GK4 A;  3FXD A;  2RQT A;  3TDK A;  4LNP A;  4M78 D;  2GUS A;  3G71 P;  3VS5 A;  1SQQ G;  2IZ0 A;  3QWO C;  3L42 A;  3EAE A;  2D0Q B;  4ZN1 A;  2QEX A;  3JB9 I;  1GFD A;  1USD A;  1T0H A;  4HVW A;  2EYW A;  3LWH A;  1FX7 A;  1Q82 Q;  3JCU E;  3M0D A;  5CKB A;  3CCE T;  1NKZ B;  3TF5 A;  3CME Q;  1JO8 A;  1AOJ A;  1RAC B;  4H44 B;  4KT0 E;  2XND H;  3QXE B;  1S2E A;  3V4W A;  2C9N Y;  4QQ6 A;  1IK9 A;  1L4A C;  1SQV E;  1ZA2 B;  3BAT A;  2K6D A;  3M0P A;  5FWB A;  4C0D C;  2A7Y A;  3CCS Q;  3NMD A;  2K2V A;  3A1P A;  5KYY A;  2LDM A;  1FE6 A;  3CMA T;  2WPQ A;  3WUU A;  3H1K J;  1BCO A;  3GF7 A;  1SQX K;  1UG1 A;  2J5U A;  2WAC A;  9ATC B;  3KXT A;  1NTK D;  1L4A A;  2JWD A;  2XV5 A;  2O2O A;  1M27 C;  3AE6 C;  3H1J J;  4GY5 A;  2N9B A;  3M54 A;  4LUE A;  3I56 P;  1YIT A;  4AFQ C;  2H8H A;  4L6V 5;  4BRY B;  2DXU A;  2KXD A;  1VQN Q;  3CCM A;  1VQ6 Q;  4FIB A;  1G2C B;  1FBM A;  2EAY A;  3EH1 A;  2C0X A;  4F7U E;  2E75 C;  4WTO B;  4I7Z B;  1UJ0 A;  1OZH A;  1YQ4 C;  1OPL A;  2ZAE B;  1KB9 D;  1LTJ C;  1O9S A;  4C5G A;  1VQK T;  2X4J A;  4A54 A;  2OX7 A;  3UAT A;  4MDW A;  4N4I A;  3QHS A;  5GAO l;  3OW2 A;  1KQS O;  4RG2 A;  1RAF B;  4X9C A;  2E5T A;  3JAM E;  2DTH A;  4R56 A;  2QIW A;  2JKV A;  1M1F A;  3M56 A;  2E10 A;  1C6V X;  2EYQ A;  3VYG A;  3JCM J;  1LTJ A;  2SPZ A;  1VQM P;  1V76 A;  1H92 A;  1KIL E;  1VA7 A;  1ZUY A;  3EQ2 A;  2CH4 W;  1KIK A;  3CC2 A;  4C0G A;  3CBM A;  3F70 A;  3L2U A;  1MMN A;  1BB9 A;  5KLV J;  3JCM c;  2CK3 H;  3M91 A;  4JJD A;  1N9S A;  4DBQ A;  2AXC A;  4C46 A;  3CCR P;  4KH1 B;  2HOD A;  1BSN A;  3CCJ P;  1N7S B;  3FIF A;  1K73 R;  2E4H A;  2JEE A;  1Q2N A;  2ZCF B;  1NPR A;  3ASK A;  2RN0 A;  3AHU A;  4PD4 I;  1PGQ A;  3QH9 A;  2VC8 A;  5IHK A;  1GW3 A;  2FXM A;  2Y9Z A;  1CW5 A;  1W2B A;  1BE3 D;  2BUD A;  3VV0 A;  2M5A B;  1CSB A;  4L59 A;  5KCH A;  2ATC B;  4OMN A;  4D6W A;  3OA7 A;  2F2V A;  1M2V A;  3H0F A;  4JJB A;  4E7Z A;  2E74 D;  1YWO A;  2DO3 A;  3P8M C;  4B86 A;  1SQV J;  2KRM A;  2JS0 A;  4AFS C;  3SB2 A;  3J7A F;  2DNU A;  1SHF A;  1JJ2 P;  1T3J A;  1PGJ A;  1S1N A;  3HD7 B;  3G71 A;  4ASV A;  2PNI A;  3KHU A;  1JXM A;  1OW6 A;  2QXF A;  4FT2 A;  4OWF A;  4JRQ A;  4A4F A;  1NBE B;  3RK3 C;  1LTS C;  1OX8 A;  1VQ4 Q;  3HPW A;  5AVQ B;  4IL6 E;  3V2P A;  2FYN B;  3CCL T;  4L5G A;  5KAF H;  3CD6 P;  2RPN A;  3JCM P;  3V7C A;  4OB0 B;  4RG8 A;  3WU2 E;  3L73 G;  2D2C C;  4DCK A;  5GAN 6;  6AT1 B;  1OYX A;  3U23 A;  1LWU C;  4Y28 E;  1LGH B;  1YBK A;  1RQU A;  4OGQ C;  3H25 A;  2E3H A;  2JMA A;  3SD4 A;  5GAM e;  1NAF A;  3E19 A;  1USE A;  2QGF B;  2QA4 T;  3CX5 H;  1L2P A;  3CXH E;  3M0S A;  2QJK B;  4GBQ A;  4D8K A;  2W6B A;  5GMK m;  3N7N A;  3C4S A;  4M7D B;  1J1D C;  1NTZ K;  1TS9 A;  1S1C X;  1VQL A;  4P5N A;  2K9J A;  2V8I A;  4ME7 A;  2CSI A;  1YJW T;  3CC7 T;  3VKI A;  1FXX A;  1QX8 A;  5AW6 B;  3H1H D;  3HE4 B;  2R5A A;  1K8A Q;  4M75 B;  3C12 A;  5CCH D;  3NXS A;  1S72 Q;  5B5E E;  2RK1 A;  2HPC B;  5GJW B;  3CME P;  1IHV A;  3NFC A;  4MZM A;  2PAJ A;  1ZR4 A;  1P84 H;  3IAO A;  4XTX A;  3R6N A;  1NYH A;  1VQO T;  1KMI Z;  3H6Z A;  1OEB A;  3UF4 A;  4XU1 A;  2ZXX A;  1D09 B;  1Q7Y C;  2WWW A;  1VQ9 T;  1WJR A;  3FGA D;  2WSC H;  4E7J A;  3CCQ Q;  1J2J B;  3L36 A;  3S3M A;  2YO2 A;  3X26 B;  5HKC A;  4J9D A;  1SS1 A;  3CCS P;  1W5C E;  2B87 A;  2XI9 A;  2JR8 A;  2FPD A;  3I55 T;  1W6X A;  1SSF A;  1CKA A;  1Y47 A;  4B6M A;  1MFT A;  3RDV A;  1L0N K;  4A7P A;  3FLG A;  3VN0 A;  4J7F A;  3H1H G;  3RK2 D;  4ZTF A;  1VUB A;  3CX5 E;  2GCX A;  5BU5 A;  3NFQ A;  2JW4 A;  2QEX T;  4IKF A;  1KQF B;  1BGY E;  3RBX A;  3CQT A;  3JRZ A;  2ED0 A;  2NRG A;  1Y71 A;  1EZV E;  2GFA A;  1H88 A;  1U3O A;  2Y4X A;  1VQN P;  1DEE G;  1VQ6 P;  1NKN A;  1ZA1 B;  4JRK A;  3PH0 A;  4AT1 B;  1D0Y A;  3JCM d;  3T9N A;  3II6 A;  3RR6 A;  5LJ5 e;  3CXC P;  3OYL A;  1OZ3 A;  4HCB A;  1K4U S;  1FZG A;  5KAI H;  3CCR A;  1OFC X;  1KQS P;  1RAI B;  2Q6Q A;  1JY3 N;  5CCG A;  3H8Z A;  4C92 B;  1Z9Z A;  1Q7Y U;  3JB9 H;  5C39 A;  3TNU B;  2X3X D;  1OU9 A;  1U06 A;  3BRV B;  2OTK E;  3EFO B;  3S4R A;  4K3A A;  3X20 B;  1SLQ A;  2D8J A;  1BCC E;  2M0Y A;  5GAN 2;  2FRY A;  3A98 A;  3JSC A;  2MF2 A;  1AV1 A;  2FB7 A;  2KYM A;  1UEB A;  1AQT A;  3O6Q A;  2MWP A;  4MN4 C;  3PGG A;  1Z9Q A;  3KUF A;  1YIT T;  2HL5 C;  5M9O A;  4Y28 J;  3CCM T;  4C7N A;  1ZQ1 A;  5IHN A;  1E5W A;  1AVO A;  2K5F A;  4WB4 A;  1YHQ A;  3W67 A;  4JRP A;  3M4G A;  2P0Q A;  2DYB A;  3AE4 C;  4NOY A;  3G4S Q;  2V26 A;  1VQP Q;  5GAN g;  5GAO p;  3HRU A;  1VYT A;  2OTJ P;  2VUB A;  1Y07 A;  1L4A D;  2JNG A;  3MEV A;  1MMD A;  1EDJ A;  2JWA A;  4FSX A;  4J8O A;  1J1E B;  4TT3 H;  2QQB A;  2XHC A;  4FYV B;  1NYF A;  4N4G A;  3CD6 A;  2VXE A;  2WIT A;  1X01 A;  1L0L E;  4KGX B;  2HNI A;  3CWB E;  2A37 A;  1D3B A;  2CZ6 B;  4VUB A;  2AEF A;  1ZBX A;  2A45 G;  3EG2 A;  3E1S A;  2Q5U A;  4YXD C;  2KNC A;  1LTA C;  1QCF A;  1YWP A;  4JZ3 A;  2K57 A;  2H88 C;  2HDA A;  4E7L A;  4MDX A;  3ZFJ A;  1VQ8 Q;  4ZGE B;  1OOT A;  4XU3 A;  2RJE A;  1F1B B;  1CI6 A;  2MOX A;  2VVK A;  2CP7 A;  4XQ3 A;  5CCA A;  2XU8 A;  1VQ4 P;  5C0M A;  2E75 D;  3L71 E;  2I2L A;  5DLQ E;  2B89 A;  2LQK A;  1N7L A;  2OTL A;  2LX9 A;  2PP6 A;  1JY3 P;  1S5L E;  3MKD A;  2F5K A;  1QL1 A;  3GBQ A;  1NJI C;  1JO5 A;  2CUD A;  1D1A A;  5LJ5 h;  2EJ9 A;  1BGY J;  1CZQ A;  3R4Y A;  2BKD N;  8AT1 B;  1M5Q 1;  3OS1 A;  1YN8 A;  3V8K A;  4Z1M H;  2V7Q J;  2JTE A;  1MZ9 A;  2V8K A;  1YTZ T;  5KE3 A;  4R4M A;  1VYV A;  2P4T A;  2ZZD A;  1KOR A;  2H89 C;  3CCU A;  1QLE D;  3RMQ A;  4LDW A;  3WUV A;  1KYO I;  1TH7 A;  1SEM A;  3KQG A;  1HJ0 A;  1SFC B;  4YPC A;  1PWT A;  3OYJ A;  2WSC J;  3QDF A;  4U3F G;  1NTK K;  2QK0 A;  2XDP A;  4M78 A;  4PD4 H;  1S72 P;  5HY6 A;  2GM4 A;  3G71 T;  1N8R R;  1RH5 B;  1RF1 C;  1I8F A;  4BWN A;  1Q7Y R;  1EDI A;  1SQX G;  3KZI H;  1GU5 A;  1N86 A;  1LT1 A;  2PFX A;  1N5Z A;  1BCC J;  5HK3 A;  1K9M C;  1HGZ A;  4HJG H;  3CCQ P;  2Y4Y A;  5D7U A;  3VMX A;  2RHX A;  1PGP A;  3M0Q A;  2GTO A;  2DET A;  4RO0 A;  2Q3E A;  1LOJ A;  5FRM A;  1N27 A;  1G2B A;  3CC4 Q;  4N78 E;  3L72 D;  1JY2 P;  1ZXG A;  3BCC E;  3GLM A;  1RF1 A;  4ZKU A;  1TXQ A;  4DOW A;  1ACM B;  1PZQ A;  2CPB A;  2FZC B;  4CPG A;  2QYZ A;  1OW8 A;  1I0C A;  1NJI U;  2E5Y A;  4JLI A;  1M1G A;  1EX4 A;  1VQL T;  1KIL C;  3TQ7 P;  1KJW A;  4C5H A;  1URQ C;  3GMA A;  1TWB A;  1M8M A;  2DVE A;  3WUT A;  4FU6 A;  3AEA C;  1M90 C;  3L70 D;  1ABQ A;  1ABO A;  4QVZ A;  3EG0 A;  1FZF A;  2L3P A;  2HD0 A;  1WLP B;  2E5K A;  4A4G A;  4EIK A;  1IB8 A;  5GTI H;  3CBO A;  4GLM A;  2CP6 A;  2C9L Y;  2P1J A;  1L0L J;  1FS0 E;  4GT1 A;  4N0A A;  3CWB J;  2NUT A;  4B9X A;  4PD4 E;  4BE0 A;  2Q9I A;  2H3J A;  2DL4 A;  2O01 H;  1KIL A;  3I56 T;  3RK3 D;  2Z5I A;  2RQR A;  1AT1 B;  1EIF A;  1R0B G;  1URQ A;  5J39 A;  3KZI E;  4RTU A;  1RE3 A;  5FU6 C;  1YIJ P;  5CHX A;  3WMM 0;  1SHG A;  2J7I A;  1YNZ A;  3M57 A;  2PUK B;  1JTH B;  3CMA A;  1PPJ D;  2A06 E;  2AXT E;  1EDL A;  2QAZ A;  1K9M U;  4OGQ D;  4BDY A;  4C5E A;  2OTJ A;  1XJW B;  1M57 D;  4O6J A;  2E74 B;  4HVV A;  1JEK A;  1V1C A;  3GF5 A;  2JO1 A;  3L70 G;  3L71 J;  2D8H A;  4PV1 C;  3OS0 A;  4GDO A;  3CCV Q;  2Q1K A;  4BE2 A;  2M16 A;  1Y8A A;  1JRI A;  4RTZ A;  4Y91 A;  2GA1 A;  2QJY B;  3V2N A;  2JM8 A;  2X9H A;  3E1I A;  1YI2 Q;  2VXF A;  3ER0 A;  3I5C A;  1QVP A;  1AEY A;  1MHN A;  2YHT A;  2CP5 A;  4BY6 C;  1TU3 F;  1VQK A;  3V8J A;  4BB7 A;  4LLH A;  1VQP P;  1K76 A;  2C06 A;  4QVC A;  1FMK A;  1DEB A;  1K0S A;  1PPJ G;  3QYH B;  3OYN A;  3CCR T;  5GAO r;  2FKW B;  3F89 A;  3P32 A;  5TIS H;  1G3W A;  3KFV A;  2MK5 A;  3CPW O;  1VQ7 Q;  4W7Y A;  3PLN A;  3BY7 A;  1X6O A;  3REB B;  1E6G A;  4JRI A;  2MWO A;  3M53 A;  3QSU A;  3H32 B;  5CKD A;  2K3R A;  3Q5P A;  3H1L G;  3AT1 B;  1LPL A;  2IBZ D;  3G1J A;  5KE2 A;  3CXH I;  1WHL A;  2E6N A;  1RF0 A;  1BIB A;  1OUL A;  3EHQ A;  2YKQ A;  3TU4 K;  2GF7 A;  4HB1 A;  4A63 B;  3QPH A;  2V1R A;  1VQ8 P;  1PP9 G;  3I5S A;  3OSV A;  3HE5 A;  4ZTJ A;  3BCC J;  3HTK B;  1YHQ T;  4NL2 A;  1DIP A;  2X3W D;  4JJC A;  1RY3 A;  1HGV A;  1NTZ G;  3KXD A;  3VMZ A;  3VTP C;  2CYZ B;  1NJI R;  1QMC A;  3G3Z A;  2K5I A;  3H1J D;  3M9Q A;  3AEF C;  5H2F E;  2EWN A;  2RMO A;  3JCM h;  5E79 E;  1RI9 A;  1YJ9 Q;  2IBZ G;  3CD6 T;  2FZK B;  3S1K A;  5J3B A;  4PJO C;  1CSK A;  3RIR A;  3NTK A;  5GMK i;  4W80 A;  3RK2 B;  4LGD E;  1GL2 B;  3Q5R A;  1PHT A;  1MV3 A;  1N8R Q;  1NVO A;  4LDX A;  3O8Z A;  3A8H B;  2QQA A;  2RHI A;  1X9V A;  3X28 B;  2LP5 A;  2QVA A;  1PFI A;  5LJ3 f;  1FZC C;  1Q95 G;  3QUI A;  1QVF O;  4J9C A;  5AVX B;  4EMK B;  7AT1 B;  2KIK A;  2H7H A;  3A0H H;  2WSE E;  3OA6 A;  3OYG A;  3SWF A;  3OYY A;  1GBQ A;  2JJ9 A;  1H0T B;  4PJO A;  5GAN e;  2LXC B;  4M7D E;  1EZV I;  4OGE A;  2MKV A;  1BK2 A;  1L0N G;  2KT1 A;  2OTL T;  3A0B E;  4EI2 A;  2KYB A;  3RBB B;  2ZYG A;  3MP1 A;  2DXB A;  4M75 E;  2M3B A;  2JJL A;  3HUS C;  3P8C E;  1M2O A;  1QWF A;  2IG0 A;  2E76 C;  5KLV D;  3V7S A;  4Z89 A;  2EGA A;  1SRL A;  3CC4 P;  2EYY A;  4D6T E;  1YIJ A;  5CJ0 A;  2HL3 A;  1PV3 A;  4UC4 A;  5KKZ C;  2Y0E A;  3CCU T;  2O01 N;  3CCS T;  1NZ9 A;  2LQ8 A;  3INZ A;  5GAM j;  2L3R A;  4IOI H;  2GUV A;  3M0A A;  2W0Z A;  1TUD A;  2IX7 C;  2J59 M;  3HUS A;  2JUF A;  2Y9Y A;  4BE1 A;  2GFU A;  3C1L A;  2JMC A;  2XID A;  2M0O A;  1NU1 D;  1NWQ A;  5KYY B;  1RAD B;  5IXB A;  3QJ6 A;  1U8R A;  1VQO A;  2FXP A;  1NO4 A;  3OBW A;  2YO3 A;  3FJ5 A;  3D71 A;  1ZV8 A;  1OX3 A;  1J3T A;  1L4A B;  2J58 A;  2FL7 A;  2KR3 A;  2BCC E;  5GAM d;  3VS3 A;  1SQV D;  1VQN T;  1VQ6 T;  1WZO A;  1ZX6 A;  3S3O A;  4K11 A;  3VU3 C;  1QCO A;  2COY A;  2MCN A;  4Y99 C;  1KYO H;  2JN0 A;  2HSP A;  1XQH A;  3I55 A;  3UPU A;  1UGP B;  3G6E A;  3URG A;  1UDL A;  1M56 D;  5CO7 A;  3M0R A;  2FFD C;  1U5S A;  2YNY A;  3EG9 A;  1QGK B;  1FMV A;  1K9A A;  3QDR B;  1SQP E;  2ROL A;  2WZ7 A;  3I5R A;  4C8Q G;  1H3H A;  3U1C A;  5APS A;  4BXL A;  2DL5 A;  2NUZ A;  1NU1 G;  3CCV P;  4PFO A;  4OF1 A;  4C92 E;  5B66 H;  1IJD B;  4QW2 A;  1NLP C;  2RKL A;  2QJP C;  1H64 1;  3M0U A;  1YI2 P;  2XNX A;  4TLF A;  1N2D C;  2FFD A;  5FU7 C;  2KLU A;  2EBP A;  2E75 B;  2FYU E;  2VRS A;  2YXQ B;  3IFM A;  2FZG B;  1E79 H;  2IYP A;  5I11 A;  1T3U A;  4ANJ A;  1LTJ B;  4GIF A;  1X8Y A;  3AE1 C;  4RKU E;  3MP6 A;  1SQQ E;  2DTO A;  3GOX A;  5HK0 A;  1PNJ A;  4M77 C;  4U7J A;  1AFO A;  4XTZ A;  2ZYD A;  1M1J C;  2VGM A;  2DL7 A;  2E43 A;  5LJ5 j;  4M78 G;  1KHC A;  4ELZ C;  3CPW P;  1VQ7 P;  1KV4 A;  1JEG A;  1UGS B;  1EDK A;  3THK A;  2OTJ T;  2WSE J;  1KYO E;  2KP8 A;  1DD4 A;  4IFM A;  1DX7 A;  4BI8 B;  2HOD B;  4L76 A;  3ZDM A;  3SWN C;  3VYH B;  2YIU C;  1W1F A;  3UDC A;  2EVR A;  2I8D A;  2QQ9 A;  3LGF A;  4M77 A;  1KIL D;  1WJS A;  1AWW A;  3FX0 A;  4BI4 A;  1URQ D;  2CT4 A;  1M1J A;  2GQI A;  3HRT A;  2BEQ D;  2EKO A;  4FL6 A;  2WPS A;  2L3Q A;  1Y57 A;  2BIV A;  5DJU B;  2KYV A;  5LJ5 d;  4EOT A;  1C1A A;  1FZB A;  1WYX A;  4J9B A;  3SSU A;  2CRE A;  5B66 E;  1OVV A;  1BI2 A;  2LNH B;  4D6T J;  1VDF A;  3SWN A;  1MV0 B;  1M2V B;  3EH2 A;  3IR9 A;  1GBR A;  1VQ5 P;  2RJD A;  4KJM A;  4PL6 A;  2P58 A;  1UFF A;  3AEG C;  5CK9 A;  2OYH C;  2F2X A;  1LP1 A;  4ZKP A;  4PLI A;  4N3Y B;  3PHL A;  1VQ4 T;  1VOM A;  2K1A A;  3UA6 A;  1M7L A;  1LJO A;  1NTK G;  2XMF A;  1YJ9 P;  3MPU B;  2YMY A;  1GK6 A;  4JPB W;  4JUV A;  3QG1 A;  1AWX A;  1KD1 Q;  4QQD A;  2EJF A;  1NPP A;  4DBR A;  2OYH A;  2BCC J;  2DA9 A;  4PV1 D;  3A8L B;  2K4Y A;  3TYY A;  4XE5 B;  2JT4 A;  4MMK A;  1PCX A;  1ZLM A;  4IL6 H;  1Q81 C;  1JJ2 S;  1Q90 D;  1QVF P;  3CCE Q;  2C0W A;  3WU2 H;  2N1T C;  3H1I D;  3RK3 B;  3AE7 C;  3PIP A;  1ZRT E;  3TGU D;  3MET A;  3SEM A;  1YBY A;  1SQP J;  4M7A C;  3UWN A;  2QRX A;  2K9J B;  1S72 T;  2E3I A;  3L75 D;  2V8J A;  4CC2 A;  3X24 B;  2D2C B;  1WDX A;  1V29 B;  4GOE A;  3CXH H;  1KG1 A;  1Y96 A;  3MUD C;  1Q86 C;  4OGQ B;  4D8D A;  3EG3 A;  5AVZ B;  3TRE A;  4I7Z C;  1HH0 A;  4KT0 J;  2MMP A;  1RE4 C;  2N1T A;  3IQL A;  2FYU J;  2KI7 B;  4LC1 A;  1K0X A;  1J1D B;  4M7A A;  1EFN A;  2RNA A;  5B5E H;  4RKU J;  2R5B A;  1SQQ J;  3L74 D;  1R8O B;  4BD3 A;  1T2K C;  1G2C A;  1A0N B;  4IFF A;  1OV3 A;  2JVV A;  3CI9 A;  3E9F A;  4H0L C;  1YJN Q;  3HL8 A;  2RF0 A;  1R5S A;  4M7D F;  2B87 B;  2K9Y A;  1IZN B;  1IRX A;  3A5T A;  1RE4 A;  2ZAE A;  3RGU A;  1FDI A;  3LX7 A;  3L75 G;  1QVG O;  4BAC A;  1G1I A;  4AG2 C;  2HCK A;  3DKM A;  4M75 F;  3PMI A;  1Q81 U;  3VOP A;  5KYW A;  1BE3 G;  1YP5 A;  3WXM B;  5GMK l;  2XDJ A;  2QQS A;  3EGD B;  4J9H A;  3DB3 A;  5APV A;  2VV5 A;  4JJN K;  2L5G B;  4XU2 A;  2CS7 A;  2CZ1 B;  1YIJ T;  2XIC A;  2R5D A;  1M1K C;  3V5B A;  1S9K D;  1XOV A;  2KNB B;  4KUD K;  4PJO D;  1IFM A;  3L74 G;  1Q86 U;  4ZMD A;  3VS0 A;  2V7Q H;  5KH6 A;  3CX5 D;  4AQR D;  4GOD A;  3TVT A;  1LWU A;  2PUO B;  4DEX A;  3L73 E;  4OMO A;  4LD9 K;  1AVY A;  1BGY D;  4ATO A;  5APT A;  5AVU B;  3TSI A;  2OAU A;  4HCZ A;  3TSW A;  3A8G B;  4PJ0 E;  2A08 A;  2VB6 A;  1EZV D;  3GF3 A;  4PJM A;  1JOC A;  5GAO n;  4JYB A;  5AW4 B;  2MJZ A;  2M3E A;  1JQQ A;  3I56 A;  1QW1 A;  5APX A;  4J9F A;  1EC5 A;  2L3S A;  2YLB A;  4LDY A;  2PQW A;  3MEU A;  4J9I A;  3VP9 A;  1P84 D;  1LCK A;  2YLC A;  2DRM A;  1UE9 A;  3CXC S;  2DBM A;  1G3S A;  4RTY A;  3O6Q B;  2QE7 H;  1KC8 C;  1NG2 A;  3C94 A;  4R0K A;  3WVE B;  1VQP T;  1KQS S;  1VQ5 A;  2E76 D;  4C7N B;  3G6E T;  4E6R A;  2XKM A;  2KVQ G;  5AVT B;  3E9G A;  2KS1 A;  1YFN A;  1BCC D;  1S3J A;  4PKC C;  2RN8 A;  1SKU B;  2XKO C;  5AW2 B;  1N9R A;  3P8H A;  2KUB A;  3AEE C;  4AMC A;  4C92 F;  3A2A A;  1AQ5 A;  3OAK A;  1VQM A;  2M51 A;  3L2V A;  3LH0 A;  1M1K U;  2E41 A;  1N73 C;  1WJQ A;  1KFM A;  4AFU C;  5GJV B;  5KYU A;  3U59 A;  3V2Q A;  1U7J A;  2QJK C;  5A0D A;  4UB8 E;  1X0T A;  3NHN A;  1JM0 A;  4II1 A;  1D3B B;  3UA7 A;  4C8Q F;  2WVR A;  1U57 A;  1Y7X A;  2O9S A;  4AUW A;  2WSS H;  3H1H E;  1VQ8 T;  1BDD A;  1H3Z A;  1RLP C;  5KLI C;  2DKG A;  2KNC B;  2POH A;  3CCL Q;  5KTB A;  1GDT A;  3CCJ A;  1DH3 A;  1N73 A;  2PU9 B;  1AZG B;  3MP7 B;  2KGT A;  1ARK A;  2CKK A;  1LTB C;  2NLU A;  5LJ3 g;  4J9E A;  2HMA A;  1WPY A;  2AZV A;  3CWB D;  2PTK A;  2YUQ A;  4CRI A;  1CI6 B;  1QWE A;  5GAM h;  3AE9 C;  2O88 A;  3JB9 D;  1KC8 U;  1JBM A;  2ED1 A;  3V2R A;  2QA4 Q;  5KLV K;  4C8Q B;  3MZW B;  2XDB A;  2KEA A;  3L1A A;  1LT9 C;  2QTV A;  2B9B A;  1IO4 A;  1K73 Q;  4YTL A;  3L37 A;  2J05 A;  3ZBD A;  3L2Q A;  3VMA A;  1ZSZ C;  4E7K A;  1YJW Q;  3CC7 Q;  1Q81 R;  3R6O A;  4M78 F;  2QAS A;  2ZGW A;  4J6W A;  2QSI A;  1HUC A;  1H8A A;  4IUR A;  2EQI A;  1S5L H;  3PP5 A;  1FYN A;  2OAW A;  4HKZ H;  4H13 B;  1JJ2 A;  3CCE P;  1EXI A;  4ESR A;  5CIU A;  2IYO A;  3L71 D;  1NU1 K;  1LT9 A;  4HXJ A;  5DLO A;  4HYT B;  2YRD A;  2QTX A;  3M9H A;  1ZSZ A;  3QBY A;  1Q86 R;  4M77 D;  1VQ9 Q;  3TCJ A;  3L73 J;  1M3B A;  3AE3 C;  5D6W A;  5AVY B;  2FPE A;  4M78 B;  3JB9 G;  2PVO B;  2JXB A;  1SQV K;  2G8Y A;  1ZSG A;  2DXC A;  1AA0 A;  2RO0 A;  1JY2 N;  3EGU A;  5TJH A;  5GAN 4;  1Q82 C;  3A8M B;  1FWZ A;  3O5Z A;  1LNQ A;  2DXT A;  3CC4 T;  1HF9 A;  4Y92 A;  2VKN A;  2KQW A;  2QEX Q;  4FT4 A;  4WF2 A;  2K3B A;  2RM4 A;  4E7S A;  2DPP B;  1YJN P;  1ZME C;  2CPS A;  5CKF A;  1RF1 B;  1YCS B;  1MMG A;  2WQY C;  2LJ1 A;  1RAH B;  2HEQ A;  2VYT A;  1FMW A;  3L2R A;  2F2W A;  1NEB A;  3CME A;  2J06 A;  4M77 G;  1QVG P;  2DIG A;  3I9Q A;  3RKX A;  1UGV A;  2D0N A;  3OYD A;  1KQG B;  2XU6 A;  5GAN j;  4LN2 A;  3PTZ A;  2DM1 A;  3IN6 A;  1MKM A;  3MO8 A;  2GTJ A;  4QQG A;  2KK7 A;  1NYG A;  2P7J A;  4N78 D;  5A0G A;  1M1K R;  2YRC A;  4C0F A;  5CAI A;  3JCM V;  3CCS A;  3FRN A;  1SQB D;  2NUT B;  1HTL C;  4HH2 A;  1KN7 A;  1AWO A;  4DZO A;  1M9S A;  2A36 A;  4X1V A;  1URQ B;  2GGR A;  1J1E C;  3LID A;  1EQ7 A;  3H1H J;  2WTY A;  2DJZ A;  1T3S A;  5GMK e;  1YCY A;  5AVW B;  1NTM D;  1TUC A;  5GAN d;  2X35 A;  4E7I A;  2QI2 A;  1Q82 U;  5ECA A;  3C0C A;  1YIT Q;  3CCM Q;  3CCV T;  4WY4 C;  2E42 A;  2ZPE B;  3IF4 A;  2RD1 A;  4PD4 D;  2N1T D;  3JCM X;  4V2S A;  1VQN A;  1VQ6 A;  2AXT H;  4QKU A;  4WCI A;  3MJX A;  4NS5 A;  4M7A D;  2FXO A;  3LGL A;  5CMZ A;  1KC8 R;  5FU6 B;  2DD5 A;  1IGQ A;  5CJ4 A;  4EMH A;  3CXC A;  2GQV A;  2AKL A;  1Y0M A;  3OW2 O;  2KZI A;  1ZN5 A;  1X2K A;  4F7U A;  5D6X A;  4M3L A;  4U3F E;  2A06 D;  2E70 A;  2K2M A;  2KT8 A;  3H0I A;  1SQB G;  1RL2 A;  4WY4 A;  1KQS A;  1SQX E;  3BRT B;  1PRM C;  4O9B A;  2KLV A;  4WBA A;  2QGG A;  3RKW A;  3OYA A;  4EDU A;  3CEY A;  1RAB B;  4LDU A;  3HRS A;  1NTM G;  4PV1 B;  1JNM A;  4NPF X;  2EYZ A;  1GL5 A;  1QEX A;  2K9G A;  5DM7 R;  2ITA A;  2EW3 A;  1WRG A;  1GU4 A;  2R5M A;  3VS2 A;  3UIA A;  1ZLL A;  1T2K D;  3CC2 Q;  3N5B B;  1T3L A;  4H0L D;  2NPS C;  2RH2 A;  4BY6 B;  2YT6 A;  3KYQ A;  2I0N A;  2YUP A;  1D1C A;  4M7A G;  2LT4 A;  3X25 B;  2RA2 A;  3OYK A;  5AT1 B;  4JQ0 D;  1XTC C;  3P8B B;  2AEJ A;  1JB0 E;  1SFC C;  3I35 A;  2YSQ A;  2R32 A;  1WHK A;  4J9G A;  3L72 G;  5IN1 A;  2WPV B;  3CCL P;  3LYI A;  5L23 A;  1LJ2 A;  2HSE B;  4KUL A;  1GMJ A;  2DYI A;  4AFZ C;  3AEB C;  1XTD A;  1VQ5 T;  2NPS A;  2KRN A;  1W2B O;  1D0Z A;  4JS5 A;  3HE5 B;  1B7T A;  1NAY A;  2ZVN B;  4ZNC A;  2FHD A;  3QJY A;  1EXJ A;  1LVK A;  1KB9 I;  2EJG A;  2RQV A;  2QA4 P;  1SFC A;  2P0P A;  2KXP B;  3E7K A;  3L4F A;  4IUP A;  1HVV A;  2L91 A;  1YJ9 T;  3KDP B;  1PKS A;  1VQM T;  1UEC A;  3C8V A;  1YJW P;  4R55 A;  3CC7 P;  1BYM A;  3OYC A;  1RAA B;  2BE9 B;  2DW3 A;  4QMA A;  3J80 E;  1WHG A;  1LTG C;  3W68 A;  1SPK A;  1M90 U;  1G1J A;  3EFS A;  2B86 A;  2WT7 A;  3OS5 A;  1TU0 B;  2HZY A;  3G4S P;  3BFM A;  2W27 A;  5H2F H;  3AE8 C;  2YXR B;  3JCM f;  3CLQ A;  3NGP A;  1WHM A;  3L70 E;  2P67 A;  4XTY A;  2CGH A;  5E79 H;  1IZ6 A;  3AEC C;  1FZE A;  3CCJ T;  2NWM A;  1VQ4 A;  1VQ9 P;  1AJY A;  2K37 A;  4IUQ A;  1B3Q A;  1W2E A;  3VYI A;  1VF5 C;  2W8Z A;  3RK3 E;  5KYX A;  5BU8 B;  3T97 A;  4PJO B;  2KSJ A;  3NTI A;  1K8A C;  2ZT9 C;  4OMP A;  4JYC A;  3E1R A;  1JUN A;  4ASW A;  2RJC A;  1IFD A;  3EWK A;  1OPK A;  2LX7 A;  1FDO A;  2WSE H;  1VQL Q;  1PPJ E;  2W83 C;  1KK7 A;  3VUZ A;  1AD5 A;  3H1K D;  1CKB A;  1BI3 A;  5GTH E;  2QEX P;  3A3Y B;  2IDB A;  3AED C;  3V8L A;  3A0B H;  2R3C A;  4GOF A;  4U3F J;  2SRC A;  3C95 A;  3H1L E;  3DB4 A;  4PFP A;  4RUG A;  2FG0 A;  2AK5 A;  4RTT A;  1S72 A;  1SQX J;  4NPE A;  1X69 A;  3OYI A;  1RLQ C;  5APW A;  2EQJ A;  1QP3 A;  1RQV A;  5LJ3 e;  2C0O A;  3P8C D;  3GHG C;  2E76 B;  1KQL A;  2ZVO B;  2LCC A;  2YUO A;  3CCQ A;  1VPC A;  1PP9 E;  4DA4 A;  2KZJ A;  3Q2Y A;  4XAX B;  4HCC A;  1W4S A;  2I1J A;  4D6T D;  2E64 A;  4WVZ A;  1I4K 1;  1PRL C;  5KKZ B;  3S3N A;  1NTZ E;  3N4X A;  4NPD A;  1QKX A;  5I22 A;  4UB6 E;  1Q7Y Q;  4HVU A;  4JPZ B;  3H1K G;  1B07 A;  2C0I A;  1JB0 J;  4OB2 B;  2DD4 A;  1IXD A;  1TOV A;  1X27 A;  1T0J A;  2JM9 A;  2OYO A;  4XTU A;  2YKO A;  3B5N C;  1K8A U;  3LIE A;  3GHG A;  2I1K A;  4J83 A;  1YYC A;  3JB9 F;  1UB4 A;  2IBZ E;  1YIT P;  1K9M R;  2IFM A;  3MHV A;  3H1J G;  3EG9 B;  3RKY A;  1BIA A;  3A8O B;  3HHT B;  5KYN A;  3RER A;  2O1J A;  2ZFC A;  5AW0 B;  3CME T;  1ZHI A;  3LW5 H;  2Z4E A;  1K05 A;  2DIQ A;  3TEE A;  2FYK A;  4IL6 X;  2BCC D;  2RHY A;  1DJ7 B;  1FZC A;  3B5N A;  5IH2 A;  3M06 A;  3H0H A;  4E47 A;  1JCD A;  1WI7 A;  1B34 A;  3CCR Q;  3PVQ A;  2RI3 A;  1KSW A;  4DBF A;  3RL0 C;  2NYS A;  2AT1 B;  3OB9 A;  4Z8A A;  3AE2 C;  4L75 A;  2EGC A;  3OBY A;  1G8X A;  1E6H A;  4L73 A;  2EIF A;  4BUG A;  2FFD B;  4E7H A;  1VYU A;  2LQW A;  1SQP D;  3EGX A;  4JZ4 A;  1FDM A;  4OB3 B;  1L0N E;  4M77 F;  2BTT A;  3GP8 A;  1M90 R;  2QQR A;  1XNI A;  4ORZ A;  2E5Q A;  3L70 J;  3V4Q A;  2KK4 A;  1M8V A;  2RH0 A;  1UTI A;  4RMO A;  2V4H A;  1HD3 A;  2AKK A;  2KOG A;  4F16 A;  2CDT A;  2QJP B;  3CC2 P;  3PE0 A;  2YMK A;  1I5O B;  3E2U A;  2WSF E;  1GL2 C;  3PT9 A;  2YKP A;  2OYI C;  4BDZ A;  2FYU D;  1M3A A;  4Z88 A;  4IIM A;  1GCP A;  1YHQ Q;  2GNC A;  3GNG A;  4AYC A;  1NGM B;  5KLV G;  1SQQ D;  2O4X A;  3A5Z B;  4M77 B;  1FU1 A;  4C0D B;  4I1L A;  2W10 A;  1M1J B;  3OJA B;  3LW5 E;  4RCC A;  4HT9 A;  3USS A;  3G4S A;  1VQP A;  1OX9 A;  2DX1 A;  1GXI E;  2DL8 A;  2A0F B;  3CPW S;  5I21 A;  2H3E B;  2OYI A;  1KYO D;  1W2B P;  1D7M A;  3VS7 A;  3H1L J;  2L5Q A;  3SWN B;  4LD6 A;  2YIU B;  1WMK A;  2VGN A;  1LP1 B;  1BU1 A;  4J7I A;  1TG0 A;  5AVR B;  1X6G A;  2DRK A;  1GZL A;  3QYG B;  1M30 A;  8ATC B;  1UGR B;  2GBQ A;  1PP9 J;  2Y90 A;  1SQV G;  2X4Y A;  3C9I A;  1GFC A;  3BW1 A;  3OYE A;  1VQ8 A;  4C8Q E;  4DBH A;  4E2F B;  4WY4 D;  1RHZ B;  4CC3 A;  5GAN h;  1NTZ J;  4N6J A;  4GLK A;  5CQX A;  3M58 A;  2A45 I;  4FW2 A;  2OTL Q;  1IFI A;  1NU1 E;  2OYH B;  5BVZ A;  2D9T A;  3Q1J A;  1WIE A;  2Q3I A;  5CVI A;  2KAF A;  2G3R A;  4ZGD B;  3HTR A;  5IAY A;  3GPL A;  5AW9 B;  1JMB A;  2FYZ A;  2KRS A;  1K8A R;  1SSH A;  5GAO q;  4KBM B;  4PK4 A;  4M7A F;  1KZU B;  3PFS A;  2HLO A;  3MTU E;  2AHJ B;  2ZPH B;  2FEI A;  3CCU Q;  1VQL P;  1UJY A;  2K79 A;  3HSB A;  1KFN A;  2Y0C A;  4XA4 A;  2AEM A;  2IFN A;  4IFD K;  1MGQ A;  2ZXE B;  1SQB K;  2LC4 A;  4A4K A;  1A02 F;  4CC4 B;  4F7U G;  1Y96 B;  1JU5 C;  4M78 E;  1NJI Q;  5EFW B;  1O75 A;  4ELY C;  4LUD A;  2R58 A;  2A3L A;  2KXC A;  2DEQ A;  4OGC A;  5CKE A;  1ZOY C;  2ROT A;  2LJ0 A;  1H89 A;  2NPS D;  2N1T B;  4AG1 C;  5C6S A;  1QVF S;  1NTM K;  1Z56 A;  1PG5 B;  2NUP A;  4N4H A;  1OWA A;  1ZRT D;  1RAE B;  4M7A B;  2N9Y B;  1L0N J;  1YJN T;  1D1B A;  2DEU A;  2BZX A;  1KB9 H;  1SFC D;  4OMF B;  2W90 A;  4ZGJ B;  4H44 C;  3MP8 A;  3NTN A;  4XK8 E;  2Y0D A;  4C0Z A;  1X75 C;  3ULR B;  2XDD A;  1FAV A;  5APQ A;  2RQU A;  3SFM A;  4CI0 C;  1SVF A;  3PVL A;  2B88 A;  2WSF J;  3H6P A;  1MUU A;  3A7O A;  3CBP A;  2OI3 A;  1OIP A;  2HFE D;  3JCM W;  3CC4 A;  3MGN A;  5J26 A;  3O8V A;  2DBK A;  4KGV B;  5KYW B;  1K9M Q;  1G83 A;  2UWJ E;  2FO0 A;  5AVS B;  5GAO m;  5D6Y A;  5CBO A;  4RES B;  3LW5 J;  1IHW A;  5KJ7 C;  2P84 A;  4H0L B;  1NHL A;  4GKG A;  1NTK E;  3S9O A;  2MI6 A;  1IGU A;  2H43 A;  1KQ1 A;  3EFR A;  3EG1 A;  3REA B;  2RHU A;  1PSF A;  3D6Y A;  1WGS A;  2ZYA A;  1VIF A;  5KCO A;  1IK7 A;  3OYF A;  4LXC A;  1NE8 A;  1PD1 A;  1WXU A;  2E65 A;  1S5L X;  2KSS A;  1LWU B;  2OJ2 A;  3SFE C;  2YWW A; 
#chains in the Genus database with same CATH homology
 2PVD B;  2RK2 A;  5KJ7 A;  3P8D A;  3CCQ T;  1LTI C;  4XTV A;  2JTF A;  2EFI A;  1KQ2 A;  2CZ7 B;  1YTZ I;  4PLL A;  3HP9 A;  3MUD A;  2RJF A;  2HYN A;  4BI3 A;  5LL6 S;  1PSE A;  3CCV A;  5GMK j;  5DY9 A;  4XU0 A;  4NL3 A;  1YI2 A;  2IPP A;  3MEW A;  5AYF A;  1UGQ B;  1VIE A;  2QDY B;  1N7S C;  3L2Z A;  3J80 E;  3UPU A;  3OY9 A;  3V7R A;  3SWY A;  5AW5 B;  1JY3 O;  4QVD A;  3BAS A;  3CPW A;  1VQ7 A;  3DLM A;  2DZ9 A;  2PVG B;  4A53 A;  3JCM g;  2DAQ A;  1X79 B;  2F69 A;  4TVR A;  1IC2 A;  1N73 B;  4FM4 B;  1N7S A;  3B5N D;  3OMG A;  2LCL A;  2P2U A;  4IUU A;  2Q7C A;  3FDR A;  3QII A;  1GTW A;  2RHZ A;  3HD7 C;  5GAM f;  4X34 A;  4DQ2 A;  3G4S T;  3KPE A;  3PTA A;  1U1T A;  4PJO G;  3GIB A;  1N8R C;  2X4W A;  3RL0 D;  1N6A A;  4RCB A;  2D6F A;  2QM8 A;  2KMT A;  3PIO A;  2KY9 A;  1YJ9 A;  2M9U A;  3HD7 A;  1LT9 B;  4JLG A;  5CR2 A;  3P7K A;  3M55 A;  3FB9 A;  1BI1 A;  1JY2 O;  3OMC A;  4M7D C;  1S9K E;  2ZPG B;  3HRN A;  4PJO E;  3HFO A;  1HXD A;  1GL2 D;  4A4H A;  2B8A A;  1QVF A;  5I2M A;  4M75 C;  1AHJ B;  1IFJ A;  5AW7 B;  3JCM b;  4OVA A;  5CCG C;  1WT6 A;  2K3X A;  4ZN3 A;  4M7D A;  2FVU A;  2M8R A;  1JMM A;  3HE4 A;  4M75 A;  4Z02 A;  1BKB A;  1N8R U;  3KBG A;  2HPC A;  2WSC E;  2WPR A;  3DLL A;  2JOY A;  3OYM A;  1HBW A;  1SQP K;  2A45 H;  1HWT C;  3OYB A;  5LJ5 f;  3LLR A;  1OZ2 A;  3PNW C;  2XD0 A;  2EQU A;  4KHX A;  2X4X A;  4C5I A;  2BAS A;  1QVG S;  2E12 A;  4F7U F;  2FYU K;  4OH8 B;  3CPF A;  1SQQ K;  5LJ3 j;  1QL2 A;  1NH4 A;  1G3Y A;  4C92 C;  4I6M C;  3TK1 A;  3M9B A;  2R57 A;  4F7U B;  4JS4 A;  4WY4 B;  4C8Q C;  1I5L A;  3VMY A;  3M5A A;  5LJ3 d;  5GAN 3;  4C92 A;  3CC2 T;  1XTG B;  3TNU A;  2KB7 P;  1WQ7 A;  5AW3 B;  4C8Q A;  1KIL B;  3GLX A;  4MML A;  3QO3 A;  4M77 E;  1IFN A;  2E6Z A;  3HFN A;  2M1H A;  3UT1 A;  2LRQ A;  3WVD B;  1FOS E;  4M78 C;  3RMS A;  5FLX E;  1M4Z A;  5KJ7 D;  1P92 A;  2NPS B;  3NTH A;  3U1A A;  2K3Y A;  3PMT A;  3LWI A;  3ZEH A;  1YI2 T;  3VUB A;  4HA8 A;  4J6Y A;  3MEA A;  4O5V A;  1KD1 C;  1FJK A;  4EMG A;  5GAN 7;  5GAN 5;  1RI0 A;  2L89 A;  2WT7 B;  1I81 A;  1T8Z A;  1VQ7 T;  4JF7 A;  4A4E A;  2E1H A;  5L8R E;  3R2P A;  2ZPB B;  2HBP A;  3RES A;  3GNF B;  3BDL A;  1U1S A;  4LDV A;  4N0A C;  4EIJ A;  5GAN 8;  1RE3 C;  1ZR2 A;  4IUT A;  3CCE A;  3CL3 D;  3VJP A;  3G7Z A;  5IT9 E;  2JTM A;  1N7S D;  3M4Y A;  3MHX A;  3JB9 J;  5FRN A;  1IRE B;  3J81 E;  2XZR A;  2HQE A;  4M7A E;  3L35 A;  3JCM e;  3B8E B;  1KD1 U;  2DZC A;  3MD0 A;  2O1K A;  4Q5W A;  1G5V A;  5CQY A;  2LTO A;  1BI0 A;  2XG8 D;  3MCA B;  2LVM A;  1KHI A;  4PJO F;  3HKS A;  2RI5 A;  1G3T A;  5GMK h;  2QM7 A;  2L8D A;  1FJP A;  1YJN A;  4PNO A;  4X9D A;  3QZ9 B;  5EG2 A;  2HAX A;  3HD7 D;  1GD2 E;  3SDZ A;  3MIW A;  2CZ0 B;  1LNX A;  1JCC A;  1QVG A;  3GHG B;  2DK3 A;  1WNL A;  2RI2 A;  2XK0 A;  2HG5 D;  3OYH A;  2ZPI B;  2O01 E;  1RF0 C;  1HJB A;  3S6W A;  5APU A;  3QKJ A;  2LNV A;  1FZC B;  3B5N B;  1B34 B;  2Z5H A;  2W6A A;  2JZ2 A;  5AW1 B;  4M7D D;  3L2W A;  4XTW A;  4I2L C;  1OI1 A;  1JTH A;  3QZ5 B;  4KUI A;  5APY A;  4M75 D;  3HUS B;  5CCG D;  3ME9 A;  3RL0 B;  3OW2 S;  1LTT C;  4C7R A;  2P0K A;  4OP0 A;  2O4X B;  1MV8 A;  4IUV A;  2WSF H;  1WQW A;  4M7D G;  5GAM g;  2HQX A;  2OAR A;  2DTI A;  3OS2 A;  2OYI B;  3FC3 A;  4MZT A;  4M75 G;  5CCH C;  2EQM A;  5I2S A;  2IVW A;  4Y99 B;  3H32 A;  1OXZ A;  3BDU A;  4DOJ A;  1A02 J;  3CCL A;  2F5T X;  1K73 C;  4OB1 B;  3OSS C;  5A0L A;  2MAM A;  5CCH A;  1W2B S;  4DOV A;  1L0L K;  1FOS F;  1NOH A;  2ZPF B;  4C92 D;  3HTK A;  5CKH A;  3BVH A;  4J6X A;  2QA4 A;  5AVV B;  5GAN f;  4JDS A;  4MZP A;  5FU7 B;  3RK2 C;  3FEO A;  1MFZ A;  3OQ5 A;  3FJP A;  1YJW A;  3CC7 A;  4J5Y A;  5A2Q E;  3RUX A;  1QP2 A;  2H8P D;  4EPC A;  2KDS A;  2EQK A;  2YRV A;  4W7Z A;  4C8Q D;  1GW4 A;  4EMK C;  1SP4 A;  4HT8 A;  2K5L A;  1FZA A;  1GL2 A;  3M59 A;  2LKM A;  1VQ9 A;  5LJ3 h;  1HK9 A;  3JCM Q;  5LJ5 g;  4C92 G;  5AW8 B;  4HKE A;  4EMK A;  3EFG A;  3M0D C;  5FRO A;  2RB6 A;  4B9W A;  1K73 U;  3VP8 A;  2LT1 A;  1GK4 A;  4M78 D;  2GUS A;  3L42 A;  3EAE A;  2D0Q B;  4ZN1 A;  2QEX A;  3JB9 I;  3LWH A;  1FX7 A;  3M0D A;  3CCE T;  5CKB A;  1NKZ B;  4KT0 E;  3QXE B;  3V4W A;  2C9N Y;  4QQ6 A;  1IK9 A;  1L4A C;  3BAT A;  4C0D C;  2A7Y A;  3NMD A;  2K2V A;  2LDM A;  3CMA T;  2WPQ A;  1SQX K;  2WAC A;  3KXT A;  1L4A A;  2XV5 A;  4GY5 A;  2N9B A;  3M54 A;  1YIT A;  4L6V 5;  2DXU A;  3CCM A;  4FIB A;  1G2C B;  1FBM A;  2EAY A;  2C0X A;  4F7U E;  1O9S A;  1LTJ C;  4C5G A;  1VQK T;  2X4J A;  4A54 A;  4MDW A;  4N4I A;  3QHS A;  5GAO l;  3OW2 A;  4RG2 A;  4X9C A;  3JAM E;  2DTH A;  4R56 A;  1M1F A;  3M56 A;  2E10 A;  2EYQ A;  3VYG A;  3JCM J;  1LTJ A;  3EQ2 A;  3CC2 A;  4C0G A;  3CBM A;  3F70 A;  3L2U A;  3JCM c;  3M91 A;  1N9S A;  4C46 A;  2HOD A;  1N7S B;  3FIF A;  2JEE A;  2ZCF B;  1NPR A;  3ASK A;  3AHU A;  2VC8 A;  1GW3 A;  2FXM A;  1W2B A;  1CW5 A;  3VV0 A;  2BUD A;  1CSB A;  4L59 A;  5KCH A;  4D6W A;  3OA7 A;  2DO3 A;  3P8M C;  4B86 A;  3J7A F;  3SB2 A;  1T3J A;  3HD7 B;  3G71 A;  2QXF A;  4FT2 A;  4JRQ A;  4A4F A;  3RK3 C;  1LTS C;  3HPW A;  5AVQ B;  3V2P A;  3CCL T;  4L5G A;  3JCM P;  3V7C A;  4OB0 B;  4RG8 A;  5GAN 6;  1OYX A;  1LWU C;  4Y28 E;  1LGH B;  3SD4 A;  5GAM e;  1NAF A;  3E19 A;  2QA4 T;  5GMK m;  2W6B A;  3N7N A;  3C4S A;  4M7D B;  1J1D C;  1NTZ K;  1VQL A;  4P5N A;  2V8I A;  4ME7 A;  1YJW T;  3CC7 T;  3VKI A;  1FXX A;  5AW6 B;  3HE4 B;  2R5A A;  4M75 B;  3C12 A;  5CCH D;  3NXS A;  2RK1 A;  2HPC B;  4MZM A;  3NFC A;  2PAJ A;  1ZR4 A;  4XTX A;  1VQO T;  3H6Z A;  4XU1 A;  1Q7Y C;  2WWW A;  1VQ9 T;  1WJR A;  2WSC H;  4E7J A;  1J2J B;  3L36 A;  3S3M A;  2YO2 A;  3X26 B;  5HKC A;  2XI9 A;  3I55 T;  1SSF A;  1L0N K;  3FLG A;  3VN0 A;  4J7F A;  3RK2 D;  4ZTF A;  1VUB A;  2GCX A;  5BU5 A;  3NFQ A;  2QEX T;  4IKF A;  3JRZ A;  1Y71 A;  2GFA A;  1H88 A;  2Y4X A;  1NKN A;  4JRK A;  3JCM d;  3T9N A;  3II6 A;  5LJ5 e;  3OYL A;  1OZ3 A;  4HCB A;  1FZG A;  3CCR A;  1JY3 N;  5CCG A;  3H8Z A;  4C92 B;  1Q7Y U;  3JB9 H;  3TNU B;  3BRV B;  3X20 B;  1SLQ A;  5GAN 2;  3JSC A;  2MF2 A;  2FB7 A;  1UEB A;  2MWP A;  3PGG A;  3KUF A;  1YIT T;  5M9O A;  3CCM T;  4C7N A;  1ZQ1 A;  1E5W A;  2K5F A;  4WB4 A;  1YHQ A;  4JRP A;  3M4G A;  2P0Q A;  4NOY A;  5GAN g;  5GAO p;  3HRU A;  2VUB A;  1Y07 A;  1L4A D;  2JNG A;  3MEV A;  4FSX A;  4J8O A;  1J1E B;  2QQB A;  2XHC A;  4N4G A;  3CD6 A;  2VXE A;  2WIT A;  1X01 A;  2HNI A;  1D3B A;  2CZ6 B;  4VUB A;  1ZBX A;  2A45 G;  3E1S A;  2Q5U A;  1LTA C;  2K57 A;  4E7L A;  4MDX A;  3ZFJ A;  4ZGE B;  4XU3 A;  2RJE A;  1CI6 A;  4XQ3 A;  5CCA A;  2XU8 A;  5C0M A;  5DLQ E;  2I2L A;  2LQK A;  1N7L A;  2OTL A;  2LX9 A;  2PP6 A;  1JY3 P;  2F5K A;  1QL1 A;  1NJI C;  1JO5 A;  5LJ5 h;  2EJ9 A;  2BKD N;  1CZQ A;  3OS1 A;  1M5Q 1;  3V8K A;  1MZ9 A;  2V8K A;  1YTZ T;  5KE3 A;  2P4T A;  2ZZD A;  3CCU A;  3RMQ A;  4LDW A;  1TH7 A;  3KQG A;  1SFC B;  3OYJ A;  3G71 T;  1NTK K;  2XDP A;  5HY6 A;  4M78 A;  2GM4 A;  1RF1 C;  1I8F A;  1GU5 A;  1N86 A;  5HK3 A;  1K9M C;  1HGZ A;  2Y4Y A;  3VMX A;  2RHX A;  1LOJ A;  5FRM A;  1N27 A;  1JY2 P;  4N78 E;  4ZKU A;  1RF1 A;  4DOW A;  2CPB A;  1NJI U;  4JLI A;  1M1G A;  1VQL T;  1KIL C;  4C5H A;  1URQ C;  2DVE A;  4FU6 A;  1M90 C;  4QVZ A;  1FZF A;  2HD0 A;  4A4G A;  3CBO A;  2C9L Y;  2P1J A;  4N0A A;  4GT1 A;  4BE0 A;  4B9X A;  2Q9I A;  2H3J A;  2O01 H;  1KIL A;  3I56 T;  3RK3 D;  2Z5I A;  1EIF A;  1URQ A;  5J39 A;  1RE3 A;  5FU6 C;  5CHX A;  3WMM 0;  3M57 A;  2PUK B;  1JTH B;  3CMA A;  1K9M U;  4BDY A;  4C5E A;  2OTJ A;  4O6J A;  3GF5 A;  3OS0 A;  4BE2 A;  2M16 A;  1JRI A;  4Y91 A;  3V2N A;  3E1I A;  2VXF A;  3ER0 A;  3I5C A;  1QVP A;  1MHN A;  2YHT A;  4BY6 C;  1VQK A;  3V8J A;  4BB7 A;  4LLH A;  2C06 A;  4QVC A;  1DEB A;  3QYH B;  3OYN A;  3CCR T;  5GAO r;  2FKW B;  3P32 A;  1G3W A;  4W7Y A;  3BY7 A;  1X6O A;  4JRI A;  2MWO A;  3M53 A;  3QSU A;  3H32 B;  5CKD A;  5KE2 A;  2E6N A;  1RF0 A;  1BIB A;  2YKQ A;  3TU4 K;  2GF7 A;  3QPH A;  3OSV A;  3HE5 A;  4ZTJ A;  3HTK B;  1YHQ T;  4NL2 A;  1RY3 A;  1HGV A;  3VMZ A;  3VTP C;  2CYZ B;  3G3Z A;  2K5I A;  3M9Q A;  2EWN A;  3JCM h;  3CD6 T;  5J3B A;  4PJO C;  3RIR A;  3NTK A;  5GMK i;  4W80 A;  3RK2 B;  4LGD E;  1GL2 B;  4LDX A;  3O8Z A;  3A8H B;  2QQA A;  2RHI A;  1X9V A;  3X28 B;  5LJ3 f;  1PFI A;  1FZC C;  3QUI A;  5AVX B;  4EMK B;  2H7H A;  2WSE E;  3OA6 A;  3OYG A;  3SWF A;  3OYY A;  4PJO A;  5GAN e;  4M7D E;  4OGE A;  2OTL T;  3MP1 A;  2DXB A;  4M75 E;  2M3B A;  2JJL A;  3HUS C;  3P8C E;  2IG0 A;  3V7S A;  1YIJ A;  5CJ0 A;  4UC4 A;  3CCU T;  3CCS T;  1NZ9 A;  2LQ8 A;  3INZ A;  5GAM j;  2L3R A;  2GUV A;  3M0A A;  2IX7 C;  2J59 M;  3HUS A;  2JUF A;  4BE1 A;  2GFU A;  2XID A;  2M0O A;  1NWQ A;  3QJ6 A;  1U8R A;  1VQO A;  3OBW A;  1NO4 A;  2YO3 A;  1ZV8 A;  1L4A B;  2J58 A;  2FL7 A;  5GAM d;  1VQN T;  1VQ6 T;  3S3O A;  3VU3 C;  4Y99 C;  2JN0 A;  1XQH A;  3I55 A;  1UGP B;  3G6E A;  3URG A;  5CO7 A;  2FFD C;  2YNY A;  3QDR B;  2WZ7 A;  4C8Q G;  3U1C A;  5APS A;  4OF1 A;  4C92 E;  1IJD B;  4QW2 A;  1H64 1;  2XNX A;  1N2D C;  2FFD A;  5FU7 C;  2VRS A;  3IFM A;  1T3U A;  1LTJ B;  1X8Y A;  4GIF A;  4RKU E;  3MP6 A;  3GOX A;  2DTO A;  5HK0 A;  4M77 C;  1AFO A;  4XTZ A;  1M1J C;  2VGM A;  2E43 A;  5LJ5 j;  4M78 G;  1KHC A;  4ELZ C;  1UGS B;  2OTJ T;  2KP8 A;  4IFM A;  1DX7 A;  4BI8 B;  2HOD B;  3SWN C;  3VYH B;  3UDC A;  2QQ9 A;  3LGF A;  4M77 A;  1KIL D;  1WJS A;  4BI4 A;  1URQ D;  1M1J A;  3HRT A;  2EKO A;  4FL6 A;  2WPS A;  2BIV A;  2KYV A;  5LJ5 d;  4EOT A;  1FZB A;  1BI2 A;  1VDF A;  3SWN A;  3IR9 A;  2RJD A;  4PL6 A;  5CK9 A;  2OYH C;  4ZKP A;  4PLI A;  4N3Y B;  1VQ4 T;  1M7L A;  1LJO A;  2YMY A;  1GK6 A;  4JUV A;  3QG1 A;  4QQD A;  2EJF A;  1NPP A;  2OYH A;  3A8L B;  2K4Y A;  3TYY A;  4XE5 B;  4MMK A;  1Q81 C;  1JJ2 S;  2C0W A;  2N1T C;  3RK3 B;  3PIP A;  3MET A;  1YBY A;  4M7A C;  3UWN A;  1S72 T;  2V8J A;  3X24 B;  1V29 B;  1KG1 A;  1Y96 A;  1Q86 C;  5AVZ B;  3TRE A;  1HH0 A;  2MMP A;  1RE4 C;  2N1T A;  4LC1 A;  1J1D B;  4M7A A;  2R5B A;  1R8O B;  4BD3 A;  1T2K C;  1G2C A;  4IFF A;  3E9F A;  2JVV A;  3CI9 A;  3HL8 A;  4M7D F;  3A5T A;  1RE4 A;  3LX7 A;  4BAC A;  1G1I A;  3DKM A;  4M75 F;  1Q81 U;  3PMI A;  3VOP A;  3WXM B;  5GMK l;  2XDJ A;  2QQS A;  3DB3 A;  5APV A;  2VV5 A;  4JJN K;  2L5G B;  4XU2 A;  2CS7 A;  2CZ1 B;  1YIJ T;  2XIC A;  2R5D A;  1M1K C;  3V5B A;  1S9K D;  1XOV A;  4KUD K;  4PJO D;  1IFM A;  1Q86 U;  5KH6 A;  4AQR D;  1LWU A;  2PUO B;  4LD9 K;  4ATO A;  5APT A;  5AVU B;  3TSI A;  2OAU A;  4HCZ A;  3A8G B;  1JOC A;  5GAO n;  4JYB A;  5AW4 B;  2MJZ A;  3I56 A;  1QW1 A;  5APX A;  2YLB A;  4LDY A;  2PQW A;  3MEU A;  3VP9 A;  2YLC A;  3CXC S;  1G3S A;  1KC8 C;  3C94 A;  3WVE B;  1VQP T;  1KQS S;  1VQ5 A;  3G6E T;  4C7N B;  2XKM A;  2KVQ G;  5AVT B;  3E9G A;  4PKC C;  2XKO C;  5AW2 B;  1N9R A;  3P8H A;  4C92 F;  3A2A A;  1AQ5 A;  3OAK A;  1VQM A;  3L2V A;  3LH0 A;  1M1K U;  2E41 A;  1N73 C;  1WJQ A;  1KFM A;  3U59 A;  3V2Q A;  5A0D A;  4II1 A;  1D3B B;  4C8Q F;  1Y7X A;  4AUW A;  1VQ8 T;  1H3Z A;  2DKG A;  2POH A;  5KTB A;  1GDT A;  3CCJ A;  1DH3 A;  1N73 A;  2PU9 B;  2CKK A;  1LTB C;  2NLU A;  5LJ3 g;  1WPY A;  4CRI A;  1CI6 B;  5GAM h;  3JB9 D;  1KC8 U;  1JBM A;  3V2R A;  5KLV K;  4C8Q B;  2XDB A;  3L1A A;  1LT9 C;  1IO4 A;  4YTL A;  3L2Q A;  4E7K A;  3L37 A;  3ZBD A;  3R6O A;  4M78 F;  2ZGW A;  4J6W A;  4IUR A;  1HUC A;  1H8A A;  3PP5 A;  1JJ2 A;  5CIU A;  1NU1 K;  1LT9 A;  5DLO A;  4HYT B;  2QTX A;  3M9H A;  3QBY A;  4M77 D;  3TCJ A;  5D6W A;  5AVY B;  4M78 B;  3JB9 G;  2PVO B;  1SQV K;  2DXC A;  2RO0 A;  1JY2 N;  5GAN 4;  1Q82 C;  3A8M B;  1FWZ A;  2DXT A;  3CC4 T;  2KQW A;  4FT4 A;  4WF2 A;  2RM4 A;  2DPP B;  2CPS A;  5CKF A;  1RF1 B;  2VYT A;  3L2R A;  3CME A;  4M77 G;  2DIG A;  3RKX A;  3OYD A;  2XU6 A;  5GAN j;  3MO8 A;  4QQG A;  2P7J A;  4N78 D;  5A0G A;  4C0F A;  5CAI A;  3JCM V;  3CCS A;  3FRN A;  1HTL C;  4HH2 A;  4DZO A;  1M9S A;  1URQ B;  1J1E C;  3LID A;  1EQ7 A;  2WTY A;  2DJZ A;  5GMK e;  1YCY A;  5AVW B;  5GAN d;  2X35 A;  4E7I A;  2QI2 A;  1Q82 U;  3CCV T;  4WY4 C;  2E42 A;  2ZPE B;  2RD1 A;  2N1T D;  3JCM X;  4V2S A;  1VQN A;  1VQ6 A;  4NS5 A;  4M7A D;  3LGL A;  5CMZ A;  5FU6 B;  2DD5 A;  5CJ4 A;  4EMH A;  3CXC A;  2GQV A;  1ZN5 A;  4F7U A;  5D6X A;  4M3L A;  2E70 A;  1RL2 A;  4WY4 A;  1KQS A;  3BRT B;  4O9B A;  2KLV A;  4WBA A;  3RKW A;  3OYA A;  4EDU A;  3CEY A;  4LDU A;  3HRS A;  1JNM A;  5DM7 R;  1WRG A;  1GU4 A;  2R5M A;  3UIA A;  1ZLL A;  1T2K D;  3N5B B;  2NPS C;  2RH2 A;  4BY6 B;  3KYQ A;  4M7A G;  2LT4 A;  3X25 B;  2RA2 A;  3OYK A;  1XTC C;  3P8B B;  1JB0 E;  1SFC C;  2R32 A;  5IN1 A;  3LYI A;  4KUL A;  1XTD A;  1VQ5 T;  2NPS A;  4JS5 A;  3HE5 B;  3QJY A;  2FHD A;  2EJG A;  2P0P A;  1SFC A;  3L4F A;  4IUP A;  1HVV A;  1YJ9 T;  3KDP B;  1VQM T;  4R55 A;  1BYM A;  3OYC A;  1LTG C;  1M90 U;  1G1J A;  3EFS A;  2WT7 A;  3OS5 A;  3BFM A;  2W27 A;  3JCM f;  3CLQ A;  4XTY A;  2P67 A;  2CGH A;  1IZ6 A;  1FZE A;  3CCJ T;  1VQ4 A;  4IUQ A;  1W2E A;  3VYI A;  5BU8 B;  3T97 A;  4PJO B;  2KSJ A;  3NTI A;  1K8A C;  4JYC A;  1JUN A;  2RJC A;  1IFD A;  2WSE H;  3VUZ A;  1BI3 A;  3A3Y B;  3V8L A;  2R3C A;  3C95 A;  3DB4 A;  1S72 A;  3OYI A;  5APW A;  2EQJ A;  1QP3 A;  5LJ3 e;  2LCC A;  3P8C D;  3GHG C;  1KQL A;  3CCQ A;  1VPC A;  4DA4 A;  4XAX B;  4HCC A;  1W4S A;  2I1J A;  2E64 A;  1I4K 1;  3S3N A;  3N4X A;  4OB2 B;  2DD4 A;  4XTU A;  2YKO A;  3B5N C;  1K8A U;  3LIE A;  3GHG A;  2I1K A;  4J83 A;  1YYC A;  3JB9 F;  1UB4 A;  2IFM A;  3RKY A;  1BIA A;  3A8O B;  3HHT B;  3RER A;  2O1J A;  2ZFC A;  5AW0 B;  3CME T;  1ZHI A;  3LW5 H;  2Z4E A;  2DIQ A;  3TEE A;  2FYK A;  2RHY A;  1DJ7 B;  1FZC A;  3B5N A;  3M06 A;  4E47 A;  1JCD A;  1B34 A;  2RI3 A;  3RL0 C;  3OB9 A;  3OBY A;  2EIF A;  4BUG A;  2FFD B;  4E7H A;  4OB3 B;  1FDM A;  3GP8 A;  4M77 F;  2QQR A;  1XNI A;  2E5Q A;  3V4Q A;  2KK4 A;  1M8V A;  4RMO A;  2KOG A;  2WSF E;  1GL2 C;  3PT9 A;  2YKP A;  2OYI C;  4BDZ A;  3GNG A;  4AYC A;  2O4X A;  3A5Z B;  4M77 B;  1FU1 A;  4C0D B;  4I1L A;  1M1J B;  3OJA B;  3LW5 E;  4RCC A;  4HT9 A;  3G4S A;  1VQP A;  1GXI E;  3CPW S;  5I21 A;  2OYI A;  2L5Q A;  3SWN B;  4LD6 A;  2VGN A;  4J7I A;  5AVR B;  3QYG B;  1GZL A;  1UGR B;  2Y90 A;  2X4Y A;  3C9I A;  3BW1 A;  3OYE A;  1VQ8 A;  4C8Q E;  4WY4 D;  5GAN h;  4N6J A;  4GLK A;  5CQX A;  3M58 A;  2A45 I;  1IFI A;  2OYH B;  5BVZ A;  2D9T A;  3Q1J A;  2Q3I A;  5CVI A;  2KAF A;  2G3R A;  4ZGD B;  5IAY A;  3GPL A;  5AW9 B;  2FYZ A;  5GAO q;  4KBM B;  4M7A F;  1KZU B;  3PFS A;  2HLO A;  3MTU E;  2AHJ B;  2ZPH B;  3HSB A;  1KFN A;  4XA4 A;  4IFD K;  2IFN A;  1MGQ A;  2ZXE B;  1SQB K;  2LC4 A;  4A4K A;  1A02 F;  4F7U G;  1Y96 B;  4M78 E;  1O75 A;  4ELY C;  2R58 A;  2A3L A;  2DEQ A;  4OGC A;  5CKE A;  2NPS D;  1H89 A;  2N1T B;  5C6S A;  1QVF S;  1NTM K;  4N4H A;  1Z56 A;  1OWA A;  4M7A B;  1YJN T;  1SFC D;  4OMF B;  4ZGJ B;  3MP8 A;  3NTN A;  4XK8 E;  4C0Z A;  1X75 C;  2XDD A;  1FAV A;  5APQ A;  3SFM A;  4CI0 C;  1SVF A;  3H6P A;  1MUU A;  3A7O A;  3CBP A;  2HFE D;  3JCM W;  3CC4 A;  3MGN A;  5J26 A;  3O8V A;  5AVS B;  5GAO m;  5D6Y A;  4RES B;  5KJ7 C;  1NHL A;  4GKG A;  2MI6 A;  2H43 A;  1KQ1 A;  3EFR A;  2RHU A;  1PSF A;  1WGS A;  1VIF A;  5KCO A;  3OYF A;  1NE8 A;  2KSS A;  2E65 A;  1LWU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...