3M9QA

Drosophila msl3 chromodomain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
b'LRDETPLFHKGEIVLCYEPDKSKARVLYTSKVLNVFERRNEHGLRFYEYKIHFQGWRPSYDRAVRATVLLKDTEENRQLQRELAEAAKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein male-specific lethal-3
publication title Corecognition of DNA and a methylated histone tail by the MSL3 chromodomain.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 22
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3m9qA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3m9qA01
4BD3A 3NTHA 2E5QA 4B9XA 2RJFA 3LLRA 3OYBA 2E6NA 2LDMA 2RI2A 1N27A 2X4YA 3LW5H 1NU1K 2LVMA 3LGFA 3LX7A 4A4EA 4C5IA 3L2QA 1OI1A 4PL6A 2RI3A 3SD4A 4A4HA 5KH6A 2DAQA 4IUQA 4PLIA 5D6YA 2EQUA 1SQBK 2HQEA 3O8VA 4BDYA 3NTIA 3LYIA 3KUFA 2L8DA 5D6XA 2GFAA 1OYXA 2YRVA 3MP6A 2LCCA 2X4XA 1WGSA 4QQDA 3M9QA 1XNIA 3LH0A 4CRIA 2L89A 2M16A 3MEVA 4IURA 2K3YA 2LTOA 4N4GA 3FDRA 4C5EA 4ZTJA 4E7IA 2XK0A 3OYIA 3FEOA 1RI0A 2BUDA 2GF7A 3OYNA 4QVZA 3QKJA 2LKMA 3L2WA 4IFDK 3S3NA 3OYJA 4X34A 4Q5WA 2MWPA 3OYGA 4IUUA 1SQPK 5IAYA 2GFUA 3OMCA 3C4SA 3MEWA 2NLUA 2X4WA 2LRQA 1WJRA 5IN1A 3MEAA 4N4IA 1L0NK 5M9OA 1G5VA 3MP8A 4LD6A 3OS1A 1L0LK 3E9FA 2RHYA 2IG0A 3PNWC 3S3MA 2O01H 2WSFH 2BIVA 2M0OA 3OB9A 3QIIA 4C5GA 4II1A 3L2VA 2K3XA 2PQWA 3OYAA 4ZTFA 3L2UA 3CEYA 3OMGA 2O4XA 3PMIA 1H3ZA 2D9TA 3P8DA 4IUPA 2WSCH 1MHNA 3ASKA 1NTMK 4PLLA 2JZ2A 3UT1A 3L2RA 3DB4A 2RHXA 3OYHA 2WACA 2P0KA 3H8ZA 2R57A 3FC3A 3DB3A 2B8AA 3OYLA 4OVAA 2BKDN 4B9WA 3OS0A 3OA6A 4BE2A 3L42A 1NTZK 2WSEH 2CKKA 2EQJA 2EQKA 4NS5A 4BDZA 1WJSA 2VYTA 2JTFA 4QW2A 2EKOA 3MEUA 4IUVA 1KHCA 3OYDA 5D6WA 2R5AA 4E7KA 1SSFA 4HCZA 5CIUA 1OZ2A 2R5MA 4C5HA 3LGLA 1NTKK 3CLQA 5KE3A 5FRMA 4GY5A 2EFIA 4N4HA 5KCOA 2RO0A 3MO8A 4L59A 3FLGA 2RJCA 4BACA 2QQRA 4BE0A 2MWOA 2FHDA 5FRNA 2L3RA 2RJEA 3OYMA 2RHIA 3F70A 2HQXA 3G3ZA 5C0MA 3S3OA 3EAEA 3DLMA 5FROA 2QQSA 5KE2A 3OYFA 4QQ6A 2X35A 3OY9A 4IKFA 1SQQK 2RHZA 3BDLA 3S6WA 3E9GA 3GOXA 1SQVK 3PMTA 2EQMA 4IUTA 3PFSA 2RI5A 3OS2A 4RG2A 4QQGA 2M1HA 3H6ZA 2R58A 4A4FA 4FL6A 2G3RA 3Q1JA 5J26A 2F5KA 2J59M 2DIQA 3OQ5A 3QBYA 3MP1A 4Z02A 5KLVK 3P8HA 2XDPA 3ME9A 3META 4FU6A 4EDUA 2DIGA 3ZEHA 4E7HA 2RJDA 2FYUK 3QJ6A 4E7JA 5KCHA 3OYEA 3UWNA 1OZ3A 4UC4A 5C6SA 2RHUA 3OYCA 3OYKA 4A4GA 4E7LA 2O4XB 2OARA 4BE1A 3NTKA 1WJQA 1SQXK 5J39A
chains in the Genus database with same CATH superfamily
3H1KE 2B87A 2CH4A 4M77G 1WT6A 4I2LC 4RKUE 3MKDA 5FU6C 1QMCA 5I2MA 3G71A 5KLVG 2JEEA 1VQPQ 2EYWA 2KNBB 4M7AG 2KOGA 4Z8AA 5DJTB 5KAFE 4U3FE 1D3BB 1BCMA 4XU0A 4QQDA 1EXIA 2HNIA 4O9BA 1KC8Q 1M1FA 2QJKB 1HXDA 2XK0A 4TVRA 4QT7A 4JRPA 4OB1B 2RK2A 3L37A 4J6XA 2NUPB 2LX7A 2B89A 4GLKA 3OYJA 1NO4A 4Q5WA 1GFDA 2O01N 4PNOA 3H1LD 1KFMA 3RMSA 4DOVA 1Y71A 1VQ7T 2G3AA 1X79B 2WT7B 4Z88A 4L5GA 3CXHD 1M90U 4M77E 2QRXA 2ROLA 1KTMA 2O2OA 2V1QA 1M27C 2WSFH 3OAKA 2BIVA 3OB9A 3GIBA 2NYSA 5GAN4 5KLVE 3VUBA 2XMFA 1KYOH 4M7AE 1JO5A 5D7UA 1N73C 2JZ2A 4GOFA 3RGUA 3UATA 3WVDB 1GU4A 1SP4A 3J81E 1YIJQ 4HKEA 3M0TA 2MCNA 3H8ZA 2B8AA 2RQWA 4H13D 1VQOQ 2NPSD 2XG8D 4QVCA 4DBFA 1FX7A 2CH4W 1VQ4T 3CC7T 3TF5A 5AW1B 3EGXA 2CP5A 1URQD 1ZBXA 2PTKA 3MEUA 4C92G 1YI2A 1IO6A 1KYOE 2KLUA 5B66E 5B5EE 3QDRB 3BCCD 4JRQA 2R5MA 2VB6A 3BY7A 2JOYA 2EFIA 3BFMA 1GXIE 3QHSA 3I55T 4BE0A 2KYBA 1SQVJ 3JCUH 4ESRA 3CC4A 3P8CD 4N3YB 2DRKA 1RH5B 3C12A 1K73R 1HUCA 3KXTA 3L74D 2P1JA 5GAOq 3NGPA 1IRXA 3BDLA 4PJMA 1JB0J 1Q7YC 3Q5RA 2M1HA 3CCVT 3CCSA 1VQKA 1PCXA 5KJ7D 1OIPA 1X01A 2J6OA 3OQ5A 1JNMA 4Z02A 4ZGJB 4HJGH 1Y07A 3META 3JCUE 2QTVA 2LCSA 4AFZC 4E7JA 2F5TX 5KAIH 2Y9YA 2I0NA 4J83A 4I7ZC 4RMOA 2HPCA 1M9SA 3CCUA 1GK4A 4C92E 1B7TA 2ZXEB 4IFMA 3I56A 3TSIA 3CCJA 3NTKA 1WJQA 3OYLA 4IFFA 3GNGA 1WHJA 1BGYG 4J9GA 1GMJA 1QVFO 2WMMA 4Y91A 1VQLP 1E6HA 1MGQA 2N1TA 1LP1B 2ZT9D 1I4K1 3M59A 3CMAA 5DJUB 1JO8A 2BE7D 1NOHA 1SFCD 2HDAA 3H1HG 1L0ND 2A28A 5GANe 5GTIH 3CCRQ 1FJKA 2K9GA 2YRVA 5GMKi 2DVEA 2RH0A 4QMAA 2KAFA 2RMZA 3VN0A 2JS2A 1RLQC 2LTOA 3QG1A 3H1JD 3CPWA 2YKOA 2YXRB 4OMLA 3A0HH 3FGAD 2QAZA 4J6YA 2OAWA 2LKMA 2LT1A 1NJIU 1AVYA 3HKSA 1W2BA 5CCAA 2QA4P 4LGDE 2HEQA 3OS5A 2ZYGA 1EC5A 3MHXA 3CXCS 3OMCA 1JU5C 1V29B 2YDLA 2XKOC 1RE4A 3JCMJ 5GTIE 1N7SB 2C9LY 5HCKA 2ZZDA 5TISH 1HJ0A 1BGYE 1UIIA 3C8VA 2DL8A 2XNDH 2DFUA 5AVTB 1RF1B 5KYYA 3MIWA 2PQWA 5AW2B 2N1TC 3R4YA 3AECC 1S72A 3U1CA 1IZ6A 3H1HE 1UGRB 3CMEA 3A8OB 5CCGA 1VQ6Q 1KK7A 4ASWA 2OX7A 2RHXA 3BVHA 4PJOC 5EFWB 2DRMA 4B9WA 3PE0A 2JM9A 5GAN6 5KYXB 5GAOr 1QQJA 1Q82C 1ZLLA 2B87B 1Q2NA 4M3LA 2DYBA 4TT3H 5KYWB 1U57A 2K9YA 1KORA 4AFQC 2MAMA 3D70A 1VQ7P 4XTWA 2K1AA 4L76A 1R0BG 3MO8A 1IK9A 1D09B 2LXCB 3TGUJ 4MZTA 3CCMQ 5GAMg 1ZXGA 2VKNA 5GMKe 2DEUA 2A06G 3VOPA 4D8KA 1VQPA 1RAEB 1YHQQ 1X0TA 1E6GA 3SB2A 3SEMA 1SQVK 1RI9A 2E5TA 2E12A 4QQGA 2YRDA 2H3EB 2R58A 5AVWB 4NL3A 4PV1D 2NUTA 5CKBA 1SQXJ 2DIGA 3CD6A 1VDFA 1QVFP 5IH2A 1LCKA 4M77C 1T3SA 1G2CA 1PPJD 4MZPA 2JDIH 3OYKA 2FG0A 5A0GA 5GTHE 3V7SA 5CJ4A 3CCLP 3EG2A 1AEYA 3OW2S 1M1KU 2RQVA 4M7AC 4H44B 1UJYA 1LWUA 4HVUA 3OYBA 3Q2YA 2WITA 1N27A 1K73C 5HK3A 4KGZB 4ZNCA 2DZ9A 3EFOA 4EMHA 1OQKA 1LT9A 1N6AA 3C9IA 1A0NB 5KH6A 1ZSGA 2DAQA 4RCCA 2A06E 3MD0A 3EGXB 1JY2O 1L0LD 2BCCG 1GCPA 1FAVA 2V4HA 1OYXA 2IFNA 4CRIA 3LH0A 1JY3O 3RBXA 2QM7A 2IBZI 4IURA 2FBWC 2HG5D 3VMAA 1I1JA 2RA2A 1PD0A 2RNAA 5LL6S 1YJNT 1KQSA 4CC4B 3OYNA 1P84H 3EFFK 1W1FA 4L6V5 1K05A 4IFDK 2PVGB 1JY2N 2Y4YA 4KH1B 4RTVA 1ZR4A 1NWQA 1S3JA 2COZA 1M8MA 4EIKA 2DBKA 1VIEA 1X9VA 5M9OA 3AE7C 3HD7C 1RAHB 1IC2A 3PNWC 2J6KA 3UDCA 3MUDC 4C0DC 4I6MC 5AVZB 1Q81R 2EVRA 1JEKA 4C5GA 2DJQA 1VQ4Q 1P84E 2JP3A 3L2UA 3CC7Q 4MDXA 2Y90A 3J7AF 5AW0B 1G3SA 1JOCA 2LJ3A 2H3JA 1NTMK 1X8YA 3RESA 1EX4A 1SQPG 3MP7B 1M90C 3JSVC 2BCCE 1N7LA 2OTLT 1Q86Q 1MFTA 5BU5A 2E41A 4K11A 4C92C 1K0XA 2QEXT 3GF3A 2KT1A 2CP6A 3GF5A 1M56D 2O88A 4JZ4A 3I55Q 1OVUA 2FYNC 2JKVA 1KQ2A 1V76A 3CXHI 2JTFA 4OP0A 5GAN5 4DQ2A 1ZSZB 1Z56A 5CKDA 1NVOA 4HCZA 2JWAA 1FZCA 4HT8A 1GD2E 2QSIA 3CCVQ 2K4YA 2DILA 3JCMQ 3BASA 3E19A 3OYMA 4J8OA 3SFMA 3HTKA 5CBNA 1BKBA 1NPRA 2YWWA 2E43A 2Q1KA 3OSVA 1U7JA 3VKIA 1M7LA 2X35A 3EG3A 2FPEA 1M1KR 1VQNQ 3V8JA 2K2MA 2F1LA 1KB9H 3FWLA 5GAMd 2R3SA 2Z0WA 1SQPE 3CCRA 5AT1B 3X25B 4XAXB 1ZOYC 3OYYA 1WA7A 2DIQA 1QVGP 4F04B 3ME9A 1NYHA 4E2FB 1QLED 2GTOA 5APXA 5LJ5h 4DOWA 3DLLA 3IQLA 3L75D 2Z5HA 5KYYB 1KILA 4I1LA 2D8JA 2YLCA 2YXYA 1SQXK 1ZHIA 2HKNA 1IXDA 3CX5I 3UIAA 1W5CE 1LT1A 4GOEA 4L75A 1HSQA 3EFGA 4AMCA 1GW4A 2DO3A 2EBPA 2KEAA 1M8VA 3EFSA 2XV5A 1YJ9T 4BDYA 5APSA 2LR2A 3WMM0 1FMVA 2L8DA 3L72G 1SFCC 1KIKA 2X4XA 1IFDA 5J3BA 2LX9A 4XK8E 4PJ0E 1VUBA 3AEAC 3URGA 3L2WA 2ZPHB 2FFDA 5LJ5j 1GFCA 1VQLA 3LWHA 1IK7A 4J7IA 1NYGA 4O6JA 1SQBG 1RF0A 2D2CB 2GM4A 3OA7A 2WWWA 1NJIC 2H8PD 3CPWO 1X2QA 1GL5A 4J5YA 3H1KJ 2YLBA 3HRNA 5GANh 4CPGA 4D8DA 1U1TA 2LP5A 3CCMA 4IL6X 4RKUJ 1VQ8T 1BCCD 2FPDA 3CBOA 2NUTB 5AW4B 1OU8A 1QX8A 4C8QG 2KK4A 2COWA 4FW1A 1YHQA 1G2CB 1WYXA 1FS0E 4M78G 5M1BA 3I9QA 1Y0MA 4PFOA 2QA4A 4U3FJ 2P0KA 2EYZA 2YKPA 3C1LA 1QCFA 3S1KA 4PD4H 2E4HA 1LWUB 1SQQD 1UG1A 2EQKA 3KDPB 3JB9I 3EFOB 3FRNA 4E7ZA 3G4ST 1LT9B 2VXFA 3B5NA 2JUFA 1YJWP 4KULA 4DT0A 5HKCA 2RO0A 4L74A 4LDWA 3QWOC 1EFNA 2PU9B 3X28B 2X9HA 5FU7B 3G6EP 3SWNA 4HA8A 2HCKA 2RB6A 2FZCB 4WY4C 5KLVJ 4M7DF 3K5BA 3VS1A 2COYA 4C8QE 1NAYA 3VRZA 2XKMA 3OS2A 1BE3G 2FVUA 5GAOn 3H6ZA 3VTPC 3GHGA 2QEXP 1VQ9P 3HTRA 4M78E 4LDYA 3V7CA 3INZA 1RAIB 4RJTA 4H0LB 4PFZA 2OYOA 2ZPFB 2O3JA 4N78E 1VQ7A 1PZQA 3CCQP 2E5YA 1T0JA 2ZAEA 1U7MA 3QZ5B 3JSCA 4ZN1A 2LMJA 1OZ3A 4F7UG 1ZW0A 3L35A 3M0DC 2WSFJ 4HH2A 1N5ZA 2GNCA 2ABLA 1GTWA 4E7SA 1BI2A 1I5OB 1Y7XA 1RHZB 2DPPB 2OYIC 5AW3B 4M75A 1Q7YQ 4HKZH 1LNXA 4RG8A 4A53A 2E6NA 3F5HA 2D0QB 2LVMA 1YJNQ 3M9HA 1RY3A 3TDKA 2FYUJ 4WCIA 2FYKA 2WPVB 2M3EA 1K9MR 1VQ4A 3KHUA 1M1KC 3CC7A 5FW9A 4BRYA 2FL7A 3JB9F 1JUNA 3V2PA 1QVFA 2DL4A 2J05A 3QWYA 2JN0A 2CSQA 3PTAA 1BE3E 1ZA2B 1OFCX 2HL3A 4JBZA 1IREB 1YFNA 4ZTJA 1IHWA 4OGQD 1FZCB 1ZUUA 3NFCA 2M8RA 4JJBA 2F2WA 3I55A 1NU1G 1VF5B 3ZL7C 2VGMA 3NXSA 5AVUB 2MWPA 3L70D 3HTKB 3V4QA 2POHA 4D6TG 4F7UE 4CI0C 1MFZA 5IN1A 3AE3C 1L4AD 4IL6H 2DTIA 3C94A 3MP8A 5KKZC 2YUNA 1AVOA 3Q3DA 2DL3A 5L8RJ 2E5KA 2OTLQ 2RHYA 3THKA 2WSCE 1ZMEC 3CCVA 2OTJP 1AT1B 2O31A 4X1VA 3L2VA 3REBB 1QP2A 2K3XA 5FWCA 4R0KA 3C0CA 3VV0A 4GKGA 2R5BA 2HQHA 4KJMA 2N9YB 1WIEA 2C06A 1E79H 2WACA 1KILB 1CW5A 2ESWA 1QKXA 2FEIA 2B9BA 3WXMB 3L42A 4OB3B 4EMKC 1DJ7B 1MMGA 4NS5A 2Y0EA 4AFSC 1U5SA 1NU1E 5HY6A 3TREA 2BEQD 5CMZA 3CWBD 2PGDA 3ZDMA 4D6TE 4OVNF 2ZXXA 2MMPA 2GQVA 2RF0A 3IF4A 2RJCA 1YWOA 1G2BA 2K3BA 2FHDA 2L3QA 3TCJA 3OW2O 4LLHA 3G3ZA 2HQXA 1BGYJ 4Z89A 1OX8A 3SWFA 1Q82Q 2EAYA 2PUOB 3OY9A 1PG5B 2FFDB 2QI2A 5GAOl 3V2RA 2EQMA 4XA4A 3RIRA 1LPLA 3MTUE 3H1HJ 4EI2A 1NTKG 2HBPA 2W90A 1MMAA 4LNPA 2G3RA 2F5KA 5KLVK 1JJ2S 2ROTA 3CXCP 1YQ4C 2RJDA 4RTTA 3OYEA 3JCMW 5C6SA 2M0BA 3G4SP 2A45I 1FDIA 1D1BA 4A4GA 1PHTA 1YJ9Q 2W8ZA 2MPXC 1LTBC 3PRJA 5J39A 1ZQ1A 4M78A 2AXCA 4B9XA 1J2JB 1PRLC 1NZ9A 2X4YA 4C5IA 3V6IA 2FRWA 2ZFCA 1V1CA 1UE9A 2Q7CA 2EQUA 2CYZB 3A3YB 2HQEA 4J9IA 5D6YA 3X20B 1M1JC 1Y8AA 1QCNA 3M58A 3KUFA 4CC2A 1LTTC 1HBWA 4C7RA 4BI8B 3PJSK 3B5NB 1NTKE 1GL2D 5KAFH 4E47A 3FWNA 2EIFA 2HMAA 2IBZD 3BRVB 1UGVA 4A4KA 3L71G 1ABOA 1R8OB 1K73Q 1EZVI 4X34A 2V8JA 2E6ZA 3VU3C 4DEXA 1VQ8Q 1AA0A 4AYCA 3SWNB 5CCGD 3JCMh 2NLUA 4ZGDB 5GAN3 3BATA 2P4TA 1G5VA 1PRMC 4C8QC 1N73A 1T3JA 3A8LB 3AE6C 2LNVA 4M78C 3GHGB 2O1JA 2K5FA 2IPOB 2E65A 2F69A 1E5WA 3VYIA 3E2UA 2QJYB 4JRIA 3RK2D 1JMBA 1LOJA 4F7UA 4PLLA 4C0FA 1MV8A 3CD6Q 2J06A 2E3HA 4XTYA 1BSHA 2DM1A 2XZRA 2L5QA 3QH9A 4O5VA 3OS0A 4BE2A 3RK3B 1Z9ZA 4M75B 4DOJA 2D2CD 2NWMA 5LJ5f 3L71E 1NTZD 3OW2P 2JR8A 3VP8A 3SWKA 4ZGEB 1PP9J 3OYDA 3CCEP 1FZAA 2DTHA 5CIUA 2KQWA 1OZ2A 5AVSB 1FOSF 4X9DA 4PD4I 4GY5A 4BRYB 1M90Q 2FYUD 2OQQA 2DKGA 3H1LG 5B5EH 5B66H 3O6QA 2JT4A 2RPNA 3F70A 1E7OA 2OJ2A 1IFMA 1NTZG 4JYCA 1YJNA 2E75D 1EZZB 2KT8A 4AUWA 2VUBA 3L4FA 1AWOA 1H3HA 2CS7A 2UWJE 2YMKA 1K8AR 4BUGA 1LTJC 5GMKl 2E74B 1YNZA 2Y4XA 2BTTA 2LC4A 1T2KC 2HL5C 1QWEA 2BCCJ 2PNIA 4QKUA 3RL0B 2DW3A 3E1RA 1M30A 3FIFA 4FU6A 2XDPA 1B07A 3CC2T 2PUKB 1MMNA 1BDDA 2YUOA 2DJZA 3QJ6A 3HRSA 3RBZA 5LJ5e 3CCLT 4KUIA 2W10A 1BB9A 4FT4A 1GRIA 4OMOA 5D6XA 1N9RA 4HCKA 2YHTA 4A4EA 2AEMA 3BCCG 2RD1A 2OTLA 5GANf 3H1LE 2DMOA 2JS0A 2QEXA 1RABB 1NTZE 3CX5D 3LWIA 5CHXA 3CXHE 4H0LD 2CSIA 3O8VA 2KVQG 4DBHA 1H92A 1PWTA 1JQQA 3L74G 5KLIC 1CZQA 1W2BS 1FDOA 3PVLA 2QQAA 2QVAA 5CO7A 1XNIA 4ELYC 4HYTB 1HWTC 4UB6E 1SQPJ 3FDRA 1WMKA 1WXTA 4ASVA 1XJWB 4OGQC 3QXEB 3TSWA 4LDXA 2V8KA 1T3UA 3L73J 2KLVA 4XTUA 2ED0A 1T6AA 2FXMA 4B6MA 1LTSC 2JO1A 4M7DD 3QPHA 5GJVB 4OGCA 1X6GA 1RAFB 3GG2A 2IG0A 1ZA1B 2VC8A 1L4AC 2QQ9A 1QP3A 1S4XA 3BCCE 4EDFA 4PJOA 3E1SA 4DJGA 2QGFB 4LUDA 2BASA 4Z1MH 3KBGA 2C9NY 2D9TA 1B34B 2HBWA 4KGVB 4M7DG 3P8CE 4C7NA 2WTYA 5FU6B 1VF5D 5LJ3g 3L74E 3DB3A 4GBQA 1GZLA 4PK4A 1KHIA 1L0NG 1TU3F 2C0TA 1Y9BA 4EIJA 3EQ2A 3S4RA 1NJIQ 2QJPC 2C0XA 4IIOA 4ZNXA 3ZBDA 3QWXX 1OXZA 3CX5E 2DXBA 1LNQA 3H1JG 2OYHA 5EC7A 3P8MC 1NTMJ 2DTOA 2DZCA 1CSBA 1FDMA 1IFNA 2BE9B 3JB9D 2ECZA 3UA7A 1YJ9A 3T97A 3SFEC 1BYMA 2QQRA 2XU6A 1TOVA 1AOJA 3N7NA 1ZV8A 4ZN3A 4R55A 3A0BE 1ACMB 2K5LA 1YTZI 1HJDA 2RHZA 4J9BA 1N2DC 1RACB 2HZYA 4M7DE 2EW3A 3B71A 4M77A 2E42A 1HTLC 3H1ID 5AVXB 1VQLQ 3QYGB 3SWYA 2YSQA 3L72J 1PC0A 1Q81U 2HKQB 2LXBA 1L0NE 2B86A 6AT1B 2NUZA 4M7AA 3TNUA 3ZEHA 1N73B 1TU0B 4KT0E 5KCHA 2QM8A 1S9KD 5BVZA 4LDUA 3P7KA 1QWFA 3CL3D 3H1JE 3U1AA 2RHUA 5AVVB 3EH2A 4OGEA 3WU2H 2OYHC 1VQ8A 4XQ3A 3H1IG 2OARA 2YO2A 5IT9E 1VYUA 1SQBJ 2RJFA 2GA1A 2E76C 1RAGB 5GTHH 2KSSA 2ZGWA 2V7QH 5H2FH 2QA4Q 3Q5SA 1KQSS 1IHVA 4J9FA 3WU2E 1M2VA 1XOVA 2K79A 1OVVA 1HH0A 3G4SA 1PGOA 2Y0CA 3MEVA 2P84A 4J9DA 3GOXA 3CC2P 5ECAA 2GF7A 4QVZA 1PP9D 1L2PA 2I1KA 1GL2C 3HD7A 3HE4A 3JCMb 5H2FE 1WX6A 1QVGO 3O6QB 4EYYQ 3MUDA 1IB8A 4ZKPA 4IUUA 1SQPK 1A02F 2H43A 2RQTA 3OJAB 1M1KQ 1HYOA 3H1IE 3M0SA 5APVA 4FYWB 1PPJG 4I7ZB 3S3MA 4DCKA 3H25A 2O01H 4A63B 1CKAA 3QIIA 3VS6A 4C92A 1S9KE 1DIPA 1G1IA 1J1DC 2VWFA 1AWWA 3B5ND 5LJ5g 1AD5A 1VQ7Q 2NRGA 2KRNA 1OMIA 3PIOA 1DEEG 2KMTA 2LQNA 3VMZA 2Q6QA 3Q5PA 3RNJA 2J5UA 1I81A 3OA6A 1BE3J 1L0LG 3HFNA 1JY3N 5AW6B 2WSEH 5LJ3d 3II6A 1QW1A 4N0AC 3MZWB 4K3AA 2O01E 1SQVD 5CCHD 1KQLA 5AVQB 1YJWT 2PRRA 1RE3C 3MHVA 2QYZA 1N8RU 3VYHB 4C5HA 3CLQA 2KZIA 3JC22 3G6ET 4PJOF 2H88C 2FO0A 3GF7A 4ANJA 1BU1A 1PPJE 3GNFB 2CZ6B 3IAOA 1PGQA 2OI3A 3B8EB 2HPCB 2WSEE 3M56A 1UEBA 3CC2Q 2A3LA 2DLPA 1VQ9T 3E1IA 2E75C 2M02A 3CCLQ 1C0MA 4BY6C 8ATCB 2GUSA 2KGTA 4M75D 2IFMA 2QIWA 1KYOI 1OWAA 4H13C 3OW2A 2NPSC 3CCQT 1H8AA 3NTNA 1BDCA 3W68A 5J26A 5K5GB 2N1TB 5AVRB 2CPSA 3V8KA 2FZKB 4P5NA 3VS2A 1L0LE 1WHKA 1URQC 4EDUA 3L73D 4E7HA 3H32A 3AE9C 3TK1A 5GANg 4R4LA 1GBRA 2YIUC 3BDUA 4JLIA 4Y99C 2RN8A 4J9EA 1NU1J 4PJOB 2A0FB 2ZYAA 3JCMf 1YIJA 2PVOB 3LH5A 1NKNA 4D6TJ 2DE0X 1G3TA 1M3AA 2PP6A 2LDMA 1SFCA 3CPFA 4W80A 1DD4A 2CUDA 1GBQA 4M77F 1BBZA 4IUQA 1SQBK 2H8HA 3RL0D 2V8IA 1HGZA 1RLPC 5KJ7C 5TJHA 4M7AF 1JB0E 4AG1C 3M9BA 1A02J 2EJFA 1NE8A 1WPYA 3T97B 1LTGC 1RQVA 4LE9A 7AT1B 4RO0A 4HVVA 1NTMD 2KE9A 1DEBA 5GAMj 3NMDA 4NPFX 4PJ0H 1K1ZA 2JXBA 3W67A 1YITP 4RTYA 3GW6A 4QVDA 4DBQA 1EZVD 1VQMP 1N86A 3JCMe 4WWIA 2JTEA 3MEAA 1UUEA 2OTJT 2OTKE 3L75G 4M7DC 2AHJB 1R0CB 4M77B 2ZT9C 5DM7R 1KJWA 4MDWA 2FXPA 3NMZC 3EFRA 2HSPA 4HT9A 3RUXA 1N8RR 2YT6A 4FT2A 3PMIA 4R4MA 4M7AB 3TNUB 3J80E 1GCQC 2E64A 1M1GA 3MCAB 3U23A 2YO3A 1JJ2P 3FC3A 2H89C 3MJXA 2DA9A 1NH4A 4FSSA 2LQKA 5LJ5d 3UF4A 4BI3A 3AT1B 1NTKJ 1ZP0C 3G71P 2AKLA 1K9MU 3TGUD 3D6ZA 4DEYA 4IUVA 1KHCA 3BE3A 1EIFA 1SSFA 1OW8A 2KZJA 2M51A 2E10A 4WY4A 2KRSA 2QG4A 1MMDA 4C92F 1YQ3C 4YTPC 3L75E 4XU3A 3E7KA 5AVYB 1M2VB 1VL2A 4PD4D 2GGRA 3R6OA 1HVVA 5APYA 2ZVNB 3REAB 1DX7A 1G3WA 3JCMc 1T0HA 1SQXD 1NYFA 3HD7B 2FB7A 1WDXA 3C95A 5GAN2 1HF9A 2P0PA 4C0DB 4RG2A 1BCCG 3M0DA 1EDIA 1BK2A 1N7SD 4WBAA 4FL6A 3AEDC 1KSWA 1J1EC 2MI6A 2OYIA 1CKBA 2I8DA 1UDLA 3UWNA 3HP9A 3L71J 1N9SA 2DXUA 4C92B 2P4RA 4IIMA 1Q81C 1SQQG 2K9JA 3CBPA 1MZ9A 2FYNB 5GANd 3NTHA 2EJ9A 3A5TA 1W4SA 1YP5A 4GT1A 2DEQA 1C6VX 1NU1K 1OI1A 1R8EA 2XDJA 2ZCFB 1XTGB 3OBYA 4XE5B 1CSKA 3KXDA 3HUSA 1PD1A 1YI2P 2RN0A 3VMYA 2AIRB 2JMCA 2MF2A 3MP6A 3KYQA 1W70A 3A8MB 1BCCE 4RCBA 4PV1C 5IXBA 3CC4P 5E79E 2QQBA 4EMGA 4FM4B 2VV5A 4XFJA 1ZR2A 1X6OA 3JV3A 1ARKA 2KI7A 4GODA 4DBRA 1WI7A 3A1PA 2MYSA 1SF9A 2GQIA 2GFUA 1KD1U 2V1RA 1JXOA 1WJRA 1OVRA 1SQQE 3EGUA 1PKTA 4VUBA 3CCSP 1VQKP 1BSNA 2QGGA 2K6DA 2EYYA 3HRTA 3V2QA 2MJZA 1UIXA 1VQOT 2E3IA 1WHGA 4AFUC 1SPKA 4EMKA 3P8BB 1H3ZA 3CC2A 3CCUP 2A36A 2DL5A 2WSCH 3H32B 4IUPA 1YJWQ 2XU8A 2VVKA 3I56P 3CCLA 3HUSC 1HJBA 3CCJP 3A98A 4H44D 3RKXA 3UA6A 3G1JA 3G6EQ 1TUGB 4OMFB 1VQ5P 1C1AA 2LNHB 3M57A 4ME7A 3CCET 1PL5A 4BWNA 4XTVA 5FWBA 3TVTA 5I11A 1SFCB 2BZYA 3CMAP 3V2NA 3SSUA 2C0WA 3HRUA 1P84I 1MNDA 5A2QE 2C0IA 2R5AA 4E7KA 3EG1A 1VQ9Q 2QEXQ 1NTKK 4L59A 3L70G 1NPPA 3FLGA 4BACA 2CREA 2PAJA 2IZ0A 3CCQQ 2X3XD 5CKFA 2FKWB 4HXJA 2R5DA 1N8RC 3U59A 1D0ZA 3DLMA 1W2BP 3BCCJ 1UB4A 2JNGA 1WFWA 2QJKC 4WB4A 4LD9K 3S6WA 4AT1B 5APQA 1LJ2A 1M3BA 3KZIH 3SFDC 2RI5A 3JCMg 4FSXA 5GAN8 2KB7P 2SRCA 3L74J 2EYQA 2DX1A 1I5LA 1S5LX 2CK3H 1U1SA 3A7OA 1PNJA 1NEBA 1KG1A 3PP5A 4UB8E 1S72P 3R6NA 2W27A 1JTHA 1VIFA 3CMEP 2RK1A 4JPBW 2MKVA 1D7MA 1AZGB 2DF6A 3O5ZA 4RESB 3KZIE 4AQRD 1OEBA 1M1JA 3P32A 4NL2A 3CWBG 3L70E 3T9NA 2HLOA 1O75A 1ZRTD 4GLMA 3RKYA 3M0AA 2W83C 3FB9A 5CKHA 1KD1R 2CPBA 1VA7A 3H0IA 2F2VA 2G6FX 2L3SA 2N1TD 4MMLA 2GFAA 4MZMA 1WGSA 1USDA 3M9QA 1AV1A 4YXDC 1KB9I 2K3YA 3JRZA 2OTJQ 2HFED 4X9CA 4PJOD 4WY4B 1TXQA 5FLXE 1Q7YR 4PJJA 1L0NJ 3H1KD 2MK5A 4C8QA 5CJ0A 2WPQA 1VQPP 2P10A 4KUDK 4KT0J 2ZVOB 2HODA 3V5BA 1AZEA 1K8AU 5IAYA 4OMMA 2X4WA 4B86A 3H1JJ 2LRQA 1JMMA 4LDVA 4N4IA 1QGKB 2ZPGB 4LD6A 3QYHB 3L36A 1VQ6T 2L2PA 2X4JA 1QVGA 3CWBE 4U3FD 2JM8A 1NAFA 1GU5A 1EXJA 2M0OA 4FYVB 4II1A 1EQ7A 2M9UA 3OYAA 2AZVA 3OMGA 1IFJA 5CKEA 2OYIB 1I0CA 5IHNA 2DD5A 1AQTA 1X43A 1UGQB 4M4ZA 2K9JB 1UECA 2KNCA 2YUPA 3JAME 1ZRTE 1NTZK 2B88A 2GCXA 4M75F 2EQJA 1U3OA 1WQWA 4BDZA 4QW2A 3TU4K 2V7QJ 4M77D 2IYOA 3RKWA 2IBZG 1S1NA 4KHXA 2KYVA 2VGNA 3X24B 3QSUA 3M55A 5KLVD 2FPFA 1K9MC 1YIJP 4L73A 5GAN7 4KBMB 1KQSP 4M7AD 4JUVA 5FRNA 1LTJA 1ZN5A 1O9SA 2ZAEB 4A7PA 1VQOP 5C0MA 3S3OA 3G4SQ 1BI3A 2K2VA 1SVFA 1PV3A 2D1XA 3QO3A 2KBTA 5KKZB 3L1AA 2KI7B 5KYWA 2P7JA 3HSBA 3AE1C 3MGNA 4YPCA 1S5LH 2AEJA 1PIXA 1H8KA 1LVKA 5APWA 1SLQA 3AE2C 1KYOD 1IGUA 3P8HA 1KC8U 1N7SC 2L91A 1M3CA 2C0OA 4XU2A 3JCMd 4UC4A 5GAMe 2O01J 3VRYA 3S9OA 1Y57A 3Q1MA 4J9HA 4F16A 1RF1C 1Q82R 1OW6A 2IBZE 4EMKB 1UGPB 2JTMA 1MNEA 1S5LE 1R77A 1LTAC 4TLFA 1JXMA 2FYZA 2E5QA 3LLRA 4Y92A 2WQYC 4A54A 3B4SA 2E70A 3PLNA 3HD7D 1H0TA 3M5AA 1NLPC 1TSFA 2A7YA 3QUIA 1AHJB 4RUGA 4A4HA 4BI4A 2O1KA 3UPUA 2R44A 2FYUG 4RTXA 4PLIA 2WSEJ 1RQUA 4WF2A 1AWJA 3D6YA 1YJWA 4ZKUA 1SKUB 3QJYA 1PFIA 3A8GB 2PVDB 2L5GB 2YMYA 4JJCA 3CXHH 5L23A 2XHCA 2WPRA 4C92D 2IDBA 1OPKA 3G6EA 2AT1B 2X3WD 1L0LJ 2P2UA 1FMWA 4UB6H 1L4AA 4OB0B 1OOTA 2K3RA 1USEA 2GUVA 1XQHA 2EGEA 2WSFE 1FWZA 1CI6A 4J6WA 3CCRP 1M57D 3RMQA 4XU1A 1L0NK 1VQ9A 2V26A 5C39A 3PH0A 1ZUKA 3CPWS 3E9FA 1FYNA 4D6WA 2XNXA 3I35A 3CCQA 4EOTA 1KD1C 2A37A 3BRTB 4MMKA 3CCEQ 1DH3A 1UJ0A 1ZLMA 1IO4A 2FYUE 1UHFA 1MHNA 1UGSB 2OAUA 1K04A 3IR9A 3A2AA 4R56A 1OPLA 4DA4A 3OYHA 3ITKA 3NPFA 1JTHB 4FCYA 4C8QF 3VS5A 2IYPA 3H0HA 2LZ6B 4M78F 3AEGC 4H44C 1M1JB 1M8OB 1WJSA 2LQ8A 5CVIA 1SG5A 3OSSC 1FMKA 1YCYA 1BGYD 1AJYA 2KS1A 2LT4A 3GP8A 3EHRA 3CX5H 4PFPA 5CQXA 1VQNT 1UHCA 4N4HA 1KC8R 2MOXA 2KUBA 1VQ6P 2KYMA 3CBMA 2YNYA 3AE4C 1QKWA 3H1HD 2F2XA 1PKSA 3HL8A 5L8RE 1EDLA 2E1HA 2AK5A 2CT3A 5KE2A 2XIDA 2J58A 1VQ5A 1QVPA 4IKFA 4C8QB 1P92A 2DYIA 3PMTA 1ZSZA 1YCSB 4M78B 1H89A 3A0BH 2HODB 1HD3A 5KAIE 1SEMA 1ZX6A 2DD4A 1FJPA 2W0ZA 2J59M 3CQTA 5KTBA 1Y47A 1MV0B 1U8RA 2OTJA 1M90R 1RADB 1HGVA 2PFXA 1VOMA 4F14A 3CCMP 1MUZA 4HCCA 3ULRB 2CZ0B 1PM3A 2KY9A 3AEBC 3GLMA 5AW5B 1YHQP 3A5ZB 2NZ2A 1NLOC 4F7UF 5I22A 2SPZA 1KILD 1X27A 1EDJA 4NPEA 5IXFA 2RI2A 3LW5H 3LGFA 3JB9G 3L75J 1SSHA 1D1AA 2KNCB 2ED1A 1OULA 2YUQA 3A0HE 1GL2A 3WUTA 1YYCA 3H0FA 1TG0A 3EG9A 2KSEA 4C0GA 2Y0DA 1Q81Q 2LJ0A 1ZSZC 4C5EA 1JBMA 1GDTA 2Z5IA 1KFNA 2BUDA 3JB9H 1JM0A 3QKJA 2AKKA 3LW5E 1YITT 4ATOA 3S3NA 1VQMT 4ELZC 1LTJB 2CP0A 4F7UB 2IZ1A 5TISE 2Y9ZA 3NHNA 2CGHA 3D71A 1H641 1QEXA 2QE7H 2BEZF 1LGHB 2A06D 1L0LK 1I8FA 2IPPA 1TUCA 4C46A 2XICA 2QASA 3HFOA 3CXCA 1K8AC 2P67A 4Y28E 4HCBA 2QXFA 4OMQA 4YTLA 3PIPA 1RE4C 3L2ZA 3NFQA 2O4XA 4CC3A 1TWBA 3ASKA 3EHQA 4N0AA 5AW9B 2EQIA 2VXEA 4WY4D 2HR3A 5DLOA 1FXXA 1RE3A 4FIBA 2R57A 4C0ZA 3G71T 1KILE 4NPDA 4OVAA 2BKDN 1BCCJ 2L0AA 1R5SA 2KXPB 1FC2C 1TS9A 3I5SA 1NM7A 5KLIB 3EH1A 3ABVC 5CCGC 2EKOA 1VQ4P 3VMXA 2JW4A 1H0TB 3CC7P 1PP9G 4NOYA 3WUUA 1P84D 1JCDA 1LJOA 5KCOA 4KGXB 4OGQB 1SQQJ 5LJ3h 2P58A 2LJ1A 2MWOA 2JJ9A 1XTDA 1LTIC 2RJEA 2RHIA 2NPSA 1KQFB 2BCCD 3I55P 4FYYB 5FROA 2KDSA 1NJIR 3RK2C 4JYBA 2DK3A 2WSSH 1URQA 2EGCA 3E9GA 1D0XA 4DZOA 3PFSA 1L4AB 2QDLA 2ZPBB 3H9NA 9ATCB 1WXBA 3JCMX 4A4FA 3GMAA 3Q1JA 2I1JA 4FW2A 2D2CC 1CI6B 3CCVP 3JCMP 1PSFA 2Z4EA 1M2OA 2KXCA 2DETA 3LIEA 3RERA 2W6BA 1N8RQ 1RUWA 4HVWA 1B3QA 4CC7A 2JMAA 1VQOA 4ORZA 1M5Q1 3I5CA 3EGDA 1TH7A 2QJPB 1VQNP 1PP9E 1SQVG 5I21A 1KC8C 4K35A 2WSCJ 1MUUA 4BD3A 4KRTA 5LJ3j 2ZJSE 5DLQE 2KP8A 2JWDA 1G8XA 5KJ7A 3RK3D 3L2QA 2AEFA 1YI2T 5APTA 3VS0A 1SQPD 5KYUA 1D1CA 3SHWA 1W2EA 1KQGB 1GW3A 3CCEA 3NTIA 1LWUC 2KK7A 1IZNB 1TTHB 3CC4T 1FZBA 4HB1A 3QZ9B 1YN8A 2EKHA 2KS1B 2M16A 5GAMh 1LT9C 1Q86U 3PGGA 1YTZT 2WZ7A 3M4GA 2EWNA 3WVEB 3OYIA 4M75G 1KN7A 3R2PA 1KB9D 2DXTA 1T8ZA 2O9SA 1ZBJA 4M7DA 3V4WA 4J9CA 3TQ7P 3H6PA 2HD0A 1J3TA 2FXOA 3TYYA 3PVQA 5FU7C 1NKZB 4C7NB 1I07A 3HHTB 3CCST 2K5IA 1VQKT 1FZFA 3C4SA 3MEWA 3L73G 4GIFA 3VS4A 2ATCB 3KPEA 1SQVE 1K9AA 3OS1A 1GCQA 2BZ8A 2E74D 1UFFA 2RMOA 3EG0A 2M3BA 2KXDA 2PZ1A 3CCUT 3PTZA 3L70J 1FZEA 3IFMA 1X22A 2A45G 2OYHB 4H0LC 1NGMB 3I56T 3CCJT 2XDDA 5APUA 1SHFA 1XTCC 2RQRA 2D0NA 4J7FA 2DERA 2Q9IA 3UT1A 2E76B 3X26B 1VQ5T 1UTIA 1RL2A 4KH0B 4IOIH 3CMAT 2K37A 3RK3E 1PGPA 1WNLA 4JS5A 4M75E 2A45H 3M4YA 2D6FA 5IHKA 5GAOp 1JRIA 3M0QA 2CZ1B 1Q90D 1PGJA 1IJDB 4WVZA 3HE5A 1Y96A 1RAAB 1NTMG 2XD0A 3L73E 3QDFA 3SDZA 1GL2B 1SS1A 3EG9B 2GTJA 1EZVG 2L3RA 1JCCA 1KB9E 4LC1A 1WZOA 2LQWA 3CWBJ 3L72D 1JY2P 3EAEA 1F1BB 1FZCC 3OYFA 1G83A 1SQQK 2A08A 1JY3P 2J7IA 8AT1B 1Q95G 1VF5C 1T3LA 2JJLA 1HK9A 1KV4A 1YWPA 2IVWA 3CI9A 4YXWH 1J1DB 1PSEA 1WQ7A 2RQUA 3MP1A 1K9MQ 2QG9B 4OWFA 1S72T 1FE6A 1SQBD 1VQ6A 1VPCA 3CMET 2DXCA 1FOSE 4JJNK 3RK2B 2K7AA 3OYCA 2AXTH 4E7LA 2WPSA 3FJ5A 2O4XB 4BE1A 1Q86R 3TGUG 2JVVA 1NTME 3EWKA 2OGUA 2R32A 3ER0A 1BI1A 2EGAA 3MPUB 5HK0A 3KQGA 4C8QD 1EZVE 3HE4B 1KILC 5AYFA 2IIMA 4PL6A 2KIKA 3PHLA 2RI3A 3M54A 4M78D 3D7SB 2HYNA 1YITQ 4OMPA 3TSZA 1WHLA 1VQMQ 4JRKA 4N78D 4JZ3A 3LYIA 1W2BO 1ZUYA 5GAOm 3AHUA 1OX3A 2AXTE 1FU1A 3JCMV 2K88A 2CDTA 2VASA 1SQXG 4N4GA 4OH8B 1SRLA 5KYNA 1QL2A 4E7IA 3GBQA 1RI0A 2RM4A 1X2KA 1VQPT 1W6XA 2W6AA 3M0PA 2E75B 3L72E 1JEGA 4BY6B 1YJNP 4V2SA 4H13B 5IHIA 1M4ZA 2NPSB 5E79H 2I2LA 1QVFS 4PKCC 4FYXB 2M5AA 1URQB 3RBBB 4W7YA 3TGUE 3KFVA 4U7JA 3CD6T 2FFDC 1G3YA 4BB7A 2YIUB 3G71Q 1K76A 4Y99B 3RDVA 1SQBE 5BU8B 1QLYA 1RF0C 1FZGA 2EPDA 1BE3D 2L3PA 1IFPA 2XI9A 1H88A 5GANj 2XDBA 3M53A 2VRSA 4PD4E 2DBMA 5DY9A 3AEEC 3GPLA 5CCHA 3EGDB 2YXQB 1SQXE 3WUVA 1T2KD 2Q3IA 2OTLP 4JLGA 2CKKA 3BW1A 2CUBA 2ZPIB 3M0UA 3ZFJA 1EDKA 3AEFC 3H41A 2VYTA 1D3BA 2QDYB 4WTOB 4PJNA 1KD1Q 2GBQA 5KYUB 2M0YA 1YIJT 1BI0A 3I5RA 5FRMA 3LGLA 4F17A 5KE3A 2KRMA 1MKMA 3F89A 2R3CA 3H1LJ 3IN6A 2NUPA 2CP7A 1X6BA 4JS4A 1Q7YU 2H7HA 5CQYA 1NTZJ 1U06A 5GMKh 2IX7C 1WXUA 3B5NC 1WHMA 2YRCA 2EYXA 4MN4C 2QQSA 4AG2C 4W7ZA 3G9RA 1S1CX 5CBOA 1KMIZ 1VYTA 2WT7A 4M7DB 2ZT9B 1X75C 1KFZA 2Q5UA 3FX0A 2RH2A 2FZGB 1NU1D 2FY8A 2KR3A 2Q3EA 3SWNC 4JJDA 3GLXA 2ZPEB 1Z9QA 4D6TD 1NHLA 3G7ZA 5CCHC 2DL7A 5AW7B 1YI2Q 4RTZA 1NEGA 1BCOA 3GHGC 1S2EA 5CR2A 3CPWP 1D0YA 1X69A 4RTUA 2QJYC 1OW7A 3RR6A 3CC4Q 3M91A 4UB8H 1NG2A 3RL0g 2BZXA 2SEMA 3FJPA 1AFOA 2QTXA 3LX7A 5EG2A 1BIAA 3M06A 5GMKj 1IGQA 3SD4A 1MV3A 2N9BA 1KQSO 2YKQA 3RK3C 2CT4A 4RTWA 4LUEA 1AVZC 3AE5C 4M75C 3VJPA 1QL1A 3CCSQ 1VYVA 1VQKQ 2LCCA 1YJ9P 4LXCA 4XTZA 2ENMA 5GMKm 1OU9A 4GDOA 2D8HA 2L89A 5I2SA 3HE5B 1Y96B 1QCOA 1BIBA 3FEOA 1VQNA 1OZHA 1DD3A 4LN2A 2MIOA 5A0LA 3CCUQ 1R5LA 3VYGA 4IL6E 3N4XA 1QVGS 3CCRT 3OYGA 3I56Q 3OBWA 3A8HB 3CCJQ 2X51A 1Q86C 1J1EB 4ZMDA 3DKMA 2RKLA 1KQ1A 1VQ5Q 1YBKA 5LJ3f 2DNUA 3V7RA 2E74C 1FBMA 3CMAQ 4ZTFA 3CEYA 3RL0C 4N6JA 2LCLA 2W6JH 4PJLA 1NTKD 3VUZA 3P8DA 1Q82U 3N5BB 2P0QA 2K57A 1K0SA 1VQ8P 2DVJA 3L2RA 3DB4A 5CAIA 1SHGA 1LP1A 2CP3A 3O8ZA 2KROA 1G1JA 1NBEB 1GK6A 3TEEA 1AQ5A 3M0RA 2HSEB 4OMNA 1K8AQ 3LW5J 1WLPB 4PJOG 1OV3A 2HAXA 2ITAA 4PV1B 5D6WA 1B34A 5CK9A 1TUDA 3H1KG 1WRGA 2ZYDA 3CD6P 3FXDA 3PT9A 4E6RA 5A0DA 4EPCA 4BXLA 5LJ3e 4XTXA 3HPWA 1VQLT 4JQ0D 4OF1A 2O9VA 1OX9A 2E76D 1IFIA 1S72Q 2CZ7B 4Y28J 4QQ6A 3JB9J 1N7SA 1KZUB 1ABQA 2WVRA 4U3FG 3CMEQ 1YITA 1VQMA 2QK0A 4IUTA 4JDSA 3VP9A 3L71D 3AE8C 3VS3A 1RF1A 3CCMT 5GJWB 2FRYA 5AW8B 5GAMf 2CP2A 2KSJA 3QBYA 2M5AB 1AWXA 1K4US 2G8YA 4OB2B 1SRMA 2FYUK 1YBYA 4JF7A 3FXEA 3HUSB 3VS7A 2AZSA 1YHQT 2J6FA 1K73U 3V8LA 4JPZB 3LIDA 2QA4T 3H1IJ 5KYXA 1WHHA 4PJOE 2EJGA 3USSA 1JJ2A
chains in the Genus database with same CATH topology
4M77G 1WT6A 4I2LC 4RKUE 5FU6C 5I2MA 3G71A 2JEEA 4M7AG 2KOGA 1D3BB 4XU0A 4QQDA 2HNIA 4O9BA 1M1FA 1HXDA 2XK0A 4TVRA 4JRPA 4OB1B 2RK2A 3L37A 4J6XA 4GLKA 3OYJA 1NO4A 4Q5WA 4PNOA 1KFMA 3RMSA 4DOVA 1Y71A 1VQ7T 1X79B 2WT7B 4L5GA 1M90U 4M77E 3J7AF 3GIBA 2WSFH 3OAKA 2BIVA 3OB9A 5GAN4 3VUBA 4M7AE 1JO5A 1N73C 2JZ2A 3WVDB 1GU4A 1SP4A 3J81E 4HKEA 3H8ZA 2B8AA 2NPSD 2XG8D 4QVCA 1FX7A 1VQ4T 3CC7T 5AW1B 1URQD 1ZBXA 3MEUA 4C92G 1YI2A 3QDRB 4JRQA 2R5MA 3BY7A 2JOYA 2EFIA 3BFMA 1GXIE 3QHSA 3I55T 4BE0A 3CC4A 3P8CD 4N3YB 3C12A 1HUCA 3KXTA 2P1JA 5GAOq 3BDLA 1Q7YC 2M1HA 3CCVT 3CCSA 1VQKA 5KJ7D 1X01A 3OQ5A 4Z02A 1JNMA 4ZGJB 1Y07A 3META 4E7JA 2F5TX 4J83A 4RMOA 2HPCA 1M9SA 3CCUA 1GK4A 4C92E 2ZXEB 4IFMA 3I56A 3TSIA 3CCJA 3NTKA 1WJQA 3OYLA 4IFFA 3GNGA 4Y91A 1MGQA 2N1TA 1I4K1 3M59A 3CMAA 1NOHA 1SFCD 5GANe 1FJKA 2YRVA 5GMKi 2DVEA 2KAFA 3VN0A 3QG1A 2LTOA 3CPWA 2YKOA 4J6YA 2LKMA 2LT1A 1NJIU 3HKSA 1W2BA 5CCAA 4LGDE 3OS5A 3MHXA 3CXCS 3OMCA 1V29B 2XKOC 1RE4A 3JCMJ 1N7SB 2C9LY 2ZZDA 5AVTB 1RF1B 3MIWA 2PQWA 5AW2B 2N1TC 1S72A 3U1CA 1IZ6A 1UGRB 3CMEA 3A8OB 5CCGA 2RHXA 3BVHA 4PJOC 5GAN6 4B9WA 5GAOr 1Q82C 1ZLLA 4M3LA 2MAMA 4XTWA 3MO8A 1IK9A 4MZTA 5GAMg 5GMKe 3VOPA 1VQPA 3SB2A 1SQVK 2E12A 4QQGA 2R58A 5AVWB 4NL3A 5CKBA 2DIGA 3CD6A 1VDFA 4M77C 1G2CA 4MZPA 3OYKA 5A0GA 3V7SA 5CJ4A 3OW2S 1M1KU 4M7AC 1LWUA 3OYBA 2WITA 1N27A 1K73C 5HK3A 2DZ9A 4EMHA 1LT9A 1N6AA 3C9IA 5KH6A 2DAQA 4RCCA 3MD0A 1JY2O 1FAVA 1OYXA 2IFNA 4CRIA 3LH0A 1JY3O 2QM7A 4IURA 1YIJA 2HG5D 2RA2A 5LL6S 1KQSA 1YJNT 3OYNA 4L6V5 4IFDK 2PVGB 1JY2N 2Y4YA 1ZR4A 1NWQA 1VIEA 1X9VA 5M9OA 3HD7C 1IC2A 3PNWC 3UDCA 4C0DC 4I6MC 5AVZB 4C5GA 3L2UA 4MDXA 2Y90A 5AW0B 1G3SA 1JOCA 2H3JA 1NTMK 1X8YA 3RESA 1M90C 1N7LA 2OTLT 5BU5A 2E41A 4C92C 2QEXT 3GF5A 1KQ2A 2JTFA 4OP0A 5GAN5 4DQ2A 1Z56A 5CKDA 4HCZA 1FZCA 4HT8A 1GD2E 2K4YA 3JCMQ 3BASA 3E19A 3OYMA 4J8OA 3SFMA 3HTKA 1BKBA 1NPRA 2E43A 3OSVA 3VKIA 1M7LA 2X35A 3V8JA 5GAMd 3CCRA 3X25B 4XAXB 3OYYA 2DIQA 3ME9A 5APXA 5LJ5h 4DOWA 3DLLA 2Z5HA 1KILA 4I1LA 2YLCA 1SQXK 1ZHIA 3UIAA 3EFGA 1GW4A 2DO3A 1M8VA 3EFSA 2XV5A 1YJ9T 4BDYA 5APSA 3WMM0 2L8DA 1SFCC 2X4XA 1IFDA 5J3BA 2LX9A 4XK8E 1VUBA 3URGA 3L2WA 2ZPHB 2FFDA 5LJ5j 1VQLA 3LWHA 4J7IA 4O6JA 1RF0A 2GM4A 3OA7A 2WWWA 1NJIC 2H8PD 4J5YA 2YLBA 3HRNA 5GANh 1U1TA 3CCMA 1VQ8T 3CBOA 5AW4B 4C8QG 2KK4A 1YHQA 1G2CB 4M78G 2QA4A 2P0KA 2YKPA 1LWUB 2EQKA 3KDPB 3JB9I 3FRNA 3G4ST 1LT9B 2VXFA 3B5NA 2JUFA 4KULA 5HKCA 2RO0A 4LDWA 3X28B 2PU9B 5FU7B 3SWNA 4HA8A 2RB6A 4WY4C 4M7DF 4C8QE 2XKMA 3OS2A 2FVUA 5GAOn 3H6ZA 3VTPC 3GHGA 4M78E 4LDYA 3V7CA 3INZA 2ZPFB 4N78E 1VQ7A 3QZ5B 3JSCA 4ZN1A 1OZ3A 4F7UG 3L35A 3M0DC 4HH2A 1GTWA 1BI2A 1Y7XA 2DPPB 2OYIC 5AW3B 4M75A 1LNXA 4RG8A 4A53A 2E6NA 2D0QB 2LVMA 3M9HA 1RY3A 2FYKA 1VQ4A 1M1KC 3CC7A 2FL7A 3JB9F 1JUNA 3V2PA 1QVFA 2JN0A 3PTAA 1IREB 4ZTJA 1FZCB 3NFCA 2M8RA 3I55A 2VGMA 3NXSA 5AVUB 2MWPA 3HTKB 3V4QA 2POHA 4F7UE 4CI0C 1MFZA 5IN1A 1L4AD 2DTIA 3C94A 3MP8A 2RHYA 2WSCE 3CCVA 3L2VA 1QP2A 2K3XA 3VV0A 4GKGA 2R5BA 2C06A 2WACA 1KILB 1CW5A 3WXMB 3L42A 4OB3B 4EMKC 1DJ7B 4NS5A 5HY6A 3TREA 5CMZA 2MMPA 2GQVA 2RJCA 2FHDA 3TCJA 4LLHA 3G3ZA 2HQXA 3SWFA 2EAYA 2PUOB 3OY9A 2FFDB 2QI2A 5GAOl 3V2RA 2EQMA 4XA4A 3RIRA 3MTUE 2HBPA 2G3RA 2F5KA 5KLVK 1JJ2S 2RJDA 3OYEA 3JCMW 5C6SA 2A45I 4A4GA 1LTBC 5J39A 1ZQ1A 4M78A 4B9XA 1J2JB 1NZ9A 2X4YA 4C5IA 2ZFCA 2Q7CA 2EQUA 2CYZB 3A3YB 2HQEA 5D6YA 3X20B 1M1JC 3M58A 3KUFA 1LTTC 1HBWA 4C7RA 4BI8B 3B5NB 1GL2D 4E47A 2EIFA 3BRVB 4A4KA 1R8OB 4X34A 2V8JA 2E6ZA 3VU3C 4AYCA 3SWNB 5CCGD 3JCMh 2NLUA 4ZGDB 5GAN3 3BATA 2P4TA 1G5VA 4C8QC 1N73A 1T3JA 3A8LB 2LNVA 4M78C 3GHGB 2O1JA 2K5FA 2E65A 2F69A 1E5WA 3VYIA 4JRIA 3RK2D 1LOJA 4F7UA 4PLLA 4C0FA 1MV8A 4XTYA 2XZRA 2L5QA 4O5VA 3OS0A 4BE2A 3RK3B 4M75B 4DOJA 5LJ5f 3VP8A 4ZGEB 3OYDA 1FZAA 2DTHA 5CIUA 2KQWA 1OZ2A 5AVSB 1FOSF 4X9DA 4GY5A 2DKGA 3F70A 1IFMA 4JYCA 1YJNA 4AUWA 2VUBA 3L4FA 2CS7A 4BUGA 1LTJC 5GMKl 2Y4XA 2LC4A 1T2KC 3RL0B 3FIFA 4FU6A 2XDPA 3CC2T 2PUKB 2DJZA 3QJ6A 3HRSA 5LJ5e 3CCLT 4KUIA 4FT4A 5D6XA 1N9RA 2YHTA 4A4EA 2RD1A 2OTLA 5GANf 2QEXA 3LWIA 5CHXA 3O8VA 2KVQG 1W2BS 1CZQA 2QQAA 5CO7A 1XNIA 4ELYC 4HYTB 1HWTC 3FDRA 3QXEB 4LDXA 2V8KA 1T3UA 4XTUA 2KLVA 2FXMA 1LTSC 4M7DD 3QPHA 4OGCA 2IG0A 2VC8A 1L4AC 2QQ9A 1QP3A 4PJOA 3E1SA 2BASA 3KBGA 2C9NY 2D9TA 1B34B 4M7DG 3P8CE 4C7NA 2WTYA 5FU6B 5LJ3g 3DB3A 1GZLA 1KHIA 4EIJA 3EQ2A 3ZBDA 2C0XA 1OXZA 2DXBA 2OYHA 3P8MC 2DZCA 2DTOA 1CSBA 1FDMA 1IFNA 3JB9D 1YJ9A 3T97A 1BYMA 2QQRA 2XU6A 3N7NA 1ZV8A 4ZN3A 4R55A 2K5LA 1YTZI 2RHZA 1N2DC 4M7DE 4M77A 2E42A 1HTLC 5AVXB 3QYGB 3SWYA 1Q81U 4M7AA 3TNUA 3ZEHA 1N73B 4KT0E 5KCHA 2QM8A 1S9KD 5BVZA 4LDUA 3P7KA 3CL3D 3U1AA 2RHUA 5AVVB 4OGEA 2OYHC 1VQ8A 4XQ3A 2OARA 2YO2A 5IT9E 2RJFA 2KSSA 2ZGWA 1KQSS 1XOVA 1HH0A 3G4SA 3MEVA 3GOXA 2GF7A 4QVZA 2I1KA 1GL2C 3HD7A 3HE4A 3JCMb 3MUDA 4ZKPA 4IUUA 1SQPK 1A02F 2H43A 3OJAB 5APVA 3S3MA 2O01H 3QIIA 4C92A 1S9KE 1G1IA 1J1DC 3B5ND 5LJ5g 3PIOA 2KMTA 3VMZA 1I81A 3OA6A 3HFNA 1JY3N 2WSEH 5AW6B 5LJ3d 3II6A 1QW1A 4N0AC 2O01E 5CCHD 1KQLA 5AVQB 1YJWT 1RE3C 1N8RU 3VYHB 4C5HA 3CLQA 3G6ET 4PJOF 3GNFB 2CZ6B 3B8EB 2HPCB 2WSEE 3M56A 1UEBA 2A3LA 1VQ9T 3E1IA 4BY6C 2GUSA 4M75D 2IFMA 1OWAA 3OW2A 2NPSC 3CCQT 1H8AA 3NTNA 5J26A 2N1TB 5AVRB 2CPSA 3V8KA 4P5NA 4EDUA 1URQC 4E7HA 3H32A 3TK1A 5GANg 3BDUA 4JLIA 4Y99C 4PJOB 3JCMf 2PVOB 1NKNA 1G3TA 2PP6A 2LDMA 1SFCA 3CPFA 4W80A 4M77F 4IUQA 1SQBK 3RL0D 2V8IA 1HGZA 5KJ7C 4M7AF 1JB0E 3M9BA 1A02J 2EJFA 1NE8A 1WPYA 1LTGC 1DEBA 5GAMj 3NMDA 4QVDA 1N86A 3JCMe 3MEAA 2OTJT 4M7DC 2AHJB 4M77B 5DM7R 4MDWA 3EFRA 4HT9A 3RUXA 4FT2A 3PMIA 4M7AB 3TNUB 3J80E 2E64A 1M1GA 3MCAB 2YO3A 3FC3A 1NH4A 2LQKA 5LJ5d 4BI3A 1K9MU 4IUVA 1KHCA 1EIFA 1SSFA 2E10A 4WY4A 4C92F 4XU3A 5AVYB 3R6OA 1HVVA 5APYA 1DX7A 1G3WA 3JCMc 3HD7B 2FB7A 3C95A 5GAN2 2P0PA 4C0DB 4RG2A 3M0DA 1N7SD 4WBAA 4FL6A 1J1EC 2MI6A 2OYIA 3UWNA 3HP9A 2DXUA 1N9SA 4C92B 1Q81C 3CBPA 1MZ9A 5GANd 3NTHA 2EJ9A 3A5TA 1W4SA 4GT1A 2DEQA 1NU1K 1OI1A 2XDJA 2ZCFB 1XTGB 3OBYA 4XE5B 3HUSA 3VMYA 2MF2A 3MP6A 3KYQA 3A8MB 4RCBA 2QQBA 4EMGA 4FM4B 2VV5A 1ZR2A 1X6OA 2GFUA 1KD1U 1WJRA 4VUBA 3HRTA 3V2QA 2MJZA 1VQOT 4EMKA 3P8BB 1H3ZA 3CC2A 4IUPA 2WSCH 3H32B 2XU8A 3CCLA 3HUSC 1HJBA 3RKXA 4OMFB 3M57A 4ME7A 3CCET 4XTVA 1SFCB 3V2NA 2C0WA 3HRUA 5A2QE 2R5AA 4E7KA 1NTKK 4L59A 1NPPA 3FLGA 4BACA 2PAJA 5CKFA 2FKWB 2R5DA 1N8RC 3U59A 3DLMA 1UB4A 2JNGA 4WB4A 4LD9K 3S6WA 5APQA 2RI5A 3JCMg 4FSXA 5GAN8 2KB7P 2EYQA 1I5LA 1U1SA 3A7OA 1KG1A 3PP5A 2W27A 1JTHA 1VIFA 2RK1A 4RESB 4AQRD 1M1JA 3P32A 4NL2A 3T9NA 2HLOA 1O75A 3RKYA 3M0AA 3FB9A 5CKHA 2CPBA 2N1TD 4MMLA 2GFAA 4MZMA 1WGSA 3M9QA 2K3YA 3JRZA 2HFED 4X9CA 4PJOD 4WY4B 5FLXE 4C8QA 5CJ0A 2WPQA 4KUDK 2HODA 3V5BA 1K8AU 5IAYA 2X4WA 4B86A 2LRQA 1JMMA 4LDVA 4N4IA 2ZPGB 4LD6A 3QYHB 3L36A 1VQ6T 2X4JA 1QVGA 1NAFA 1GU5A 2M0OA 4II1A 1EQ7A 2M9UA 3OYAA 3OMGA 1IFJA 5CKEA 2OYIB 2DD5A 1UGQB 3JAME 1NTZK 2GCXA 4M75F 2EQJA 1WQWA 4BDZA 4QW2A 3TU4K 4M77D 3RKWA 4KHXA 2KYVA 2VGNA 3X24B 3QSUA 3M55A 1K9MC 5GAN7 4KBMB 4M7AD 4JUVA 5FRNA 1LTJA 1ZN5A 1O9SA 5C0MA 3S3OA 1BI3A 2K2VA 1SVFA 3QO3A 3L1AA 2P7JA 3HSBA 3MGNA 5APWA 1SLQA 3P8HA 1KC8U 1N7SC 3JCMd 4XU2A 4UC4A 5GAMe 1RF1C 4EMKB 1UGPB 2JTMA 2E5QA 1LTAC 3LLRA 2FYZA 4A54A 2E70A 3HD7D 3M5AA 3QUIA 2A7YA 1AHJB 4A4HA 4BI4A 2O1KA 3UPUA 4PLIA 4WF2A 1YJWA 4ZKUA 3QJYA 1PFIA 3A8GB 2PVDB 2L5GB 2YMYA 2XHCA 2WPRA 4C92D 3G6EA 2P2UA 1L4AA 4OB0B 2GUVA 1XQHA 2WSFE 1FWZA 1CI6A 4J6WA 3RMQA 1VQ9A 4XU1A 1L0NK 3CPWS 3E9FA 4D6WA 2XNXA 3CCQA 4EOTA 1KD1C 4MMKA 3BRTB 1DH3A 1IO4A 1MHNA 1UGSB 2OAUA 3IR9A 3A2AA 4R56A 4DA4A 3OYHA 1JTHB 4C8QF 4M78F 1M1JB 1WJSA 2LQ8A 5CVIA 3OSSC 1YCYA 2LT4A 3GP8A 5CQXA 1VQNT 4N4HA 3CBMA 2YNYA 3HL8A 5L8RE 2E1HA 5KE2A 2XIDA 2J58A 1VQ5A 1QVPA 4IKFA 4C8QB 1P92A 3PMTA 4M78B 1H89A 2HODB 2DD4A 1FJPA 2J59M 5KTBA 1U8RA 2OTJA 1HGVA 4HCCA 2CZ0B 2KY9A 3A5ZB 5AW5B 4F7UF 1KILD 2RI2A 3LW5H 3LGFA 3JB9G 1GL2A 1YYCA 4C0GA 4C5EA 1JBMA 1GDTA 2Z5IA 1KFNA 2BUDA 3JB9H 3QKJA 3LW5E 1YITT 4ATOA 3S3NA 1VQMT 4ELZC 1LTJB 4F7UB 2CGHA 1H641 1I8FA 1LGHB 1L0LK 2IPPA 4C46A 2XICA 3HFOA 3CXCA 1K8AC 2P67A 4Y28E 4HCBA 2QXFA 4YTLA 3PIPA 1RE4C 3L2ZA 3NFQA 2O4XA 3ASKA 4N0AA 5AW9B 2VXEA 4WY4D 5DLOA 1FXXA 1RE3A 4FIBA 2R57A 4C0ZA 3G71T 4OVAA 2BKDN 5CCGC 2EKOA 3VMXA 4NOYA 1JCDA 1LJOA 5KCOA 5LJ3h 2MWOA 1XTDA 1LTIC 2RJEA 2RHIA 2NPSA 5FROA 2KDSA 3RK2C 4JYBA 2DK3A 1URQA 3E9GA 4DZOA 3PFSA 1L4AB 2ZPBB 3JCMX 4A4FA 3Q1JA 2I1JA 1CI6B 3JCMP 1PSFA 2Z4EA 3LIEA 3RERA 2W6BA 1VQOA 1M5Q1 3I5CA 1TH7A 5I21A 1KC8C 4BD3A 1MUUA 5LJ3j 5DLQE 2KP8A 5KJ7A 3RK3D 3L2QA 1YI2T 5APTA 1W2EA 1GW3A 3CCEA 3NTIA 1LWUC 3CC4T 1FZBA 3QZ9B 2M16A 5GAMh 1LT9C 1Q86U 3PGGA 1YTZT 2WZ7A 3M4GA 2EWNA 3WVEB 3OYIA 4M75G 3R2PA 2DXTA 1T8ZA 4M7DA 3V4WA 3H6PA 2HD0A 3TYYA 5FU7C 1NKZB 4C7NB 3HHTB 3CCST 1VQKT 2K5IA 1FZFA 3C4SA 3MEWA 4GIFA 3KPEA 3OS1A 2M3BA 3CCUT 1FZEA 3IFMA 2A45G 2OYHB 3I56T 3CCJT 2XDDA 5APUA 1XTCC 4J7FA 2Q9IA 3UT1A 3X26B 1VQ5T 1RL2A 3CMAT 1WNLA 4JS5A 4M75E 2A45H 3M4YA 2D6FA 5GAOp 1JRIA 2CZ1B 1IJDB 3HE5A 1Y96A 2XD0A 3SDZA 1GL2B 2L3RA 1JCCA 4LC1A 1JY2P 3EAEA 1FZCC 3OYFA 1SQQK 1JY3P 2JJLA 1HK9A 2IVWA 3CI9A 1J1DB 1PSEA 1WQ7A 3MP1A 1S72T 1VQ6A 1VPCA 3CMET 2DXCA 1FOSE 4JJNK 3RK2B 3OYCA 4E7LA 2WPSA 2O4XB 4BE1A 2JVVA 3ER0A 2R32A 1BI1A 5HK0A 3KQGA 4C8QD 3HE4B 1KILC 5AYFA 4PL6A 2RI3A 3M54A 4M78D 2HYNA 4JRKA 4N78D 3LYIA 5GAOm 3AHUA 1FU1A 3JCMV 4N4GA 4OH8B 1QL2A 4E7IA 1VQPT 1RI0A 2RM4A 2W6AA 4BY6B 4V2SA 1M4ZA 2NPSB 2I2LA 1QVFS 4PKCC 1URQB 4W7YA 3CD6T 2FFDC 1G3YA 4BB7A 4Y99B 5BU8B 1RF0C 1FZGA 2XI9A 1H88A 5GANj 2XDBA 3M53A 2VRSA 5DY9A 3GPLA 5CCHA 1T2KD 2Q3IA 4JLGA 2CKKA 3BW1A 2ZPIB 3ZFJA 2VYTA 1D3BA 2QDYB 1YIJT 1BI0A 5FRMA 3LGLA 5KE3A 2R3CA 4JS4A 1Q7YU 2H7HA 5CQYA 5GMKh 2IX7C 3B5NC 2QQSA 4W7ZA 2WT7A 4M7DB 1X75C 2Q5UA 2RH2A 3SWNC 3GLXA 2ZPEB 1NHLA 3G7ZA 5CCHC 5AW7B 3GHGC 5CR2A 3M91A 3FJPA 1AFOA 2QTXA 3LX7A 5EG2A 1BIAA 3M06A 5GMKj 3SD4A 2N9BA 2YKQA 3RK3C 4M75C 3VJPA 1QL1A 2LCCA 5GMKm 4XTZA 2L89A 5I2SA 3HE5B 1Y96B 1BIBA 3FEOA 1VQNA 5A0LA 3VYGA 3N4XA 1QVGS 3CCRT 3OYGA 3OBWA 3A8HB 1Q86C 1J1EB 3DKMA 1KQ1A 5LJ3f 3V7RA 1FBMA 4ZTFA 3CEYA 3RL0C 4N6JA 2LCLA 3VUZA 3P8DA 1Q82U 3N5BB 2P0QA 2K57A 3L2RA 3DB4A 5CAIA 3O8ZA 1G1JA 1GK6A 3TEEA 1AQ5A 4PJOG 2HAXA 5D6WA 5CK9A 1B34A 1WRGA 3PT9A 5A0DA 4EPCA 5LJ3e 4XTXA 3HPWA 1VQLT 4OF1A 1IFIA 2CZ7B 4QQ6A 3JB9J 1N7SA 1KZUB 1YITA 1VQMA 4IUTA 4JDSA 3VP9A 1RF1A 3CCMT 5GAMf 5AW8B 2KSJA 3QBYA 4OB2B 2FYUK 1YBYA 4JF7A 1YHQT 3HUSB 1K73U 3V8LA 2QA4T 3LIDA 4PJOE 2EJGA 1JJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BD3 A;  3NTH A;  2E5Q A;  4B9X A;  2RJF A;  3LLR A;  3OYB A;  2E6N A;  2LDM A;  2RI2 A;  1N27 A;  2X4Y A;  3LW5 H;  1NU1 K;  2LVM A;  3LGF A;  3LX7 A;  4A4E A;  4C5I A;  3L2Q A;  1OI1 A;  4PL6 A;  2RI3 A;  3SD4 A;  4A4H A;  5KH6 A;  2DAQ A;  4IUQ A;  4PLI A;  5D6Y A;  2EQU A;  1SQB K;  2HQE A;  3O8V A;  4BDY A;  3NTI A;  3LYI A;  3KUF A;  2L8D A;  5D6X A;  2GFA A;  1OYX A;  2YRV A;  3MP6 A;  2LCC A;  2X4X A;  1WGS A;  4QQD A;  3M9Q A;  1XNI A;  3LH0 A;  4CRI A;  2L89 A;  2M16 A;  3MEV A;  4IUR A;  2K3Y A;  2LTO A;  4N4G A;  3FDR A;  4C5E A;  4ZTJ A;  4E7I A;  2XK0 A;  3OYI A;  3FEO A;  1RI0 A;  2BUD A;  2GF7 A;  3OYN A;  4QVZ A;  3QKJ A;  2LKM A;  3L2W A;  4IFD K;  3S3N A;  3OYJ A;  4X34 A;  4Q5W A;  2MWP A;  3OYG A;  4IUU A;  1SQP K;  5IAY A;  2GFU A;  3OMC A;  3C4S A;  3MEW A;  2NLU A;  2X4W A;  2LRQ A;  1WJR A;  5IN1 A;  3MEA A;  4N4I A;  1L0N K;  5M9O A;  1G5V A;  3MP8 A;  4LD6 A;  3OS1 A;  1L0L K;  3E9F A;  2RHY A;  2IG0 A;  3PNW C;  3S3M A;  2O01 H;  2WSF H;  2BIV A;  2M0O A;  3OB9 A;  3QII A;  4C5G A;  4II1 A;  3L2V A;  2K3X A;  2PQW A;  3OYA A;  4ZTF A;  3L2U A;  3CEY A;  3OMG A;  2O4X A;  3PMI A;  1H3Z A;  2D9T A;  3P8D A;  4IUP A;  2WSC H;  1MHN A;  3ASK A;  1NTM K;  4PLL A;  2JZ2 A;  3UT1 A;  3L2R A;  3DB4 A;  2RHX A;  3OYH A;  2WAC A;  2P0K A;  3H8Z A;  2R57 A;  3FC3 A;  3DB3 A;  2B8A A;  3OYL A;  4OVA A;  2BKD N;  4B9W A;  3OS0 A;  3OA6 A;  4BE2 A;  3L42 A;  1NTZ K;  2WSE H;  2CKK A;  2EQJ A;  2EQK A;  4NS5 A;  4BDZ A;  1WJS A;  2VYT A;  2JTF A;  4QW2 A;  2EKO A;  3MEU A;  4IUV A;  1KHC A;  3OYD A;  5D6W A;  2R5A A;  4E7K A;  1SSF A;  4HCZ A;  5CIU A;  1OZ2 A;  2R5M A;  4C5H A;  3LGL A;  1NTK K;  3CLQ A;  5KE3 A;  5FRM A;  4GY5 A;  2EFI A;  4N4H A;  5KCO A;  2RO0 A;  3MO8 A;  4L59 A;  3FLG A;  2RJC A;  4BAC A;  2QQR A;  4BE0 A;  2MWO A;  2FHD A;  5FRN A;  2L3R A;  2RJE A;  3OYM A;  2RHI A;  3F70 A;  2HQX A;  3G3Z A;  5C0M A;  3S3O A;  3EAE A;  3DLM A;  5FRO A;  2QQS A;  5KE2 A;  3OYF A;  4QQ6 A;  2X35 A;  3OY9 A;  4IKF A;  1SQQ K;  2RHZ A;  3BDL A;  3S6W A;  3E9G A;  3GOX A;  1SQV K;  3PMT A;  2EQM A;  4IUT A;  3PFS A;  2RI5 A;  3OS2 A;  4RG2 A;  4QQG A;  2M1H A;  3H6Z A;  2R58 A;  4A4F A;  4FL6 A;  2G3R A;  3Q1J A;  5J26 A;  2F5K A;  2J59 M;  2DIQ A;  3OQ5 A;  3QBY A;  3MP1 A;  4Z02 A;  5KLV K;  3P8H A;  2XDP A;  3ME9 A;  3MET A;  4FU6 A;  4EDU A;  2DIG A;  3ZEH A;  4E7H A;  2RJD A;  2FYU K;  3QJ6 A;  4E7J A;  5KCH A;  3OYE A;  3UWN A;  1OZ3 A;  4UC4 A;  5C6S A;  2RHU A;  3OYC A;  3OYK A;  4A4G A;  4E7L A;  2O4X B;  2OAR A;  4BE1 A;  3NTK A;  1WJQ A;  1SQX K;  5J39 A; 
#chains in the Genus database with same CATH topology
 3H1K E;  2B87 A;  2CH4 A;  4M77 G;  1WT6 A;  4I2L C;  4RKU E;  3MKD A;  5FU6 C;  1QMC A;  5I2M A;  3G71 A;  5KLV G;  2JEE A;  1VQP Q;  2EYW A;  2KNB B;  4M7A G;  2KOG A;  4Z8A A;  5DJT B;  5KAF E;  4U3F E;  1D3B B;  1BCM A;  4XU0 A;  4QQD A;  1EXI A;  2HNI A;  4O9B A;  1KC8 Q;  1M1F A;  2QJK B;  1HXD A;  2XK0 A;  4TVR A;  4QT7 A;  4JRP A;  4OB1 B;  2RK2 A;  3L37 A;  4J6X A;  2NUP B;  2LX7 A;  2B89 A;  4GLK A;  3OYJ A;  1NO4 A;  4Q5W A;  1GFD A;  2O01 N;  4PNO A;  3H1L D;  1KFM A;  3RMS A;  4DOV A;  1Y71 A;  1VQ7 T;  2G3A A;  1X79 B;  2WT7 B;  4Z88 A;  4L5G A;  3CXH D;  1M90 U;  4M77 E;  2QRX A;  2ROL A;  1KTM A;  2O2O A;  2V1Q A;  1M27 C;  2WSF H;  3OAK A;  2BIV A;  3OB9 A;  3GIB A;  2NYS A;  5GAN 4;  5KLV E;  3VUB A;  2XMF A;  1KYO H;  4M7A E;  1JO5 A;  5D7U A;  1N73 C;  2JZ2 A;  4GOF A;  3RGU A;  3UAT A;  3WVD B;  1GU4 A;  1SP4 A;  3J81 E;  1YIJ Q;  4HKE A;  3M0T A;  2MCN A;  3H8Z A;  2B8A A;  2RQW A;  4H13 D;  1VQO Q;  2NPS D;  2XG8 D;  4QVC A;  4DBF A;  1FX7 A;  2CH4 W;  1VQ4 T;  3CC7 T;  3TF5 A;  5AW1 B;  3EGX A;  2CP5 A;  1URQ D;  1ZBX A;  2PTK A;  3MEU A;  4C92 G;  1YI2 A;  1IO6 A;  1KYO E;  2KLU A;  5B66 E;  5B5E E;  3QDR B;  3BCC D;  4JRQ A;  2R5M A;  2VB6 A;  3BY7 A;  2JOY A;  2EFI A;  3BFM A;  1GXI E;  3QHS A;  3I55 T;  4BE0 A;  2KYB A;  1SQV J;  3JCU H;  4ESR A;  3CC4 A;  3P8C D;  4N3Y B;  2DRK A;  1RH5 B;  3C12 A;  1K73 R;  1HUC A;  3KXT A;  3L74 D;  2P1J A;  5GAO q;  3NGP A;  1IRX A;  3BDL A;  4PJM A;  1JB0 J;  1Q7Y C;  3Q5R A;  2M1H A;  3CCV T;  3CCS A;  1VQK A;  1PCX A;  5KJ7 D;  1OIP A;  1X01 A;  2J6O A;  3OQ5 A;  1JNM A;  4Z02 A;  4ZGJ B;  4HJG H;  1Y07 A;  3MET A;  3JCU E;  2QTV A;  2LCS A;  4AFZ C;  4E7J A;  2F5T X;  5KAI H;  2Y9Y A;  2I0N A;  4J83 A;  4I7Z C;  4RMO A;  2HPC A;  1M9S A;  3CCU A;  1GK4 A;  4C92 E;  1B7T A;  2ZXE B;  4IFM A;  3I56 A;  3TSI A;  3CCJ A;  3NTK A;  1WJQ A;  3OYL A;  4IFF A;  3GNG A;  1WHJ A;  1BGY G;  4J9G A;  1GMJ A;  1QVF O;  2WMM A;  4Y91 A;  1VQL P;  1E6H A;  1MGQ A;  2N1T A;  1LP1 B;  2ZT9 D;  1I4K 1;  3M59 A;  3CMA A;  5DJU B;  1JO8 A;  2BE7 D;  1NOH A;  1SFC D;  2HDA A;  3H1H G;  1L0N D;  2A28 A;  5GAN e;  5GTI H;  3CCR Q;  1FJK A;  2K9G A;  2YRV A;  5GMK i;  2DVE A;  2RH0 A;  4QMA A;  2KAF A;  2RMZ A;  3VN0 A;  2JS2 A;  1RLQ C;  2LTO A;  3QG1 A;  3H1J D;  3CPW A;  2YKO A;  2YXR B;  4OML A;  3A0H H;  3FGA D;  2QAZ A;  4J6Y A;  2OAW A;  2LKM A;  2LT1 A;  1NJI U;  1AVY A;  3HKS A;  1W2B A;  5CCA A;  2QA4 P;  4LGD E;  2HEQ A;  3OS5 A;  2ZYG A;  1EC5 A;  3MHX A;  3CXC S;  3OMC A;  1JU5 C;  1V29 B;  2YDL A;  2XKO C;  1RE4 A;  3JCM J;  5GTI E;  1N7S B;  2C9L Y;  5HCK A;  2ZZD A;  5TIS H;  1HJ0 A;  1BGY E;  1UII A;  3C8V A;  2DL8 A;  2XND H;  2DFU A;  5AVT B;  1RF1 B;  5KYY A;  3MIW A;  2PQW A;  5AW2 B;  2N1T C;  3R4Y A;  3AEC C;  1S72 A;  3U1C A;  1IZ6 A;  3H1H E;  1UGR B;  3CME A;  3A8O B;  5CCG A;  1VQ6 Q;  1KK7 A;  4ASW A;  2OX7 A;  2RHX A;  3BVH A;  4PJO C;  5EFW B;  2DRM A;  4B9W A;  3PE0 A;  2JM9 A;  5GAN 6;  5KYX B;  5GAO r;  1QQJ A;  1Q82 C;  1ZLL A;  2B87 B;  1Q2N A;  4M3L A;  2DYB A;  4TT3 H;  5KYW B;  1U57 A;  2K9Y A;  1KOR A;  4AFQ C;  2MAM A;  3D70 A;  1VQ7 P;  4XTW A;  2K1A A;  4L76 A;  1R0B G;  3MO8 A;  1IK9 A;  1D09 B;  2LXC B;  3TGU J;  4MZT A;  3CCM Q;  5GAM g;  1ZXG A;  2VKN A;  5GMK e;  2DEU A;  2A06 G;  3VOP A;  4D8K A;  1VQP A;  1RAE B;  1YHQ Q;  1X0T A;  1E6G A;  3SB2 A;  3SEM A;  1SQV K;  1RI9 A;  2E5T A;  2E12 A;  4QQG A;  2YRD A;  2H3E B;  2R58 A;  5AVW B;  4NL3 A;  4PV1 D;  2NUT A;  5CKB A;  1SQX J;  2DIG A;  3CD6 A;  1VDF A;  1QVF P;  5IH2 A;  1LCK A;  4M77 C;  1T3S A;  1G2C A;  1PPJ D;  4MZP A;  2JDI H;  3OYK A;  2FG0 A;  5A0G A;  5GTH E;  3V7S A;  5CJ4 A;  3CCL P;  3EG2 A;  1AEY A;  3OW2 S;  1M1K U;  2RQV A;  4M7A C;  4H44 B;  1UJY A;  1LWU A;  4HVU A;  3OYB A;  3Q2Y A;  2WIT A;  1N27 A;  1K73 C;  5HK3 A;  4KGZ B;  4ZNC A;  2DZ9 A;  3EFO A;  4EMH A;  1OQK A;  1LT9 A;  1N6A A;  3C9I A;  1A0N B;  5KH6 A;  1ZSG A;  2DAQ A;  4RCC A;  2A06 E;  3MD0 A;  3EGX B;  1JY2 O;  1L0L D;  2BCC G;  1GCP A;  1FAV A;  2V4H A;  1OYX A;  2IFN A;  4CRI A;  3LH0 A;  1JY3 O;  3RBX A;  2QM7 A;  2IBZ I;  4IUR A;  2FBW C;  2HG5 D;  3VMA A;  1I1J A;  2RA2 A;  1PD0 A;  2RNA A;  5LL6 S;  1YJN T;  1KQS A;  4CC4 B;  3OYN A;  1P84 H;  3EFF K;  1W1F A;  4L6V 5;  1K05 A;  4IFD K;  2PVG B;  1JY2 N;  2Y4Y A;  4KH1 B;  4RTV A;  1ZR4 A;  1NWQ A;  1S3J A;  2COZ A;  1M8M A;  4EIK A;  2DBK A;  1VIE A;  1X9V A;  5M9O A;  3AE7 C;  3HD7 C;  1RAH B;  1IC2 A;  3PNW C;  2J6K A;  3UDC A;  3MUD C;  4C0D C;  4I6M C;  5AVZ B;  1Q81 R;  2EVR A;  1JEK A;  4C5G A;  2DJQ A;  1VQ4 Q;  1P84 E;  2JP3 A;  3L2U A;  3CC7 Q;  4MDX A;  2Y90 A;  3J7A F;  5AW0 B;  1G3S A;  1JOC A;  2LJ3 A;  2H3J A;  1NTM K;  1X8Y A;  3RES A;  1EX4 A;  1SQP G;  3MP7 B;  1M90 C;  3JSV C;  2BCC E;  1N7L A;  2OTL T;  1Q86 Q;  1MFT A;  5BU5 A;  2E41 A;  4K11 A;  4C92 C;  1K0X A;  2QEX T;  3GF3 A;  2KT1 A;  2CP6 A;  3GF5 A;  1M56 D;  2O88 A;  4JZ4 A;  3I55 Q;  1OVU A;  2FYN C;  2JKV A;  1KQ2 A;  1V76 A;  3CXH I;  2JTF A;  4OP0 A;  5GAN 5;  4DQ2 A;  1ZSZ B;  1Z56 A;  5CKD A;  1NVO A;  4HCZ A;  2JWA A;  1FZC A;  4HT8 A;  1GD2 E;  2QSI A;  3CCV Q;  2K4Y A;  2DIL A;  3JCM Q;  3BAS A;  3E19 A;  3OYM A;  4J8O A;  3SFM A;  3HTK A;  5CBN A;  1BKB A;  1NPR A;  2YWW A;  2E43 A;  2Q1K A;  3OSV A;  1U7J A;  3VKI A;  1M7L A;  2X35 A;  3EG3 A;  2FPE A;  1M1K R;  1VQN Q;  3V8J A;  2K2M A;  2F1L A;  1KB9 H;  3FWL A;  5GAM d;  2R3S A;  2Z0W A;  1SQP E;  3CCR A;  5AT1 B;  3X25 B;  4XAX B;  1ZOY C;  3OYY A;  1WA7 A;  2DIQ A;  1QVG P;  4F04 B;  3ME9 A;  1NYH A;  4E2F B;  1QLE D;  2GTO A;  5APX A;  5LJ5 h;  4DOW A;  3DLL A;  3IQL A;  3L75 D;  2Z5H A;  5KYY B;  1KIL A;  4I1L A;  2D8J A;  2YLC A;  2YXY A;  1SQX K;  1ZHI A;  2HKN A;  1IXD A;  3CX5 I;  3UIA A;  1W5C E;  1LT1 A;  4GOE A;  4L75 A;  1HSQ A;  3EFG A;  4AMC A;  1GW4 A;  2DO3 A;  2EBP A;  2KEA A;  1M8V A;  3EFS A;  2XV5 A;  1YJ9 T;  4BDY A;  5APS A;  2LR2 A;  3WMM 0;  1FMV A;  2L8D A;  3L72 G;  1SFC C;  1KIK A;  2X4X A;  1IFD A;  5J3B A;  2LX9 A;  4XK8 E;  4PJ0 E;  1VUB A;  3AEA C;  3URG A;  3L2W A;  2ZPH B;  2FFD A;  5LJ5 j;  1GFC A;  1VQL A;  3LWH A;  1IK7 A;  4J7I A;  1NYG A;  4O6J A;  1SQB G;  1RF0 A;  2D2C B;  2GM4 A;  3OA7 A;  2WWW A;  1NJI C;  2H8P D;  3CPW O;  1X2Q A;  1GL5 A;  4J5Y A;  3H1K J;  2YLB A;  3HRN A;  5GAN h;  4CPG A;  4D8D A;  1U1T A;  2LP5 A;  3CCM A;  4IL6 X;  4RKU J;  1VQ8 T;  1BCC D;  2FPD A;  3CBO A;  2NUT B;  5AW4 B;  1OU8 A;  1QX8 A;  4C8Q G;  2KK4 A;  2COW A;  4FW1 A;  1YHQ A;  1G2C B;  1WYX A;  1FS0 E;  4M78 G;  5M1B A;  3I9Q A;  1Y0M A;  4PFO A;  2QA4 A;  4U3F J;  2P0K A;  2EYZ A;  2YKP A;  3C1L A;  1QCF A;  3S1K A;  4PD4 H;  2E4H A;  1LWU B;  1SQQ D;  1UG1 A;  2EQK A;  3KDP B;  3JB9 I;  3EFO B;  3FRN A;  4E7Z A;  3G4S T;  1LT9 B;  2VXF A;  3B5N A;  2JUF A;  1YJW P;  4KUL A;  4DT0 A;  5HKC A;  2RO0 A;  4L74 A;  4LDW A;  3QWO C;  1EFN A;  2PU9 B;  3X28 B;  2X9H A;  5FU7 B;  3G6E P;  3SWN A;  4HA8 A;  2HCK A;  2RB6 A;  2FZC B;  4WY4 C;  5KLV J;  4M7D F;  3K5B A;  3VS1 A;  2COY A;  4C8Q E;  1NAY A;  3VRZ A;  2XKM A;  3OS2 A;  1BE3 G;  2FVU A;  5GAO n;  3H6Z A;  3VTP C;  3GHG A;  2QEX P;  1VQ9 P;  3HTR A;  4M78 E;  4LDY A;  3V7C A;  3INZ A;  1RAI B;  4RJT A;  4H0L B;  4PFZ A;  2OYO A;  2ZPF B;  2O3J A;  4N78 E;  1VQ7 A;  1PZQ A;  3CCQ P;  2E5Y A;  1T0J A;  2ZAE A;  1U7M A;  3QZ5 B;  3JSC A;  4ZN1 A;  2LMJ A;  1OZ3 A;  4F7U G;  1ZW0 A;  3L35 A;  3M0D C;  2WSF J;  4HH2 A;  1N5Z A;  2GNC A;  2ABL A;  1GTW A;  4E7S A;  1BI2 A;  1I5O B;  1Y7X A;  1RHZ B;  2DPP B;  2OYI C;  5AW3 B;  4M75 A;  1Q7Y Q;  4HKZ H;  1LNX A;  4RG8 A;  4A53 A;  2E6N A;  3F5H A;  2D0Q B;  2LVM A;  1YJN Q;  3M9H A;  1RY3 A;  3TDK A;  2FYU J;  4WCI A;  2FYK A;  2WPV B;  2M3E A;  1K9M R;  1VQ4 A;  3KHU A;  1M1K C;  3CC7 A;  5FW9 A;  4BRY A;  2FL7 A;  3JB9 F;  1JUN A;  3V2P A;  1QVF A;  2DL4 A;  2J05 A;  3QWY A;  2JN0 A;  2CSQ A;  3PTA A;  1BE3 E;  1ZA2 B;  1OFC X;  2HL3 A;  4JBZ A;  1IRE B;  1YFN A;  4ZTJ A;  1IHW A;  4OGQ D;  1FZC B;  1ZUU A;  3NFC A;  2M8R A;  4JJB A;  2F2W A;  3I55 A;  1NU1 G;  1VF5 B;  3ZL7 C;  2VGM A;  3NXS A;  5AVU B;  2MWP A;  3L70 D;  3HTK B;  3V4Q A;  2POH A;  4D6T G;  4F7U E;  4CI0 C;  1MFZ A;  5IN1 A;  3AE3 C;  1L4A D;  4IL6 H;  2DTI A;  3C94 A;  3MP8 A;  5KKZ C;  2YUN A;  1AVO A;  3Q3D A;  2DL3 A;  5L8R J;  2E5K A;  2OTL Q;  2RHY A;  3THK A;  2WSC E;  1ZME C;  3CCV A;  2OTJ P;  1AT1 B;  2O31 A;  4X1V A;  3L2V A;  3REB B;  1QP2 A;  2K3X A;  5FWC A;  4R0K A;  3C0C A;  3VV0 A;  4GKG A;  2R5B A;  2HQH A;  4KJM A;  2N9Y B;  1WIE A;  2C06 A;  1E79 H;  2WAC A;  1KIL B;  1CW5 A;  2ESW A;  1QKX A;  2FEI A;  2B9B A;  3WXM B;  3L42 A;  4OB3 B;  4EMK C;  1DJ7 B;  1MMG A;  4NS5 A;  2Y0E A;  4AFS C;  1U5S A;  1NU1 E;  5HY6 A;  3TRE A;  2BEQ D;  5CMZ A;  3CWB D;  2PGD A;  3ZDM A;  4D6T E;  4OVN F;  2ZXX A;  2MMP A;  2GQV A;  2RF0 A;  3IF4 A;  2RJC A;  1YWO A;  1G2B A;  2K3B A;  2FHD A;  2L3Q A;  3TCJ A;  3OW2 O;  4LLH A;  3G3Z A;  2HQX A;  1BGY J;  4Z89 A;  1OX8 A;  3SWF A;  1Q82 Q;  2EAY A;  2PUO B;  3OY9 A;  1PG5 B;  2FFD B;  2QI2 A;  5GAO l;  3V2R A;  2EQM A;  4XA4 A;  3RIR A;  1LPL A;  3MTU E;  3H1H J;  4EI2 A;  1NTK G;  2HBP A;  2W90 A;  1MMA A;  4LNP A;  2G3R A;  2F5K A;  5KLV K;  1JJ2 S;  2ROT A;  3CXC P;  1YQ4 C;  2RJD A;  4RTT A;  3OYE A;  3JCM W;  5C6S A;  2M0B A;  3G4S P;  2A45 I;  1FDI A;  1D1B A;  4A4G A;  1PHT A;  1YJ9 Q;  2W8Z A;  2MPX C;  1LTB C;  3PRJ A;  5J39 A;  1ZQ1 A;  4M78 A;  2AXC A;  4B9X A;  1J2J B;  1PRL C;  1NZ9 A;  2X4Y A;  4C5I A;  3V6I A;  2FRW A;  2ZFC A;  1V1C A;  1UE9 A;  2Q7C A;  2EQU A;  2CYZ B;  3A3Y B;  2HQE A;  4J9I A;  5D6Y A;  3X20 B;  1M1J C;  1Y8A A;  1QCN A;  3M58 A;  3KUF A;  4CC2 A;  1LTT C;  1HBW A;  4C7R A;  4BI8 B;  3PJS K;  3B5N B;  1NTK E;  1GL2 D;  5KAF H;  4E47 A;  3FWN A;  2EIF A;  2HMA A;  2IBZ D;  3BRV B;  1UGV A;  4A4K A;  3L71 G;  1ABO A;  1R8O B;  1K73 Q;  1EZV I;  4X34 A;  2V8J A;  2E6Z A;  3VU3 C;  4DEX A;  1VQ8 Q;  1AA0 A;  4AYC A;  3SWN B;  5CCG D;  3JCM h;  2NLU A;  4ZGD B;  5GAN 3;  3BAT A;  2P4T A;  1G5V A;  1PRM C;  4C8Q C;  1N73 A;  1T3J A;  3A8L B;  3AE6 C;  2LNV A;  4M78 C;  3GHG B;  2O1J A;  2K5F A;  2IPO B;  2E65 A;  2F69 A;  1E5W A;  3VYI A;  3E2U A;  2QJY B;  4JRI A;  3RK2 D;  1JMB A;  1LOJ A;  4F7U A;  4PLL A;  4C0F A;  1MV8 A;  3CD6 Q;  2J06 A;  2E3H A;  4XTY A;  1BSH A;  2DM1 A;  2XZR A;  2L5Q A;  3QH9 A;  4O5V A;  3OS0 A;  4BE2 A;  3RK3 B;  1Z9Z A;  4M75 B;  4DOJ A;  2D2C D;  2NWM A;  5LJ5 f;  3L71 E;  1NTZ D;  3OW2 P;  2JR8 A;  3VP8 A;  3SWK A;  4ZGE B;  1PP9 J;  3OYD A;  3CCE P;  1FZA A;  2DTH A;  5CIU A;  2KQW A;  1OZ2 A;  5AVS B;  1FOS F;  4X9D A;  4PD4 I;  4GY5 A;  4BRY B;  1M90 Q;  2FYU D;  2OQQ A;  2DKG A;  3H1L G;  5B5E H;  5B66 H;  3O6Q A;  2JT4 A;  2RPN A;  3F70 A;  1E7O A;  2OJ2 A;  1IFM A;  1NTZ G;  4JYC A;  1YJN A;  2E75 D;  1EZZ B;  2KT8 A;  4AUW A;  2VUB A;  3L4F A;  1AWO A;  1H3H A;  2CS7 A;  2UWJ E;  2YMK A;  1K8A R;  4BUG A;  1LTJ C;  5GMK l;  2E74 B;  1YNZ A;  2Y4X A;  2BTT A;  2LC4 A;  1T2K C;  2HL5 C;  1QWE A;  2BCC J;  2PNI A;  4QKU A;  3RL0 B;  2DW3 A;  3E1R A;  1M30 A;  3FIF A;  4FU6 A;  2XDP A;  1B07 A;  3CC2 T;  2PUK B;  1MMN A;  1BDD A;  2YUO A;  2DJZ A;  3QJ6 A;  3HRS A;  3RBZ A;  5LJ5 e;  3CCL T;  4KUI A;  2W10 A;  1BB9 A;  4FT4 A;  1GRI A;  4OMO A;  5D6X A;  1N9R A;  4HCK A;  2YHT A;  4A4E A;  2AEM A;  3BCC G;  2RD1 A;  2OTL A;  5GAN f;  3H1L E;  2DMO A;  2JS0 A;  2QEX A;  1RAB B;  1NTZ E;  3CX5 D;  3LWI A;  5CHX A;  3CXH E;  4H0L D;  2CSI A;  3O8V A;  2KVQ G;  4DBH A;  1H92 A;  1PWT A;  1JQQ A;  3L74 G;  5KLI C;  1CZQ A;  1W2B S;  1FDO A;  3PVL A;  2QQA A;  2QVA A;  5CO7 A;  1XNI A;  4ELY C;  4HYT B;  1HWT C;  4UB6 E;  1SQP J;  3FDR A;  1WMK A;  1WXT A;  4ASV A;  1XJW B;  4OGQ C;  3QXE B;  3TSW A;  4LDX A;  2V8K A;  1T3U A;  3L73 J;  2KLV A;  4XTU A;  2ED0 A;  1T6A A;  2FXM A;  4B6M A;  1LTS C;  2JO1 A;  4M7D D;  3QPH A;  5GJV B;  4OGC A;  1X6G A;  1RAF B;  3GG2 A;  2IG0 A;  1ZA1 B;  2VC8 A;  1L4A C;  2QQ9 A;  1QP3 A;  1S4X A;  3BCC E;  4EDF A;  4PJO A;  3E1S A;  4DJG A;  2QGF B;  4LUD A;  2BAS A;  4Z1M H;  3KBG A;  2C9N Y;  2D9T A;  1B34 B;  2HBW A;  4KGV B;  4M7D G;  3P8C E;  4C7N A;  2WTY A;  5FU6 B;  1VF5 D;  5LJ3 g;  3L74 E;  3DB3 A;  4GBQ A;  1GZL A;  4PK4 A;  1KHI A;  1L0N G;  1TU3 F;  2C0T A;  1Y9B A;  4EIJ A;  3EQ2 A;  3S4R A;  1NJI Q;  2QJP C;  2C0X A;  4IIO A;  4ZNX A;  3ZBD A;  3QWX X;  1OXZ A;  3CX5 E;  2DXB A;  1LNQ A;  3H1J G;  2OYH A;  5EC7 A;  3P8M C;  1NTM J;  2DTO A;  2DZC A;  1CSB A;  1FDM A;  1IFN A;  2BE9 B;  3JB9 D;  2ECZ A;  3UA7 A;  1YJ9 A;  3T97 A;  3SFE C;  1BYM A;  2QQR A;  2XU6 A;  1TOV A;  1AOJ A;  3N7N A;  1ZV8 A;  4ZN3 A;  4R55 A;  3A0B E;  1ACM B;  2K5L A;  1YTZ I;  1HJD A;  2RHZ A;  4J9B A;  1N2D C;  1RAC B;  2HZY A;  4M7D E;  2EW3 A;  3B71 A;  4M77 A;  2E42 A;  1HTL C;  3H1I D;  5AVX B;  1VQL Q;  3QYG B;  3SWY A;  2YSQ A;  3L72 J;  1PC0 A;  1Q81 U;  2HKQ B;  2LXB A;  1L0N E;  2B86 A;  6AT1 B;  2NUZ A;  4M7A A;  3TNU A;  3ZEH A;  1N73 B;  1TU0 B;  4KT0 E;  5KCH A;  2QM8 A;  1S9K D;  5BVZ A;  4LDU A;  3P7K A;  1QWF A;  3CL3 D;  3H1J E;  3U1A A;  2RHU A;  5AVV B;  3EH2 A;  4OGE A;  3WU2 H;  2OYH C;  1VQ8 A;  4XQ3 A;  3H1I G;  2OAR A;  2YO2 A;  5IT9 E;  1VYU A;  1SQB J;  2RJF A;  2GA1 A;  2E76 C;  1RAG B;  5GTH H;  2KSS A;  2ZGW A;  2V7Q H;  5H2F H;  2QA4 Q;  3Q5S A;  1KQS S;  1IHV A;  4J9F A;  3WU2 E;  1M2V A;  1XOV A;  2K79 A;  1OVV A;  1HH0 A;  3G4S A;  1PGO A;  2Y0C A;  3MEV A;  2P84 A;  4J9D A;  3GOX A;  3CC2 P;  5ECA A;  2GF7 A;  4QVZ A;  1PP9 D;  1L2P A;  2I1K A;  1GL2 C;  3HD7 A;  3HE4 A;  3JCM b;  5H2F E;  1WX6 A;  1QVG O;  3O6Q B;  4EYY Q;  3MUD A;  1IB8 A;  4ZKP A;  4IUU A;  1SQP K;  1A02 F;  2H43 A;  2RQT A;  3OJA B;  1M1K Q;  1HYO A;  3H1I E;  3M0S A;  5APV A;  4FYW B;  1PPJ G;  4I7Z B;  3S3M A;  4DCK A;  3H25 A;  2O01 H;  4A63 B;  1CKA A;  3QII A;  3VS6 A;  4C92 A;  1S9K E;  1DIP A;  1G1I A;  1J1D C;  2VWF A;  1AWW A;  3B5N D;  5LJ5 g;  1AD5 A;  1VQ7 Q;  2NRG A;  2KRN A;  1OMI A;  3PIO A;  1DEE G;  2KMT A;  2LQN A;  3VMZ A;  2Q6Q A;  3Q5P A;  3RNJ A;  2J5U A;  1I81 A;  3OA6 A;  1BE3 J;  1L0L G;  3HFN A;  1JY3 N;  5AW6 B;  2WSE H;  5LJ3 d;  3II6 A;  1QW1 A;  4N0A C;  3MZW B;  4K3A A;  2O01 E;  1SQV D;  5CCH D;  1KQL A;  5AVQ B;  1YJW T;  2PRR A;  1RE3 C;  3MHV A;  2QYZ A;  1N8R U;  3VYH B;  4C5H A;  3CLQ A;  2KZI A;  3JC2 2;  3G6E T;  4PJO F;  2H88 C;  2FO0 A;  3GF7 A;  4ANJ A;  1BU1 A;  1PPJ E;  3GNF B;  2CZ6 B;  3IAO A;  1PGQ A;  2OI3 A;  3B8E B;  2HPC B;  2WSE E;  3M56 A;  1UEB A;  3CC2 Q;  2A3L A;  2DLP A;  1VQ9 T;  3E1I A;  2E75 C;  2M02 A;  3CCL Q;  1C0M A;  4BY6 C;  8ATC B;  2GUS A;  2KGT A;  4M75 D;  2IFM A;  2QIW A;  1KYO I;  1OWA A;  4H13 C;  3OW2 A;  2NPS C;  3CCQ T;  1H8A A;  3NTN A;  1BDC A;  3W68 A;  5J26 A;  5K5G B;  2N1T B;  5AVR B;  2CPS A;  3V8K A;  2FZK B;  4P5N A;  3VS2 A;  1L0L E;  1WHK A;  1URQ C;  4EDU A;  3L73 D;  4E7H A;  3H32 A;  3AE9 C;  3TK1 A;  5GAN g;  4R4L A;  1GBR A;  2YIU C;  3BDU A;  4JLI A;  4Y99 C;  2RN8 A;  4J9E A;  1NU1 J;  4PJO B;  2A0F B;  2ZYA A;  3JCM f;  1YIJ A;  2PVO B;  3LH5 A;  1NKN A;  4D6T J;  2DE0 X;  1G3T A;  1M3A A;  2PP6 A;  2LDM A;  1SFC A;  3CPF A;  4W80 A;  1DD4 A;  2CUD A;  1GBQ A;  4M77 F;  1BBZ A;  4IUQ A;  1SQB K;  2H8H A;  3RL0 D;  2V8I A;  1HGZ A;  1RLP C;  5KJ7 C;  5TJH A;  4M7A F;  1JB0 E;  4AG1 C;  3M9B A;  1A02 J;  2EJF A;  1NE8 A;  1WPY A;  3T97 B;  1LTG C;  1RQV A;  4LE9 A;  7AT1 B;  4RO0 A;  4HVV A;  1NTM D;  2KE9 A;  1DEB A;  5GAM j;  3NMD A;  4NPF X;  4PJ0 H;  1K1Z A;  2JXB A;  3W67 A;  1YIT P;  4RTY A;  3GW6 A;  4QVD A;  4DBQ A;  1EZV D;  1VQM P;  1N86 A;  3JCM e;  4WWI A;  2JTE A;  3MEA A;  1UUE A;  2OTJ T;  2OTK E;  3L75 G;  4M7D C;  2AHJ B;  1R0C B;  4M77 B;  2ZT9 C;  5DM7 R;  1KJW A;  4MDW A;  2FXP A;  3NMZ C;  3EFR A;  2HSP A;  4HT9 A;  3RUX A;  1N8R R;  2YT6 A;  4FT2 A;  3PMI A;  4R4M A;  4M7A B;  3TNU B;  3J80 E;  1GCQ C;  2E64 A;  1M1G A;  3MCA B;  3U23 A;  2YO3 A;  1JJ2 P;  3FC3 A;  2H89 C;  3MJX A;  2DA9 A;  1NH4 A;  4FSS A;  2LQK A;  5LJ5 d;  3UF4 A;  4BI3 A;  3AT1 B;  1NTK J;  1ZP0 C;  3G71 P;  2AKL A;  1K9M U;  3TGU D;  3D6Z A;  4DEY A;  4IUV A;  1KHC A;  3BE3 A;  1EIF A;  1SSF A;  1OW8 A;  2KZJ A;  2M51 A;  2E10 A;  4WY4 A;  2KRS A;  2QG4 A;  1MMD A;  4C92 F;  1YQ3 C;  4YTP C;  3L75 E;  4XU3 A;  3E7K A;  5AVY B;  1M2V B;  1VL2 A;  4PD4 D;  2GGR A;  3R6O A;  1HVV A;  5APY A;  2ZVN B;  3REA B;  1DX7 A;  1G3W A;  3JCM c;  1T0H A;  1SQX D;  1NYF A;  3HD7 B;  2FB7 A;  1WDX A;  3C95 A;  5GAN 2;  1HF9 A;  2P0P A;  4C0D B;  4RG2 A;  1BCC G;  3M0D A;  1EDI A;  1BK2 A;  1N7S D;  4WBA A;  4FL6 A;  3AED C;  1KSW A;  1J1E C;  2MI6 A;  2OYI A;  1CKB A;  2I8D A;  1UDL A;  3UWN A;  3HP9 A;  3L71 J;  1N9S A;  2DXU A;  4C92 B;  2P4R A;  4IIM A;  1Q81 C;  1SQQ G;  2K9J A;  3CBP A;  1MZ9 A;  2FYN B;  5GAN d;  3NTH A;  2EJ9 A;  3A5T A;  1W4S A;  1YP5 A;  4GT1 A;  2DEQ A;  1C6V X;  1NU1 K;  1OI1 A;  1R8E A;  2XDJ A;  2ZCF B;  1XTG B;  3OBY A;  4XE5 B;  1CSK A;  3KXD A;  3HUS A;  1PD1 A;  1YI2 P;  2RN0 A;  3VMY A;  2AIR B;  2JMC A;  2MF2 A;  3MP6 A;  3KYQ A;  1W70 A;  3A8M B;  1BCC E;  4RCB A;  4PV1 C;  5IXB A;  3CC4 P;  5E79 E;  2QQB A;  4EMG A;  4FM4 B;  2VV5 A;  4XFJ A;  1ZR2 A;  1X6O A;  3JV3 A;  1ARK A;  2KI7 A;  4GOD A;  4DBR A;  1WI7 A;  3A1P A;  2MYS A;  1SF9 A;  2GQI A;  2GFU A;  1KD1 U;  2V1R A;  1JXO A;  1WJR A;  1OVR A;  1SQQ E;  3EGU A;  1PKT A;  4VUB A;  3CCS P;  1VQK P;  1BSN A;  2QGG A;  2K6D A;  2EYY A;  3HRT A;  3V2Q A;  2MJZ A;  1UIX A;  1VQO T;  2E3I A;  1WHG A;  4AFU C;  1SPK A;  4EMK A;  3P8B B;  1H3Z A;  3CC2 A;  3CCU P;  2A36 A;  2DL5 A;  2WSC H;  3H32 B;  4IUP A;  1YJW Q;  2XU8 A;  2VVK A;  3I56 P;  3CCL A;  3HUS C;  1HJB A;  3CCJ P;  3A98 A;  4H44 D;  3RKX A;  3UA6 A;  3G1J A;  3G6E Q;  1TUG B;  4OMF B;  1VQ5 P;  1C1A A;  2LNH B;  3M57 A;  4ME7 A;  3CCE T;  1PL5 A;  4BWN A;  4XTV A;  5FWB A;  3TVT A;  5I11 A;  1SFC B;  2BZY A;  3CMA P;  3V2N A;  3SSU A;  2C0W A;  3HRU A;  1P84 I;  1MND A;  5A2Q E;  2C0I A;  2R5A A;  4E7K A;  3EG1 A;  1VQ9 Q;  2QEX Q;  1NTK K;  4L59 A;  3L70 G;  1NPP A;  3FLG A;  4BAC A;  2CRE A;  2PAJ A;  2IZ0 A;  3CCQ Q;  2X3X D;  5CKF A;  2FKW B;  4HXJ A;  2R5D A;  1N8R C;  3U59 A;  1D0Z A;  3DLM A;  1W2B P;  3BCC J;  1UB4 A;  2JNG A;  1WFW A;  2QJK C;  4WB4 A;  4LD9 K;  3S6W A;  4AT1 B;  5APQ A;  1LJ2 A;  1M3B A;  3KZI H;  3SFD C;  2RI5 A;  3JCM g;  4FSX A;  5GAN 8;  2KB7 P;  2SRC A;  3L74 J;  2EYQ A;  2DX1 A;  1I5L A;  1S5L X;  2CK3 H;  1U1S A;  3A7O A;  1PNJ A;  1NEB A;  1KG1 A;  3PP5 A;  4UB8 E;  1S72 P;  3R6N A;  2W27 A;  1JTH A;  1VIF A;  3CME P;  2RK1 A;  4JPB W;  2MKV A;  1D7M A;  1AZG B;  2DF6 A;  3O5Z A;  4RES B;  3KZI E;  4AQR D;  1OEB A;  1M1J A;  3P32 A;  4NL2 A;  3CWB G;  3L70 E;  3T9N A;  2HLO A;  1O75 A;  1ZRT D;  4GLM A;  3RKY A;  3M0A A;  2W83 C;  3FB9 A;  5CKH A;  1KD1 R;  2CPB A;  1VA7 A;  3H0I A;  2F2V A;  2G6F X;  2L3S A;  2N1T D;  4MML A;  2GFA A;  4MZM A;  1WGS A;  1USD A;  3M9Q A;  1AV1 A;  4YXD C;  1KB9 I;  2K3Y A;  3JRZ A;  2OTJ Q;  2HFE D;  4X9C A;  4PJO D;  4WY4 B;  1TXQ A;  5FLX E;  1Q7Y R;  4PJJ A;  1L0N J;  3H1K D;  2MK5 A;  4C8Q A;  5CJ0 A;  2WPQ A;  1VQP P;  2P10 A;  4KUD K;  4KT0 J;  2ZVO B;  2HOD A;  3V5B A;  1AZE A;  1K8A U;  5IAY A;  4OMM A;  2X4W A;  4B86 A;  3H1J J;  2LRQ A;  1JMM A;  4LDV A;  4N4I A;  1QGK B;  2ZPG B;  4LD6 A;  3QYH B;  3L36 A;  1VQ6 T;  2L2P A;  2X4J A;  1QVG A;  3CWB E;  4U3F D;  2JM8 A;  1NAF A;  1GU5 A;  1EXJ A;  2M0O A;  4FYV B;  4II1 A;  1EQ7 A;  2M9U A;  3OYA A;  2AZV A;  3OMG A;  1IFJ A;  5CKE A;  2OYI B;  1I0C A;  5IHN A;  2DD5 A;  1AQT A;  1X43 A;  1UGQ B;  4M4Z A;  2K9J B;  1UEC A;  2KNC A;  2YUP A;  3JAM E;  1ZRT E;  1NTZ K;  2B88 A;  2GCX A;  4M75 F;  2EQJ A;  1U3O A;  1WQW A;  4BDZ A;  4QW2 A;  3TU4 K;  2V7Q J;  4M77 D;  2IYO A;  3RKW A;  2IBZ G;  1S1N A;  4KHX A;  2KYV A;  2VGN A;  3X24 B;  3QSU A;  3M55 A;  5KLV D;  2FPF A;  1K9M C;  1YIJ P;  4L73 A;  5GAN 7;  4KBM B;  1KQS P;  4M7A D;  4JUV A;  5FRN A;  1LTJ A;  1ZN5 A;  1O9S A;  2ZAE B;  4A7P A;  1VQO P;  5C0M A;  3S3O A;  3G4S Q;  1BI3 A;  2K2V A;  1SVF A;  1PV3 A;  2D1X A;  3QO3 A;  2KBT A;  5KKZ B;  3L1A A;  2KI7 B;  5KYW A;  2P7J A;  3HSB A;  3AE1 C;  3MGN A;  4YPC A;  1S5L H;  2AEJ A;  1PIX A;  1H8K A;  1LVK A;  5APW A;  1SLQ A;  3AE2 C;  1KYO D;  1IGU A;  3P8H A;  1KC8 U;  1N7S C;  2L91 A;  1M3C A;  2C0O A;  4XU2 A;  3JCM d;  4UC4 A;  5GAM e;  2O01 J;  3VRY A;  3S9O A;  1Y57 A;  3Q1M A;  4J9H A;  4F16 A;  1RF1 C;  1Q82 R;  1OW6 A;  2IBZ E;  4EMK B;  1UGP B;  2JTM A;  1MNE A;  1S5L E;  1R77 A;  1LTA C;  4TLF A;  1JXM A;  2FYZ A;  2E5Q A;  3LLR A;  4Y92 A;  2WQY C;  4A54 A;  3B4S A;  2E70 A;  3PLN A;  3HD7 D;  1H0T A;  3M5A A;  1NLP C;  1TSF A;  2A7Y A;  3QUI A;  1AHJ B;  4RUG A;  4A4H A;  4BI4 A;  2O1K A;  3UPU A;  2R44 A;  2FYU G;  4RTX A;  4PLI A;  2WSE J;  1RQU A;  4WF2 A;  1AWJ A;  3D6Y A;  1YJW A;  4ZKU A;  1SKU B;  3QJY A;  1PFI A;  3A8G B;  2PVD B;  2L5G B;  2YMY A;  4JJC A;  3CXH H;  5L23 A;  2XHC A;  2WPR A;  4C92 D;  2IDB A;  1OPK A;  3G6E A;  2AT1 B;  2X3W D;  1L0L J;  2P2U A;  1FMW A;  4UB6 H;  1L4A A;  4OB0 B;  1OOT A;  2K3R A;  1USE A;  2GUV A;  1XQH A;  2EGE A;  2WSF E;  1FWZ A;  1CI6 A;  4J6W A;  3CCR P;  1M57 D;  3RMQ A;  4XU1 A;  1L0N K;  1VQ9 A;  2V26 A;  5C39 A;  3PH0 A;  1ZUK A;  3CPW S;  3E9F A;  1FYN A;  4D6W A;  2XNX A;  3I35 A;  3CCQ A;  4EOT A;  1KD1 C;  2A37 A;  3BRT B;  4MMK A;  3CCE Q;  1DH3 A;  1UJ0 A;  1ZLM A;  1IO4 A;  2FYU E;  1UHF A;  1MHN A;  1UGS B;  2OAU A;  1K04 A;  3IR9 A;  3A2A A;  4R56 A;  1OPL A;  4DA4 A;  3OYH A;  3ITK A;  3NPF A;  1JTH B;  4FCY A;  4C8Q F;  3VS5 A;  2IYP A;  3H0H A;  2LZ6 B;  4M78 F;  3AEG C;  4H44 C;  1M1J B;  1M8O B;  1WJS A;  2LQ8 A;  5CVI A;  1SG5 A;  3OSS C;  1FMK A;  1YCY A;  1BGY D;  1AJY A;  2KS1 A;  2LT4 A;  3GP8 A;  3EHR A;  3CX5 H;  4PFP A;  5CQX A;  1VQN T;  1UHC A;  4N4H A;  1KC8 R;  2MOX A;  2KUB A;  1VQ6 P;  2KYM A;  3CBM A;  2YNY A;  3AE4 C;  1QKW A;  3H1H D;  2F2X A;  1PKS A;  3HL8 A;  5L8R E;  1EDL A;  2E1H A;  2AK5 A;  2CT3 A;  5KE2 A;  2XID A;  2J58 A;  1VQ5 A;  1QVP A;  4IKF A;  4C8Q B;  1P92 A;  2DYI A;  3PMT A;  1ZSZ A;  1YCS B;  4M78 B;  1H89 A;  3A0B H;  2HOD B;  1HD3 A;  5KAI E;  1SEM A;  1ZX6 A;  2DD4 A;  1FJP A;  2W0Z A;  2J59 M;  3CQT A;  5KTB A;  1Y47 A;  1MV0 B;  1U8R A;  2OTJ A;  1M90 R;  1RAD B;  1HGV A;  2PFX A;  1VOM A;  4F14 A;  3CCM P;  1MUZ A;  4HCC A;  3ULR B;  2CZ0 B;  1PM3 A;  2KY9 A;  3AEB C;  3GLM A;  5AW5 B;  1YHQ P;  3A5Z B;  2NZ2 A;  1NLO C;  4F7U F;  5I22 A;  2SPZ A;  1KIL D;  1X27 A;  1EDJ A;  4NPE A;  5IXF A;  2RI2 A;  3LW5 H;  3LGF A;  3JB9 G;  3L75 J;  1SSH A;  1D1A A;  2KNC B;  2ED1 A;  1OUL A;  2YUQ A;  3A0H E;  1GL2 A;  3WUT A;  1YYC A;  3H0F A;  1TG0 A;  3EG9 A;  2KSE A;  4C0G A;  2Y0D A;  1Q81 Q;  2LJ0 A;  1ZSZ C;  4C5E A;  1JBM A;  1GDT A;  2Z5I A;  1KFN A;  2BUD A;  3JB9 H;  1JM0 A;  3QKJ A;  2AKK A;  3LW5 E;  1YIT T;  4ATO A;  3S3N A;  1VQM T;  4ELZ C;  1LTJ B;  2CP0 A;  4F7U B;  2IZ1 A;  5TIS E;  2Y9Z A;  3NHN A;  2CGH A;  3D71 A;  1H64 1;  1QEX A;  2QE7 H;  2BEZ F;  1LGH B;  2A06 D;  1L0L K;  1I8F A;  2IPP A;  1TUC A;  4C46 A;  2XIC A;  2QAS A;  3HFO A;  3CXC A;  1K8A C;  2P67 A;  4Y28 E;  4HCB A;  2QXF A;  4OMQ A;  4YTL A;  3PIP A;  1RE4 C;  3L2Z A;  3NFQ A;  2O4X A;  4CC3 A;  1TWB A;  3ASK A;  3EHQ A;  4N0A A;  5AW9 B;  2EQI A;  2VXE A;  4WY4 D;  2HR3 A;  5DLO A;  1FXX A;  1RE3 A;  4FIB A;  2R57 A;  4C0Z A;  3G71 T;  1KIL E;  4NPD A;  4OVA A;  2BKD N;  1BCC J;  2L0A A;  1R5S A;  2KXP B;  1FC2 C;  1TS9 A;  3I5S A;  1NM7 A;  5KLI B;  3EH1 A;  3ABV C;  5CCG C;  2EKO A;  1VQ4 P;  3VMX A;  2JW4 A;  1H0T B;  3CC7 P;  1PP9 G;  4NOY A;  3WUU A;  1P84 D;  1JCD A;  1LJO A;  5KCO A;  4KGX B;  4OGQ B;  1SQQ J;  5LJ3 h;  2P58 A;  2LJ1 A;  2MWO A;  2JJ9 A;  1XTD A;  1LTI C;  2RJE A;  2RHI A;  2NPS A;  1KQF B;  2BCC D;  3I55 P;  4FYY B;  5FRO A;  2KDS A;  1NJI R;  3RK2 C;  4JYB A;  2DK3 A;  2WSS H;  1URQ A;  2EGC A;  3E9G A;  1D0X A;  4DZO A;  3PFS A;  1L4A B;  2QDL A;  2ZPB B;  3H9N A;  9ATC B;  1WXB A;  3JCM X;  4A4F A;  3GMA A;  3Q1J A;  2I1J A;  4FW2 A;  2D2C C;  1CI6 B;  3CCV P;  3JCM P;  1PSF A;  2Z4E A;  1M2O A;  2KXC A;  2DET A;  3LIE A;  3RER A;  2W6B A;  1N8R Q;  1RUW A;  4HVW A;  1B3Q A;  4CC7 A;  2JMA A;  1VQO A;  4ORZ A;  1M5Q 1;  3I5C A;  3EGD A;  1TH7 A;  2QJP B;  1VQN P;  1PP9 E;  1SQV G;  5I21 A;  1KC8 C;  4K35 A;  2WSC J;  1MUU A;  4BD3 A;  4KRT A;  5LJ3 j;  2ZJS E;  5DLQ E;  2KP8 A;  2JWD A;  1G8X A;  5KJ7 A;  3RK3 D;  3L2Q A;  2AEF A;  1YI2 T;  5APT A;  3VS0 A;  1SQP D;  5KYU A;  1D1C A;  3SHW A;  1W2E A;  1KQG B;  1GW3 A;  3CCE A;  3NTI A;  1LWU C;  2KK7 A;  1IZN B;  1TTH B;  3CC4 T;  1FZB A;  4HB1 A;  3QZ9 B;  1YN8 A;  2EKH A;  2KS1 B;  2M16 A;  5GAM h;  1LT9 C;  1Q86 U;  3PGG A;  1YTZ T;  2WZ7 A;  3M4G A;  2EWN A;  3WVE B;  3OYI A;  4M75 G;  1KN7 A;  3R2P A;  1KB9 D;  2DXT A;  1T8Z A;  2O9S A;  1ZBJ A;  4M7D A;  3V4W A;  4J9C A;  3TQ7 P;  3H6P A;  2HD0 A;  1J3T A;  2FXO A;  3TYY A;  3PVQ A;  5FU7 C;  1NKZ B;  4C7N B;  1I07 A;  3HHT B;  3CCS T;  2K5I A;  1VQK T;  1FZF A;  3C4S A;  3MEW A;  3L73 G;  4GIF A;  3VS4 A;  2ATC B;  3KPE A;  1SQV E;  1K9A A;  3OS1 A;  1GCQ A;  2BZ8 A;  2E74 D;  1UFF A;  2RMO A;  3EG0 A;  2M3B A;  2KXD A;  2PZ1 A;  3CCU T;  3PTZ A;  3L70 J;  1FZE A;  3IFM A;  1X22 A;  2A45 G;  2OYH B;  4H0L C;  1NGM B;  3I56 T;  3CCJ T;  2XDD A;  5APU A;  1SHF A;  1XTC C;  2RQR A;  2D0N A;  4J7F A;  2DER A;  2Q9I A;  3UT1 A;  2E76 B;  3X26 B;  1VQ5 T;  1UTI A;  1RL2 A;  4KH0 B;  4IOI H;  3CMA T;  2K37 A;  3RK3 E;  1PGP A;  1WNL A;  4JS5 A;  4M75 E;  2A45 H;  3M4Y A;  2D6F A;  5IHK A;  5GAO p;  1JRI A;  3M0Q A;  2CZ1 B;  1Q90 D;  1PGJ A;  1IJD B;  4WVZ A;  3HE5 A;  1Y96 A;  1RAA B;  1NTM G;  2XD0 A;  3L73 E;  3QDF A;  3SDZ A;  1GL2 B;  1SS1 A;  3EG9 B;  2GTJ A;  1EZV G;  2L3R A;  1JCC A;  1KB9 E;  4LC1 A;  1WZO A;  2LQW A;  3CWB J;  3L72 D;  1JY2 P;  3EAE A;  1F1B B;  1FZC C;  3OYF A;  1G83 A;  1SQQ K;  2A08 A;  1JY3 P;  2J7I A;  8AT1 B;  1Q95 G;  1VF5 C;  1T3L A;  2JJL A;  1HK9 A;  1KV4 A;  1YWP A;  2IVW A;  3CI9 A;  4YXW H;  1J1D B;  1PSE A;  1WQ7 A;  2RQU A;  3MP1 A;  1K9M Q;  2QG9 B;  4OWF A;  1S72 T;  1FE6 A;  1SQB D;  1VQ6 A;  1VPC A;  3CME T;  2DXC A;  1FOS E;  4JJN K;  3RK2 B;  2K7A A;  3OYC A;  2AXT H;  4E7L A;  2WPS A;  3FJ5 A;  2O4X B;  4BE1 A;  1Q86 R;  3TGU G;  2JVV A;  1NTM E;  3EWK A;  2OGU A;  2R32 A;  3ER0 A;  1BI1 A;  2EGA A;  3MPU B;  5HK0 A;  3KQG A;  4C8Q D;  1EZV E;  3HE4 B;  1KIL C;  5AYF A;  2IIM A;  4PL6 A;  2KIK A;  3PHL A;  2RI3 A;  3M54 A;  4M78 D;  3D7S B;  2HYN A;  1YIT Q;  4OMP A;  3TSZ A;  1WHL A;  1VQM Q;  4JRK A;  4N78 D;  4JZ3 A;  3LYI A;  1W2B O;  1ZUY A;  5GAO m;  3AHU A;  1OX3 A;  2AXT E;  1FU1 A;  3JCM V;  2K88 A;  2CDT A;  2VAS A;  1SQX G;  4N4G A;  4OH8 B;  1SRL A;  5KYN A;  1QL2 A;  4E7I A;  3GBQ A;  1RI0 A;  2RM4 A;  1X2K A;  1VQP T;  1W6X A;  2W6A A;  3M0P A;  2E75 B;  3L72 E;  1JEG A;  4BY6 B;  1YJN P;  4V2S A;  4H13 B;  5IHI A;  1M4Z A;  2NPS B;  5E79 H;  2I2L A;  1QVF S;  4PKC C;  4FYX B;  2M5A A;  1URQ B;  3RBB B;  4W7Y A;  3TGU E;  3KFV A;  4U7J A;  3CD6 T;  2FFD C;  1G3Y A;  4BB7 A;  2YIU B;  3G71 Q;  1K76 A;  4Y99 B;  3RDV A;  1SQB E;  5BU8 B;  1QLY A;  1RF0 C;  1FZG A;  2EPD A;  1BE3 D;  2L3P A;  1IFP A;  2XI9 A;  1H88 A;  5GAN j;  2XDB A;  3M53 A;  2VRS A;  4PD4 E;  2DBM A;  5DY9 A;  3AEE C;  3GPL A;  5CCH A;  3EGD B;  2YXQ B;  1SQX E;  3WUV A;  1T2K D;  2Q3I A;  2OTL P;  4JLG A;  2CKK A;  3BW1 A;  2CUB A;  2ZPI B;  3M0U A;  3ZFJ A;  1EDK A;  3AEF C;  3H41 A;  2VYT A;  1D3B A;  2QDY B;  4WTO B;  4PJN A;  1KD1 Q;  2GBQ A;  5KYU B;  2M0Y A;  1YIJ T;  1BI0 A;  3I5R A;  5FRM A;  3LGL A;  4F17 A;  5KE3 A;  2KRM A;  1MKM A;  3F89 A;  2R3C A;  3H1L J;  3IN6 A;  2NUP A;  2CP7 A;  1X6B A;  4JS4 A;  1Q7Y U;  2H7H A;  5CQY A;  1NTZ J;  1U06 A;  5GMK h;  2IX7 C;  1WXU A;  3B5N C;  1WHM A;  2YRC A;  2EYX A;  4MN4 C;  2QQS A;  4AG2 C;  4W7Z A;  3G9R A;  1S1C X;  5CBO A;  1KMI Z;  1VYT A;  2WT7 A;  4M7D B;  2ZT9 B;  1X75 C;  1KFZ A;  2Q5U A;  3FX0 A;  2RH2 A;  2FZG B;  1NU1 D;  2FY8 A;  2KR3 A;  2Q3E A;  3SWN C;  4JJD A;  3GLX A;  2ZPE B;  1Z9Q A;  4D6T D;  1NHL A;  3G7Z A;  5CCH C;  2DL7 A;  5AW7 B;  1YI2 Q;  4RTZ A;  1NEG A;  1BCO A;  3GHG C;  1S2E A;  5CR2 A;  3CPW P;  1D0Y A;  1X69 A;  4RTU A;  2QJY C;  1OW7 A;  3RR6 A;  3CC4 Q;  3M91 A;  4UB8 H;  1NG2 A;  3RL0 g;  2BZX A;  2SEM A;  3FJP A;  1AFO A;  2QTX A;  3LX7 A;  5EG2 A;  1BIA A;  3M06 A;  5GMK j;  1IGQ A;  3SD4 A;  1MV3 A;  2N9B A;  1KQS O;  2YKQ A;  3RK3 C;  2CT4 A;  4RTW A;  4LUE A;  1AVZ C;  3AE5 C;  4M75 C;  3VJP A;  1QL1 A;  3CCS Q;  1VYV A;  1VQK Q;  2LCC A;  1YJ9 P;  4LXC A;  4XTZ A;  2ENM A;  5GMK m;  1OU9 A;  4GDO A;  2D8H A;  2L89 A;  5I2S A;  3HE5 B;  1Y96 B;  1QCO A;  1BIB A;  3FEO A;  1VQN A;  1OZH A;  1DD3 A;  4LN2 A;  2MIO A;  5A0L A;  3CCU Q;  1R5L A;  3VYG A;  4IL6 E;  3N4X A;  1QVG S;  3CCR T;  3OYG A;  3I56 Q;  3OBW A;  3A8H B;  3CCJ Q;  2X51 A;  1Q86 C;  1J1E B;  4ZMD A;  3DKM A;  2RKL A;  1KQ1 A;  1VQ5 Q;  1YBK A;  5LJ3 f;  2DNU A;  3V7R A;  2E74 C;  1FBM A;  3CMA Q;  4ZTF A;  3CEY A;  3RL0 C;  4N6J A;  2LCL A;  2W6J H;  4PJL A;  1NTK D;  3VUZ A;  3P8D A;  1Q82 U;  3N5B B;  2P0Q A;  2K57 A;  1K0S A;  1VQ8 P;  2DVJ A;  3L2R A;  3DB4 A;  5CAI A;  1SHG A;  1LP1 A;  2CP3 A;  3O8Z A;  2KRO A;  1G1J A;  1NBE B;  1GK6 A;  3TEE A;  1AQ5 A;  3M0R A;  2HSE B;  4OMN A;  1K8A Q;  3LW5 J;  1WLP B;  4PJO G;  1OV3 A;  2HAX A;  2ITA A;  4PV1 B;  5D6W A;  1B34 A;  5CK9 A;  1TUD A;  3H1K G;  1WRG A;  2ZYD A;  3CD6 P;  3FXD A;  3PT9 A;  4E6R A;  5A0D A;  4EPC A;  4BXL A;  5LJ3 e;  4XTX A;  3HPW A;  1VQL T;  4JQ0 D;  4OF1 A;  2O9V A;  1OX9 A;  2E76 D;  1IFI A;  1S72 Q;  2CZ7 B;  4Y28 J;  4QQ6 A;  3JB9 J;  1N7S A;  1KZU B;  1ABQ A;  2WVR A;  4U3F G;  3CME Q;  1YIT A;  1VQM A;  2QK0 A;  4IUT A;  4JDS A;  3VP9 A;  3L71 D;  3AE8 C;  3VS3 A;  1RF1 A;  3CCM T;  5GJW B;  2FRY A;  5AW8 B;  5GAM f;  2CP2 A;  2KSJ A;  3QBY A;  2M5A B;  1AWX A;  1K4U S;  2G8Y A;  4OB2 B;  1SRM A;  2FYU K;  1YBY A;  4JF7 A;  3FXE A;  3HUS B;  3VS7 A;  2AZS A;  1YHQ T;  2J6F A;  1K73 U;  3V8L A;  4JPZ B;  3LID A;  2QA4 T;  3H1I J;  5KYX A;  1WHH A;  4PJO E;  2EJG A;  3USS A;  1JJ2 A; 
#chains in the Genus database with same CATH homology
 4M77 G;  1WT6 A;  4I2L C;  4RKU E;  5FU6 C;  5I2M A;  3G71 A;  2JEE A;  4M7A G;  2KOG A;  1D3B B;  4XU0 A;  4QQD A;  2HNI A;  4O9B A;  1M1F A;  1HXD A;  2XK0 A;  4TVR A;  4JRP A;  4OB1 B;  2RK2 A;  3L37 A;  4J6X A;  4GLK A;  3OYJ A;  1NO4 A;  4Q5W A;  4PNO A;  1KFM A;  3RMS A;  4DOV A;  1Y71 A;  1VQ7 T;  1X79 B;  2WT7 B;  4L5G A;  1M90 U;  4M77 E;  3J7A F;  3GIB A;  2WSF H;  3OAK A;  2BIV A;  3OB9 A;  5GAN 4;  3VUB A;  4M7A E;  1JO5 A;  1N73 C;  2JZ2 A;  3WVD B;  1GU4 A;  1SP4 A;  3J81 E;  4HKE A;  3H8Z A;  2B8A A;  2NPS D;  2XG8 D;  4QVC A;  1FX7 A;  1VQ4 T;  3CC7 T;  5AW1 B;  1URQ D;  1ZBX A;  3MEU A;  4C92 G;  1YI2 A;  3QDR B;  4JRQ A;  2R5M A;  3BY7 A;  2JOY A;  2EFI A;  3BFM A;  1GXI E;  3QHS A;  3I55 T;  4BE0 A;  3CC4 A;  3P8C D;  4N3Y B;  3C12 A;  1HUC A;  3KXT A;  2P1J A;  5GAO q;  3BDL A;  1Q7Y C;  2M1H A;  3CCV T;  3CCS A;  1VQK A;  5KJ7 D;  1X01 A;  3OQ5 A;  4Z02 A;  1JNM A;  4ZGJ B;  1Y07 A;  3MET A;  4E7J A;  2F5T X;  4J83 A;  4RMO A;  2HPC A;  1M9S A;  3CCU A;  1GK4 A;  4C92 E;  2ZXE B;  4IFM A;  3I56 A;  3TSI A;  3CCJ A;  3NTK A;  1WJQ A;  3OYL A;  4IFF A;  3GNG A;  4Y91 A;  1MGQ A;  2N1T A;  1I4K 1;  3M59 A;  3CMA A;  1NOH A;  1SFC D;  5GAN e;  1FJK A;  2YRV A;  5GMK i;  2DVE A;  2KAF A;  3VN0 A;  3QG1 A;  2LTO A;  3CPW A;  2YKO A;  4J6Y A;  2LKM A;  2LT1 A;  1NJI U;  3HKS A;  1W2B A;  5CCA A;  4LGD E;  3OS5 A;  3MHX A;  3CXC S;  3OMC A;  1V29 B;  2XKO C;  1RE4 A;  3JCM J;  1N7S B;  2C9L Y;  2ZZD A;  5AVT B;  1RF1 B;  3MIW A;  2PQW A;  5AW2 B;  2N1T C;  1S72 A;  3U1C A;  1IZ6 A;  1UGR B;  3CME A;  3A8O B;  5CCG A;  2RHX A;  3BVH A;  4PJO C;  5GAN 6;  4B9W A;  5GAO r;  1Q82 C;  1ZLL A;  4M3L A;  2MAM A;  4XTW A;  3MO8 A;  1IK9 A;  4MZT A;  5GAM g;  5GMK e;  3VOP A;  1VQP A;  3SB2 A;  1SQV K;  2E12 A;  4QQG A;  2R58 A;  5AVW B;  4NL3 A;  5CKB A;  2DIG A;  3CD6 A;  1VDF A;  4M77 C;  1G2C A;  4MZP A;  3OYK A;  5A0G A;  3V7S A;  5CJ4 A;  3OW2 S;  1M1K U;  4M7A C;  1LWU A;  3OYB A;  2WIT A;  1N27 A;  1K73 C;  5HK3 A;  2DZ9 A;  4EMH A;  1LT9 A;  1N6A A;  3C9I A;  5KH6 A;  2DAQ A;  4RCC A;  3MD0 A;  1JY2 O;  1FAV A;  1OYX A;  2IFN A;  4CRI A;  3LH0 A;  1JY3 O;  2QM7 A;  4IUR A;  1YIJ A;  2HG5 D;  2RA2 A;  5LL6 S;  1KQS A;  1YJN T;  3OYN A;  4L6V 5;  4IFD K;  2PVG B;  1JY2 N;  2Y4Y A;  1ZR4 A;  1NWQ A;  1VIE A;  1X9V A;  5M9O A;  3HD7 C;  1IC2 A;  3PNW C;  3UDC A;  4C0D C;  4I6M C;  5AVZ B;  4C5G A;  3L2U A;  4MDX A;  2Y90 A;  5AW0 B;  1G3S A;  1JOC A;  2H3J A;  1NTM K;  1X8Y A;  3RES A;  1M90 C;  1N7L A;  2OTL T;  5BU5 A;  2E41 A;  4C92 C;  2QEX T;  3GF5 A;  1KQ2 A;  2JTF A;  4OP0 A;  5GAN 5;  4DQ2 A;  1Z56 A;  5CKD A;  4HCZ A;  1FZC A;  4HT8 A;  1GD2 E;  2K4Y A;  3JCM Q;  3BAS A;  3E19 A;  3OYM A;  4J8O A;  3SFM A;  3HTK A;  1BKB A;  1NPR A;  2E43 A;  3OSV A;  3VKI A;  1M7L A;  2X35 A;  3V8J A;  5GAM d;  3CCR A;  3X25 B;  4XAX B;  3OYY A;  2DIQ A;  3ME9 A;  5APX A;  5LJ5 h;  4DOW A;  3DLL A;  2Z5H A;  1KIL A;  4I1L A;  2YLC A;  1SQX K;  1ZHI A;  3UIA A;  3EFG A;  1GW4 A;  2DO3 A;  1M8V A;  3EFS A;  2XV5 A;  1YJ9 T;  4BDY A;  5APS A;  3WMM 0;  2L8D A;  1SFC C;  2X4X A;  1IFD A;  5J3B A;  2LX9 A;  4XK8 E;  1VUB A;  3URG A;  3L2W A;  2ZPH B;  2FFD A;  5LJ5 j;  1VQL A;  3LWH A;  4J7I A;  4O6J A;  1RF0 A;  2GM4 A;  3OA7 A;  2WWW A;  1NJI C;  2H8P D;  4J5Y A;  2YLB A;  3HRN A;  5GAN h;  1U1T A;  3CCM A;  1VQ8 T;  3CBO A;  5AW4 B;  4C8Q G;  2KK4 A;  1YHQ A;  1G2C B;  4M78 G;  2QA4 A;  2P0K A;  2YKP A;  1LWU B;  2EQK A;  3KDP B;  3JB9 I;  3FRN A;  3G4S T;  1LT9 B;  2VXF A;  3B5N A;  2JUF A;  4KUL A;  5HKC A;  2RO0 A;  4LDW A;  3X28 B;  2PU9 B;  5FU7 B;  3SWN A;  4HA8 A;  2RB6 A;  4WY4 C;  4M7D F;  4C8Q E;  2XKM A;  3OS2 A;  2FVU A;  5GAO n;  3H6Z A;  3VTP C;  3GHG A;  4M78 E;  4LDY A;  3V7C A;  3INZ A;  2ZPF B;  4N78 E;  1VQ7 A;  3QZ5 B;  3JSC A;  4ZN1 A;  1OZ3 A;  4F7U G;  3L35 A;  3M0D C;  4HH2 A;  1GTW A;  1BI2 A;  1Y7X A;  2DPP B;  2OYI C;  5AW3 B;  4M75 A;  1LNX A;  4RG8 A;  4A53 A;  2E6N A;  2D0Q B;  2LVM A;  3M9H A;  1RY3 A;  2FYK A;  1VQ4 A;  1M1K C;  3CC7 A;  2FL7 A;  3JB9 F;  1JUN A;  3V2P A;  1QVF A;  2JN0 A;  3PTA A;  1IRE B;  4ZTJ A;  1FZC B;  3NFC A;  2M8R A;  3I55 A;  2VGM A;  3NXS A;  5AVU B;  2MWP A;  3HTK B;  3V4Q A;  2POH A;  4F7U E;  4CI0 C;  1MFZ A;  5IN1 A;  1L4A D;  2DTI A;  3C94 A;  3MP8 A;  2RHY A;  2WSC E;  3CCV A;  3L2V A;  1QP2 A;  2K3X A;  3VV0 A;  4GKG A;  2R5B A;  2C06 A;  2WAC A;  1KIL B;  1CW5 A;  3WXM B;  3L42 A;  4OB3 B;  4EMK C;  1DJ7 B;  4NS5 A;  5HY6 A;  3TRE A;  5CMZ A;  2MMP A;  2GQV A;  2RJC A;  2FHD A;  3TCJ A;  4LLH A;  3G3Z A;  2HQX A;  3SWF A;  2EAY A;  2PUO B;  3OY9 A;  2FFD B;  2QI2 A;  5GAO l;  3V2R A;  2EQM A;  4XA4 A;  3RIR A;  3MTU E;  2HBP A;  2G3R A;  2F5K A;  5KLV K;  1JJ2 S;  2RJD A;  3OYE A;  3JCM W;  5C6S A;  2A45 I;  4A4G A;  1LTB C;  5J39 A;  1ZQ1 A;  4M78 A;  4B9X A;  1J2J B;  1NZ9 A;  2X4Y A;  4C5I A;  2ZFC A;  2Q7C A;  2EQU A;  2CYZ B;  3A3Y B;  2HQE A;  5D6Y A;  3X20 B;  1M1J C;  3M58 A;  3KUF A;  1LTT C;  1HBW A;  4C7R A;  4BI8 B;  3B5N B;  1GL2 D;  4E47 A;  2EIF A;  3BRV B;  4A4K A;  1R8O B;  4X34 A;  2V8J A;  2E6Z A;  3VU3 C;  4AYC A;  3SWN B;  5CCG D;  3JCM h;  2NLU A;  4ZGD B;  5GAN 3;  3BAT A;  2P4T A;  1G5V A;  4C8Q C;  1N73 A;  1T3J A;  3A8L B;  2LNV A;  4M78 C;  3GHG B;  2O1J A;  2K5F A;  2E65 A;  2F69 A;  1E5W A;  3VYI A;  4JRI A;  3RK2 D;  1LOJ A;  4F7U A;  4PLL A;  4C0F A;  1MV8 A;  4XTY A;  2XZR A;  2L5Q A;  4O5V A;  3OS0 A;  4BE2 A;  3RK3 B;  4M75 B;  4DOJ A;  5LJ5 f;  3VP8 A;  4ZGE B;  3OYD A;  1FZA A;  2DTH A;  5CIU A;  2KQW A;  1OZ2 A;  5AVS B;  1FOS F;  4X9D A;  4GY5 A;  2DKG A;  3F70 A;  1IFM A;  4JYC A;  1YJN A;  4AUW A;  2VUB A;  3L4F A;  2CS7 A;  4BUG A;  1LTJ C;  5GMK l;  2Y4X A;  2LC4 A;  1T2K C;  3RL0 B;  3FIF A;  4FU6 A;  2XDP A;  3CC2 T;  2PUK B;  2DJZ A;  3QJ6 A;  3HRS A;  5LJ5 e;  3CCL T;  4KUI A;  4FT4 A;  5D6X A;  1N9R A;  2YHT A;  4A4E A;  2RD1 A;  2OTL A;  5GAN f;  2QEX A;  3LWI A;  5CHX A;  3O8V A;  2KVQ G;  1W2B S;  1CZQ A;  2QQA A;  5CO7 A;  1XNI A;  4ELY C;  4HYT B;  1HWT C;  3FDR A;  3QXE B;  4LDX A;  2V8K A;  1T3U A;  4XTU A;  2KLV A;  2FXM A;  1LTS C;  4M7D D;  3QPH A;  4OGC A;  2IG0 A;  2VC8 A;  1L4A C;  2QQ9 A;  1QP3 A;  4PJO A;  3E1S A;  2BAS A;  3KBG A;  2C9N Y;  2D9T A;  1B34 B;  4M7D G;  3P8C E;  4C7N A;  2WTY A;  5FU6 B;  5LJ3 g;  3DB3 A;  1GZL A;  1KHI A;  4EIJ A;  3EQ2 A;  3ZBD A;  2C0X A;  1OXZ A;  2DXB A;  2OYH A;  3P8M C;  2DZC A;  2DTO A;  1CSB A;  1FDM A;  1IFN A;  3JB9 D;  1YJ9 A;  3T97 A;  1BYM A;  2QQR A;  2XU6 A;  3N7N A;  1ZV8 A;  4ZN3 A;  4R55 A;  2K5L A;  1YTZ I;  2RHZ A;  1N2D C;  4M7D E;  4M77 A;  2E42 A;  1HTL C;  5AVX B;  3QYG B;  3SWY A;  1Q81 U;  4M7A A;  3TNU A;  3ZEH A;  1N73 B;  4KT0 E;  5KCH A;  2QM8 A;  1S9K D;  5BVZ A;  4LDU A;  3P7K A;  3CL3 D;  3U1A A;  2RHU A;  5AVV B;  4OGE A;  2OYH C;  1VQ8 A;  4XQ3 A;  2OAR A;  2YO2 A;  5IT9 E;  2RJF A;  2KSS A;  2ZGW A;  1KQS S;  1XOV A;  1HH0 A;  3G4S A;  3MEV A;  3GOX A;  2GF7 A;  4QVZ A;  2I1K A;  1GL2 C;  3HD7 A;  3HE4 A;  3JCM b;  3MUD A;  4ZKP A;  4IUU A;  1SQP K;  1A02 F;  2H43 A;  3OJA B;  5APV A;  3S3M A;  2O01 H;  3QII A;  4C92 A;  1S9K E;  1G1I A;  1J1D C;  3B5N D;  5LJ5 g;  3PIO A;  2KMT A;  3VMZ A;  1I81 A;  3OA6 A;  3HFN A;  1JY3 N;  2WSE H;  5AW6 B;  5LJ3 d;  3II6 A;  1QW1 A;  4N0A C;  2O01 E;  5CCH D;  1KQL A;  5AVQ B;  1YJW T;  1RE3 C;  1N8R U;  3VYH B;  4C5H A;  3CLQ A;  3G6E T;  4PJO F;  3GNF B;  2CZ6 B;  3B8E B;  2HPC B;  2WSE E;  3M56 A;  1UEB A;  2A3L A;  1VQ9 T;  3E1I A;  4BY6 C;  2GUS A;  4M75 D;  2IFM A;  1OWA A;  3OW2 A;  2NPS C;  3CCQ T;  1H8A A;  3NTN A;  5J26 A;  2N1T B;  5AVR B;  2CPS A;  3V8K A;  4P5N A;  4EDU A;  1URQ C;  4E7H A;  3H32 A;  3TK1 A;  5GAN g;  3BDU A;  4JLI A;  4Y99 C;  4PJO B;  3JCM f;  2PVO B;  1NKN A;  1G3T A;  2PP6 A;  2LDM A;  1SFC A;  3CPF A;  4W80 A;  4M77 F;  4IUQ A;  1SQB K;  3RL0 D;  2V8I A;  1HGZ A;  5KJ7 C;  4M7A F;  1JB0 E;  3M9B A;  1A02 J;  2EJF A;  1NE8 A;  1WPY A;  1LTG C;  1DEB A;  5GAM j;  3NMD A;  4QVD A;  1N86 A;  3JCM e;  3MEA A;  2OTJ T;  4M7D C;  2AHJ B;  4M77 B;  5DM7 R;  4MDW A;  3EFR A;  4HT9 A;  3RUX A;  4FT2 A;  3PMI A;  4M7A B;  3TNU B;  3J80 E;  2E64 A;  1M1G A;  3MCA B;  2YO3 A;  3FC3 A;  1NH4 A;  2LQK A;  5LJ5 d;  4BI3 A;  1K9M U;  4IUV A;  1KHC A;  1EIF A;  1SSF A;  2E10 A;  4WY4 A;  4C92 F;  4XU3 A;  5AVY B;  3R6O A;  1HVV A;  5APY A;  1DX7 A;  1G3W A;  3JCM c;  3HD7 B;  2FB7 A;  3C95 A;  5GAN 2;  2P0P A;  4C0D B;  4RG2 A;  3M0D A;  1N7S D;  4WBA A;  4FL6 A;  1J1E C;  2MI6 A;  2OYI A;  3UWN A;  3HP9 A;  2DXU A;  1N9S A;  4C92 B;  1Q81 C;  3CBP A;  1MZ9 A;  5GAN d;  3NTH A;  2EJ9 A;  3A5T A;  1W4S A;  4GT1 A;  2DEQ A;  1NU1 K;  1OI1 A;  2XDJ A;  2ZCF B;  1XTG B;  3OBY A;  4XE5 B;  3HUS A;  3VMY A;  2MF2 A;  3MP6 A;  3KYQ A;  3A8M B;  4RCB A;  2QQB A;  4EMG A;  4FM4 B;  2VV5 A;  1ZR2 A;  1X6O A;  2GFU A;  1KD1 U;  1WJR A;  4VUB A;  3HRT A;  3V2Q A;  2MJZ A;  1VQO T;  4EMK A;  3P8B B;  1H3Z A;  3CC2 A;  4IUP A;  2WSC H;  3H32 B;  2XU8 A;  3CCL A;  3HUS C;  1HJB A;  3RKX A;  4OMF B;  3M57 A;  4ME7 A;  3CCE T;  4XTV A;  1SFC B;  3V2N A;  2C0W A;  3HRU A;  5A2Q E;  2R5A A;  4E7K A;  1NTK K;  4L59 A;  1NPP A;  3FLG A;  4BAC A;  2PAJ A;  5CKF A;  2FKW B;  2R5D A;  1N8R C;  3U59 A;  3DLM A;  1UB4 A;  2JNG A;  4WB4 A;  4LD9 K;  3S6W A;  5APQ A;  2RI5 A;  3JCM g;  4FSX A;  5GAN 8;  2KB7 P;  2EYQ A;  1I5L A;  1U1S A;  3A7O A;  1KG1 A;  3PP5 A;  2W27 A;  1JTH A;  1VIF A;  2RK1 A;  4RES B;  4AQR D;  1M1J A;  3P32 A;  4NL2 A;  3T9N A;  2HLO A;  1O75 A;  3RKY A;  3M0A A;  3FB9 A;  5CKH A;  2CPB A;  2N1T D;  4MML A;  2GFA A;  4MZM A;  1WGS A;  3M9Q A;  2K3Y A;  3JRZ A;  2HFE D;  4X9C A;  4PJO D;  4WY4 B;  5FLX E;  4C8Q A;  5CJ0 A;  2WPQ A;  4KUD K;  2HOD A;  3V5B A;  1K8A U;  5IAY A;  2X4W A;  4B86 A;  2LRQ A;  1JMM A;  4LDV A;  4N4I A;  2ZPG B;  4LD6 A;  3QYH B;  3L36 A;  1VQ6 T;  2X4J A;  1QVG A;  1NAF A;  1GU5 A;  2M0O A;  4II1 A;  1EQ7 A;  2M9U A;  3OYA A;  3OMG A;  1IFJ A;  5CKE A;  2OYI B;  2DD5 A;  1UGQ B;  3JAM E;  1NTZ K;  2GCX A;  4M75 F;  2EQJ A;  1WQW A;  4BDZ A;  4QW2 A;  3TU4 K;  4M77 D;  3RKW A;  4KHX A;  2KYV A;  2VGN A;  3X24 B;  3QSU A;  3M55 A;  1K9M C;  5GAN 7;  4KBM B;  4M7A D;  4JUV A;  5FRN A;  1LTJ A;  1ZN5 A;  1O9S A;  5C0M A;  3S3O A;  1BI3 A;  2K2V A;  1SVF A;  3QO3 A;  3L1A A;  2P7J A;  3HSB A;  3MGN A;  5APW A;  1SLQ A;  3P8H A;  1KC8 U;  1N7S C;  3JCM d;  4XU2 A;  4UC4 A;  5GAM e;  1RF1 C;  4EMK B;  1UGP B;  2JTM A;  2E5Q A;  1LTA C;  3LLR A;  2FYZ A;  4A54 A;  2E70 A;  3HD7 D;  3M5A A;  3QUI A;  2A7Y A;  1AHJ B;  4A4H A;  4BI4 A;  2O1K A;  3UPU A;  4PLI A;  4WF2 A;  1YJW A;  4ZKU A;  3QJY A;  1PFI A;  3A8G B;  2PVD B;  2L5G B;  2YMY A;  2XHC A;  2WPR A;  4C92 D;  3G6E A;  2P2U A;  1L4A A;  4OB0 B;  2GUV A;  1XQH A;  2WSF E;  1FWZ A;  1CI6 A;  4J6W A;  3RMQ A;  1VQ9 A;  4XU1 A;  1L0N K;  3CPW S;  3E9F A;  4D6W A;  2XNX A;  3CCQ A;  4EOT A;  1KD1 C;  4MMK A;  3BRT B;  1DH3 A;  1IO4 A;  1MHN A;  1UGS B;  2OAU A;  3IR9 A;  3A2A A;  4R56 A;  4DA4 A;  3OYH A;  1JTH B;  4C8Q F;  4M78 F;  1M1J B;  1WJS A;  2LQ8 A;  5CVI A;  3OSS C;  1YCY A;  2LT4 A;  3GP8 A;  5CQX A;  1VQN T;  4N4H A;  3CBM A;  2YNY A;  3HL8 A;  5L8R E;  2E1H A;  5KE2 A;  2XID A;  2J58 A;  1VQ5 A;  1QVP A;  4IKF A;  4C8Q B;  1P92 A;  3PMT A;  4M78 B;  1H89 A;  2HOD B;  2DD4 A;  1FJP A;  2J59 M;  5KTB A;  1U8R A;  2OTJ A;  1HGV A;  4HCC A;  2CZ0 B;  2KY9 A;  3A5Z B;  5AW5 B;  4F7U F;  1KIL D;  2RI2 A;  3LW5 H;  3LGF A;  3JB9 G;  1GL2 A;  1YYC A;  4C0G A;  4C5E A;  1JBM A;  1GDT A;  2Z5I A;  1KFN A;  2BUD A;  3JB9 H;  3QKJ A;  3LW5 E;  1YIT T;  4ATO A;  3S3N A;  1VQM T;  4ELZ C;  1LTJ B;  4F7U B;  2CGH A;  1H64 1;  1I8F A;  1LGH B;  1L0L K;  2IPP A;  4C46 A;  2XIC A;  3HFO A;  3CXC A;  1K8A C;  2P67 A;  4Y28 E;  4HCB A;  2QXF A;  4YTL A;  3PIP A;  1RE4 C;  3L2Z A;  3NFQ A;  2O4X A;  3ASK A;  4N0A A;  5AW9 B;  2VXE A;  4WY4 D;  5DLO A;  1FXX A;  1RE3 A;  4FIB A;  2R57 A;  4C0Z A;  3G71 T;  4OVA A;  2BKD N;  5CCG C;  2EKO A;  3VMX A;  4NOY A;  1JCD A;  1LJO A;  5KCO A;  5LJ3 h;  2MWO A;  1XTD A;  1LTI C;  2RJE A;  2RHI A;  2NPS A;  5FRO A;  2KDS A;  3RK2 C;  4JYB A;  2DK3 A;  1URQ A;  3E9G A;  4DZO A;  3PFS A;  1L4A B;  2ZPB B;  3JCM X;  4A4F A;  3Q1J A;  2I1J A;  1CI6 B;  3JCM P;  1PSF A;  2Z4E A;  3LIE A;  3RER A;  2W6B A;  1VQO A;  1M5Q 1;  3I5C A;  1TH7 A;  5I21 A;  1KC8 C;  4BD3 A;  1MUU A;  5LJ3 j;  5DLQ E;  2KP8 A;  5KJ7 A;  3RK3 D;  3L2Q A;  1YI2 T;  5APT A;  1W2E A;  1GW3 A;  3CCE A;  3NTI A;  1LWU C;  3CC4 T;  1FZB A;  3QZ9 B;  2M16 A;  5GAM h;  1LT9 C;  1Q86 U;  3PGG A;  1YTZ T;  2WZ7 A;  3M4G A;  2EWN A;  3WVE B;  3OYI A;  4M75 G;  3R2P A;  2DXT A;  1T8Z A;  4M7D A;  3V4W A;  3H6P A;  2HD0 A;  3TYY A;  5FU7 C;  1NKZ B;  4C7N B;  3HHT B;  3CCS T;  1VQK T;  2K5I A;  1FZF A;  3C4S A;  3MEW A;  4GIF A;  3KPE A;  3OS1 A;  2M3B A;  3CCU T;  1FZE A;  3IFM A;  2A45 G;  2OYH B;  3I56 T;  3CCJ T;  2XDD A;  5APU A;  1XTC C;  4J7F A;  2Q9I A;  3UT1 A;  3X26 B;  1VQ5 T;  1RL2 A;  3CMA T;  1WNL A;  4JS5 A;  4M75 E;  2A45 H;  3M4Y A;  2D6F A;  5GAO p;  1JRI A;  2CZ1 B;  1IJD B;  3HE5 A;  1Y96 A;  2XD0 A;  3SDZ A;  1GL2 B;  2L3R A;  1JCC A;  4LC1 A;  1JY2 P;  3EAE A;  1FZC C;  3OYF A;  1SQQ K;  1JY3 P;  2JJL A;  1HK9 A;  2IVW A;  3CI9 A;  1J1D B;  1PSE A;  1WQ7 A;  3MP1 A;  1S72 T;  1VQ6 A;  1VPC A;  3CME T;  2DXC A;  1FOS E;  4JJN K;  3RK2 B;  3OYC A;  4E7L A;  2WPS A;  2O4X B;  4BE1 A;  2JVV A;  3ER0 A;  2R32 A;  1BI1 A;  5HK0 A;  3KQG A;  4C8Q D;  3HE4 B;  1KIL C;  5AYF A;  4PL6 A;  2RI3 A;  3M54 A;  4M78 D;  2HYN A;  4JRK A;  4N78 D;  3LYI A;  5GAO m;  3AHU A;  1FU1 A;  3JCM V;  4N4G A;  4OH8 B;  1QL2 A;  4E7I A;  1VQP T;  1RI0 A;  2RM4 A;  2W6A A;  4BY6 B;  4V2S A;  1M4Z A;  2NPS B;  2I2L A;  1QVF S;  4PKC C;  1URQ B;  4W7Y A;  3CD6 T;  2FFD C;  1G3Y A;  4BB7 A;  4Y99 B;  5BU8 B;  1RF0 C;  1FZG A;  2XI9 A;  1H88 A;  5GAN j;  2XDB A;  3M53 A;  2VRS A;  5DY9 A;  3GPL A;  5CCH A;  1T2K D;  2Q3I A;  4JLG A;  2CKK A;  3BW1 A;  2ZPI B;  3ZFJ A;  2VYT A;  1D3B A;  2QDY B;  1YIJ T;  1BI0 A;  5FRM A;  3LGL A;  5KE3 A;  2R3C A;  4JS4 A;  1Q7Y U;  2H7H A;  5CQY A;  5GMK h;  2IX7 C;  3B5N C;  2QQS A;  4W7Z A;  2WT7 A;  4M7D B;  1X75 C;  2Q5U A;  2RH2 A;  3SWN C;  3GLX A;  2ZPE B;  1NHL A;  3G7Z A;  5CCH C;  5AW7 B;  3GHG C;  5CR2 A;  3M91 A;  3FJP A;  1AFO A;  2QTX A;  3LX7 A;  5EG2 A;  1BIA A;  3M06 A;  5GMK j;  3SD4 A;  2N9B A;  2YKQ A;  3RK3 C;  4M75 C;  3VJP A;  1QL1 A;  2LCC A;  5GMK m;  4XTZ A;  2L89 A;  5I2S A;  3HE5 B;  1Y96 B;  1BIB A;  3FEO A;  1VQN A;  5A0L A;  3VYG A;  3N4X A;  1QVG S;  3CCR T;  3OYG A;  3OBW A;  3A8H B;  1Q86 C;  1J1E B;  3DKM A;  1KQ1 A;  5LJ3 f;  3V7R A;  1FBM A;  4ZTF A;  3CEY A;  3RL0 C;  4N6J A;  2LCL A;  3VUZ A;  3P8D A;  1Q82 U;  3N5B B;  2P0Q A;  2K57 A;  3L2R A;  3DB4 A;  5CAI A;  3O8Z A;  1G1J A;  1GK6 A;  3TEE A;  1AQ5 A;  4PJO G;  2HAX A;  5D6W A;  5CK9 A;  1B34 A;  1WRG A;  3PT9 A;  5A0D A;  4EPC A;  5LJ3 e;  4XTX A;  3HPW A;  1VQL T;  4OF1 A;  1IFI A;  2CZ7 B;  4QQ6 A;  3JB9 J;  1N7S A;  1KZU B;  1YIT A;  1VQM A;  4IUT A;  4JDS A;  3VP9 A;  1RF1 A;  3CCM T;  5GAM f;  5AW8 B;  2KSJ A;  3QBY A;  4OB2 B;  2FYU K;  1YBY A;  4JF7 A;  1YHQ T;  3HUS B;  1K73 U;  3V8L A;  2QA4 T;  3LID A;  4PJO E;  2EJG A;  1JJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...