3M9QA

Drosophila msl3 chromodomain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
LRDETPLFHKGEIVLCYEPDKSKARVLYTSKVLNVFERRNEHGLRFYEYKIHFQGWRPSYDRAVRATVLLKDTEENRQLQRELAEAAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Corecognition of DNA and a methylated histone tail by the MSL3 chromodomain.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords Protein male-specific lethal-3
total genus 22
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3m9qA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3m9qA01
2LKMA 4FU6A 2WSEH 2MWPA 3OYFA 3OB9A 2D9TA 2CKKA 3FEOA 3LGFA 3MO8A 4GY5A 5J26A 2YRVA 5D6WA 1SQPK 2L89A 3OYIA 2J59M 2O4XB 3ME9A 3OYEA 2GFUA 2O4XA 4N4HA 5J39A 2JZ2A 1WGSA 2K3YA 2RHXA 3CLQA 4NS5A 4B9WA 3S3NA 3OS1A 1L0LK 2LRQA 2IG0A 4IUTA 2FHDA 1WJSA 2LDMA 4E7JA 2EKOA 3OYLA 4BE0A 5IN1A 4E7LA 3BDLA 5FRMA 5KE3A 3P8DA 5C6SA 3OA6A 4E7HA 1SQBK 1NTZK 2LCCA 2NLUA 2RHZA 1KHCA 4IURA 4EDUA 2XK0A 2X4YA 1SSFA 1RI0A 2RHIA 3ASKA 3OQ5A 2LTOA 3OYGA 3DLMA 3LW5H 4QQGA 3FC3A 3S6WA 4B9XA 4IFDK 4QW2A 4C5HA 5KCHA 4C5GA 3OYJA 4OVAA 4E7IA 2LVMA 5CIUA 1OYXA 3PNWC 4IUQA 3OYKA 3MP8A 1WJQA 3F70A 2E5QA 4N4GA 3OS0A 1OZ2A 2WSFH 2BIVA 2RJDA 2MWOA 4C5IA 4A4HA 3L2UA 1NU1K 1NTMK 4QVZA 2X35A 2RO0A 2O01H 3E9FA 3MP1A 4L59A 3OMGA 3MEAA 1L0NK 1OZ3A 3L2WA 5M9OA 2OARA 2R57A 3C4SA 3OYAA 2DAQA 3META 3NTIA 2RHUA 4N4IA 5IAYA 5D6XA 3ZEHA 3S3OA 2BKDN 3L42A 3PMIA 3L2QA 2EQJA 3SD4A 5KCOA 3OY9A 3OYDA 3E9GA 4IUPA 3QIIA 3LH0A 4UC4A 4Z02A 2EQUA 2B8AA 2X4XA 1SQQK 4PLLA 4E7KA 2RI5A 2RI3A 2F5KA 3DB4A 3QBYA 4IKFA 2M0OA 2PQWA 1MHNA 2X4WA 4QQ6A 3OS2A 4C5EA 3OYBA 4X34A 2DIGA 3Q1JA 4CRIA 4BDZA 5KH6A 3CEYA 2EQKA 2HQXA 3FLGA 3G3ZA 1OI1A 4ZTFA 2P0KA 5KLVK 5FRNA 4A4FA 1G5VA 2GF7A 3OYMA 3MEVA 2RI2A 3UWNA 1N27A 3NTKA 5KE2A 2M1HA 4IUUA 4A4GA 3OYCA 3OMCA 2RJFA 1NTKK 2L8DA 3GOXA 3NTHA 2QQSA 3M9QA 1SQXK 1WJRA 4BD3A 2K3XA 5C0MA 2L3RA 2EQMA 4Q5WA 4IUVA 4BACA 4ZTJA 3OYNA 3EAEA 3PFSA 3LGLA 3LLRA 2RJEA 3KUFA 4FL6A 3DB3A 3FDRA 5D6YA 3OYHA 4BDYA 2FYUK 2G3RA 4PLIA 2RHYA 4HCZA 3LX7A 2GFAA 3PMTA 4PL6A 2HQEA 4A4EA 2WSCH 4LD6A 4II1A 2EFIA 3H8ZA 4QQDA 3MEUA 5FROA 2R58A 2BUDA 3MEWA 4RG2A 3QJ6A 4BE2A 2R5AA 1H3ZA 2M16A 2E6NA 2WACA 2DIQA 3H6ZA 3P8HA 2R5MA 3L2RA 3UT1A 2QQRA 1SQVK 2VYTA 3LYIA 3L2VA 2XDPA 2JTFA 2RJCA 3O8VA 4BE1A 3QKJA 3S3MA 3MP6A 1XNIA
chains in the Genus database with same CATH superfamily
1L4AB 2JTMA 3M57A 3V7SA 1VQ8P 2JMAA 3H6PA 2QK0A 4C8QC 4IOIH 2YSQA 3L37A 4ZNCA 2QDLA 3RMSA 1VQMQ 1N7SA 5AVSB 4HCBA 4RUGA 1S9KE 1NH4A 3H1IJ 3E19A 3NHNA 2V7QH 4H44C 2J59M 2O4XB 1PZQA 1YIJT 4FSXA 3JCMd 5GAOl 1YTZT 3PP5A 2E6ZA 2FY8A 3L71E 1W2BO 1VIEA 2JZ2A 2ZPIB 3BRVB 2AHJB 3RKXA 2IYOA 2RN0A 2OYIC 2E1HA 3IAOA 2BCCJ 1B07A 3RL0B 1KORA 4GKGA 3EH1A 2RQTA 5KE3A 1G3YA 3KBGA 1BK2A 4JRIA 2JXBA 1KFMA 4U3FD 1YTZI 1K9MU 2X4YA 1FJKA 1PSFA 2XV5A 4K3AA 1L0LJ 4QQGA 3CCVQ 2P0QA 1ZOYC 4C8QB 4JYBA 4B9XA 1PKTA 5CKHA 1KV4A 2NRGA 2K88A 3B5NC 5KYUB 3CMEP 2RQVA 2EJFA 1S3JA 2IDBA 3MTUE 4LUDA 4M75B 1OZ2A 4EPCA 1VQLQ 5LJ5j 1R0BG 4RCBA 5ECAA 2R57A 3H9NA 1UIXA 3S9OA 2D0NA 2A06E 2GCXA 1ZMEC 2BKDN 3HL8A 1S72Q 4M7AC 4KT0E 2JR8A 1UGRB 4M75G 1SQVJ 1DEEG 1DX7A 1IO6A 2M5AB 2HEQA 1KZUB 3X20B 2OTLP 3ER0A 1YBKA 1NAFA 1I4K1 2PP6A 3THKA 1FOSF 1SQXE 2DMOA 4XU2A 2ZAEB 4BDZA 2KSSA 3CEYA 1HGZA 1FOSE 3L74E 1JEGA 1OW6A 1QKWA 3UA6A 2PUOB 3UWNA 4WBAA 4KGXB 3RMQA 3H32B 1NKNA 2ESWA 3CCSQ 4M7DC 2J05A 2QAZA 3GOXA 2Y90A 3OYYA 1PRMC 3GNGA 5C0MA 2P84A 2OTJQ 3V6IA 1OU8A 3PFSA 1MMNA 4Z1MH 1JXMA 1AEYA 3B71A 1YCYA 2J5UA 2VV5A 4J9BA 1SG5A 3FDRA 3I56T 1MZ9A 1L0LE 3E1RA 4BY6C 2PGDA 1S5LE 1OULA 1QX8A 4Z8AA 2LNHB 1N5ZA 1KYOD 1KILD 2N1TB 4II1A 1M30A 3G71P 3CCUP 1TWBA 1UE9A 2GTOA 4PJOG 3RK2C 4ZKPA 2UWJE 1YNZA 3L2ZA 1VQ7A 2OJ2A 3HRSA 1RF1B 1G8XA 1XJWB 1B7TA 1KMIZ 1M90C 1VDFA 4HB1A 1LTBC 3FXDA 2HL3A 4K11A 1IXDA 3FEOA 1F1BB 1K73U 2LX9A 2CP6A 2FYUD 3TCJA 2IFMA 2K37A 2Y0EA 2LQWA 1VQLA 2XNDH 2WSFE 5GAN6 3JCUE 5DY9A 3NMZC 5J39A 5C39A 3M91A 3CLQA 1BGYJ 3CCMP 1W6XA 2ZZDA 1NU1J 2YKOA 2ZFCA 4ELYC 5AVWB 1KB9I 1M9SA 4HVWA 4PJLA 5FRMA 1HTLC 2YKPA 1SS1A 5B5EE 3G7ZA 5GANf 6AT1B 4PJOA 4R0KA 2OTKE 2VASA 1X8YA 2ZGWA 5CKEA 2K9JB 5CCAA 5KJ7D 1EZZB 2XK0A 3MJXA 5A0DA 3VMZA 3WMM0 3RGUA 5GMKe 5APWA 5B66H 1LGHB 1UDLA 2LC4A 2P4RA 2HR3A 1U1SA 3MP8A 3D70A 4JLGA 1BCCE 2BIVA 2L5QA 3PTAA 4J5YA 1Y47A 2PVDB 5GMKl 2JMCA 2O01H 1QVGS 4MZTA 2YKQA 2CZ6B 2OARA 4RTWA 1BIAA 1WI7A 4OWFA 2VKNA 2ITAA 2CSIA 4YXWH 1GL2C 2IVWA 1ARKA 1TH7A 3SWFA 2A36A 3RKWA 3CCSA 1YI2Q 4M3LA 2OTJT 3OYDA 4LLHA 3MD0A 3VYGA 4N0AC 1P84D 1H641 2FB7A 2RM4A 3TVTA 1DEBA 2HBPA 1SHGA 1K05A 1X6GA 1D0YA 2KGTA 1NG2A 3Q1JA 4XTWA 3OW2O 2EQKA 2BE7D 1M1JA 4F16A 1E6HA 4XAXB 2BASA 2ZXEB 4YTLA 2YXRB 3P8MC 2O88A 2E5TA 1RAIB 2L0AA 1JB0E 4JDSA 1H0TB 4XU3A 2K3XA 2JJ9A 1FYNA 5FU7B 4BACA 2W8ZA 2KEAA 5FU6B 1Y96A 1Z9QA 2E64A 4RTYA 3HE5A 2W27A 1VQOP 3H0HA 4XU1A 5AW2B 4F7UA 1EFNA 1SQPE 3CCMT 3M0DC 1FJPA 3VOPA 3H8ZA 3M0TA 3CWBJ 4RG2A 4BE2A 5GTHE 3TU4K 2KYBA 3CXHI 1P92A 1FC2C 1SFCA 1SQVK 3H32A 2Y4XA 4EYYQ 1AJYA 1I5LA 2KROA 1X6OA 2V8KA 3QKJA 1D1AA 1KC8Q 2FL7A 2QQAA 2R5DA 1MNDA 2EWNA 4FW2A 1UTIA 5KYWB 2KIKA 2P1JA 1N8RR 1PG5B 1JBMA 2MWPA 3TNUA 1IREB 4M7DF 2YXYA 1OW7A 3CX5H 4J7IA 2M5AA 2DL4A 1O9SA 2D8HA 1EZVG 5GMKh 1VQKQ 2KQWA 4AFQC 4EMKB 3U59A 2FXPA 1KQFB 2DD5A 1ZLMA 3OS1A 4C0FA 1VIFA 1PP9E 2FHDA 4XTXA 1PFIA 3EGUA 5H2FH 3OSVA 4PJOE 3BFMA 4F7UF 3J80E 1KQSS 3H0FA 5I11A 3BDLA 2JW4A 3H1JE 2WZ7A 3L70G 3CWBE 1WHJA 3EGDB 4JJCA 1SQBK 1BI0A 2MK5A 4IIMA 4M75A 4LDVA 2MIOA 2WVRA 1GBQA 1USDA 2KYMA 3TGUG 1JEKA 2BEZF 5FWCA 3M0DA 2YMKA 3LIEA 1NTKG 5GTIE 3RNJA 4ZNXA 4M7AD 4AG2C 1OZHA 1FZBA 4UB8H 1J1DB 1SQXJ 1PNJA 2GA1A 4J9HA 2DL7A 1YWOA 1GCQC 3CCLA 2G3AA 3T97B 1FDMA 1NTMK 2EW3A 3D71A 2RH2A 5CHXA 1L0NK 1VQLP 1VQ8T 1GRIA 3UDCA 3L70D 1G3TA 1UGPB 3GHGC 1P84I 2KSJA 4NPEA 5AW4B 4ASVA 4M78B 2KK4A 3CCRT 2IPOB 3H1LD 4D6TG 1AFOA 1IFDA 3VYHB 1Q82U 2XKMA 4MDWA 3M54A 2AIRB 4PLLA 1SQQK 1BSHA 4J9EA 3RIRA 3SDZA 2HPCB 2JN0A 1NOHA 1TU3F 3RBXA 4PD4I 2EKHA 4M75F 4CRIA 1VQMP 4BB7A 3QH9A 2J7IA 1GZLA 2PRRA 1Q7YR 3AECC 1ZBXA 3L1AA 1L0NE 1JNMA 3MUDC 3QWOC 3QZ5B 4ZGJB 1OFCX 2RI2A 2FFDA 3P7KA 4BWNA 1P84H 1LTSC 2ZPFB 1A02J 2M9UA 3NTHA 4C92A 2NPSB 1GU4A 2PAJA 4WVZA 1BDCA 4Z89A 3VS6A 3VMXA 3PHLA 1HD3A 4F7UG 2EAYA 5LJ5g 3RK3D 2XZRA 3JCMQ 2W10A 2E74B 1RACB 1QP3A 1PIXA 2G3RA 1X2QA 4PLIA 5AW8B 3JB9D 3ULRB 2CS7A 5KYYA 3V4QA 1VQPP 2JJLA 1V29B 1VPCA 3ABVC 3QJ6A 2IBZG 2KMTA 2GUVA 3QYHB 4OMFB 1SF9A 1X0TA 3L2VA 2RJCA 3GHGA 4U7JA 3HUSB 1SKUB 1VQ9T 1YIJQ 2Y9YA 2EIFA 2HNIA 4A4KA 1VF5C 3RK2B 1U1TA 1C6VX 3GF5A 3OYFA 2YIUB 9ATCB 1N6AA 1AQ5A 2DD4A 1EDKA 3HFNA 5D6WA 3CC2T 5AW9B 1D1BA 2LXBA 2HD0A 1HH0A 2N9BA 3A8MB 1MV8A 2WSEE 2FXOA 1B34A 1FMWA 2SRCA 3A5ZB 4E7ZA 1KB9E 2IFNA 2FRWA 3JCMh 3P8BB 2E43A 5KLIB 2HODA 1SEMA 1T0JA 4BE0A 2DK3A 1NPRA 3JV3A 3P8DA 1UIIA 1K0XA 3EFRA 1H92A 1OEBA 1KHCA 1C1AA 4J83A 1N8RQ 4J8OA 1WLPB 1ZSGA 2D1XA 3CCJA 1PHTA 3PIPA 4M78C 2ZYDA 3TGUE 2JOYA 3TGUD 1AQTA 5KCHA 2IYPA 1GK6A 1XTGB 4GBQA 2XMFA 3H1HG 3G6EQ 2OGUA 5EFWB 4M77F 2MWOA 1RAHB 1KYOH 4R55A 3O6QB 3E9FA 1MFTA 4LN2A 3INZA 3AE8C 1FZCB 4O6JA 2JT4A 3CCQP 1H0TA 1LNXA 4BI8B 2DPPB 4DT0A 2J6OA 1NTZE 2XDBA 2H8HA 5CCHA 2JVVA 4JUVA 5A0LA 1JY2N 2V4HA 3G6EP 4BI4A 3QPHA 1HSQA 2M3BA 1G83A 4RKUJ 4C0DC 4D6TD 3L74J 2ZT9C 3JCMP 4CC3A 1W2BP 3OAKA 1JO5A 2E70A 5APTA 1TXQA 3IQLA 5GANh 3CCST 1EIFA 1TTHB 1YITQ 4OGQB 2Z0WA 3EG3A 1JU5C 2HQXA 3GF3A 2EJGA 1SQVE 3FLGA 3CCEQ 1FZAA 3E1IA 4BXLA 4L5GA 4M7AE 1D3BA 1GMJA 2M3EA 3Q3DA 1WIEA 1UECA 3CQTA 4M78A 3E2UA 3AE9C 1UHFA 5GAN7 3CMAT 2R32A 4DBRA 3M9BA 1KQSA 2QM8A 1QKXA 3LX7A 1OW8A 5KYNA 1EDLA 5I2MA 2FBWC 4M7DE 1QMCA 2J6KA 5KKZB 3M58A 2YO2A 2BZYA 2GBQA 1KIKA 3W68A 5I22A 1SQQE 1M5Q1 2CYZB 2JNGA 4H0LD 5APUA 1U57A 1VQOT 2EYZA 1ZSZB 2B87A 3R2PA 1K0SA 1W1FA 4O5VA 1ZRTE 2DKGA 1ZQ1A 2VXEA 1SQPK 1RQVA 3CC4A 1AZEA 1RE3C 3WUTA 4U3FG 4J6YA 4NS5A 2E3HA 3FJPA 5CQXA 1T0HA 4C8QA 2KRMA 2KYVA 5GAOq 2QGGA 1PGJA 1PC0A 1JJ2P 1M2VA 1TUGB 3V2RA 2DVEA 2C06A 3OYLA 1LOJA 3CX5D 2V26A 2NUPA 4EIJA 1OPLA 2YO3A 1FMKA 1NTZK 1MV3A 1IGQA 5TISE 4EDUA 2KP8A 1YJNQ 1N2DC 2KUBA 2DILA 1HJDA 2KR3A 2CZ7B 5CKFA 2WSCE 1KG1A 3URGA 3Q5PA 1Q81C 1RF1C 1USEA 5CIUA 2LJ3A 1NE8A 2FFDC 2XU6A 1UB4A 2K3BA 5GAMg 3L73D 1AA0A 3G6EA 5IHKA 2RNAA 1V76A 2MPXC 2K7AA 2DX1A 1NTMG 2FKWB 4KULA 3GG2A 2HODB 2A45H 1LJOA 1P84E 3HE5B 2GM4A 2XG8D 3QXEB 3CCUA 1QL2A 1T2KD 2DAQA 8AT1B 1D3BB 1SQBE 4XU0A 1UJYA 2M02A 3L42A 1VQ9A 2OAWA 2IPPA 5GAOp 4Z02A 4KUIA 3HTRA 4X9CA 3RKYA 2H8PD 1FAVA 1QVGA 2PQWA 1RAGB 4X34A 1H89A 1BCCD 3VP8A 2QEXA 2SEMA 1G5VA 5TJHA 3AE5C 5CO7A 1PPJD 2HSEB 2KXPB 2JKVA 4B6MA 2ABLA 1E5WA 2YUOA 5CCHD 2E76C 5CKDA 2OAUA 2OYIB 2DEQA 3D6YA 3V8LA 3AEAC 1LWUB 3Q1MA 2OYOA 1AOJA 2F1LA 4ZGDB 1IZNB 1IHWA 4PD4D 2HMAA 3I9QA 2WSSH 4HA8A 5GTIH 2XD0A 1LTGC 3N4XA 3BCCD 3GIBA 2N9YB 1LT9C 4RCCA 3CXHE 3L4FA 3HFOA 1S5LX 4M78F 2Z5IA 4M77G 2RMOA 3M0RA 2E6NA 2YXQB 1PCXA 2QQRA 3VS3A 3WUVA 1W2BS 2Q9IA 2FYUE 1YWPA 2CP5A 4Z88A 4PFPA 3G4SQ 4ATOA 4BE1A 1VOMA 3MP6A 3H1JJ 3BRTB 1NHLA 2LKMA 2F69A 2RA2A 3CMEA 1J1DC 1EQ7A 4GIFA 3W67A 1X2KA 2Q3IA 2AK5A 3QSUA 3A0BH 4RTTA 4JLIA 4DBHA 4HH2A 2OX7A 2W0ZA 5AVQB 2AEMA 3TDKA 1PD0A 3SHWA 3OYEA 2DL5A 2CP7A 4GODA 2RHXA 1VQPQ 1CSKA 3SWNB 2JDIH 3PJSK 1CKBA 1ZV8A 2IG0A 2KNBB 1NPPA 3EG9A 2A06G 1ZR2A 3CPWO 4IIOA 4OMQA 2HDAA 2QJPC 1CI6B 2DZ9A 5GAMj 1S72P 1GL5A 3H1KG 4FIBA 3WU2H 4J9CA 1GD2E 1NZ9A 2QG9B 1FX7A 3SSUA 3SWYA 1TU0B 3BATA 2RB6A 5GANg 2YT6A 3CCUQ 4PJOC 3M0AA 4WCIA 3CXHH 3EQ2A 1RAFB 5GAN2 3L2UA 4VUBA 4A53A 4JS4A 4LNPA 3RK3B 2Y0DA 3OW2P 5GAOn 2QJYC 3FWNA 1Q81U 2E41A 4M78G 2C0WA 3H1HD 1LPLA 3BCCE 2HCKA 3PMIA 2NPSD 2YUQA 1FXXA 1WFWA 3CCLP 4PV1D 1KTMA 2ROLA 3LH0A 4UC4A 3G9RA 2QEXQ 1QLED 5KLVG 3RL0D 4EI2A 4R4MA 4RG8A 3G71Q 3CC4P 4M7DG 1D0ZA 4C7NB 2KVQG 4QMAA 3OJAB 4A4GA 5LJ3j 3OMCA 3CPWS 4M78D 1SQXK 2O1JA 1WJRA 3I55P 2DYIA 5A0GA 2AZSA 1X22A 4IUVA 2XI9A 2NZ2A 1YI2T 1QCOA 1MMDA 5HKCA 3OBWA 3OYHA 1VQ5Q 5CJ0A 3WUUA 1KILA 1NTKE 3VS5A 4W7ZA 2KI7A 3X24B 3HUSA 4DOVA 2ZYGA 3L71J 5GMKm 2DRKA 4FYXB 2COWA 1IK7A 2KK7A 2R5AA 3SFEC 4M7AB 1BCCJ 5AYFA 2DXCA 2FPDA 2BCCG 3UF4A 5GAMe 4IFMA 1OIPA 4FM4B 1PGPA 5KYYB 1JQQA 2RPNA 1N8RU 3S3NA 2EPDA 1T6AA 2DA9A 3MHVA 4IL6E 2EGAA 1BIBA 4UB8E 4J9GA 3V5BA 3O6QA 2CKKA 1QQJA 3EHQA 2VGMA 2YRVA 5KJ7C 1G3SA 2FZKB 4C92B 2CUDA 3CXCP 2R3CA 1MMGA 4AUWA 1AVZC 2O1KA 4B9WA 1L0LK 3KPEA 5CCHC 2NWMA 2LP5A 2HKNA 3FXEA 3Q5SA 1K9MR 3JCMJ 3OA6A 5CJ4A 1VQ9Q 1KD1C 2BZ8A 3B4SA 4M77B 4OB2B 1KQGB 1QVGO 1KFZA 1U06A 5HCKA 4PJMA 1RI0A 3AEEC 4MN4C 3DLMA 3VMYA 1BSNA 1KILC 2O01J 1ZRTD 3J7AF 4A7PA 2XHCA 1R5SA 3KXTA 4C5GA 1YJWA 2CUBA 4BRYA 3RESA 4H44B 2NUZA 3HD7D 2KBTA 3KHUA 2LJ0A 2W83C 2QGFB 3EFSA 2JTEA 2H3JA 3PT9A 4KGZB 5DM7R 2FYKA 1NU1G 2RO0A 1BBZA 2AXCA 1H88A 1M2VB 3L2WA 2CSQA 1KHIA 1OV3A 1RLPC 2FPEA 2AZVA 1L4AC 2CZ1B 2YNYA 3FGAD 4NPFX 3CD6P 1CKAA 2COYA 2VB6A 3UATA 2W6AA 1TUCA 2RH0A 1FZCA 2A37A 4OB3B 2M0BA 4MMLA 4IKFA 1KD1U 1MHNA 2VGNA 3V2PA 3NXSA 4C5EA 4DA4A 1RE4A 1CZQA 4UB6H 2L3QA 1Q7YQ 1I5OB 4RTUA 3BDUA 2LMJA 3G3ZA 4A54A 1VQ6P 3RL0C 1RF0A 5CBOA 3HD7B 5BU5A 2RK1A 5GAN8 1J1EB 1NU1E 1LTIC 4Y99B 1KD1R 2AXTH 2JWDA 4CPGA 4RTVA 5DLQE 2XICA 1U5SA 3L70J 3H1HJ 3VMAA 3CCMA 4JJNK 2K2MA 3M0UA 2CDTA 2Y4YA 3TNUB 1IHVA 1H8KA 4D6TE 3HRUA 4EMGA 1LTJC 1JJ2S 2KZIA 1BKBA 2ZPBB 1ZSZC 4C0ZA 4MZMA 1YJNP 4AG1C 4C92C 2R58A 3CC7Q 4JBZA 2I8DA 4OMOA 2ZT9B 3A3YB 1K9MC 3P8HA 2L91A 2VYTA 1PP9J 1NEBA 2QDYB 1NTKD 4J7FA 1VQKT 2ZCFB 3A0HH 1XNIA 2RKLA 2OTJA 3EHRA 3AEDC 4KBMB 3VV0A 4W80A 4KRTA 3OB9A 1SQQJ 4JQ0D 3MO8A 2LT1A 1ABQA 5HK3A 2PNIA 4PFOA 1NBEB 3OYIA 4AFZC 1VYUA 5AVYB 1URQC 3V8JA 2CREA 5B5EH 2WPQA 3E7KA 4E7SA 1E6GA 3HD7C 1NTMJ 3F89A 1NJIQ 1T3UA 1BE3G 2KZJA 2K79A 3T9NA 1HVVA 2XDJA 3BY7A 4WWIA 1RL2A 3CD6Q 2QA4P 1BI2A 2B87B 4F14A 1EXJA 2WSEJ 4GLMA 1SQVD 1YFNA 2DBKA 2KS1A 1HK9A 3QDRB 1RADB 2OYHB 5K5GB 3I5CA 1LT1A 4QW2A 5LJ3g 1ZP0C 3L72J 3H25A 1U7JA 5GAMh 1M90R 4EMKA 2V8IA 3JCMe 4ZGEB 1OVUA 1LP1A 1LNQA 3AE1C 3M5AA 1AZGB 3EFOA 3O5ZA 4XTUA 2DTOA 1N7SD 2YIUC 4JPBW 3OMGA 1M2OA 4DEXA 4ELZC 1IFMA 1NTZJ 4JF7A 1Q86Q 3AEFC 3RK3C 3NPFA 1FS0E 4KHXA 1S5LH 3QIIA 2PFXA 2YLBA 1JY2O 2IBZD 3JCUH 2CGHA 4LE9A 1UEBA 4CC2A 3E1SA 3A0BE 1ACMB 1JY3P 5CKBA 2LQ8A 4XFJA 4FSSA 1G1JA 3CCRA 4PNOA 3OYBA 3V8KA 3JCMV 4M77C 1K8AR 3BW1A 2DIGA 1M57D 2WT7B 1JMBA 4U3FE 2KNCA 2E74C 1DIPA 3VKIA 3QDFA 5LJ3d 3DLLA 2LQKA 2P0KA 1QVFA 1LWUA 4M7AF 5IH2A 3CBPA 1N27A 1HBWA 1OOTA 5GJVB 4WB4A 5GANj 1AVYA 1DD4A 3LW5E 2RN8A 4AMCA 2DRMA 1UHCA 3TF5A 3I55Q 2RD1A 2B89A 5AVXB 2FPFA 3LGLA 1NYFA 1EDJA 3KUFA 3IFMA 4J6WA 4EMKC 5AW0B 2MI6A 4GLKA 1Q7YU 2M51A 2J58A 3N7NA 2E10A 4LD6A 4TLFA 2KXCA 3CPWA 4AQRD 1BGYD 2BUDA 3MEWA 2W6BA 1H3ZA 1VQOA 3AHUA 2GTJA 3L2RA 1VQ8A 1ZUYA 4C8QD 4V2SA 2P58A 3CCQQ 3LYIA 1WZOA 2LCSA 1Q82R 3PGGA 2WWWA 3CD6T 1S2EA 4WY4A 3L72E 3BASA 2RJFA 1ZN5A 4K35A 1BI1A 3FB9A 1QWFA 2QA4Q 1JUNA 1YCSB 5I2SA 2YUNA 1HUCA 3KDPB 5KJ7A 4LC1A 1N7SB 2EYQA 2E75D 2A3LA 2CZ0B 3GF7A 3PE0A 2O4XA 3ZDMA 1NAYA 1LWUC 3MIWA 1VQNP 2AEFA 1VQPT 1KK7A 2QYZA 1WDXA 2EKOA 3A1PA 1VQ4P 3CCSP 1SFCC 1SP4A 3REAB 5GAN5 5C6SA 4E7HA 2CK3H 1NTKJ 1EDIA 2RHZA 4I7ZB 1K73Q 1ZHIA 4OB0B 2KB7P 3KFVA 3LIDA 5AVRB 3S6WA 1L0NJ 2C0XA 1KC8U 4E7IA 2LXCB 1WXTA 2ECZA 2H88C 3OSSC 1VQ6Q 2FZCB 4N4GA 3EGDA 2WPVB 2WSFH 1WHMA 5GANe 1NU1K 1VF5B 4QVZA 4RJTA 4LUEA 2QXFA 1OX3A 1FZGA 1OQKA 5E79H 3JCMf 2YHTA 3A5TA 3L36A 3CCLT 1RF1A 1DJ7B 3I5SA 2MAMA 1M3AA 2W6JH 3R4YA 3CXHD 1JMMA 2QQBA 4C0GA 3LWIA 4ANJA 5KCOA 2L3PA 3MP7B 4CC7A 5EC7A 1VQLT 2FYNC 2I2LA 1SQPJ 2M0YA 1PPJG 4PD4E 5GAN4 1S72T 3B5NA 1JB0J 3BCCJ 3GNFB 1T3LA 1S4XA 1VQ6T 5KTBA 1M1KC 1Y7XA 1SPKA 4FYWB 4JYCA 1O75A 2DJZA 2KXDA 2QA4A 1KC8C 1YITT 4HT9A 1L0LG 1FZEA 2ENMA 5LJ3f 1Q86U 1NTME 1PWTA 1SFCB 2P10A 3H1JD 1NTKK 4PJNA 3CCLQ 3QG1A 5LJ5e 2M8RA 1Z56A 2QSIA 4C0DB 2VVKA 4M75E 3CCVT 2DETA 2K6DA 1GW4A 1OVRA 4FL6A 1W4SA 2COZA 2O3JA 1KN7A 3NGPA 2GNCA 2RHYA 1FZFA 3KZIH 4WY4B 1PSEA 4JRPA 2EGEA 2EFIA 3MEUA 2LJ1A 1FBMA 1UGQB 2R5BA 1MUUA 2WACA 4ZKUA 1Y8AA 4M7DA 2DW3A 1KJWA 2IX7C 5CCGD 2LCLA 5CBNA 1VQ4Q 1T8ZA 1K9MQ 1NM7A 1RHZB 1PGQA 3JCMX 1GFDA 4PK4A 4OMLA 3NFQA 3ZFJA 4H0LB 1HWTC 2FG0A 3X26B 5KKZC 2DFUA 4XK8E 2KDSA 2CT4A 1Y0MA 4BUGA 2R3SA 3P32A 4H44D 1E79H 2DXTA 3PVQA 4AFUC 1W5CE 3GMAA 4IUTA 5BVZA 1SQQG 2POHA 3HE4B 1QCNA 1PGOA 2PTKA 4C8QE 3VS0A 1U7MA 2LQNA 4IURA 2HL5C 4ZN1A 5KYWA 3RBZA 2FEIA 3ASKA 1K9AA 3OYGA 2JS0A 3BE3A 1AV1A 2EQIA 1KD1Q 1KQLA 3U23A 1K1ZA 2QQ9A 4DZOA 2X4JA 3QUIA 2VWFA 1BE3D 3H1ID 3OYJA 1A02F 3VTPC 1BCMA 1VUBA 4J9FA 3S4RA 2LVMA 1Q95G 3PNWC 1RH5B 3EWKA 2ZAEA 3CBMA 3WXMB 2AKKA 3EFOB 2A08A 1X9VA 1ZLLA 2PUKB 3CD6A 1M7LA 3JCMg 3L75E 3G4SP 1GFCA 2O9VA 2K5IA 3EG0A 4KH0B 1KQSO 2BEQD 5APQA 1KILE 1M1FA 4FT4A 1KYOE 5FLXE 1KC8R 2WTYA 2A45I 4M7DD 2OYIA 3SD4A 4U3FJ 2E65A 2DYBA 1LCKA 3E9GA 2D6FA 2EQUA 3FJ5A 1IJDB 2Q6QA 1M4ZA 4AFSC 2X4WA 3AT1B 3HKSA 3AE6C 2MF2A 1XQHA 1WQWA 1AD5A 5GMKi 1FDIA 1GL2A 1X75C 1KB9D 2LR2A 4HCCA 1YHQQ 2Q5UA 3SFDC 5FRNA 4Y28E 1NLOC 2IIMA 2MMPA 4KGVB 3L75G 1MKMA 1WPYA 2DVJA 2ZPGB 2JP3A 4LDUA 1SVFA 3CWBG 3H1JG 1ZUUA 2K5FA 2YLCA 2EQMA 4KJMA 2WSCJ 3EAEA 1UG1A 1URQA 1WMKA 3DB3A 4GOEA 3CXCA 1QCFA 4E6RA 2YDLA 1M27C 4HCZA 4PL6A 3PMTA 1BYMA 2HQEA 3TYYA 2A06D 3CPWP 3JB9G 2K5LA 2WSFJ 2QJKC 2FRYA 4QQDA 5FROA 2FO0A 2DIQA 5KLVE 2R5MA 1XTCC 1K73R 2H89C 2W90A 1X01A 4ZMDA 4PV1B 4W7YA 2KY9A 1TUDA 4F17A 1VA7A 2OQQA 3VUZA 3EFFK 1IB8A 2MJZA 1NYHA 1BGYG 1YIJA 2K9JA 1HYOA 1Q81R 3RK2D 5IHIA 2D9TA 2DERA 4RO0A 5J26A 4HVVA 3B5NB 4QVDA 3CCJP 1JM0A 3HE4A 2L89A 3OBYA 3CC7T 1RABB 4M78E 3G4SA 2P7JA 1J3TA 2KSEA 3M0SA 2E42A 2CT3A 2I1KA 2IZ0A 1T2KC 3D6ZA 2A7YA 3JB9H 2KS1B 2KLVA 3CC2P 3I56Q 3EG2A 4WTOB 2G6FX 1VQMT 5CMZA 3M55A 2QA4T 5FU7C 4E7LA 2E74D 1OX9A 2C0OA 1YITA 3Q2YA 3QZ9B 3CCMQ 3CCEA 2H7HA 1OXZA 3MZWB 4XE5B 3H1LE 3L74D 2LTOA 4RTXA 3C9IA 5L23A 3OA7A 3FC3A 2I1JA 3VU3C 1VQNT 2VRSA 1N73C 2JM8A 5D7UA 4DOWA 1JRIA 2ATCB 1VL2A 2KI7B 1WRGA 4PJOF 2DNUA 3A8HB 4IUQA 5AW7B 1BCCG 2E5QA 3EH2A 3GLMA 2GQVA 4A63B 5I21A 4A4HA 1YHQT 1JCCA 4XQ3A 3UIAA 3PIOA 3EG9B 1Y9BA 8ATCB 4BRYB 3J81E 4N4IA 2O2OA 3A98A 1MMAA 4RKUE 1K8AC 1KYOI 3GBQA 3AEBC 4C7NA 2E76D 2B8AA 1R0CB 1MGQA 1PPJE 4YTPC 2ED1A 3NTNA 2QASA 4PJOB 1BCOA 1BE3J 3X25B 1N7LA 3LWHA 3REBB 2D8JA 2VXFA 1Q81Q 2DXBA 2D2CD 4H13B 1B3QA 2ZPEB 3AE2C 5KAFE 1D0XA 4OH8B 5KLVK 3C94A 4LDWA 1URQB 1NWQA 3T97A 1UFFA 4HKZH 2D0QB 3OYCA 3K5BA 2GQIA 1AWJA 2K57A 3C0CA 4HT8A 2X51A 2OTJP 4JJDA 2L3RA 3RDVA 3VYIA 7AT1B 1ZW0A 2DTIA 4OGQC 2Z4EA 1Q86C 4M77E 4OMNA 3AEGC 1QVFS 1WA7A 2ZVOB 3H1IE 4JRQA 3HTKB 3U1CA 1K8AQ 5J3BA 1YJNA 4F04B 3M56A 1G2CA 3H41A 4XTYA 1NJIC 1H3HA 3KZIE 3BVHA 1JY2P 4Y91A 1IFJA 1Z9ZA 2JO1A 2KRNA 1IRXA 4OGCA 3C12A 5GANd 3S3MA 2OTLA 3ZL7C 2WSEH 2E5KA 5LJ3e 2EJ9A 1WNLA 1IFIA 3H1KJ 3EGXA 3HHTB 5LL6S 4DBFA 3Q5RA 3JB9I 1ZX6A 4L73A 4EOTA 1M8OB 1YQ3C 1WYXA 1WHGA 4NPDA 5LJ5f 5H2FE 1SQBG 1QEXA 1J1EC 4IL6H 3F5HA 1WGSA 5EG2A 2HKQB 4MDXA 3VS1A 4H13D 2D2CB 1YITP 2Y9ZA 2OI3A 2WQYC 2FYZA 2HAXA 1FU1A 2A0FB 4FW1A 3CC2A 4PJOD 4ORZA 1ZA1B 1ZUKA 4NOYA 3JCMW 3CCVP 3JRZA 1AWXA 2E76B 1LP1B 1OVVA 3M59A 2NLUA 3DKMA 4I6MC 3V7CA 3TK1A 1M1KU 2ZJSE 2RK2A 1IFNA 3LW5H 5AVUB 2YRCA 1Y96B 4H0LC 3L74G 1SQQD 4IFDK 2F2XA 2QRXA 3OW2S 2ZVNB 1QVGP 3MPUB 2F5TX 5GAMf 3PRJA 1SQBD 2RF0A 5CAIA 1WJQA 3F70A 1W2EA 1PL5A 4C5IA 1YJWP 3L73G 1AT1B 1JO8A 1N9SA 3HTKA 3B8EB 1D09B 5CR2A 5AVTB 4CI0C 1DD3A 1NTMD 1OX8A 5M9OA 1XTDA 5AW1B 2SPZA 3ZEHA 4WY4C 3QO3A 3CPFA 4M4ZA 1VQ7T 1VQ8Q 2EQJA 2K9YA 2EVRA 2HYNA 2MYSA 2X4XA 4PKCC 2RQUA 4FT2A 2HFED 5B66E 2MCNA 3OS2A 3V7RA 3L72D 2WT7A 5APXA 2QTVA 1HJBA 5GAOm 4OMPA 3TSZA 3AE3C 1BI3A 4PFZA 1YYCA 1M1GA 1EX4A 4R56A 3RR6A 1TG0A 4KUDK 5IHNA 1VYTA 2K1AA 2JS2A 2X9HA 3CCJT 3JCMb 1NTZD 1K76A 4M77A 4ZTJA 5HY6A 2PVGB 4C8QF 3H1LJ 1G3WA 1LVKA 2LT4A 2B88A 2QVAA 3PH0A 4N0AA 3HP9A 1I1JA 2GFAA 4C92F 2QE7H 4OGQD 3TEEA 4D6WA 5KYXA 1BU1A 1GK4A 1QWEA 2LZ6B 1B34B 2YRDA 1AVOA 4ME7A 1R77A 2E3IA 1D7MA 5GAOr 1M1JC 4DQ2A 3CCRP 1QLYA 5APYA 1K73C 2NUPB 3O8VA 2CH4A 5CCGA 3OS5A 1U8RA 4M75C 4E47A 4FU6A 4L6V5 1NTZG 2HBWA 5GMKj 4IFFA 3MUDA 2BCCE 4D8KA 3P8CE 1IK9A 3LGFA 2KOGA 2C0IA 3S1KA 1K4US 5DJTB 3X28B 3USSA 1OWAA 1M3BA 2Q7CA 4Y99C 1KQSP 4N4HA 2OYHC 3RERA 3SB2A 3U1AA 1N9RA 1VYVA 2LRQA 4DEYA 3CC7A 1KILB 2N1TD 3NMDA 3I56P 3CC2Q 2MKVA 5KAFH 5IT9E 3H1HE 5GTHH 5KLIC 1SSHA 3JC22 4LD9K 3CI9A 4DBQA 4M7DB 1N73A 4GOFA 3PTZA 4GDOA 4FYVB 4LXCA 3H1KD 3CCET 1QL1A 1RE3A 2ZXXA 2G8YA 2F2VA 2NYSA 5CK9A 3CMAA 4N3YB 2WITA 1OYXA 1MNEA 2DXUA 2QTXA 5LJ3h 2BTTA 4N6JA 1E7OA 1W70A 4Y28J 2RJDA 2YUPA 1VQ5A 3RL0g 1X79B 2X35A 3MP1A 1RLQC 4F7UB 4HCKA 3IN6A 3L35A 3C4SA 1YJ9A 1S72A 2RHUA 3VRZA 5IAYA 2HG5D 5D6XA 3HUSC 1NVOA 1SQXG 2HSPA 4XA4A 5APSA 4B86A 1WXBA 3R6OA 1JOCA 1NO4A 3WVDB 1L0LD 2RI3A 3FRNA 1Y71A 3G71T 3TGUJ 1PRLC 2MOXA 1FE6A 1V1CA 2PVOB 5KH6A 4M75D 2EBPA 2V8JA 2EYXA 4OMMA 1X43A 1GTWA 4OVNF 2CPSA 2YWWA 2LX7A 3HRTA 1G1IA 5KE2A 3CCRQ 3CCVA 2JM9A 4H13C 2I0NA 4HVUA 1JCDA 3V2NA 5IXBA 3M9QA 1EZVD 3L73E 4Q5WA 2KE9A 3OYNA 1QVFO 2E4HA 2O31A 2XNXA 3LLRA 1JTHA 4XTVA 3VRYA 4F7UE 1ZBJA 2CP0A 2C9LY 3LH5A 2HLOA 3QJYA 3SFMA 3SEMA 1SQPD 5KYUA 3EG1A 2ED0A 1YHQP 4A4EA 4JZ4A 1N7SC 2WMMA 3JB9F 1YHQA 4AYCA 2KRSA 3NFCA 2DZCA 2M16A 4OB1B 2VC8A 3N5BB 3H6ZA 2H3EB 2V7QJ 4WY4D 1Q7YC 1RF0C 1YJNT 3UA7A 5KYXB 1K04A 2XU8A 2Q3EA 4L75A 3L71G 3PVLA 1IC2A 1VQKP 4FCYA 1YN8A 2AXTE 5FWBA 4PJ0H 1L4AD 4GY5A 1YJ9Q 2HPCA 1U3OA 1Y07A 1X69A 3QWYA 1VQPA 2A28A 2J06A 1VQOQ 2QEXP 3D7SB 2HQHA 1JXOA 2IBZI 1UGSB 3ZBDA 1YJWQ 1GDTA 1M3CA 3VN0A 2K3YA 5DLOA 4FYYB 2DEUA 2QI2A 2FXMA 2K9GA 3CMEQ 4C7RA 3ITKA 1EXIA 3CMAQ 2BE9B 1FMVA 4E7JA 2JWAA 2LDMA 3CC4T 4QKUA 2FYUG 2D2CC 3A7OA 1RAAB 4JRKA 1NGMB 5DJUB 4I2LC 4ESRA 3M06A 2P4TA 2Y0CA 3C8VA 2DO3A 4Y92A 1AHJB 3MHXA 5KLVJ 4I1LA 2ZPHB 1GXIE 4J6XA 4MMKA 3TREA 1VQ5P 2FYUJ 5L8RE 3L70E 3GW6A 4EDFA 3HPWA 1GL2B 2FYNB 3CCQT 3A8GB 1CI6A 1AWOA 3CX5I 1ZR4A 4ZN3A 3GP8A 1PP9G 1FDOA 2CP2A 1ZA2B 1ABOA 1LTTC 1NU1D 4PD4H 1NJIR 2QIWA 4NL3A 3META 5LJ5d 3WVEB 4XTZA 1WX6A 3AE4C 3I55T 1NJIU 3CBOA 1M56D 1CW5A 4E7KA 4E2FB 4BI3A 1JJ2A 2H43A 1URQD 2DBMA 2F5KA 1N8RC 3DB4A 3I35A 1EZVE 3CWBD 3FWLA 4J9DA 4LDYA 5L8RJ 1UJ0A 4OGEA 1C0MA 4PJJA 1L4AA 3L73J 5FU6C 1OI1A 1PP9D 3QWXX 3V2QA 3M0PA 2NUTA 1AWWA 4C92E 1R8OB 1QVFP 2CH4W 2E75B 4HYTB 1S1CX 2XKOC 3L72G 1Y57A 4HJGH 1DH3A 3A8LB 4BD3A 4CC4B 3KYQA 1YQ4C 5AW5B 4JZ3A 4YPCA 2KT1A 1SRLA 5LJ5h 3L75J 2OYHA 3EGXB 2K4YA 1IO4A 2YMYA 2XIDA 2WPRA 1WT6A 3BCCG 4DCKA 1SQPG 1YI2A 3GHGB 3H1LG 1YJWT 1TOVA 3HRNA 2QJYB 1X27A 4UB6E 1HXDA 2AKLA 1YIJP 4AT1B 1YJ9T 1Q82C 1M90Q 4ASWA 2XDPA 2JTFA 1QW1A 3VUBA 2WPSA 1RQUA 2QM7A 3KXDA 4BY6B 1M1JB 1GU5A 5TISH 2Z5HA 1I0CA 4N78E 2E5YA 1PD1A 3G4ST 2CP3A 5GJWB 3H1KE 1HF9A 1G2BA 4IL6X 3II6A 3JSVC 1XOVA 3FX0A 4MZPA 3I5RA 3ME9A 3JSCA 3OW2A 2C9NY 1LJ2A 2GFUA 3TSWA 1KFNA 1WHLA 2IZ1A 1BGYE 1T3SA 1W2BA 1I81A 3B5ND 2JUFA 2VUBA 4O9BA 2DJQA 4RESB 1QGKB 3VS2A 2K2VA 2B86A 1QP2A 1KB9H 1VQ4T 1SSFA 2FVUA 3CCQA 2RHIA 4JJBA 3CL3D 3M0QA 5IXFA 3RK3E 1SQVG 2DL3A 2GGRA 1ZXGA 4X1VA 3M4YA 2P67A 1GW3A 1MFZA 4C5HA 3LW5J 1YP5A 2L5GB 3PLNA 4TT3H 3OYKA 2DLPA 5KAIE 2L3SA 5GAMd 3AE7C 5A2QE 5GAN3 3OS0A 2C0TA 3MGNA 1GBRA 4L76A 5CQYA 5HK0A 3MEAA 3SWKA 2LNVA 4M7AG 1I07A 1OZ3A 2B9BA 1OU9A 4D8DA 3TSIA 3NTIA 4GT1A 2DM1A 4WF2A 1VQ5T 1Q2NA 2RQWA 1VQKA 2BZXA 1X6BA 4QT7A 3OY9A 4IUPA 4I7ZC 4M7AA 4HXJA 5KLVD 3CCJQ 2OTLQ 1S1NA 4RTZA 1IFPA 1BE3E 1M8VA 1LTJA 1SHFA 3QBYA 1WHKA 4QQ6A 3VS7A 1LT9B 1LT9A 1YBYA 1Q86R 1ZSZA 5FW9A 1SQXD 3GLXA 3HSBA 1EZVI 2L2PA 3QYGB 4A4FA 3H1IG 1HJ0A 1L2PA 4KT0J 1HGVA 4JPZB 1TS9A 5AVZB 1VQ6A 2K3RA 2QQSA 2NPSA 2QJPB 3M53A 1VQNQ 3MKDA 5BU8B 2R44A 1UGVA 2E12A 1BDDA 2NUTB 3M4GA 1VQ7Q 5D6YA 1M8MA 1RUWA 4BDYA 4YXDC 1SRMA 1GCQA 3A2AA 1Q82Q 1WQ7A 1JY3O 2ZT9D 4KH1B 1CSBA 4EIKA 5KAIH 3P8CD 1I8FA 2BCCD 3CMET 5AVVB 3UT1A 3G6ET 1M1KQ 4RMOA 1GCPA 5AW3B 2FZGB 3HD7A 1QVPA 1UUEA 3QHSA 1VQ7P 3RBBB 4C8QG 4EMHA 2ROTA 2AEJA 4NL2A 1J2JB 3R6NA 2EYWA 2DE0X 1RAEB 2DF6A 3CC4Q 1VQ9P 3G71A 1L0ND 3A0HE 3L75D 3VJPA 1LTJB 3KQGA 2IBZE 2F2WA 4P5NA 2AT1B 2X3WD 1KQ2A 2DTHA 1SLQA 1YJ9P 2QJKB 4JS5A 1NEGA 3C95A 2CPBA 1VQMA 3JB9J 5M1BA 4L74A 1EC5A 3L71D 2O01N 1RY3A 2DL8A 1M90U 3MCAB 4J9IA 4TVRA 1WJSA 2NPSC 1OPKA 4DJGA 5IN1A 3CMAP 3UPUA 3WU2E 3FIFA 2LCCA 2EGCA 2E75C 4D6TJ 3OQ5A 1L0NG 3SWNA 4LDXA 3RUXA 3JCMc 4OVAA 1R5LA 3I56A 3M9HA 3CX5E 4PV1C 2XDDA 2KNCB 3CC7P 4N78D 1H8AA 5AW6B 3JAME 1TSFA 2QG4A 4HKEA 1IZ6A 4R4LA 3G1JA 2OTLT 1NYGA 1LTAC 4OF1A 4C92G 4L59A 1RE4C 5APVA 1MV0B 3OYAA 1WXUA 1PV3A 3CCEP 2N1TC 4C46A 4DOJA 1YI2P 3S3OA 5CCGC 3L2QA 2GUSA 4X9DA 1M1KR 3IF4A 1SFCD 1BB9A 1N73B 3H0IA 4M77D 1NLPC 2JEEA 2PZ1A 4PJ0E 1WHHA 1T3JA 1FWZA 2A45G 4LGDE 3EFGA 1KSWA 2RI5A 2M0OA 2V1RA 3CXCS 2KLUA 3VP9A 2J6FA 3I55A 1MUZA 1SQBJ 2O9SA 4OP0A 1R8EA 1N86A 3V4WA 1KQ1A 4ZTFA 5AT1B 1GL2D 1JTHB 2GF7A 3OYMA 3MEVA 2O01E 2RQRA 1K8AU 3NTKA 2M1HA 4IUUA 4C92D 2L8DA 1VQ4A 1D1CA 2RMZA 3IR9A 2EYYA 4QVCA 2QEXT 3TQ7P 3A8OB 1PM3A 2Q1KA 2KT8A 1JY3N 2PU9B 3SWNC 1A0NB 1G2CB 1VQNA 2X3XD 1S9KD 2RJEA 3C1LA 1VF5D 2FYUK 5CVIA 3GPLA 2WSCH 1RI9A 2P0PA 2KAFA 1Q90D 3O8ZA 1IGUA 2P2UA 1FZCC 2HZYA 2ZYAA 1OMIA 5E79E 3CCUT 2V1QA 2FFDB 2N1TA 1PKSA 1NKZB 3VS4A
chains in the Genus database with same CATH topology
1L4AB 2JTMA 3M57A 3V7SA 3H6PA 4C8QC 3L37A 3RMSA 1N7SA 5AVSB 4HCBA 1S9KE 1NH4A 3E19A 2J59M 2O4XB 1YIJT 4FSXA 3JCMd 5GAOl 1YTZT 3PP5A 2E6ZA 2JZ2A 1VIEA 2ZPIB 3BRVB 2AHJB 3RKXA 2E1HA 2OYIC 3RL0B 4GKGA 5KE3A 1G3YA 3KBGA 4JRIA 1KFMA 1YTZI 1K9MU 2X4YA 1FJKA 1PSFA 2XV5A 4QQGA 2P0QA 4C8QB 4JYBA 4B9XA 5CKHA 3B5NC 2EJFA 3MTUE 4M75B 1OZ2A 4EPCA 5LJ5j 4RCBA 2R57A 2GCXA 2BKDN 3HL8A 4M7AC 4KT0E 1UGRB 4M75G 1DX7A 1KZUB 3X20B 3ER0A 1NAFA 1I4K1 2PP6A 1FOSF 4XU2A 4BDZA 2KSSA 3CEYA 1HGZA 1FOSE 2PUOB 3UWNA 4WBAA 3RMQA 4M7DC 3H32B 1NKNA 3GOXA 2Y90A 3OYYA 3GNGA 5C0MA 3PFSA 1YCYA 2VV5A 3I56T 3FDRA 1MZ9A 4BY6C 1KILD 2N1TB 4II1A 4PJOG 3RK2C 4ZKPA 3L2ZA 1VQ7A 3HRSA 1RF1B 1M90C 1VDFA 1LTBC 3FEOA 1K73U 2LX9A 3TCJA 2IFMA 1VQLA 2WSFE 5GAN6 5DY9A 5J39A 3M91A 3CLQA 2ZZDA 2YKOA 2ZFCA 4ELYC 5AVWB 1M9SA 5FRMA 1HTLC 2YKPA 3G7ZA 5GANf 4PJOA 1X8YA 2ZGWA 5CKEA 5CCAA 5KJ7D 2XK0A 5A0DA 3VMZA 3WMM0 5GMKe 5APWA 1LGHB 2LC4A 1U1SA 3MP8A 4JLGA 2BIVA 2L5QA 3PTAA 4J5YA 2PVDB 5GMKl 2O01H 1QVGS 4MZTA 2YKQA 2CZ6B 2OARA 1BIAA 1GL2C 2IVWA 1TH7A 3SWFA 3RKWA 3CCSA 4M3LA 2OTJT 3OYDA 4LLHA 3MD0A 3VYGA 4N0AC 1H641 2FB7A 2RM4A 1DEBA 2HBPA 3Q1JA 4XTWA 2EQKA 1M1JA 4XAXB 2BASA 2ZXEB 4YTLA 3P8MC 4JDSA 1JB0E 4XU3A 2K3XA 5FU7B 4BACA 5FU6B 1Y96A 2E64A 3HE5A 2W27A 4XU1A 5AW2B 4F7UA 3CCMT 3M0DC 1FJPA 3VOPA 3H8ZA 4RG2A 4BE2A 3TU4K 1P92A 1SFCA 1SQVK 3H32A 2Y4XA 1I5LA 1X6OA 2V8KA 3QKJA 2FL7A 2QQAA 2R5DA 2EWNA 2P1JA 1JBMA 2MWPA 3TNUA 1IREB 4M7DF 4J7IA 1O9SA 5GMKh 2KQWA 4EMKB 3U59A 2DD5A 3OS1A 4C0FA 1VIFA 2FHDA 4XTXA 1PFIA 4PJOE 3OSVA 3BFMA 4F7UF 3J80E 1KQSS 3BDLA 2WZ7A 1SQBK 1BI0A 4M75A 4LDVA 3LIEA 3M0DA 4M7AD 1FZBA 1J1DB 3CCLA 1FDMA 1NTMK 2RH2A 5CHXA 1L0NK 1VQ8T 3UDCA 1G3TA 1UGPB 3GHGC 2KSJA 5AW4B 4M78B 2KK4A 3CCRT 1AFOA 1IFDA 3VYHB 1Q82U 2XKMA 4MDWA 3M54A 4PLLA 1SQQK 3RIRA 3SDZA 2HPCB 2JN0A 1NOHA 4M75F 4CRIA 4BB7A 1GZLA 1ZBXA 3L1AA 1JNMA 4ZGJB 3QZ5B 2RI2A 3P7KA 2FFDA 1LTSC 2ZPFB 1A02J 2M9UA 3NTHA 4C92A 2NPSB 1GU4A 2PAJA 3VMXA 4F7UG 2EAYA 5LJ5g 3RK3D 2XZRA 3JCMQ 1QP3A 2G3RA 4PLIA 3JB9D 5AW8B 2CS7A 3V4QA 2JJLA 1V29B 1VPCA 3QJ6A 2KMTA 2GUVA 3QYHB 4OMFB 3L2VA 2RJCA 3GHGA 3HUSB 1VQ9T 2EIFA 2HNIA 4A4KA 3RK2B 1U1TA 3GF5A 3OYFA 1N6AA 1AQ5A 2DD4A 3HFNA 5D6WA 3CC2T 5AW9B 2HD0A 1HH0A 2N9BA 3A8MB 1MV8A 2WSEE 1B34A 3A5ZB 2IFNA 3JCMh 3P8BB 2E43A 4BE0A 2HODA 2DK3A 1NPRA 3P8DA 3EFRA 4J8OA 1KHCA 4J83A 3CCJA 3PIPA 4M78C 2JOYA 5KCHA 1GK6A 1XTGB 4M77F 2MWOA 4R55A 3E9FA 3INZA 1FZCB 4O6JA 1LNXA 4BI8B 2DPPB 2XDBA 5CCHA 2JVVA 4JUVA 5A0LA 1JY2N 4BI4A 3QPHA 2M3BA 4C0DC 3JCMP 3OAKA 1JO5A 2E70A 5APTA 5GANh 3CCST 1EIFA 2HQXA 2EJGA 3FLGA 1FZAA 3E1IA 4L5GA 4M7AE 1D3BA 4M78A 5GAN7 3CMAT 2R32A 3M9BA 1KQSA 2QM8A 3LX7A 5I2MA 4M7DE 3M58A 2YO2A 1M5Q1 2CYZB 2JNGA 5APUA 1VQOT 3R2PA 4O5VA 2DKGA 1ZQ1A 2VXEA 1SQPK 3CC4A 1RE3C 4J6YA 4NS5A 3FJPA 5CQXA 4C8QA 2KYVA 5GAOq 2C06A 3V2RA 2DVEA 3OYLA 1LOJA 4EIJA 2YO3A 1NTZK 4EDUA 2KP8A 1N2DC 5CKFA 2CZ7B 2WSCE 1KG1A 3URGA 1Q81C 1RF1C 5CIUA 1NE8A 2FFDC 2XU6A 1UB4A 5GAMg 3G6EA 2FKWB 4KULA 2HODB 2A45H 1LJOA 3HE5B 2GM4A 2XG8D 3QXEB 3CCUA 1QL2A 1T2KD 2DAQA 1D3BB 4XU0A 3L42A 1VQ9A 2IPPA 5GAOp 4Z02A 4KUIA 3RKYA 4X9CA 2H8PD 1FAVA 1QVGA 2PQWA 4X34A 1H89A 3VP8A 2QEXA 1G5VA 5CO7A 1E5WA 5CCHD 5CKDA 2OAUA 2OYIB 2DEQA 3V8LA 1LWUB 4ZGDB 4HA8A 2XD0A 1LTGC 3N4XA 3GIBA 1LT9C 4RCCA 3L4FA 3HFOA 4M78F 2Z5IA 4M77G 2E6NA 2QQRA 1W2BS 2Q9IA 4ATOA 4BE1A 3MP6A 2RA2A 3BRTB 1NHLA 2LKMA 2F69A 3CMEA 1J1DC 1EQ7A 4GIFA 2Q3IA 3QSUA 4JLIA 4HH2A 5AVQB 3OYEA 2RHXA 3SWNB 2IG0A 1ZV8A 1NPPA 1ZR2A 1CI6B 2DZ9A 5GAMj 4FIBA 1GD2E 1NZ9A 1FX7A 3SWYA 2RB6A 3BATA 5GANg 4PJOC 3M0AA 3EQ2A 3L2UA 5GAN2 4VUBA 4A53A 4JS4A 3RK3B 5GAOn 1Q81U 2E41A 4M78G 2C0WA 3PMIA 2NPSD 1FXXA 3LH0A 4UC4A 3RL0D 4RG8A 4M7DG 4C7NB 2KVQG 3OJAB 4A4GA 5LJ3j 3OMCA 3CPWS 4M78D 1SQXK 2O1JA 1WJRA 5A0GA 4IUVA 2XI9A 1YI2T 5HKCA 3OBWA 3OYHA 5CJ0A 1KILA 4W7ZA 3X24B 4DOVA 3HUSA 5GMKm 2R5AA 4M7AB 5AYFA 2DXCA 5GAMe 4IFMA 4FM4B 1N8RU 3S3NA 1BIBA 3V5BA 2CKKA 2VGMA 2YRVA 5KJ7C 1G3SA 4C92B 2R3CA 4AUWA 2O1KA 4B9WA 1L0LK 3KPEA 5CCHC 3JCMJ 3OA6A 5CJ4A 1KD1C 4M77B 4OB2B 1RI0A 3DLMA 3VMYA 1KILC 3J7AF 2XHCA 3KXTA 4C5GA 1YJWA 3RESA 3HD7D 3EFSA 2H3JA 3PT9A 5DM7R 2FYKA 2RO0A 1H88A 3L2WA 1KHIA 2CZ1B 1L4AC 2YNYA 2W6AA 1FZCA 4OB3B 4MMLA 4IKFA 1KD1U 1MHNA 2VGNA 3V2PA 3NXSA 4C5EA 4DA4A 1RE4A 1CZQA 3BDUA 3G3ZA 4A54A 3RL0C 1RF0A 3HD7B 5BU5A 2RK1A 5GAN8 1J1EB 1LTIC 4Y99B 5DLQE 2XICA 3CCMA 4JJNK 2Y4YA 3TNUB 1JJ2S 3HRUA 4EMGA 1LTJC 1BKBA 2ZPBB 4C0ZA 4MZMA 4C92C 2R58A 3A3YB 1K9MC 3P8HA 2VYTA 2QDYB 4J7FA 1VQKT 2ZCFB 1XNIA 2OTJA 4KBMB 3VV0A 4W80A 3OB9A 3MO8A 2LT1A 5HK3A 3OYIA 5AVYB 1URQC 3V8JA 2WPQA 3HD7C 1T3UA 3T9NA 1HVVA 2XDJA 3BY7A 1RL2A 1BI2A 1HK9A 3QDRB 2OYHB 3I5CA 4QW2A 5LJ3g 5GAMh 4EMKA 2V8IA 3JCMe 4ZGEB 3M5AA 4XTUA 2DTOA 1N7SD 3OMGA 4ELZC 1IFMA 4JF7A 3RK3C 4KHXA 3QIIA 2YLBA 1JY2O 2CGHA 1UEBA 3E1SA 1JY3P 5CKBA 2LQ8A 1G1JA 3CCRA 4PNOA 3OYBA 3V8KA 3JCMV 4M77C 3BW1A 2DIGA 2WT7B 3VKIA 5LJ3d 3DLLA 2LQKA 2P0KA 1QVFA 1LWUA 4M7AF 3CBPA 1N27A 1HBWA 4WB4A 5GANj 3LW5E 2RD1A 5AVXB 3LGLA 3KUFA 3IFMA 4J6WA 4EMKC 5AW0B 2MI6A 4GLKA 1Q7YU 2J58A 3N7NA 2E10A 4LD6A 3CPWA 4AQRD 2BUDA 3MEWA 2W6BA 1H3ZA 1VQOA 3AHUA 3L2RA 1VQ8A 4C8QD 4V2SA 3LYIA 3CD6T 3PGGA 2WWWA 4WY4A 3BASA 2RJFA 1ZN5A 1BI1A 3FB9A 1JUNA 5I2SA 1HUCA 3KDPB 5KJ7A 4LC1A 1N7SB 2EYQA 2A3LA 2CZ0B 2O4XA 1LWUC 3MIWA 1VQPT 2EKOA 1SFCC 1SP4A 5GAN5 5C6SA 4E7HA 2RHZA 1ZHIA 4OB0B 2KB7P 3LIDA 5AVRB 3S6WA 1KC8U 2C0XA 4E7IA 3OSSC 4N4GA 2WSFH 5GANe 1NU1K 4QVZA 2QXFA 1FZGA 3JCMf 2YHTA 3A5TA 3L36A 3CCLT 1RF1A 1DJ7B 2MAMA 1JMMA 2QQBA 4C0GA 3LWIA 5KCOA 1VQLT 2I2LA 5GAN4 1S72T 3B5NA 3GNFB 1VQ6T 5KTBA 1M1KC 1Y7XA 4JYCA 1O75A 2DJZA 2QA4A 1KC8C 1YITT 4HT9A 1FZEA 5LJ3f 1Q86U 1SFCB 1NTKK 3QG1A 5LJ5e 2M8RA 1Z56A 4C0DB 4M75E 3CCVT 1GW4A 4FL6A 1W4SA 2RHYA 1FZFA 4WY4B 1PSEA 2EFIA 3MEUA 1FBMA 1UGQB 2R5BA 1MUUA 2WACA 4ZKUA 4M7DA 2IX7C 5CCGD 2LCLA 1T8ZA 3JCMX 3NFQA 3ZFJA 1HWTC 3X26B 4XK8E 2KDSA 4BUGA 3P32A 2DXTA 4IUTA 5BVZA 2POHA 4C8QE 3HE4B 4IURA 4ZN1A 3ASKA 3OYGA 1KQLA 2QQ9A 4DZOA 2X4JA 3QUIA 3OYJA 1A02F 3VTPC 1VUBA 2LVMA 3PNWC 3CBMA 3WXMB 1X9VA 1ZLLA 2PUKB 3CD6A 1M7LA 3JCMg 2K5IA 5APQA 1M1FA 4FT4A 5FLXE 2WTYA 2A45I 4M7DD 2OYIA 3SD4A 2E65A 3E9GA 2D6FA 2EQUA 1IJDB 1M4ZA 2X4WA 3HKSA 2MF2A 1XQHA 1WQWA 5GMKi 1GL2A 1X75C 4HCCA 2Q5UA 5FRNA 4Y28E 2MMPA 1WPYA 4LDUA 2ZPGB 1SVFA 2K5FA 2YLCA 2EQMA 3EAEA 1URQA 3DB3A 3CXCA 4HCZA 1BYMA 4PL6A 3PMTA 2HQEA 3TYYA 3JB9G 2K5LA 4QQDA 5FROA 2DIQA 2R5MA 1XTCC 1X01A 4W7YA 2KY9A 3VUZA 2MJZA 1YIJA 3RK2D 2D9TA 5J26A 3B5NB 4QVDA 3HE4A 2L89A 3OBYA 3CC7T 4M78E 3G4SA 2P7JA 2E42A 2I1KA 1T2KC 2A7YA 3JB9H 2KLVA 1VQMT 5CMZA 3M55A 2QA4T 5FU7C 4E7LA 1YITA 3QZ9B 3CCEA 2H7HA 1OXZA 4XE5B 2LTOA 3C9IA 3OA7A 3FC3A 2I1JA 3VU3C 1VQNT 2VRSA 1N73C 4DOWA 1JRIA 1WRGA 4PJOF 3A8HB 4IUQA 5AW7B 2E5QA 2GQVA 5I21A 4A4HA 1YHQT 1JCCA 4XQ3A 3UIAA 3PIOA 3J81E 4N4IA 4RKUE 1K8AC 4C7NA 2B8AA 1MGQA 3NTNA 4PJOB 3X25B 1N7LA 3LWHA 2VXFA 2DXBA 2ZPEB 4OH8B 5KLVK 3C94A 4LDWA 1URQB 1NWQA 3T97A 2D0QB 3OYCA 2K57A 4HT8A 2L3RA 3VYIA 2DTIA 2Z4EA 1Q86C 4M77E 1QVFS 4JRQA 3HTKB 3U1CA 5J3BA 1YJNA 3M56A 1G2CA 4XTYA 1NJIC 3BVHA 1JY2P 4Y91A 1IFJA 4OGCA 3C12A 5GANd 3S3MA 2OTLA 2WSEH 5LJ3e 2EJ9A 1WNLA 1IFIA 3HHTB 5LL6S 3JB9I 4EOTA 5LJ5f 1J1EC 1WGSA 5EG2A 4MDXA 2FYZA 2HAXA 1FU1A 3CC2A 4PJOD 4NOYA 3JCMW 3JRZA 3M59A 2NLUA 3DKMA 4I6MC 3V7CA 3TK1A 1M1KU 2RK2A 1IFNA 3LW5H 5AVUB 1Y96B 4IFDK 3OW2S 2F5TX 5GAMf 5CAIA 1WJQA 3F70A 1W2EA 4C5IA 1N9SA 3HTKA 3B8EB 5CR2A 5AVTB 4CI0C 5M9OA 1XTDA 5AW1B 3ZEHA 1VQ7T 4WY4C 3QO3A 3CPFA 2EQJA 2HYNA 2X4XA 4PKCC 4FT2A 2HFED 3OS2A 3V7RA 2WT7A 5APXA 1HJBA 5GAOm 1BI3A 1YYCA 1M1GA 4R56A 4KUDK 3CCJT 3JCMb 4M77A 4ZTJA 5HY6A 2PVGB 4C8QF 1G3WA 2LT4A 4N0AA 3HP9A 2GFAA 4C92F 3TEEA 4D6WA 1GK4A 1B34B 4ME7A 5GAOr 1M1JC 4DQ2A 5APYA 1K73C 3O8VA 1U8RA 5CCGA 3OS5A 4M75C 4E47A 4FU6A 4L6V5 5GMKj 4IFFA 3MUDA 3P8CE 1IK9A 3LGFA 2KOGA 3X28B 1OWAA 2Q7CA 4Y99C 4N4HA 2OYHC 3RERA 3SB2A 3U1AA 1N9RA 2LRQA 3CC7A 1KILB 2N1TD 3NMDA 5IT9E 4LD9K 3CI9A 4M7DB 1N73A 3CCET 1QL1A 1RE3A 3CMAA 5CK9A 4N3YB 2WITA 1OYXA 2DXUA 2QTXA 5LJ3h 4N6JA 2RJDA 1VQ5A 1X79B 2X35A 3MP1A 4F7UB 3L35A 3C4SA 1YJ9A 1S72A 2RHUA 5IAYA 2HG5D 5D6XA 3HUSC 4XA4A 5APSA 4B86A 3R6OA 1JOCA 1NO4A 3WVDB 2RI3A 3FRNA 1Y71A 3G71T 2PVOB 5KH6A 4M75D 2V8JA 1GTWA 2CPSA 3HRTA 1G1IA 5KE2A 3CCVA 1JCDA 3V2NA 3M9QA 4Q5WA 3OYNA 2XNXA 3LLRA 1JTHA 4XTVA 4F7UE 2C9LY 2HLOA 3QJYA 3SFMA 4A4EA 1N7SC 3JB9F 1YHQA 4AYCA 3NFCA 2DZCA 2M16A 4OB1B 2VC8A 3N5BB 3H6ZA 4WY4D 1Q7YC 1RF0C 1YJNT 2XU8A 1IC2A 4GY5A 1L4AD 2HPCA 1Y07A 1VQPA 3ZBDA 1UGSB 1GDTA 5DLOA 3VN0A 2K3YA 2QI2A 2FXMA 4C7RA 4E7JA 2LDMA 3CC4T 3A7OA 4JRKA 4I2LC 3M06A 2P4TA 2DO3A 1AHJB 3MHXA 2ZPHB 4I1LA 1GXIE 4J6XA 4MMKA 3TREA 5L8RE 3HPWA 3CCQT 1GL2B 3A8GB 1CI6A 1ZR4A 4ZN3A 3GP8A 1LTTC 4NL3A 3META 5LJ5d 3WVEB 4XTZA 1NJIU 3I55T 3CBOA 1CW5A 4E7KA 4BI3A 1JJ2A 2H43A 1URQD 2F5KA 1N8RC 3DB4A 4LDYA 4OGEA 1L4AA 5FU6C 1OI1A 3V2QA 4C92E 1R8OB 4HYTB 2XKOC 1DH3A 3A8LB 4BD3A 3KYQA 5AW5B 5LJ5h 2OYHA 2K4YA 1IO4A 2YMYA 2XIDA 2WPRA 1WT6A 1YI2A 3GHGB 1YJWT 3HRNA 1HXDA 1YJ9T 1Q82C 2XDPA 2JTFA 1QW1A 3VUBA 2WPSA 2QM7A 4BY6B 1M1JB 2Z5HA 1GU5A 4N78E 3G4ST 3II6A 1XOVA 4MZPA 3ME9A 3JSCA 3OW2A 2C9NY 2GFUA 1KFNA 1W2BA 1I81A 3B5ND 2JUFA 2VUBA 4O9BA 4RESB 2K2VA 1QP2A 1VQ4T 1SSFA 2FVUA 3CCQA 2RHIA 3CL3D 3M4YA 2P67A 1GW3A 1MFZA 4C5HA 2L5GB 3OYKA 5GAMd 5A2QE 5GAN3 3OS0A 3MGNA 5CQYA 5HK0A 3MEAA 2LNVA 4M7AG 1OZ3A 3TSIA 3NTIA 4GT1A 4WF2A 1VQ5T 1VQKA 3OY9A 4IUPA 4M7AA 1M8VA 1LTJA 3QBYA 4QQ6A 1LT9B 1LT9A 1YBYA 3GLXA 3HSBA 4JRPA 4A4FA 3QYGB 1HGVA 5AVZB 1VQ6A 2QQSA 2NPSA 3M53A 5BU8B 2E12A 3M4GA 5D6YA 4BDYA 3A2AA 1WQ7A 1JY3O 1CSBA 3P8CD 1I8FA 3CMET 5AVVB 3UT1A 3G6ET 4RMOA 5AW3B 3HD7A 1QVPA 4EMHA 3QHSA 4C8QG 4NL2A 1J2JB 3G71A 3VJPA 1LTJB 3KQGA 4P5NA 1KQ2A 2DTHA 1SLQA 4JS5A 3C95A 2CPBA 1VQMA 3JB9J 1RY3A 1M90U 3MCAB 4TVRA 1WJSA 2NPSC 5IN1A 3UPUA 3FIFA 2LCCA 3OQ5A 3SWNA 4LDXA 3RUXA 3JCMc 4OVAA 3I56A 3M9HA 2XDDA 4N78D 1H8AA 5AW6B 3JAME 4HKEA 1IZ6A 2OTLT 1LTAC 4OF1A 4C92G 4L59A 1RE4C 5APVA 3OYAA 2N1TC 4DOJA 4C46A 3S3OA 5CCGC 3L2QA 2GUSA 4X9DA 1SFCD 1N73B 4M77D 2JEEA 2RI5A 1T3JA 1FWZA 2A45G 4LGDE 3EFGA 2M0OA 3CXCS 3VP9A 3I55A 4OP0A 1N86A 3V4WA 1KQ1A 4ZTFA 1GL2D 1JTHB 2GF7A 3OYMA 3MEVA 2O01E 1K8AU 3NTKA 2M1HA 4IUUA 4C92D 2L8DA 1VQ4A 3IR9A 4QVCA 2QEXT 3A8OB 2PU9B 1JY3N 3SWNC 1G2CB 1VQNA 1S9KD 2RJEA 2FYUK 5CVIA 3GPLA 2WSCH 2P0PA 2KAFA 3O8ZA 2P2UA 1FZCC 3CCUT 2FFDB 2N1TA 1NKZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKM A;  4FU6 A;  2WSE H;  2MWP A;  3OYF A;  3OB9 A;  2D9T A;  2CKK A;  3FEO A;  3LGF A;  3MO8 A;  4GY5 A;  5J26 A;  2YRV A;  5D6W A;  1SQP K;  2L89 A;  3OYI A;  2J59 M;  2O4X B;  3ME9 A;  3OYE A;  2GFU A;  2O4X A;  4N4H A;  5J39 A;  2JZ2 A;  1WGS A;  2K3Y A;  2RHX A;  3CLQ A;  4NS5 A;  4B9W A;  3S3N A;  3OS1 A;  1L0L K;  2LRQ A;  2IG0 A;  4IUT A;  2FHD A;  1WJS A;  2LDM A;  4E7J A;  2EKO A;  3OYL A;  4BE0 A;  5IN1 A;  4E7L A;  3BDL A;  5FRM A;  5KE3 A;  3P8D A;  5C6S A;  3OA6 A;  4E7H A;  1SQB K;  1NTZ K;  2LCC A;  2NLU A;  2RHZ A;  1KHC A;  4IUR A;  4EDU A;  2XK0 A;  2X4Y A;  1SSF A;  1RI0 A;  2RHI A;  3ASK A;  3OQ5 A;  2LTO A;  3OYG A;  3DLM A;  3LW5 H;  4QQG A;  3FC3 A;  3S6W A;  4B9X A;  4IFD K;  4QW2 A;  4C5H A;  5KCH A;  4C5G A;  3OYJ A;  4OVA A;  4E7I A;  2LVM A;  5CIU A;  1OYX A;  3PNW C;  4IUQ A;  3OYK A;  3MP8 A;  1WJQ A;  3F70 A;  2E5Q A;  4N4G A;  3OS0 A;  1OZ2 A;  2WSF H;  2BIV A;  2RJD A;  2MWO A;  4C5I A;  4A4H A;  3L2U A;  1NU1 K;  1NTM K;  4QVZ A;  2X35 A;  2RO0 A;  2O01 H;  3E9F A;  3MP1 A;  4L59 A;  3OMG A;  3MEA A;  1L0N K;  1OZ3 A;  3L2W A;  5M9O A;  2OAR A;  2R57 A;  3C4S A;  3OYA A;  2DAQ A;  3MET A;  3NTI A;  2RHU A;  4N4I A;  5IAY A;  5D6X A;  3ZEH A;  3S3O A;  2BKD N;  3L42 A;  3PMI A;  3L2Q A;  2EQJ A;  3SD4 A;  5KCO A;  3OY9 A;  3OYD A;  3E9G A;  4IUP A;  3QII A;  3LH0 A;  4UC4 A;  4Z02 A;  2EQU A;  2B8A A;  2X4X A;  1SQQ K;  4PLL A;  4E7K A;  2RI5 A;  2RI3 A;  2F5K A;  3DB4 A;  3QBY A;  4IKF A;  2M0O A;  2PQW A;  1MHN A;  2X4W A;  4QQ6 A;  3OS2 A;  4C5E A;  3OYB A;  4X34 A;  2DIG A;  3Q1J A;  4CRI A;  4BDZ A;  5KH6 A;  3CEY A;  2EQK A;  2HQX A;  3FLG A;  3G3Z A;  1OI1 A;  4ZTF A;  2P0K A;  5KLV K;  5FRN A;  4A4F A;  1G5V A;  2GF7 A;  3OYM A;  3MEV A;  2RI2 A;  3UWN A;  1N27 A;  3NTK A;  5KE2 A;  2M1H A;  4IUU A;  4A4G A;  3OYC A;  3OMC A;  2RJF A;  1NTK K;  2L8D A;  3GOX A;  3NTH A;  2QQS A;  3M9Q A;  1SQX K;  1WJR A;  4BD3 A;  2K3X A;  5C0M A;  2L3R A;  2EQM A;  4Q5W A;  4IUV A;  4BAC A;  4ZTJ A;  3OYN A;  3EAE A;  3PFS A;  3LGL A;  3LLR A;  2RJE A;  3KUF A;  4FL6 A;  3DB3 A;  3FDR A;  5D6Y A;  3OYH A;  4BDY A;  2FYU K;  2G3R A;  4PLI A;  2RHY A;  4HCZ A;  3LX7 A;  2GFA A;  3PMT A;  4PL6 A;  2HQE A;  4A4E A;  2WSC H;  4LD6 A;  4II1 A;  2EFI A;  3H8Z A;  4QQD A;  3MEU A;  5FRO A;  2R58 A;  2BUD A;  3MEW A;  4RG2 A;  3QJ6 A;  4BE2 A;  2R5A A;  1H3Z A;  2M16 A;  2E6N A;  2WAC A;  2DIQ A;  3H6Z A;  3P8H A;  2R5M A;  3L2R A;  3UT1 A;  2QQR A;  1SQV K;  2VYT A;  3LYI A;  3L2V A;  2XDP A;  2JTF A;  2RJC A;  3O8V A;  4BE1 A;  3QKJ A;  3S3M A;  3MP6 A;  1XNI A; 
#chains in the Genus database with same CATH topology
 1L4A B;  2JTM A;  3M57 A;  3V7S A;  1VQ8 P;  2JMA A;  3H6P A;  2QK0 A;  4C8Q C;  4IOI H;  2YSQ A;  3L37 A;  4ZNC A;  2QDL A;  3RMS A;  1VQM Q;  1N7S A;  5AVS B;  4HCB A;  4RUG A;  1S9K E;  1NH4 A;  3H1I J;  3E19 A;  3NHN A;  2V7Q H;  4H44 C;  2J59 M;  2O4X B;  1PZQ A;  1YIJ T;  4FSX A;  3JCM d;  5GAO l;  1YTZ T;  3PP5 A;  2E6Z A;  2FY8 A;  3L71 E;  1W2B O;  1VIE A;  2JZ2 A;  2ZPI B;  3BRV B;  2AHJ B;  3RKX A;  2IYO A;  2RN0 A;  2OYI C;  2E1H A;  3IAO A;  2BCC J;  1B07 A;  3RL0 B;  1KOR A;  4GKG A;  3EH1 A;  2RQT A;  5KE3 A;  1G3Y A;  3KBG A;  1BK2 A;  4JRI A;  2JXB A;  1KFM A;  4U3F D;  1YTZ I;  1K9M U;  2X4Y A;  1FJK A;  1PSF A;  2XV5 A;  4K3A A;  1L0L J;  4QQG A;  3CCV Q;  2P0Q A;  1ZOY C;  4C8Q B;  4JYB A;  4B9X A;  1PKT A;  5CKH A;  1KV4 A;  2NRG A;  2K88 A;  3B5N C;  5KYU B;  3CME P;  2RQV A;  2EJF A;  1S3J A;  2IDB A;  3MTU E;  4LUD A;  4M75 B;  1OZ2 A;  4EPC A;  1VQL Q;  5LJ5 j;  1R0B G;  4RCB A;  5ECA A;  2R57 A;  3H9N A;  1UIX A;  3S9O A;  2D0N A;  2A06 E;  2GCX A;  1ZME C;  2BKD N;  3HL8 A;  1S72 Q;  4M7A C;  4KT0 E;  2JR8 A;  1UGR B;  4M75 G;  1SQV J;  1DEE G;  1DX7 A;  1IO6 A;  2M5A B;  2HEQ A;  1KZU B;  3X20 B;  2OTL P;  3ER0 A;  1YBK A;  1NAF A;  1I4K 1;  2PP6 A;  3THK A;  1FOS F;  1SQX E;  2DMO A;  4XU2 A;  2ZAE B;  4BDZ A;  2KSS A;  3CEY A;  1HGZ A;  1FOS E;  3L74 E;  1JEG A;  1OW6 A;  1QKW A;  3UA6 A;  2PUO B;  3UWN A;  4WBA A;  4KGX B;  3RMQ A;  3H32 B;  1NKN A;  2ESW A;  3CCS Q;  4M7D C;  2J05 A;  2QAZ A;  3GOX A;  2Y90 A;  3OYY A;  1PRM C;  3GNG A;  5C0M A;  2P84 A;  2OTJ Q;  3V6I A;  1OU8 A;  3PFS A;  1MMN A;  4Z1M H;  1JXM A;  1AEY A;  3B71 A;  1YCY A;  2J5U A;  2VV5 A;  4J9B A;  1SG5 A;  3FDR A;  3I56 T;  1MZ9 A;  1L0L E;  3E1R A;  4BY6 C;  2PGD A;  1S5L E;  1OUL A;  1QX8 A;  4Z8A A;  2LNH B;  1N5Z A;  1KYO D;  1KIL D;  2N1T B;  4II1 A;  1M30 A;  3G71 P;  3CCU P;  1TWB A;  1UE9 A;  2GTO A;  4PJO G;  3RK2 C;  4ZKP A;  2UWJ E;  1YNZ A;  3L2Z A;  1VQ7 A;  2OJ2 A;  3HRS A;  1RF1 B;  1G8X A;  1XJW B;  1B7T A;  1KMI Z;  1M90 C;  1VDF A;  4HB1 A;  1LTB C;  3FXD A;  2HL3 A;  4K11 A;  1IXD A;  3FEO A;  1F1B B;  1K73 U;  2LX9 A;  2CP6 A;  2FYU D;  3TCJ A;  2IFM A;  2K37 A;  2Y0E A;  2LQW A;  1VQL A;  2XND H;  2WSF E;  5GAN 6;  3JCU E;  5DY9 A;  3NMZ C;  5J39 A;  5C39 A;  3M91 A;  3CLQ A;  1BGY J;  3CCM P;  1W6X A;  2ZZD A;  1NU1 J;  2YKO A;  2ZFC A;  4ELY C;  5AVW B;  1KB9 I;  1M9S A;  4HVW A;  4PJL A;  5FRM A;  1HTL C;  2YKP A;  1SS1 A;  5B5E E;  3G7Z A;  5GAN f;  6AT1 B;  4PJO A;  4R0K A;  2OTK E;  2VAS A;  1X8Y A;  2ZGW A;  5CKE A;  2K9J B;  5CCA A;  5KJ7 D;  1EZZ B;  2XK0 A;  3MJX A;  5A0D A;  3VMZ A;  3WMM 0;  3RGU A;  5GMK e;  5APW A;  5B66 H;  1LGH B;  1UDL A;  2LC4 A;  2P4R A;  2HR3 A;  1U1S A;  3MP8 A;  3D70 A;  4JLG A;  1BCC E;  2BIV A;  2L5Q A;  3PTA A;  4J5Y A;  1Y47 A;  2PVD B;  5GMK l;  2JMC A;  2O01 H;  1QVG S;  4MZT A;  2YKQ A;  2CZ6 B;  2OAR A;  4RTW A;  1BIA A;  1WI7 A;  4OWF A;  2VKN A;  2ITA A;  2CSI A;  4YXW H;  1GL2 C;  2IVW A;  1ARK A;  1TH7 A;  3SWF A;  2A36 A;  3RKW A;  3CCS A;  1YI2 Q;  4M3L A;  2OTJ T;  3OYD A;  4LLH A;  3MD0 A;  3VYG A;  4N0A C;  1P84 D;  1H64 1;  2FB7 A;  2RM4 A;  3TVT A;  1DEB A;  2HBP A;  1SHG A;  1K05 A;  1X6G A;  1D0Y A;  2KGT A;  1NG2 A;  3Q1J A;  4XTW A;  3OW2 O;  2EQK A;  2BE7 D;  1M1J A;  4F16 A;  1E6H A;  4XAX B;  2BAS A;  2ZXE B;  4YTL A;  2YXR B;  3P8M C;  2O88 A;  2E5T A;  1RAI B;  2L0A A;  1JB0 E;  4JDS A;  1H0T B;  4XU3 A;  2K3X A;  2JJ9 A;  1FYN A;  5FU7 B;  4BAC A;  2W8Z A;  2KEA A;  5FU6 B;  1Y96 A;  1Z9Q A;  2E64 A;  4RTY A;  3HE5 A;  2W27 A;  1VQO P;  3H0H A;  4XU1 A;  5AW2 B;  4F7U A;  1EFN A;  1SQP E;  3CCM T;  3M0D C;  1FJP A;  3VOP A;  3H8Z A;  3M0T A;  3CWB J;  4RG2 A;  4BE2 A;  5GTH E;  3TU4 K;  2KYB A;  3CXH I;  1P92 A;  1FC2 C;  1SFC A;  1SQV K;  3H32 A;  2Y4X A;  4EYY Q;  1AJY A;  1I5L A;  2KRO A;  1X6O A;  2V8K A;  3QKJ A;  1D1A A;  1KC8 Q;  2FL7 A;  2QQA A;  2R5D A;  1MND A;  2EWN A;  4FW2 A;  1UTI A;  5KYW B;  2KIK A;  2P1J A;  1N8R R;  1PG5 B;  1JBM A;  2MWP A;  3TNU A;  1IRE B;  4M7D F;  2YXY A;  1OW7 A;  3CX5 H;  4J7I A;  2M5A A;  2DL4 A;  1O9S A;  2D8H A;  1EZV G;  5GMK h;  1VQK Q;  2KQW A;  4AFQ C;  4EMK B;  3U59 A;  2FXP A;  1KQF B;  2DD5 A;  1ZLM A;  3OS1 A;  4C0F A;  1VIF A;  1PP9 E;  2FHD A;  4XTX A;  1PFI A;  3EGU A;  5H2F H;  3OSV A;  4PJO E;  3BFM A;  4F7U F;  3J80 E;  1KQS S;  3H0F A;  5I11 A;  3BDL A;  2JW4 A;  3H1J E;  2WZ7 A;  3L70 G;  3CWB E;  1WHJ A;  3EGD B;  4JJC A;  1SQB K;  1BI0 A;  2MK5 A;  4IIM A;  4M75 A;  4LDV A;  2MIO A;  2WVR A;  1GBQ A;  1USD A;  2KYM A;  3TGU G;  1JEK A;  2BEZ F;  5FWC A;  3M0D A;  2YMK A;  3LIE A;  1NTK G;  5GTI E;  3RNJ A;  4ZNX A;  4M7A D;  4AG2 C;  1OZH A;  1FZB A;  4UB8 H;  1J1D B;  1SQX J;  1PNJ A;  2GA1 A;  4J9H A;  2DL7 A;  1YWO A;  1GCQ C;  3CCL A;  2G3A A;  3T97 B;  1FDM A;  1NTM K;  2EW3 A;  3D71 A;  2RH2 A;  5CHX A;  1L0N K;  1VQL P;  1VQ8 T;  1GRI A;  3UDC A;  3L70 D;  1G3T A;  1UGP B;  3GHG C;  1P84 I;  2KSJ A;  4NPE A;  5AW4 B;  4ASV A;  4M78 B;  2KK4 A;  3CCR T;  2IPO B;  3H1L D;  4D6T G;  1AFO A;  1IFD A;  3VYH B;  1Q82 U;  2XKM A;  4MDW A;  3M54 A;  2AIR B;  4PLL A;  1SQQ K;  1BSH A;  4J9E A;  3RIR A;  3SDZ A;  2HPC B;  2JN0 A;  1NOH A;  1TU3 F;  3RBX A;  4PD4 I;  2EKH A;  4M75 F;  4CRI A;  1VQM P;  4BB7 A;  3QH9 A;  2J7I A;  1GZL A;  2PRR A;  1Q7Y R;  3AEC C;  1ZBX A;  3L1A A;  1L0N E;  1JNM A;  3MUD C;  3QWO C;  3QZ5 B;  4ZGJ B;  1OFC X;  2RI2 A;  2FFD A;  3P7K A;  4BWN A;  1P84 H;  1LTS C;  2ZPF B;  1A02 J;  2M9U A;  3NTH A;  4C92 A;  2NPS B;  1GU4 A;  2PAJ A;  4WVZ A;  1BDC A;  4Z89 A;  3VS6 A;  3VMX A;  3PHL A;  1HD3 A;  4F7U G;  2EAY A;  5LJ5 g;  3RK3 D;  2XZR A;  3JCM Q;  2W10 A;  2E74 B;  1RAC B;  1QP3 A;  1PIX A;  2G3R A;  1X2Q A;  4PLI A;  5AW8 B;  3JB9 D;  3ULR B;  2CS7 A;  5KYY A;  3V4Q A;  1VQP P;  2JJL A;  1V29 B;  1VPC A;  3ABV C;  3QJ6 A;  2IBZ G;  2KMT A;  2GUV A;  3QYH B;  4OMF B;  1SF9 A;  1X0T A;  3L2V A;  2RJC A;  3GHG A;  4U7J A;  3HUS B;  1SKU B;  1VQ9 T;  1YIJ Q;  2Y9Y A;  2EIF A;  2HNI A;  4A4K A;  1VF5 C;  3RK2 B;  1U1T A;  1C6V X;  3GF5 A;  3OYF A;  2YIU B;  9ATC B;  1N6A A;  1AQ5 A;  2DD4 A;  1EDK A;  3HFN A;  5D6W A;  3CC2 T;  5AW9 B;  1D1B A;  2LXB A;  2HD0 A;  1HH0 A;  2N9B A;  3A8M B;  1MV8 A;  2WSE E;  2FXO A;  1B34 A;  1FMW A;  2SRC A;  3A5Z B;  4E7Z A;  1KB9 E;  2IFN A;  2FRW A;  3JCM h;  3P8B B;  2E43 A;  5KLI B;  2HOD A;  1SEM A;  1T0J A;  4BE0 A;  2DK3 A;  1NPR A;  3JV3 A;  3P8D A;  1UII A;  1K0X A;  3EFR A;  1H92 A;  1OEB A;  1KHC A;  1C1A A;  4J83 A;  1N8R Q;  4J8O A;  1WLP B;  1ZSG A;  2D1X A;  3CCJ A;  1PHT A;  3PIP A;  4M78 C;  2ZYD A;  3TGU E;  2JOY A;  3TGU D;  1AQT A;  5KCH A;  2IYP A;  1GK6 A;  1XTG B;  4GBQ A;  2XMF A;  3H1H G;  3G6E Q;  2OGU A;  5EFW B;  4M77 F;  2MWO A;  1RAH B;  1KYO H;  4R55 A;  3O6Q B;  3E9F A;  1MFT A;  4LN2 A;  3INZ A;  3AE8 C;  1FZC B;  4O6J A;  2JT4 A;  3CCQ P;  1H0T A;  1LNX A;  4BI8 B;  2DPP B;  4DT0 A;  2J6O A;  1NTZ E;  2XDB A;  2H8H A;  5CCH A;  2JVV A;  4JUV A;  5A0L A;  1JY2 N;  2V4H A;  3G6E P;  4BI4 A;  3QPH A;  1HSQ A;  2M3B A;  1G83 A;  4RKU J;  4C0D C;  4D6T D;  3L74 J;  2ZT9 C;  3JCM P;  4CC3 A;  1W2B P;  3OAK A;  1JO5 A;  2E70 A;  5APT A;  1TXQ A;  3IQL A;  5GAN h;  3CCS T;  1EIF A;  1TTH B;  1YIT Q;  4OGQ B;  2Z0W A;  3EG3 A;  1JU5 C;  2HQX A;  3GF3 A;  2EJG A;  1SQV E;  3FLG A;  3CCE Q;  1FZA A;  3E1I A;  4BXL A;  4L5G A;  4M7A E;  1D3B A;  1GMJ A;  2M3E A;  3Q3D A;  1WIE A;  1UEC A;  3CQT A;  4M78 A;  3E2U A;  3AE9 C;  1UHF A;  5GAN 7;  3CMA T;  2R32 A;  4DBR A;  3M9B A;  1KQS A;  2QM8 A;  1QKX A;  3LX7 A;  1OW8 A;  5KYN A;  1EDL A;  5I2M A;  2FBW C;  4M7D E;  1QMC A;  2J6K A;  5KKZ B;  3M58 A;  2YO2 A;  2BZY A;  2GBQ A;  1KIK A;  3W68 A;  5I22 A;  1SQQ E;  1M5Q 1;  2CYZ B;  2JNG A;  4H0L D;  5APU A;  1U57 A;  1VQO T;  2EYZ A;  1ZSZ B;  2B87 A;  3R2P A;  1K0S A;  1W1F A;  4O5V A;  1ZRT E;  2DKG A;  1ZQ1 A;  2VXE A;  1SQP K;  1RQV A;  3CC4 A;  1AZE A;  1RE3 C;  3WUT A;  4U3F G;  4J6Y A;  4NS5 A;  2E3H A;  3FJP A;  5CQX A;  1T0H A;  4C8Q A;  2KRM A;  2KYV A;  5GAO q;  2QGG A;  1PGJ A;  1PC0 A;  1JJ2 P;  1M2V A;  1TUG B;  3V2R A;  2DVE A;  2C06 A;  3OYL A;  1LOJ A;  3CX5 D;  2V26 A;  2NUP A;  4EIJ A;  1OPL A;  2YO3 A;  1FMK A;  1NTZ K;  1MV3 A;  1IGQ A;  5TIS E;  4EDU A;  2KP8 A;  1YJN Q;  1N2D C;  2KUB A;  2DIL A;  1HJD A;  2KR3 A;  2CZ7 B;  5CKF A;  2WSC E;  1KG1 A;  3URG A;  3Q5P A;  1Q81 C;  1RF1 C;  1USE A;  5CIU A;  2LJ3 A;  1NE8 A;  2FFD C;  2XU6 A;  1UB4 A;  2K3B A;  5GAM g;  3L73 D;  1AA0 A;  3G6E A;  5IHK A;  2RNA A;  1V76 A;  2MPX C;  2K7A A;  2DX1 A;  1NTM G;  2FKW B;  4KUL A;  3GG2 A;  2HOD B;  2A45 H;  1LJO A;  1P84 E;  3HE5 B;  2GM4 A;  2XG8 D;  3QXE B;  3CCU A;  1QL2 A;  1T2K D;  2DAQ A;  8AT1 B;  1D3B B;  1SQB E;  4XU0 A;  1UJY A;  2M02 A;  3L42 A;  1VQ9 A;  2OAW A;  2IPP A;  5GAO p;  4Z02 A;  4KUI A;  3HTR A;  4X9C A;  3RKY A;  2H8P D;  1FAV A;  1QVG A;  2PQW A;  1RAG B;  4X34 A;  1H89 A;  1BCC D;  3VP8 A;  2QEX A;  2SEM A;  1G5V A;  5TJH A;  3AE5 C;  5CO7 A;  1PPJ D;  2HSE B;  2KXP B;  2JKV A;  4B6M A;  2ABL A;  1E5W A;  2YUO A;  5CCH D;  2E76 C;  5CKD A;  2OAU A;  2OYI B;  2DEQ A;  3D6Y A;  3V8L A;  3AEA C;  1LWU B;  3Q1M A;  2OYO A;  1AOJ A;  2F1L A;  4ZGD B;  1IZN B;  1IHW A;  4PD4 D;  2HMA A;  3I9Q A;  2WSS H;  4HA8 A;  5GTI H;  2XD0 A;  1LTG C;  3N4X A;  3BCC D;  3GIB A;  2N9Y B;  1LT9 C;  4RCC A;  3CXH E;  3L4F A;  3HFO A;  1S5L X;  4M78 F;  2Z5I A;  4M77 G;  2RMO A;  3M0R A;  2E6N A;  2YXQ B;  1PCX A;  2QQR A;  3VS3 A;  3WUV A;  1W2B S;  2Q9I A;  2FYU E;  1YWP A;  2CP5 A;  4Z88 A;  4PFP A;  3G4S Q;  4ATO A;  4BE1 A;  1VOM A;  3MP6 A;  3H1J J;  3BRT B;  1NHL A;  2LKM A;  2F69 A;  2RA2 A;  3CME A;  1J1D C;  1EQ7 A;  4GIF A;  3W67 A;  1X2K A;  2Q3I A;  2AK5 A;  3QSU A;  3A0B H;  4RTT A;  4JLI A;  4DBH A;  4HH2 A;  2OX7 A;  2W0Z A;  5AVQ B;  2AEM A;  3TDK A;  1PD0 A;  3SHW A;  3OYE A;  2DL5 A;  2CP7 A;  4GOD A;  2RHX A;  1VQP Q;  1CSK A;  3SWN B;  2JDI H;  3PJS K;  1CKB A;  1ZV8 A;  2IG0 A;  2KNB B;  1NPP A;  3EG9 A;  2A06 G;  1ZR2 A;  3CPW O;  4IIO A;  4OMQ A;  2HDA A;  2QJP C;  1CI6 B;  2DZ9 A;  5GAM j;  1S72 P;  1GL5 A;  3H1K G;  4FIB A;  3WU2 H;  4J9C A;  1GD2 E;  1NZ9 A;  2QG9 B;  1FX7 A;  3SSU A;  3SWY A;  1TU0 B;  3BAT A;  2RB6 A;  5GAN g;  2YT6 A;  3CCU Q;  4PJO C;  3M0A A;  4WCI A;  3CXH H;  3EQ2 A;  1RAF B;  5GAN 2;  3L2U A;  4VUB A;  4A53 A;  4JS4 A;  4LNP A;  3RK3 B;  2Y0D A;  3OW2 P;  5GAO n;  2QJY C;  3FWN A;  1Q81 U;  2E41 A;  4M78 G;  2C0W A;  3H1H D;  1LPL A;  3BCC E;  2HCK A;  3PMI A;  2NPS D;  2YUQ A;  1FXX A;  1WFW A;  3CCL P;  4PV1 D;  1KTM A;  2ROL A;  3LH0 A;  4UC4 A;  3G9R A;  2QEX Q;  1QLE D;  5KLV G;  3RL0 D;  4EI2 A;  4R4M A;  4RG8 A;  3G71 Q;  3CC4 P;  4M7D G;  1D0Z A;  4C7N B;  2KVQ G;  4QMA A;  3OJA B;  4A4G A;  5LJ3 j;  3OMC A;  3CPW S;  4M78 D;  1SQX K;  2O1J A;  1WJR A;  3I55 P;  2DYI A;  5A0G A;  2AZS A;  1X22 A;  4IUV A;  2XI9 A;  2NZ2 A;  1YI2 T;  1QCO A;  1MMD A;  5HKC A;  3OBW A;  3OYH A;  1VQ5 Q;  5CJ0 A;  3WUU A;  1KIL A;  1NTK E;  3VS5 A;  4W7Z A;  2KI7 A;  3X24 B;  3HUS A;  4DOV A;  2ZYG A;  3L71 J;  5GMK m;  2DRK A;  4FYX B;  2COW A;  1IK7 A;  2KK7 A;  2R5A A;  3SFE C;  4M7A B;  1BCC J;  5AYF A;  2DXC A;  2FPD A;  2BCC G;  3UF4 A;  5GAM e;  4IFM A;  1OIP A;  4FM4 B;  1PGP A;  5KYY B;  1JQQ A;  2RPN A;  1N8R U;  3S3N A;  2EPD A;  1T6A A;  2DA9 A;  3MHV A;  4IL6 E;  2EGA A;  1BIB A;  4UB8 E;  4J9G A;  3V5B A;  3O6Q A;  2CKK A;  1QQJ A;  3EHQ A;  2VGM A;  2YRV A;  5KJ7 C;  1G3S A;  2FZK B;  4C92 B;  2CUD A;  3CXC P;  2R3C A;  1MMG A;  4AUW A;  1AVZ C;  2O1K A;  4B9W A;  1L0L K;  3KPE A;  5CCH C;  2NWM A;  2LP5 A;  2HKN A;  3FXE A;  3Q5S A;  1K9M R;  3JCM J;  3OA6 A;  5CJ4 A;  1VQ9 Q;  1KD1 C;  2BZ8 A;  3B4S A;  4M77 B;  4OB2 B;  1KQG B;  1QVG O;  1KFZ A;  1U06 A;  5HCK A;  4PJM A;  1RI0 A;  3AEE C;  4MN4 C;  3DLM A;  3VMY A;  1BSN A;  1KIL C;  2O01 J;  1ZRT D;  3J7A F;  4A7P A;  2XHC A;  1R5S A;  3KXT A;  4C5G A;  1YJW A;  2CUB A;  4BRY A;  3RES A;  4H44 B;  2NUZ A;  3HD7 D;  2KBT A;  3KHU A;  2LJ0 A;  2W83 C;  2QGF B;  3EFS A;  2JTE A;  2H3J A;  3PT9 A;  4KGZ B;  5DM7 R;  2FYK A;  1NU1 G;  2RO0 A;  1BBZ A;  2AXC A;  1H88 A;  1M2V B;  3L2W A;  2CSQ A;  1KHI A;  1OV3 A;  1RLP C;  2FPE A;  2AZV A;  1L4A C;  2CZ1 B;  2YNY A;  3FGA D;  4NPF X;  3CD6 P;  1CKA A;  2COY A;  2VB6 A;  3UAT A;  2W6A A;  1TUC A;  2RH0 A;  1FZC A;  2A37 A;  4OB3 B;  2M0B A;  4MML A;  4IKF A;  1KD1 U;  1MHN A;  2VGN A;  3V2P A;  3NXS A;  4C5E A;  4DA4 A;  1RE4 A;  1CZQ A;  4UB6 H;  2L3Q A;  1Q7Y Q;  1I5O B;  4RTU A;  3BDU A;  2LMJ A;  3G3Z A;  4A54 A;  1VQ6 P;  3RL0 C;  1RF0 A;  5CBO A;  3HD7 B;  5BU5 A;  2RK1 A;  5GAN 8;  1J1E B;  1NU1 E;  1LTI C;  4Y99 B;  1KD1 R;  2AXT H;  2JWD A;  4CPG A;  4RTV A;  5DLQ E;  2XIC A;  1U5S A;  3L70 J;  3H1H J;  3VMA A;  3CCM A;  4JJN K;  2K2M A;  3M0U A;  2CDT A;  2Y4Y A;  3TNU B;  1IHV A;  1H8K A;  4D6T E;  3HRU A;  4EMG A;  1LTJ C;  1JJ2 S;  2KZI A;  1BKB A;  2ZPB B;  1ZSZ C;  4C0Z A;  4MZM A;  1YJN P;  4AG1 C;  4C92 C;  2R58 A;  3CC7 Q;  4JBZ A;  2I8D A;  4OMO A;  2ZT9 B;  3A3Y B;  1K9M C;  3P8H A;  2L91 A;  2VYT A;  1PP9 J;  1NEB A;  2QDY B;  1NTK D;  4J7F A;  1VQK T;  2ZCF B;  3A0H H;  1XNI A;  2RKL A;  2OTJ A;  3EHR A;  3AED C;  4KBM B;  3VV0 A;  4W80 A;  4KRT A;  3OB9 A;  1SQQ J;  4JQ0 D;  3MO8 A;  2LT1 A;  1ABQ A;  5HK3 A;  2PNI A;  4PFO A;  1NBE B;  3OYI A;  4AFZ C;  1VYU A;  5AVY B;  1URQ C;  3V8J A;  2CRE A;  5B5E H;  2WPQ A;  3E7K A;  4E7S A;  1E6G A;  3HD7 C;  1NTM J;  3F89 A;  1NJI Q;  1T3U A;  1BE3 G;  2KZJ A;  2K79 A;  3T9N A;  1HVV A;  2XDJ A;  3BY7 A;  4WWI A;  1RL2 A;  3CD6 Q;  2QA4 P;  1BI2 A;  2B87 B;  4F14 A;  1EXJ A;  2WSE J;  4GLM A;  1SQV D;  1YFN A;  2DBK A;  2KS1 A;  1HK9 A;  3QDR B;  1RAD B;  2OYH B;  5K5G B;  3I5C A;  1LT1 A;  4QW2 A;  5LJ3 g;  1ZP0 C;  3L72 J;  3H25 A;  1U7J A;  5GAM h;  1M90 R;  4EMK A;  2V8I A;  3JCM e;  4ZGE B;  1OVU A;  1LP1 A;  1LNQ A;  3AE1 C;  3M5A A;  1AZG B;  3EFO A;  3O5Z A;  4XTU A;  2DTO A;  1N7S D;  2YIU C;  4JPB W;  3OMG A;  1M2O A;  4DEX A;  4ELZ C;  1IFM A;  1NTZ J;  4JF7 A;  1Q86 Q;  3AEF C;  3RK3 C;  3NPF A;  1FS0 E;  4KHX A;  1S5L H;  3QII A;  2PFX A;  2YLB A;  1JY2 O;  2IBZ D;  3JCU H;  2CGH A;  4LE9 A;  1UEB A;  4CC2 A;  3E1S A;  3A0B E;  1ACM B;  1JY3 P;  5CKB A;  2LQ8 A;  4XFJ A;  4FSS A;  1G1J A;  3CCR A;  4PNO A;  3OYB A;  3V8K A;  3JCM V;  4M77 C;  1K8A R;  3BW1 A;  2DIG A;  1M57 D;  2WT7 B;  1JMB A;  4U3F E;  2KNC A;  2E74 C;  1DIP A;  3VKI A;  3QDF A;  5LJ3 d;  3DLL A;  2LQK A;  2P0K A;  1QVF A;  1LWU A;  4M7A F;  5IH2 A;  3CBP A;  1N27 A;  1HBW A;  1OOT A;  5GJV B;  4WB4 A;  5GAN j;  1AVY A;  1DD4 A;  3LW5 E;  2RN8 A;  4AMC A;  2DRM A;  1UHC A;  3TF5 A;  3I55 Q;  2RD1 A;  2B89 A;  5AVX B;  2FPF A;  3LGL A;  1NYF A;  1EDJ A;  3KUF A;  3IFM A;  4J6W A;  4EMK C;  5AW0 B;  2MI6 A;  4GLK A;  1Q7Y U;  2M51 A;  2J58 A;  3N7N A;  2E10 A;  4LD6 A;  4TLF A;  2KXC A;  3CPW A;  4AQR D;  1BGY D;  2BUD A;  3MEW A;  2W6B A;  1H3Z A;  1VQO A;  3AHU A;  2GTJ A;  3L2R A;  1VQ8 A;  1ZUY A;  4C8Q D;  4V2S A;  2P58 A;  3CCQ Q;  3LYI A;  1WZO A;  2LCS A;  1Q82 R;  3PGG A;  2WWW A;  3CD6 T;  1S2E A;  4WY4 A;  3L72 E;  3BAS A;  2RJF A;  1ZN5 A;  4K35 A;  1BI1 A;  3FB9 A;  1QWF A;  2QA4 Q;  1JUN A;  1YCS B;  5I2S A;  2YUN A;  1HUC A;  3KDP B;  5KJ7 A;  4LC1 A;  1N7S B;  2EYQ A;  2E75 D;  2A3L A;  2CZ0 B;  3GF7 A;  3PE0 A;  2O4X A;  3ZDM A;  1NAY A;  1LWU C;  3MIW A;  1VQN P;  2AEF A;  1VQP T;  1KK7 A;  2QYZ A;  1WDX A;  2EKO A;  3A1P A;  1VQ4 P;  3CCS P;  1SFC C;  1SP4 A;  3REA B;  5GAN 5;  5C6S A;  4E7H A;  2CK3 H;  1NTK J;  1EDI A;  2RHZ A;  4I7Z B;  1K73 Q;  1ZHI A;  4OB0 B;  2KB7 P;  3KFV A;  3LID A;  5AVR B;  3S6W A;  1L0N J;  2C0X A;  1KC8 U;  4E7I A;  2LXC B;  1WXT A;  2ECZ A;  2H88 C;  3OSS C;  1VQ6 Q;  2FZC B;  4N4G A;  3EGD A;  2WPV B;  2WSF H;  1WHM A;  5GAN e;  1NU1 K;  1VF5 B;  4QVZ A;  4RJT A;  4LUE A;  2QXF A;  1OX3 A;  1FZG A;  1OQK A;  5E79 H;  3JCM f;  2YHT A;  3A5T A;  3L36 A;  3CCL T;  1RF1 A;  1DJ7 B;  3I5S A;  2MAM A;  1M3A A;  2W6J H;  3R4Y A;  3CXH D;  1JMM A;  2QQB A;  4C0G A;  3LWI A;  4ANJ A;  5KCO A;  2L3P A;  3MP7 B;  4CC7 A;  5EC7 A;  1VQL T;  2FYN C;  2I2L A;  1SQP J;  2M0Y A;  1PPJ G;  4PD4 E;  5GAN 4;  1S72 T;  3B5N A;  1JB0 J;  3BCC J;  3GNF B;  1T3L A;  1S4X A;  1VQ6 T;  5KTB A;  1M1K C;  1Y7X A;  1SPK A;  4FYW B;  4JYC A;  1O75 A;  2DJZ A;  2KXD A;  2QA4 A;  1KC8 C;  1YIT T;  4HT9 A;  1L0L G;  1FZE A;  2ENM A;  5LJ3 f;  1Q86 U;  1NTM E;  1PWT A;  1SFC B;  2P10 A;  3H1J D;  1NTK K;  4PJN A;  3CCL Q;  3QG1 A;  5LJ5 e;  2M8R A;  1Z56 A;  2QSI A;  4C0D B;  2VVK A;  4M75 E;  3CCV T;  2DET A;  2K6D A;  1GW4 A;  1OVR A;  4FL6 A;  1W4S A;  2COZ A;  2O3J A;  1KN7 A;  3NGP A;  2GNC A;  2RHY A;  1FZF A;  3KZI H;  4WY4 B;  1PSE A;  4JRP A;  2EGE A;  2EFI A;  3MEU A;  2LJ1 A;  1FBM A;  1UGQ B;  2R5B A;  1MUU A;  2WAC A;  4ZKU A;  1Y8A A;  4M7D A;  2DW3 A;  1KJW A;  2IX7 C;  5CCG D;  2LCL A;  5CBN A;  1VQ4 Q;  1T8Z A;  1K9M Q;  1NM7 A;  1RHZ B;  1PGQ A;  3JCM X;  1GFD A;  4PK4 A;  4OML A;  3NFQ A;  3ZFJ A;  4H0L B;  1HWT C;  2FG0 A;  3X26 B;  5KKZ C;  2DFU A;  4XK8 E;  2KDS A;  2CT4 A;  1Y0M A;  4BUG A;  2R3S A;  3P32 A;  4H44 D;  1E79 H;  2DXT A;  3PVQ A;  4AFU C;  1W5C E;  3GMA A;  4IUT A;  5BVZ A;  1SQQ G;  2POH A;  3HE4 B;  1QCN A;  1PGO A;  2PTK A;  4C8Q E;  3VS0 A;  1U7M A;  2LQN A;  4IUR A;  2HL5 C;  4ZN1 A;  5KYW A;  3RBZ A;  2FEI A;  3ASK A;  1K9A A;  3OYG A;  2JS0 A;  3BE3 A;  1AV1 A;  2EQI A;  1KD1 Q;  1KQL A;  3U23 A;  1K1Z A;  2QQ9 A;  4DZO A;  2X4J A;  3QUI A;  2VWF A;  1BE3 D;  3H1I D;  3OYJ A;  1A02 F;  3VTP C;  1BCM A;  1VUB A;  4J9F A;  3S4R A;  2LVM A;  1Q95 G;  3PNW C;  1RH5 B;  3EWK A;  2ZAE A;  3CBM A;  3WXM B;  2AKK A;  3EFO B;  2A08 A;  1X9V A;  1ZLL A;  2PUK B;  3CD6 A;  1M7L A;  3JCM g;  3L75 E;  3G4S P;  1GFC A;  2O9V A;  2K5I A;  3EG0 A;  4KH0 B;  1KQS O;  2BEQ D;  5APQ A;  1KIL E;  1M1F A;  4FT4 A;  1KYO E;  5FLX E;  1KC8 R;  2WTY A;  2A45 I;  4M7D D;  2OYI A;  3SD4 A;  4U3F J;  2E65 A;  2DYB A;  1LCK A;  3E9G A;  2D6F A;  2EQU A;  3FJ5 A;  1IJD B;  2Q6Q A;  1M4Z A;  4AFS C;  2X4W A;  3AT1 B;  3HKS A;  3AE6 C;  2MF2 A;  1XQH A;  1WQW A;  1AD5 A;  5GMK i;  1FDI A;  1GL2 A;  1X75 C;  1KB9 D;  2LR2 A;  4HCC A;  1YHQ Q;  2Q5U A;  3SFD C;  5FRN A;  4Y28 E;  1NLO C;  2IIM A;  2MMP A;  4KGV B;  3L75 G;  1MKM A;  1WPY A;  2DVJ A;  2ZPG B;  2JP3 A;  4LDU A;  1SVF A;  3CWB G;  3H1J G;  1ZUU A;  2K5F A;  2YLC A;  2EQM A;  4KJM A;  2WSC J;  3EAE A;  1UG1 A;  1URQ A;  1WMK A;  3DB3 A;  4GOE A;  3CXC A;  1QCF A;  4E6R A;  2YDL A;  1M27 C;  4HCZ A;  4PL6 A;  3PMT A;  1BYM A;  2HQE A;  3TYY A;  2A06 D;  3CPW P;  3JB9 G;  2K5L A;  2WSF J;  2QJK C;  2FRY A;  4QQD A;  5FRO A;  2FO0 A;  2DIQ A;  5KLV E;  2R5M A;  1XTC C;  1K73 R;  2H89 C;  2W90 A;  1X01 A;  4ZMD A;  4PV1 B;  4W7Y A;  2KY9 A;  1TUD A;  4F17 A;  1VA7 A;  2OQQ A;  3VUZ A;  3EFF K;  1IB8 A;  2MJZ A;  1NYH A;  1BGY G;  1YIJ A;  2K9J A;  1HYO A;  1Q81 R;  3RK2 D;  5IHI A;  2D9T A;  2DER A;  4RO0 A;  5J26 A;  4HVV A;  3B5N B;  4QVD A;  3CCJ P;  1JM0 A;  3HE4 A;  2L89 A;  3OBY A;  3CC7 T;  1RAB B;  4M78 E;  3G4S A;  2P7J A;  1J3T A;  2KSE A;  3M0S A;  2E42 A;  2CT3 A;  2I1K A;  2IZ0 A;  1T2K C;  3D6Z A;  2A7Y A;  3JB9 H;  2KS1 B;  2KLV A;  3CC2 P;  3I56 Q;  3EG2 A;  4WTO B;  2G6F X;  1VQM T;  5CMZ A;  3M55 A;  2QA4 T;  5FU7 C;  4E7L A;  2E74 D;  1OX9 A;  2C0O A;  1YIT A;  3Q2Y A;  3QZ9 B;  3CCM Q;  3CCE A;  2H7H A;  1OXZ A;  3MZW B;  4XE5 B;  3H1L E;  3L74 D;  2LTO A;  4RTX A;  3C9I A;  5L23 A;  3OA7 A;  3FC3 A;  2I1J A;  3VU3 C;  1VQN T;  2VRS A;  1N73 C;  2JM8 A;  5D7U A;  4DOW A;  1JRI A;  2ATC B;  1VL2 A;  2KI7 B;  1WRG A;  4PJO F;  2DNU A;  3A8H B;  4IUQ A;  5AW7 B;  1BCC G;  2E5Q A;  3EH2 A;  3GLM A;  2GQV A;  4A63 B;  5I21 A;  4A4H A;  1YHQ T;  1JCC A;  4XQ3 A;  3UIA A;  3PIO A;  3EG9 B;  1Y9B A;  8ATC B;  4BRY B;  3J81 E;  4N4I A;  2O2O A;  3A98 A;  1MMA A;  4RKU E;  1K8A C;  1KYO I;  3GBQ A;  3AEB C;  4C7N A;  2E76 D;  2B8A A;  1R0C B;  1MGQ A;  1PPJ E;  4YTP C;  2ED1 A;  3NTN A;  2QAS A;  4PJO B;  1BCO A;  1BE3 J;  3X25 B;  1N7L A;  3LWH A;  3REB B;  2D8J A;  2VXF A;  1Q81 Q;  2DXB A;  2D2C D;  4H13 B;  1B3Q A;  2ZPE B;  3AE2 C;  5KAF E;  1D0X A;  4OH8 B;  5KLV K;  3C94 A;  4LDW A;  1URQ B;  1NWQ A;  3T97 A;  1UFF A;  4HKZ H;  2D0Q B;  3OYC A;  3K5B A;  2GQI A;  1AWJ A;  2K57 A;  3C0C A;  4HT8 A;  2X51 A;  2OTJ P;  4JJD A;  2L3R A;  3RDV A;  3VYI A;  7AT1 B;  1ZW0 A;  2DTI A;  4OGQ C;  2Z4E A;  1Q86 C;  4M77 E;  4OMN A;  3AEG C;  1QVF S;  1WA7 A;  2ZVO B;  3H1I E;  4JRQ A;  3HTK B;  3U1C A;  1K8A Q;  5J3B A;  1YJN A;  4F04 B;  3M56 A;  1G2C A;  3H41 A;  4XTY A;  1NJI C;  1H3H A;  3KZI E;  3BVH A;  1JY2 P;  4Y91 A;  1IFJ A;  1Z9Z A;  2JO1 A;  2KRN A;  1IRX A;  4OGC A;  3C12 A;  5GAN d;  3S3M A;  2OTL A;  3ZL7 C;  2WSE H;  2E5K A;  5LJ3 e;  2EJ9 A;  1WNL A;  1IFI A;  3H1K J;  3EGX A;  3HHT B;  5LL6 S;  4DBF A;  3Q5R A;  3JB9 I;  1ZX6 A;  4L73 A;  4EOT A;  1M8O B;  1YQ3 C;  1WYX A;  1WHG A;  4NPD A;  5LJ5 f;  5H2F E;  1SQB G;  1QEX A;  1J1E C;  4IL6 H;  3F5H A;  1WGS A;  5EG2 A;  2HKQ B;  4MDX A;  3VS1 A;  4H13 D;  2D2C B;  1YIT P;  2Y9Z A;  2OI3 A;  2WQY C;  2FYZ A;  2HAX A;  1FU1 A;  2A0F B;  4FW1 A;  3CC2 A;  4PJO D;  4ORZ A;  1ZA1 B;  1ZUK A;  4NOY A;  3JCM W;  3CCV P;  3JRZ A;  1AWX A;  2E76 B;  1LP1 B;  1OVV A;  3M59 A;  2NLU A;  3DKM A;  4I6M C;  3V7C A;  3TK1 A;  1M1K U;  2ZJS E;  2RK2 A;  1IFN A;  3LW5 H;  5AVU B;  2YRC A;  1Y96 B;  4H0L C;  3L74 G;  1SQQ D;  4IFD K;  2F2X A;  2QRX A;  3OW2 S;  2ZVN B;  1QVG P;  3MPU B;  2F5T X;  5GAM f;  3PRJ A;  1SQB D;  2RF0 A;  5CAI A;  1WJQ A;  3F70 A;  1W2E A;  1PL5 A;  4C5I A;  1YJW P;  3L73 G;  1AT1 B;  1JO8 A;  1N9S A;  3HTK A;  3B8E B;  1D09 B;  5CR2 A;  5AVT B;  4CI0 C;  1DD3 A;  1NTM D;  1OX8 A;  5M9O A;  1XTD A;  5AW1 B;  2SPZ A;  3ZEH A;  4WY4 C;  3QO3 A;  3CPF A;  4M4Z A;  1VQ7 T;  1VQ8 Q;  2EQJ A;  2K9Y A;  2EVR A;  2HYN A;  2MYS A;  2X4X A;  4PKC C;  2RQU A;  4FT2 A;  2HFE D;  5B66 E;  2MCN A;  3OS2 A;  3V7R A;  3L72 D;  2WT7 A;  5APX A;  2QTV A;  1HJB A;  5GAO m;  4OMP A;  3TSZ A;  3AE3 C;  1BI3 A;  4PFZ A;  1YYC A;  1M1G A;  1EX4 A;  4R56 A;  3RR6 A;  1TG0 A;  4KUD K;  5IHN A;  1VYT A;  2K1A A;  2JS2 A;  2X9H A;  3CCJ T;  3JCM b;  1NTZ D;  1K76 A;  4M77 A;  4ZTJ A;  5HY6 A;  2PVG B;  4C8Q F;  3H1L J;  1G3W A;  1LVK A;  2LT4 A;  2B88 A;  2QVA A;  3PH0 A;  4N0A A;  3HP9 A;  1I1J A;  2GFA A;  4C92 F;  2QE7 H;  4OGQ D;  3TEE A;  4D6W A;  5KYX A;  1BU1 A;  1GK4 A;  1QWE A;  2LZ6 B;  1B34 B;  2YRD A;  1AVO A;  4ME7 A;  1R77 A;  2E3I A;  1D7M A;  5GAO r;  1M1J C;  4DQ2 A;  3CCR P;  1QLY A;  5APY A;  1K73 C;  2NUP B;  3O8V A;  2CH4 A;  5CCG A;  3OS5 A;  1U8R A;  4M75 C;  4E47 A;  4FU6 A;  4L6V 5;  1NTZ G;  2HBW A;  5GMK j;  4IFF A;  3MUD A;  2BCC E;  4D8K A;  3P8C E;  1IK9 A;  3LGF A;  2KOG A;  2C0I A;  3S1K A;  1K4U S;  5DJT B;  3X28 B;  3USS A;  1OWA A;  1M3B A;  2Q7C A;  4Y99 C;  1KQS P;  4N4H A;  2OYH C;  3RER A;  3SB2 A;  3U1A A;  1N9R A;  1VYV A;  2LRQ A;  4DEY A;  3CC7 A;  1KIL B;  2N1T D;  3NMD A;  3I56 P;  3CC2 Q;  2MKV A;  5KAF H;  5IT9 E;  3H1H E;  5GTH H;  5KLI C;  1SSH A;  3JC2 2;  4LD9 K;  3CI9 A;  4DBQ A;  4M7D B;  1N73 A;  4GOF A;  3PTZ A;  4GDO A;  4FYV B;  4LXC A;  3H1K D;  3CCE T;  1QL1 A;  1RE3 A;  2ZXX A;  2G8Y A;  2F2V A;  2NYS A;  5CK9 A;  3CMA A;  4N3Y B;  2WIT A;  1OYX A;  1MNE A;  2DXU A;  2QTX A;  5LJ3 h;  2BTT A;  4N6J A;  1E7O A;  1W70 A;  4Y28 J;  2RJD A;  2YUP A;  1VQ5 A;  3RL0 g;  1X79 B;  2X35 A;  3MP1 A;  1RLQ C;  4F7U B;  4HCK A;  3IN6 A;  3L35 A;  3C4S A;  1YJ9 A;  1S72 A;  2RHU A;  3VRZ A;  5IAY A;  2HG5 D;  5D6X A;  3HUS C;  1NVO A;  1SQX G;  2HSP A;  4XA4 A;  5APS A;  4B86 A;  1WXB A;  3R6O A;  1JOC A;  1NO4 A;  3WVD B;  1L0L D;  2RI3 A;  3FRN A;  1Y71 A;  3G71 T;  3TGU J;  1PRL C;  2MOX A;  1FE6 A;  1V1C A;  2PVO B;  5KH6 A;  4M75 D;  2EBP A;  2V8J A;  2EYX A;  4OMM A;  1X43 A;  1GTW A;  4OVN F;  2CPS A;  2YWW A;  2LX7 A;  3HRT A;  1G1I A;  5KE2 A;  3CCR Q;  3CCV A;  2JM9 A;  4H13 C;  2I0N A;  4HVU A;  1JCD A;  3V2N A;  5IXB A;  3M9Q A;  1EZV D;  3L73 E;  4Q5W A;  2KE9 A;  3OYN A;  1QVF O;  2E4H A;  2O31 A;  2XNX A;  3LLR A;  1JTH A;  4XTV A;  3VRY A;  4F7U E;  1ZBJ A;  2CP0 A;  2C9L Y;  3LH5 A;  2HLO A;  3QJY A;  3SFM A;  3SEM A;  1SQP D;  5KYU A;  3EG1 A;  2ED0 A;  1YHQ P;  4A4E A;  4JZ4 A;  1N7S C;  2WMM A;  3JB9 F;  1YHQ A;  4AYC A;  2KRS A;  3NFC A;  2DZC A;  2M16 A;  4OB1 B;  2VC8 A;  3N5B B;  3H6Z A;  2H3E B;  2V7Q J;  4WY4 D;  1Q7Y C;  1RF0 C;  1YJN T;  3UA7 A;  5KYX B;  1K04 A;  2XU8 A;  2Q3E A;  4L75 A;  3L71 G;  3PVL A;  1IC2 A;  1VQK P;  4FCY A;  1YN8 A;  2AXT E;  5FWB A;  4PJ0 H;  1L4A D;  4GY5 A;  1YJ9 Q;  2HPC A;  1U3O A;  1Y07 A;  1X69 A;  3QWY A;  1VQP A;  2A28 A;  2J06 A;  1VQO Q;  2QEX P;  3D7S B;  2HQH A;  1JXO A;  2IBZ I;  1UGS B;  3ZBD A;  1YJW Q;  1GDT A;  1M3C A;  3VN0 A;  2K3Y A;  5DLO A;  4FYY B;  2DEU A;  2QI2 A;  2FXM A;  2K9G A;  3CME Q;  4C7R A;  3ITK A;  1EXI A;  3CMA Q;  2BE9 B;  1FMV A;  4E7J A;  2JWA A;  2LDM A;  3CC4 T;  4QKU A;  2FYU G;  2D2C C;  3A7O A;  1RAA B;  4JRK A;  1NGM B;  5DJU B;  4I2L C;  4ESR A;  3M06 A;  2P4T A;  2Y0C A;  3C8V A;  2DO3 A;  4Y92 A;  1AHJ B;  3MHX A;  5KLV J;  4I1L A;  2ZPH B;  1GXI E;  4J6X A;  4MMK A;  3TRE A;  1VQ5 P;  2FYU J;  5L8R E;  3L70 E;  3GW6 A;  4EDF A;  3HPW A;  1GL2 B;  2FYN B;  3CCQ T;  3A8G B;  1CI6 A;  1AWO A;  3CX5 I;  1ZR4 A;  4ZN3 A;  3GP8 A;  1PP9 G;  1FDO A;  2CP2 A;  1ZA2 B;  1ABO A;  1LTT C;  1NU1 D;  4PD4 H;  1NJI R;  2QIW A;  4NL3 A;  3MET A;  5LJ5 d;  3WVE B;  4XTZ A;  1WX6 A;  3AE4 C;  3I55 T;  1NJI U;  3CBO A;  1M56 D;  1CW5 A;  4E7K A;  4E2F B;  4BI3 A;  1JJ2 A;  2H43 A;  1URQ D;  2DBM A;  2F5K A;  1N8R C;  3DB4 A;  3I35 A;  1EZV E;  3CWB D;  3FWL A;  4J9D A;  4LDY A;  5L8R J;  1UJ0 A;  4OGE A;  1C0M A;  4PJJ A;  1L4A A;  3L73 J;  5FU6 C;  1OI1 A;  1PP9 D;  3QWX X;  3V2Q A;  3M0P A;  2NUT A;  1AWW A;  4C92 E;  1R8O B;  1QVF P;  2CH4 W;  2E75 B;  4HYT B;  1S1C X;  2XKO C;  3L72 G;  1Y57 A;  4HJG H;  1DH3 A;  3A8L B;  4BD3 A;  4CC4 B;  3KYQ A;  1YQ4 C;  5AW5 B;  4JZ3 A;  4YPC A;  2KT1 A;  1SRL A;  5LJ5 h;  3L75 J;  2OYH A;  3EGX B;  2K4Y A;  1IO4 A;  2YMY A;  2XID A;  2WPR A;  1WT6 A;  3BCC G;  4DCK A;  1SQP G;  1YI2 A;  3GHG B;  3H1L G;  1YJW T;  1TOV A;  3HRN A;  2QJY B;  1X27 A;  4UB6 E;  1HXD A;  2AKL A;  1YIJ P;  4AT1 B;  1YJ9 T;  1Q82 C;  1M90 Q;  4ASW A;  2XDP A;  2JTF A;  1QW1 A;  3VUB A;  2WPS A;  1RQU A;  2QM7 A;  3KXD A;  4BY6 B;  1M1J B;  1GU5 A;  5TIS H;  2Z5H A;  1I0C A;  4N78 E;  2E5Y A;  1PD1 A;  3G4S T;  2CP3 A;  5GJW B;  3H1K E;  1HF9 A;  1G2B A;  4IL6 X;  3II6 A;  3JSV C;  1XOV A;  3FX0 A;  4MZP A;  3I5R A;  3ME9 A;  3JSC A;  3OW2 A;  2C9N Y;  1LJ2 A;  2GFU A;  3TSW A;  1KFN A;  1WHL A;  2IZ1 A;  1BGY E;  1T3S A;  1W2B A;  1I81 A;  3B5N D;  2JUF A;  2VUB A;  4O9B A;  2DJQ A;  4RES B;  1QGK B;  3VS2 A;  2K2V A;  2B86 A;  1QP2 A;  1KB9 H;  1VQ4 T;  1SSF A;  2FVU A;  3CCQ A;  2RHI A;  4JJB A;  3CL3 D;  3M0Q A;  5IXF A;  3RK3 E;  1SQV G;  2DL3 A;  2GGR A;  1ZXG A;  4X1V A;  3M4Y A;  2P67 A;  1GW3 A;  1MFZ A;  4C5H A;  3LW5 J;  1YP5 A;  2L5G B;  3PLN A;  4TT3 H;  3OYK A;  2DLP A;  5KAI E;  2L3S A;  5GAM d;  3AE7 C;  5A2Q E;  5GAN 3;  3OS0 A;  2C0T A;  3MGN A;  1GBR A;  4L76 A;  5CQY A;  5HK0 A;  3MEA A;  3SWK A;  2LNV A;  4M7A G;  1I07 A;  1OZ3 A;  2B9B A;  1OU9 A;  4D8D A;  3TSI A;  3NTI A;  4GT1 A;  2DM1 A;  4WF2 A;  1VQ5 T;  1Q2N A;  2RQW A;  1VQK A;  2BZX A;  1X6B A;  4QT7 A;  3OY9 A;  4IUP A;  4I7Z C;  4M7A A;  4HXJ A;  5KLV D;  3CCJ Q;  2OTL Q;  1S1N A;  4RTZ A;  1IFP A;  1BE3 E;  1M8V A;  1LTJ A;  1SHF A;  3QBY A;  1WHK A;  4QQ6 A;  3VS7 A;  1LT9 B;  1LT9 A;  1YBY A;  1Q86 R;  1ZSZ A;  5FW9 A;  1SQX D;  3GLX A;  3HSB A;  1EZV I;  2L2P A;  3QYG B;  4A4F A;  3H1I G;  1HJ0 A;  1L2P A;  4KT0 J;  1HGV A;  4JPZ B;  1TS9 A;  5AVZ B;  1VQ6 A;  2K3R A;  2QQS A;  2NPS A;  2QJP B;  3M53 A;  1VQN Q;  3MKD A;  5BU8 B;  2R44 A;  1UGV A;  2E12 A;  1BDD A;  2NUT B;  3M4G A;  1VQ7 Q;  5D6Y A;  1M8M A;  1RUW A;  4BDY A;  4YXD C;  1SRM A;  1GCQ A;  3A2A A;  1Q82 Q;  1WQ7 A;  1JY3 O;  2ZT9 D;  4KH1 B;  1CSB A;  4EIK A;  5KAI H;  3P8C D;  1I8F A;  2BCC D;  3CME T;  5AVV B;  3UT1 A;  3G6E T;  1M1K Q;  4RMO A;  1GCP A;  5AW3 B;  2FZG B;  3HD7 A;  1QVP A;  1UUE A;  3QHS A;  1VQ7 P;  3RBB B;  4C8Q G;  4EMH A;  2ROT A;  2AEJ A;  4NL2 A;  1J2J B;  3R6N A;  2EYW A;  2DE0 X;  1RAE B;  2DF6 A;  3CC4 Q;  1VQ9 P;  3G71 A;  1L0N D;  3A0H E;  3L75 D;  3VJP A;  1LTJ B;  3KQG A;  2IBZ E;  2F2W A;  4P5N A;  2AT1 B;  2X3W D;  1KQ2 A;  2DTH A;  1SLQ A;  1YJ9 P;  2QJK B;  4JS5 A;  1NEG A;  3C95 A;  2CPB A;  1VQM A;  3JB9 J;  5M1B A;  4L74 A;  1EC5 A;  3L71 D;  2O01 N;  1RY3 A;  2DL8 A;  1M90 U;  3MCA B;  4J9I A;  4TVR A;  1WJS A;  2NPS C;  1OPK A;  4DJG A;  5IN1 A;  3CMA P;  3UPU A;  3WU2 E;  3FIF A;  2LCC A;  2EGC A;  2E75 C;  4D6T J;  3OQ5 A;  1L0N G;  3SWN A;  4LDX A;  3RUX A;  3JCM c;  4OVA A;  1R5L A;  3I56 A;  3M9H A;  3CX5 E;  4PV1 C;  2XDD A;  2KNC B;  3CC7 P;  4N78 D;  1H8A A;  5AW6 B;  3JAM E;  1TSF A;  2QG4 A;  4HKE A;  1IZ6 A;  4R4L A;  3G1J A;  2OTL T;  1NYG A;  1LTA C;  4OF1 A;  4C92 G;  4L59 A;  1RE4 C;  5APV A;  1MV0 B;  3OYA A;  1WXU A;  1PV3 A;  3CCE P;  2N1T C;  4C46 A;  4DOJ A;  1YI2 P;  3S3O A;  5CCG C;  3L2Q A;  2GUS A;  4X9D A;  1M1K R;  3IF4 A;  1SFC D;  1BB9 A;  1N73 B;  3H0I A;  4M77 D;  1NLP C;  2JEE A;  2PZ1 A;  4PJ0 E;  1WHH A;  1T3J A;  1FWZ A;  2A45 G;  4LGD E;  3EFG A;  1KSW A;  2RI5 A;  2M0O A;  2V1R A;  3CXC S;  2KLU A;  3VP9 A;  2J6F A;  3I55 A;  1MUZ A;  1SQB J;  2O9S A;  4OP0 A;  1R8E A;  1N86 A;  3V4W A;  1KQ1 A;  4ZTF A;  5AT1 B;  1GL2 D;  1JTH B;  2GF7 A;  3OYM A;  3MEV A;  2O01 E;  2RQR A;  1K8A U;  3NTK A;  2M1H A;  4IUU A;  4C92 D;  2L8D A;  1VQ4 A;  1D1C A;  2RMZ A;  3IR9 A;  2EYY A;  4QVC A;  2QEX T;  3TQ7 P;  3A8O B;  1PM3 A;  2Q1K A;  2KT8 A;  1JY3 N;  2PU9 B;  3SWN C;  1A0N B;  1G2C B;  1VQN A;  2X3X D;  1S9K D;  2RJE A;  3C1L A;  1VF5 D;  2FYU K;  5CVI A;  3GPL A;  2WSC H;  1RI9 A;  2P0P A;  2KAF A;  1Q90 D;  3O8Z A;  1IGU A;  2P2U A;  1FZC C;  2HZY A;  2ZYA A;  1OMI A;  5E79 E;  3CCU T;  2V1Q A;  2FFD B;  2N1T A;  1PKS A;  1NKZ B;  3VS4 A; 
#chains in the Genus database with same CATH homology
 1L4A B;  2JTM A;  3M57 A;  3V7S A;  3H6P A;  4C8Q C;  3L37 A;  3RMS A;  1N7S A;  5AVS B;  4HCB A;  1S9K E;  1NH4 A;  3E19 A;  2J59 M;  2O4X B;  1YIJ T;  4FSX A;  3JCM d;  5GAO l;  1YTZ T;  3PP5 A;  2E6Z A;  2JZ2 A;  1VIE A;  2ZPI B;  3BRV B;  2AHJ B;  3RKX A;  2E1H A;  2OYI C;  3RL0 B;  4GKG A;  5KE3 A;  1G3Y A;  3KBG A;  4JRI A;  1KFM A;  1YTZ I;  1K9M U;  2X4Y A;  1FJK A;  1PSF A;  2XV5 A;  4QQG A;  2P0Q A;  4C8Q B;  4JYB A;  4B9X A;  5CKH A;  3B5N C;  2EJF A;  3MTU E;  4M75 B;  1OZ2 A;  4EPC A;  5LJ5 j;  4RCB A;  2R57 A;  2GCX A;  2BKD N;  3HL8 A;  4M7A C;  4KT0 E;  1UGR B;  4M75 G;  1DX7 A;  1KZU B;  3X20 B;  3ER0 A;  1NAF A;  1I4K 1;  2PP6 A;  1FOS F;  4XU2 A;  4BDZ A;  2KSS A;  3CEY A;  1HGZ A;  1FOS E;  2PUO B;  3UWN A;  4WBA A;  3RMQ A;  4M7D C;  3H32 B;  1NKN A;  3GOX A;  2Y90 A;  3OYY A;  3GNG A;  5C0M A;  3PFS A;  1YCY A;  2VV5 A;  3I56 T;  3FDR A;  1MZ9 A;  4BY6 C;  1KIL D;  2N1T B;  4II1 A;  4PJO G;  3RK2 C;  4ZKP A;  3L2Z A;  1VQ7 A;  3HRS A;  1RF1 B;  1M90 C;  1VDF A;  1LTB C;  3FEO A;  1K73 U;  2LX9 A;  3TCJ A;  2IFM A;  1VQL A;  2WSF E;  5GAN 6;  5DY9 A;  5J39 A;  3M91 A;  3CLQ A;  2ZZD A;  2YKO A;  2ZFC A;  4ELY C;  5AVW B;  1M9S A;  5FRM A;  1HTL C;  2YKP A;  3G7Z A;  5GAN f;  4PJO A;  1X8Y A;  2ZGW A;  5CKE A;  5CCA A;  5KJ7 D;  2XK0 A;  5A0D A;  3VMZ A;  3WMM 0;  5GMK e;  5APW A;  1LGH B;  2LC4 A;  1U1S A;  3MP8 A;  4JLG A;  2BIV A;  2L5Q A;  3PTA A;  4J5Y A;  2PVD B;  5GMK l;  2O01 H;  1QVG S;  4MZT A;  2YKQ A;  2CZ6 B;  2OAR A;  1BIA A;  1GL2 C;  2IVW A;  1TH7 A;  3SWF A;  3RKW A;  3CCS A;  4M3L A;  2OTJ T;  3OYD A;  4LLH A;  3MD0 A;  3VYG A;  4N0A C;  1H64 1;  2FB7 A;  2RM4 A;  1DEB A;  2HBP A;  3Q1J A;  4XTW A;  2EQK A;  1M1J A;  4XAX B;  2BAS A;  2ZXE B;  4YTL A;  3P8M C;  4JDS A;  1JB0 E;  4XU3 A;  2K3X A;  5FU7 B;  4BAC A;  5FU6 B;  1Y96 A;  2E64 A;  3HE5 A;  2W27 A;  4XU1 A;  5AW2 B;  4F7U A;  3CCM T;  3M0D C;  1FJP A;  3VOP A;  3H8Z A;  4RG2 A;  4BE2 A;  3TU4 K;  1P92 A;  1SFC A;  1SQV K;  3H32 A;  2Y4X A;  1I5L A;  1X6O A;  2V8K A;  3QKJ A;  2FL7 A;  2QQA A;  2R5D A;  2EWN A;  2P1J A;  1JBM A;  2MWP A;  3TNU A;  1IRE B;  4M7D F;  4J7I A;  1O9S A;  5GMK h;  2KQW A;  4EMK B;  3U59 A;  2DD5 A;  3OS1 A;  4C0F A;  1VIF A;  2FHD A;  4XTX A;  1PFI A;  4PJO E;  3OSV A;  3BFM A;  4F7U F;  3J80 E;  1KQS S;  3BDL A;  2WZ7 A;  1SQB K;  1BI0 A;  4M75 A;  4LDV A;  3LIE A;  3M0D A;  4M7A D;  1FZB A;  1J1D B;  3CCL A;  1FDM A;  1NTM K;  2RH2 A;  5CHX A;  1L0N K;  1VQ8 T;  3UDC A;  1G3T A;  1UGP B;  3GHG C;  2KSJ A;  5AW4 B;  4M78 B;  2KK4 A;  3CCR T;  1AFO A;  1IFD A;  3VYH B;  1Q82 U;  2XKM A;  4MDW A;  3M54 A;  4PLL A;  1SQQ K;  3RIR A;  3SDZ A;  2HPC B;  2JN0 A;  1NOH A;  4M75 F;  4CRI A;  4BB7 A;  1GZL A;  1ZBX A;  3L1A A;  1JNM A;  4ZGJ B;  3QZ5 B;  2RI2 A;  3P7K A;  2FFD A;  1LTS C;  2ZPF B;  1A02 J;  2M9U A;  3NTH A;  4C92 A;  2NPS B;  1GU4 A;  2PAJ A;  3VMX A;  4F7U G;  2EAY A;  5LJ5 g;  3RK3 D;  2XZR A;  3JCM Q;  1QP3 A;  2G3R A;  4PLI A;  3JB9 D;  5AW8 B;  2CS7 A;  3V4Q A;  2JJL A;  1V29 B;  1VPC A;  3QJ6 A;  2KMT A;  2GUV A;  3QYH B;  4OMF B;  3L2V A;  2RJC A;  3GHG A;  3HUS B;  1VQ9 T;  2EIF A;  2HNI A;  4A4K A;  3RK2 B;  1U1T A;  3GF5 A;  3OYF A;  1N6A A;  1AQ5 A;  2DD4 A;  3HFN A;  5D6W A;  3CC2 T;  5AW9 B;  2HD0 A;  1HH0 A;  2N9B A;  3A8M B;  1MV8 A;  2WSE E;  1B34 A;  3A5Z B;  2IFN A;  3JCM h;  3P8B B;  2E43 A;  4BE0 A;  2HOD A;  2DK3 A;  1NPR A;  3P8D A;  3EFR A;  4J8O A;  1KHC A;  4J83 A;  3CCJ A;  3PIP A;  4M78 C;  2JOY A;  5KCH A;  1GK6 A;  1XTG B;  4M77 F;  2MWO A;  4R55 A;  3E9F A;  3INZ A;  1FZC B;  4O6J A;  1LNX A;  4BI8 B;  2DPP B;  2XDB A;  5CCH A;  2JVV A;  4JUV A;  5A0L A;  1JY2 N;  4BI4 A;  3QPH A;  2M3B A;  4C0D C;  3JCM P;  3OAK A;  1JO5 A;  2E70 A;  5APT A;  5GAN h;  3CCS T;  1EIF A;  2HQX A;  2EJG A;  3FLG A;  1FZA A;  3E1I A;  4L5G A;  4M7A E;  1D3B A;  4M78 A;  5GAN 7;  3CMA T;  2R32 A;  3M9B A;  1KQS A;  2QM8 A;  3LX7 A;  5I2M A;  4M7D E;  3M58 A;  2YO2 A;  1M5Q 1;  2CYZ B;  2JNG A;  5APU A;  1VQO T;  3R2P A;  4O5V A;  2DKG A;  1ZQ1 A;  2VXE A;  1SQP K;  3CC4 A;  1RE3 C;  4J6Y A;  4NS5 A;  3FJP A;  5CQX A;  4C8Q A;  2KYV A;  5GAO q;  2C06 A;  3V2R A;  2DVE A;  3OYL A;  1LOJ A;  4EIJ A;  2YO3 A;  1NTZ K;  4EDU A;  2KP8 A;  1N2D C;  5CKF A;  2CZ7 B;  2WSC E;  1KG1 A;  3URG A;  1Q81 C;  1RF1 C;  5CIU A;  1NE8 A;  2FFD C;  2XU6 A;  1UB4 A;  5GAM g;  3G6E A;  2FKW B;  4KUL A;  2HOD B;  2A45 H;  1LJO A;  3HE5 B;  2GM4 A;  2XG8 D;  3QXE B;  3CCU A;  1QL2 A;  1T2K D;  2DAQ A;  1D3B B;  4XU0 A;  3L42 A;  1VQ9 A;  2IPP A;  5GAO p;  4Z02 A;  4KUI A;  3RKY A;  4X9C A;  2H8P D;  1FAV A;  1QVG A;  2PQW A;  4X34 A;  1H89 A;  3VP8 A;  2QEX A;  1G5V A;  5CO7 A;  1E5W A;  5CCH D;  5CKD A;  2OAU A;  2OYI B;  2DEQ A;  3V8L A;  1LWU B;  4ZGD B;  4HA8 A;  2XD0 A;  1LTG C;  3N4X A;  3GIB A;  1LT9 C;  4RCC A;  3L4F A;  3HFO A;  4M78 F;  2Z5I A;  4M77 G;  2E6N A;  2QQR A;  1W2B S;  2Q9I A;  4ATO A;  4BE1 A;  3MP6 A;  2RA2 A;  3BRT B;  1NHL A;  2LKM A;  2F69 A;  3CME A;  1J1D C;  1EQ7 A;  4GIF A;  2Q3I A;  3QSU A;  4JLI A;  4HH2 A;  5AVQ B;  3OYE A;  2RHX A;  3SWN B;  2IG0 A;  1ZV8 A;  1NPP A;  1ZR2 A;  1CI6 B;  2DZ9 A;  5GAM j;  4FIB A;  1GD2 E;  1NZ9 A;  1FX7 A;  3SWY A;  2RB6 A;  3BAT A;  5GAN g;  4PJO C;  3M0A A;  3EQ2 A;  3L2U A;  5GAN 2;  4VUB A;  4A53 A;  4JS4 A;  3RK3 B;  5GAO n;  1Q81 U;  2E41 A;  4M78 G;  2C0W A;  3PMI A;  2NPS D;  1FXX A;  3LH0 A;  4UC4 A;  3RL0 D;  4RG8 A;  4M7D G;  4C7N B;  2KVQ G;  3OJA B;  4A4G A;  5LJ3 j;  3OMC A;  3CPW S;  4M78 D;  1SQX K;  2O1J A;  1WJR A;  5A0G A;  4IUV A;  2XI9 A;  1YI2 T;  5HKC A;  3OBW A;  3OYH A;  5CJ0 A;  1KIL A;  4W7Z A;  3X24 B;  4DOV A;  3HUS A;  5GMK m;  2R5A A;  4M7A B;  5AYF A;  2DXC A;  5GAM e;  4IFM A;  4FM4 B;  1N8R U;  3S3N A;  1BIB A;  3V5B A;  2CKK A;  2VGM A;  2YRV A;  5KJ7 C;  1G3S A;  4C92 B;  2R3C A;  4AUW A;  2O1K A;  4B9W A;  1L0L K;  3KPE A;  5CCH C;  3JCM J;  3OA6 A;  5CJ4 A;  1KD1 C;  4M77 B;  4OB2 B;  1RI0 A;  3DLM A;  3VMY A;  1KIL C;  3J7A F;  2XHC A;  3KXT A;  4C5G A;  1YJW A;  3RES A;  3HD7 D;  3EFS A;  2H3J A;  3PT9 A;  5DM7 R;  2FYK A;  2RO0 A;  1H88 A;  3L2W A;  1KHI A;  2CZ1 B;  1L4A C;  2YNY A;  2W6A A;  1FZC A;  4OB3 B;  4MML A;  4IKF A;  1KD1 U;  1MHN A;  2VGN A;  3V2P A;  3NXS A;  4C5E A;  4DA4 A;  1RE4 A;  1CZQ A;  3BDU A;  3G3Z A;  4A54 A;  3RL0 C;  1RF0 A;  3HD7 B;  5BU5 A;  2RK1 A;  5GAN 8;  1J1E B;  1LTI C;  4Y99 B;  5DLQ E;  2XIC A;  3CCM A;  4JJN K;  2Y4Y A;  3TNU B;  1JJ2 S;  3HRU A;  4EMG A;  1LTJ C;  1BKB A;  2ZPB B;  4C0Z A;  4MZM A;  4C92 C;  2R58 A;  3A3Y B;  1K9M C;  3P8H A;  2VYT A;  2QDY B;  4J7F A;  1VQK T;  2ZCF B;  1XNI A;  2OTJ A;  4KBM B;  3VV0 A;  4W80 A;  3OB9 A;  3MO8 A;  2LT1 A;  5HK3 A;  3OYI A;  5AVY B;  1URQ C;  3V8J A;  2WPQ A;  3HD7 C;  1T3U A;  3T9N A;  1HVV A;  2XDJ A;  3BY7 A;  1RL2 A;  1BI2 A;  1HK9 A;  3QDR B;  2OYH B;  3I5C A;  4QW2 A;  5LJ3 g;  5GAM h;  4EMK A;  2V8I A;  3JCM e;  4ZGE B;  3M5A A;  4XTU A;  2DTO A;  1N7S D;  3OMG A;  4ELZ C;  1IFM A;  4JF7 A;  3RK3 C;  4KHX A;  3QII A;  2YLB A;  1JY2 O;  2CGH A;  1UEB A;  3E1S A;  1JY3 P;  5CKB A;  2LQ8 A;  1G1J A;  3CCR A;  4PNO A;  3OYB A;  3V8K A;  3JCM V;  4M77 C;  3BW1 A;  2DIG A;  2WT7 B;  3VKI A;  5LJ3 d;  3DLL A;  2LQK A;  2P0K A;  1QVF A;  1LWU A;  4M7A F;  3CBP A;  1N27 A;  1HBW A;  4WB4 A;  5GAN j;  3LW5 E;  2RD1 A;  5AVX B;  3LGL A;  3KUF A;  3IFM A;  4J6W A;  4EMK C;  5AW0 B;  2MI6 A;  4GLK A;  1Q7Y U;  2J58 A;  3N7N A;  2E10 A;  4LD6 A;  3CPW A;  4AQR D;  2BUD A;  3MEW A;  2W6B A;  1H3Z A;  1VQO A;  3AHU A;  3L2R A;  1VQ8 A;  4C8Q D;  4V2S A;  3LYI A;  3CD6 T;  3PGG A;  2WWW A;  4WY4 A;  3BAS A;  2RJF A;  1ZN5 A;  1BI1 A;  3FB9 A;  1JUN A;  5I2S A;  1HUC A;  3KDP B;  5KJ7 A;  4LC1 A;  1N7S B;  2EYQ A;  2A3L A;  2CZ0 B;  2O4X A;  1LWU C;  3MIW A;  1VQP T;  2EKO A;  1SFC C;  1SP4 A;  5GAN 5;  5C6S A;  4E7H A;  2RHZ A;  1ZHI A;  4OB0 B;  2KB7 P;  3LID A;  5AVR B;  3S6W A;  1KC8 U;  2C0X A;  4E7I A;  3OSS C;  4N4G A;  2WSF H;  5GAN e;  1NU1 K;  4QVZ A;  2QXF A;  1FZG A;  3JCM f;  2YHT A;  3A5T A;  3L36 A;  3CCL T;  1RF1 A;  1DJ7 B;  2MAM A;  1JMM A;  2QQB A;  4C0G A;  3LWI A;  5KCO A;  1VQL T;  2I2L A;  5GAN 4;  1S72 T;  3B5N A;  3GNF B;  1VQ6 T;  5KTB A;  1M1K C;  1Y7X A;  4JYC A;  1O75 A;  2DJZ A;  2QA4 A;  1KC8 C;  1YIT T;  4HT9 A;  1FZE A;  5LJ3 f;  1Q86 U;  1SFC B;  1NTK K;  3QG1 A;  5LJ5 e;  2M8R A;  1Z56 A;  4C0D B;  4M75 E;  3CCV T;  1GW4 A;  4FL6 A;  1W4S A;  2RHY A;  1FZF A;  4WY4 B;  1PSE A;  2EFI A;  3MEU A;  1FBM A;  1UGQ B;  2R5B A;  1MUU A;  2WAC A;  4ZKU A;  4M7D A;  2IX7 C;  5CCG D;  2LCL A;  1T8Z A;  3JCM X;  3NFQ A;  3ZFJ A;  1HWT C;  3X26 B;  4XK8 E;  2KDS A;  4BUG A;  3P32 A;  2DXT A;  4IUT A;  5BVZ A;  2POH A;  4C8Q E;  3HE4 B;  4IUR A;  4ZN1 A;  3ASK A;  3OYG A;  1KQL A;  2QQ9 A;  4DZO A;  2X4J A;  3QUI A;  3OYJ A;  1A02 F;  3VTP C;  1VUB A;  2LVM A;  3PNW C;  3CBM A;  3WXM B;  1X9V A;  1ZLL A;  2PUK B;  3CD6 A;  1M7L A;  3JCM g;  2K5I A;  5APQ A;  1M1F A;  4FT4 A;  5FLX E;  2WTY A;  2A45 I;  4M7D D;  2OYI A;  3SD4 A;  2E65 A;  3E9G A;  2D6F A;  2EQU A;  1IJD B;  1M4Z A;  2X4W A;  3HKS A;  2MF2 A;  1XQH A;  1WQW A;  5GMK i;  1GL2 A;  1X75 C;  4HCC A;  2Q5U A;  5FRN A;  4Y28 E;  2MMP A;  1WPY A;  4LDU A;  2ZPG B;  1SVF A;  2K5F A;  2YLC A;  2EQM A;  3EAE A;  1URQ A;  3DB3 A;  3CXC A;  4HCZ A;  1BYM A;  4PL6 A;  3PMT A;  2HQE A;  3TYY A;  3JB9 G;  2K5L A;  4QQD A;  5FRO A;  2DIQ A;  2R5M A;  1XTC C;  1X01 A;  4W7Y A;  2KY9 A;  3VUZ A;  2MJZ A;  1YIJ A;  3RK2 D;  2D9T A;  5J26 A;  3B5N B;  4QVD A;  3HE4 A;  2L89 A;  3OBY A;  3CC7 T;  4M78 E;  3G4S A;  2P7J A;  2E42 A;  2I1K A;  1T2K C;  2A7Y A;  3JB9 H;  2KLV A;  1VQM T;  5CMZ A;  3M55 A;  2QA4 T;  5FU7 C;  4E7L A;  1YIT A;  3QZ9 B;  3CCE A;  2H7H A;  1OXZ A;  4XE5 B;  2LTO A;  3C9I A;  3OA7 A;  3FC3 A;  2I1J A;  3VU3 C;  1VQN T;  2VRS A;  1N73 C;  4DOW A;  1JRI A;  1WRG A;  4PJO F;  3A8H B;  4IUQ A;  5AW7 B;  2E5Q A;  2GQV A;  5I21 A;  4A4H A;  1YHQ T;  1JCC A;  4XQ3 A;  3UIA A;  3PIO A;  3J81 E;  4N4I A;  4RKU E;  1K8A C;  4C7N A;  2B8A A;  1MGQ A;  3NTN A;  4PJO B;  3X25 B;  1N7L A;  3LWH A;  2VXF A;  2DXB A;  2ZPE B;  4OH8 B;  5KLV K;  3C94 A;  4LDW A;  1URQ B;  1NWQ A;  3T97 A;  2D0Q B;  3OYC A;  2K57 A;  4HT8 A;  2L3R A;  3VYI A;  2DTI A;  2Z4E A;  1Q86 C;  4M77 E;  1QVF S;  4JRQ A;  3HTK B;  3U1C A;  5J3B A;  1YJN A;  3M56 A;  1G2C A;  4XTY A;  1NJI C;  3BVH A;  1JY2 P;  4Y91 A;  1IFJ A;  4OGC A;  3C12 A;  5GAN d;  3S3M A;  2OTL A;  2WSE H;  5LJ3 e;  2EJ9 A;  1WNL A;  1IFI A;  3HHT B;  5LL6 S;  3JB9 I;  4EOT A;  5LJ5 f;  1J1E C;  1WGS A;  5EG2 A;  4MDX A;  2FYZ A;  2HAX A;  1FU1 A;  3CC2 A;  4PJO D;  4NOY A;  3JCM W;  3JRZ A;  3M59 A;  2NLU A;  3DKM A;  4I6M C;  3V7C A;  3TK1 A;  1M1K U;  2RK2 A;  1IFN A;  3LW5 H;  5AVU B;  1Y96 B;  4IFD K;  3OW2 S;  2F5T X;  5GAM f;  5CAI A;  1WJQ A;  3F70 A;  1W2E A;  4C5I A;  1N9S A;  3HTK A;  3B8E B;  5CR2 A;  5AVT B;  4CI0 C;  5M9O A;  1XTD A;  5AW1 B;  3ZEH A;  1VQ7 T;  4WY4 C;  3QO3 A;  3CPF A;  2EQJ A;  2HYN A;  2X4X A;  4PKC C;  4FT2 A;  2HFE D;  3OS2 A;  3V7R A;  2WT7 A;  5APX A;  1HJB A;  5GAO m;  1BI3 A;  1YYC A;  1M1G A;  4R56 A;  4KUD K;  3CCJ T;  3JCM b;  4M77 A;  4ZTJ A;  5HY6 A;  2PVG B;  4C8Q F;  1G3W A;  2LT4 A;  4N0A A;  3HP9 A;  2GFA A;  4C92 F;  3TEE A;  4D6W A;  1GK4 A;  1B34 B;  4ME7 A;  5GAO r;  1M1J C;  4DQ2 A;  5APY A;  1K73 C;  3O8V A;  1U8R A;  5CCG A;  3OS5 A;  4M75 C;  4E47 A;  4FU6 A;  4L6V 5;  5GMK j;  4IFF A;  3MUD A;  3P8C E;  1IK9 A;  3LGF A;  2KOG A;  3X28 B;  1OWA A;  2Q7C A;  4Y99 C;  4N4H A;  2OYH C;  3RER A;  3SB2 A;  3U1A A;  1N9R A;  2LRQ A;  3CC7 A;  1KIL B;  2N1T D;  3NMD A;  5IT9 E;  4LD9 K;  3CI9 A;  4M7D B;  1N73 A;  3CCE T;  1QL1 A;  1RE3 A;  3CMA A;  5CK9 A;  4N3Y B;  2WIT A;  1OYX A;  2DXU A;  2QTX A;  5LJ3 h;  4N6J A;  2RJD A;  1VQ5 A;  1X79 B;  2X35 A;  3MP1 A;  4F7U B;  3L35 A;  3C4S A;  1YJ9 A;  1S72 A;  2RHU A;  5IAY A;  2HG5 D;  5D6X A;  3HUS C;  4XA4 A;  5APS A;  4B86 A;  3R6O A;  1JOC A;  1NO4 A;  3WVD B;  2RI3 A;  3FRN A;  1Y71 A;  3G71 T;  2PVO B;  5KH6 A;  4M75 D;  2V8J A;  1GTW A;  2CPS A;  3HRT A;  1G1I A;  5KE2 A;  3CCV A;  1JCD A;  3V2N A;  3M9Q A;  4Q5W A;  3OYN A;  2XNX A;  3LLR A;  1JTH A;  4XTV A;  4F7U E;  2C9L Y;  2HLO A;  3QJY A;  3SFM A;  4A4E A;  1N7S C;  3JB9 F;  1YHQ A;  4AYC A;  3NFC A;  2DZC A;  2M16 A;  4OB1 B;  2VC8 A;  3N5B B;  3H6Z A;  4WY4 D;  1Q7Y C;  1RF0 C;  1YJN T;  2XU8 A;  1IC2 A;  4GY5 A;  1L4A D;  2HPC A;  1Y07 A;  1VQP A;  3ZBD A;  1UGS B;  1GDT A;  5DLO A;  3VN0 A;  2K3Y A;  2QI2 A;  2FXM A;  4C7R A;  4E7J A;  2LDM A;  3CC4 T;  3A7O A;  4JRK A;  4I2L C;  3M06 A;  2P4T A;  2DO3 A;  1AHJ B;  3MHX A;  2ZPH B;  4I1L A;  1GXI E;  4J6X A;  4MMK A;  3TRE A;  5L8R E;  3HPW A;  3CCQ T;  1GL2 B;  3A8G B;  1CI6 A;  1ZR4 A;  4ZN3 A;  3GP8 A;  1LTT C;  4NL3 A;  3MET A;  5LJ5 d;  3WVE B;  4XTZ A;  1NJI U;  3I55 T;  3CBO A;  1CW5 A;  4E7K A;  4BI3 A;  1JJ2 A;  2H43 A;  1URQ D;  2F5K A;  1N8R C;  3DB4 A;  4LDY A;  4OGE A;  1L4A A;  5FU6 C;  1OI1 A;  3V2Q A;  4C92 E;  1R8O B;  4HYT B;  2XKO C;  1DH3 A;  3A8L B;  4BD3 A;  3KYQ A;  5AW5 B;  5LJ5 h;  2OYH A;  2K4Y A;  1IO4 A;  2YMY A;  2XID A;  2WPR A;  1WT6 A;  1YI2 A;  3GHG B;  1YJW T;  3HRN A;  1HXD A;  1YJ9 T;  1Q82 C;  2XDP A;  2JTF A;  1QW1 A;  3VUB A;  2WPS A;  2QM7 A;  4BY6 B;  1M1J B;  2Z5H A;  1GU5 A;  4N78 E;  3G4S T;  3II6 A;  1XOV A;  4MZP A;  3ME9 A;  3JSC A;  3OW2 A;  2C9N Y;  2GFU A;  1KFN A;  1W2B A;  1I81 A;  3B5N D;  2JUF A;  2VUB A;  4O9B A;  4RES B;  2K2V A;  1QP2 A;  1VQ4 T;  1SSF A;  2FVU A;  3CCQ A;  2RHI A;  3CL3 D;  3M4Y A;  2P67 A;  1GW3 A;  1MFZ A;  4C5H A;  2L5G B;  3OYK A;  5GAM d;  5A2Q E;  5GAN 3;  3OS0 A;  3MGN A;  5CQY A;  5HK0 A;  3MEA A;  2LNV A;  4M7A G;  1OZ3 A;  3TSI A;  3NTI A;  4GT1 A;  4WF2 A;  1VQ5 T;  1VQK A;  3OY9 A;  4IUP A;  4M7A A;  1M8V A;  1LTJ A;  3QBY A;  4QQ6 A;  1LT9 B;  1LT9 A;  1YBY A;  3GLX A;  3HSB A;  4JRP A;  4A4F A;  3QYG B;  1HGV A;  5AVZ B;  1VQ6 A;  2QQS A;  2NPS A;  3M53 A;  5BU8 B;  2E12 A;  3M4G A;  5D6Y A;  4BDY A;  3A2A A;  1WQ7 A;  1JY3 O;  1CSB A;  3P8C D;  1I8F A;  3CME T;  5AVV B;  3UT1 A;  3G6E T;  4RMO A;  5AW3 B;  3HD7 A;  1QVP A;  4EMH A;  3QHS A;  4C8Q G;  4NL2 A;  1J2J B;  3G71 A;  3VJP A;  1LTJ B;  3KQG A;  4P5N A;  1KQ2 A;  2DTH A;  1SLQ A;  4JS5 A;  3C95 A;  2CPB A;  1VQM A;  3JB9 J;  1RY3 A;  1M90 U;  3MCA B;  4TVR A;  1WJS A;  2NPS C;  5IN1 A;  3UPU A;  3FIF A;  2LCC A;  3OQ5 A;  3SWN A;  4LDX A;  3RUX A;  3JCM c;  4OVA A;  3I56 A;  3M9H A;  2XDD A;  4N78 D;  1H8A A;  5AW6 B;  3JAM E;  4HKE A;  1IZ6 A;  2OTL T;  1LTA C;  4OF1 A;  4C92 G;  4L59 A;  1RE4 C;  5APV A;  3OYA A;  2N1T C;  4DOJ A;  4C46 A;  3S3O A;  5CCG C;  3L2Q A;  2GUS A;  4X9D A;  1SFC D;  1N73 B;  4M77 D;  2JEE A;  2RI5 A;  1T3J A;  1FWZ A;  2A45 G;  4LGD E;  3EFG A;  2M0O A;  3CXC S;  3VP9 A;  3I55 A;  4OP0 A;  1N86 A;  3V4W A;  1KQ1 A;  4ZTF A;  1GL2 D;  1JTH B;  2GF7 A;  3OYM A;  3MEV A;  2O01 E;  1K8A U;  3NTK A;  2M1H A;  4IUU A;  4C92 D;  2L8D A;  1VQ4 A;  3IR9 A;  4QVC A;  2QEX T;  3A8O B;  2PU9 B;  1JY3 N;  3SWN C;  1G2C B;  1VQN A;  1S9K D;  2RJE A;  2FYU K;  5CVI A;  3GPL A;  2WSC H;  2P0P A;  2KAF A;  3O8Z A;  2P2U A;  1FZC C;  3CCU T;  2FFD B;  2N1T A;  1NKZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...