3M9QA

Drosophila msl3 chromodomain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
LRDETPLFHKGEIVLCYEPDKSKARVLYTSKVLNVFERRNEHGLRFYEYKIHFQGWRPSYDRAVRATVLLKDTEENRQLQRELAEAAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Protein male-specific lethal-3
publication title Corecognition of DNA and a methylated histone tail by the MSL3 chromodomain.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 22
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3m9qA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3m9qA01
3OQ5A 3M9QA 3OYFA 5KCOA 3S3MA 3LW5H 2X35A 3E9GA 4IKFA 3DLMA 3H6ZA 2VYTA 3OMCA 4PLLA 4CRIA 3OYAA 2DIQA 3GOXA 4X34A 4BDZA 3MP8A 5KLVK 4HCZA 2RHXA 5C0MA 1WJSA 4A4GA 3DB4A 3OYLA 2RJCA 3BDLA 3FDRA 4IUTA 1SQXK 3NTHA 4IURA 3S3OA 3ZEHA 1SQVK 3LX7A 2F5KA 2O4XB 3PFSA 3P8DA 3L2VA 2RI5A 4E7HA 3ASKA 2GF7A 3MEUA 1RI0A 1XNIA 2RJDA 5KH6A 3OYCA 3MEVA 3QJ6A 3OYNA 4E7LA 3G3ZA 4B9WA 2LCCA 3UWNA 4A4HA 4IFDK 3FC3A 2P0KA 4BACA 3O8VA 2RHIA 4RG2A 2RHUA 3MP1A 3OYDA 4N4IA 2L3RA 3OYIA 3L2UA 4N4HA 5FROA 4BDYA 2RHZA 3NTIA 2MWOA 4E7KA 5FRNA 3OYGA 2NLUA 2HQEA 4Z02A 1NTZK 5D6WA 1SQQK 3NTKA 4C5GA 1OZ2A 3OYBA 4E7IA 5IN1A 4IUUA 3MEAA 4L59A 3OA6A 1MHNA 1OI1A 2R5AA 3FLGA 2MWPA 2XDPA 2RI3A 2O01H 2L89A 3LYIA 2RHYA 2DIGA 4C5HA 2WSCH 5KE2A 2M0OA 1OYXA 2LDMA 4UC4A 2E6NA 2GFAA 5IAYA 3C4SA 5D6XA 4Q5WA 3OYHA 3META 5C6SA 3S6WA 4PLIA 5KE3A 4QQDA 4PL6A 1G5VA 4IUVA 4N4GA 4A4EA 3QBYA 2RJEA 3OS1A 3UT1A 4BE0A 5D6YA 4QQGA 4QW2A 3OMGA 3PMTA 2EKOA 3PNWC 2X4WA 3SD4A 1NU1K 2RJFA 3DB3A 3MP6A 4C5EA 5J39A 4E7JA 1L0NK 2R57A 2BKDN 5M9OA 2O4XA 3LGLA 3P8HA 2QQRA 3L42A 2M1HA 2YRVA 3MO8A 4NS5A 5J26A 2DAQA 2EQMA 3OYMA 2L8DA 4FL6A 2WSEH 4OVAA 4QQ6A 2WSFH 2JZ2A 3OYEA 3EAEA 2IG0A 3QKJA 3L2RA 3Q1JA 1H3ZA 2LRQA 2QQSA 4BE1A 4ZTJA 3F70A 3L2QA 2LTOA 2JTFA 2GFUA 2WACA 4C5IA 5CIUA 2G3RA 3CEYA 3OYJA 3OY9A 1OZ3A 2HQXA 2XK0A 3E9FA 2B8AA 2BIVA 1NTKK 2RI2A 4II1A 1SQPK 1SQBK 3MEWA 1WJQA 4FU6A 5KCHA 3L2WA 3LH0A 2X4XA 3KUFA 1N27A 2EFIA 3H8ZA 4B9XA 2EQUA 4EDUA 2R5MA 2K3YA 3LGFA 2PQWA 4LD6A 2RO0A 3LLRA 1SSFA 2FHDA 2M16A 3OB9A 4IUPA 2LKMA 2EQJA 1NTMK 2EQKA 5FRMA 3S3NA 2FYUK 2OARA 3CLQA 1WGSA 3FEOA 4ZTFA 3PMIA 2K3XA 3ME9A 2X4YA 4BE2A 4BD3A 3OYKA 2J59M 3OS2A 2D9TA 2R58A 3OS0A 1WJRA 1KHCA 2BUDA 4IUQA 4A4FA 2CKKA 4GY5A 1L0LK 2E5QA 3QIIA 2LVMA 4QVZA
chains in the Genus database with same CATH superfamily
1WX6A 1O9SA 1PSEA 3S1KA 3CMAP 1UHCA 2KVQG 2R44A 4N3YB 3CXCP 1ZMEC 1RADB 4M75B 3AE5C 3H6ZA 1HBWA 3BATA 2AK5A 4EMKC 2QJKC 2OYOA 4HVVA 1JEGA 3PIOA 2NWMA 2HMAA 4HCBA 3CXHH 5GJVB 1FS0E 4C92F 4HKZH 2V8JA 2KBTA 1BCCJ 3MEUA 4HT8A 4M77A 5FW9A 5DLOA 5GAOr 4B9WA 4ELZC 2E76D 4BACA 2P0KA 2OYHA 3REBB 3O8VA 4PJMA 3OYDA 1SKUB 1MFZA 1LT9C 4DBFA 2DXUA 3M0DC 3TGUG 2X9HA 5APXA 1QCFA 3VYHB 3FWNA 4IIMA 2MWOA 5CCGC 2FYUD 4MN4C 4LE9A 1L2PA 4F7UB 2J05A 4PNOA 4IUUA 4L59A 2OTJQ 3L74D 3EGUA 1PP9J 1SQVG 5BU8B 1F1BB 1HSQA 5KE2A 2CPSA 2WT7B 2GGRA 3CBPA 4F04B 1JEKA 2L5QA 2Q3IA 2KLUA 1EDKA 1N73A 3VS2A 3OW2P 3EFFK 3GG2A 1M90R 1GL2B 3M0QA 3C0CA 1MUUA 4MMLA 4ZNCA 1K04A 3RK3C 2LX7A 2O2OA 5AVZB 1KN7A 4YTLA 3REAB 4PFOA 1GCPA 1NU1K 3DB3A 1EDLA 3H1LE 1SQXD 4L75A 3JAME 1JTHA 3H1HE 1M9SA 1VQMT 3RBXA 3SWNB 2KNCA 2Z5IA 3JV3A 2E4HA 4JRIA 2POHA 3GLXA 3JCMg 2QJYC 4OVAA 1LTJB 2OTLP 4XAXB 1D3BB 2OYIB 5CCHC 1I1JA 2EJFA 2YXQB 2JO1A 1WFWA 2J6OA 3QYHB 2GFUA 1U8RA 1BIBA 3CEYA 1J1EC 1OZHA 3HTKB 3L71D 1DX7A 1S1CX 3GF7A 1NWQA 1K1ZA 2FXPA 4XTVA 3GHGC 1IO4A 3NHNA 4HVWA 3L70J 4OGQD 1AOJA 1QCNA 2CZ6B 3D70A 1YJ9P 4KH1B 2EFIA 1LTBC 1VQ6Q 5CKEA 2GNCA 3LIEA 3W67A 3RK2D 1NEBA 4H13B 2MMPA 3I5SA 2LQNA 2LKMA 3T97B 1HVVA 1NU1E 2QM8A 4M7AB 1W70A 3CLQA 3I35A 4ZTFA 2FFDA 1JJ2A 1Z56A 1SFCD 2XNXA 3GW6A 2EVRA 5BU5A 2FXOA 2XDJA 4XU0A 1OX9A 2SPZA 1UFFA 2AEMA 2RQTA 1NAFA 1IHVA 2B86A 4JPBW 2BZXA 1KQGB 3M9QA 2KEAA 4FSXA 4RTTA 1M30A 5KCOA 1SQBG 2KIKA 2N9BA 2X35A 1VQNQ 1S72P 4WY4B 2BTTA 1RE4A 3B5NC 1ZA2B 3CCMP 4XU3A 1NKNA 4CRIA 1JB0J 2JM8A 2CH4W 1VQ9P 4M7DD 3R6OA 2ZYGA 1A02J 4D6TG 2DD4A 5LJ5j 3KXTA 4PJOF 3QO3A 3P8DA 1H8AA 5AVSB 2P4RA 2DL8A 3ZBDA 4HCKA 5LJ3g 3V2NA 2ZPHB 1YHQT 1VQ6T 1YBKA 2AKKA 4RG2A 2PFXA 1Y96A 2C06A 5L8RE 4AFZC 1AZEA 2K37A 1XTCC 1NAYA 5AW1B 4PD4D 1T3LA 2IZ1A 2DTIA 4KUIA 2K5IA 3JCMc 3V2PA 3FXEA 3CBMA 2VUBA 1M4ZA 2CT4A 2N1TC 4HJGH 3CCET 1YTZT 1VQ5Q 1VF5D 4JS5A 2DETA 1FAVA 1S5LH 3NMZC 1OYXA 2HD0A 4Q5WA 2CP7A 2BEQD 5KE3A 4U3FE 1KQSA 2V4HA 3H1LJ 1NTKD 2ZGWA 2CS7A 1VQLA 3HD7B 3LWIA 3H1HJ 3MZWB 1AWJA 3GIBA 3CCJA 1A02F 1VQ8T 2FKWB 3MP6A 2YKOA 3OSSC 1ZRTD 3USSA 2A3LA 1VQPQ 5LJ5e 5GTHH 4E7JA 1JCCA 2IFMA 3KDPB 2EQMA 2BE9B 2E75D 1E5WA 2WSEH 3CCRP 1IFMA 3L72J 1KILB 1QL2A 3HUSC 4M78C 3V7CA 3JCUE 1OPKA 1W2EA 4ZTJA 5CR2A 2E43A 2DZ9A 2EQIA 2GQVA 5LJ5h 4QVCA 8AT1B 4Y91A 3T9NA 4OMOA 3H0HA 3A8OB 4J9FA 5KAIH 2MKVA 3H32B 1R8EA 1JO5A 5FWCA 1NU1J 1FJKA 1X0TA 1X6BA 4WVZA 4A4KA 4XTXA 2LMJA 2LZ6B 5IHKA 5LJ5f 2EKHA 3TCJA 4BRYA 4IUPA 2PVDB 3MD0A 5KKZC 3DLLA 1C6VX 1ZBJA 1K9MU 2EYQA 1PHTA 3VYIA 1ZA1B 3OYKA 2HODA 2E5KA 2RM4A 2BUDA 4A4FA 4GKGA 2X4JA 1L0LK 2P58A 1JU5C 2E5QA 4WF2A 1KFNA 1VQPT 1KQSO 1JY2O 3EFOA 3UPUA 2XHCA 5KAFE 3DLMA 4M77F 4QVDA 3G4SP 2OYHB 1SQQD 4BDZA 5B66H 5AYFA 2QQ9A 2YUQA 3A5ZB 3O5ZA 4P5NA 3NTHA 3S3OA 3CMEA 3MGNA 1YFNA 4ZN1A 4HYTB 1PIXA 2RI5A 5GANg 2LQKA 3RK3E 1VOMA 1Q7YU 1LTIC 5L8RJ 1YITQ 5CCHD 2K5LA 3CCLT 3CXHD 2RMOA 1SQPD 5KJ7C 2FL7A 3CCQA 1YI2T 1PWTA 4C0DC 2NPSA 1TXQA 1JMBA 4MDXA 4C8QA 5AVWB 1GZLA 1KD1C 2DLPA 3VS3A 1PNJA 4LDUA 1OVRA 3RL0g 3SWYA 1AWOA 1L0LE 3GLMA 4M75C 4XU1A 1NTMD 4A54A 1N7SA 1NTZK 2DE0X 1Q90D 1W5CE 3IFMA 3H25A 3TEEA 1LWUA 3NMDA 4R0KA 3U1AA 2DBKA 2MWPA 1Q82U 4C92C 4U3FJ 1KB9H 2KE9A 3CBOA 5FU7B 4ASVA 3OYHA 2KNCB 2RMZA 3Q5PA 3SB2A 1YBYA 4HVUA 2R5BA 1VDFA 1MV8A 3M91A 2AEFA 4XK8E 2M5AB 1M1GA 4HCCA 2IBZE 2PRRA 1EIFA 1U1TA 3G6ET 4LXCA 2DPPB 3WU2H 2RJFA 4MZPA 1MMGA 3O6QB 3Q2YA 1WNLA 2E74C 2BKDN 2KK7A 1PGPA 2O4XA 1SFCB 2QASA 2IFNA 3U23A 2DAQA 2LR2A 2B87A 2P7JA 2QM7A 4J9BA 2XI9A 4J7IA 2M3BA 2Y4YA 1WQWA 1VQOP 2MIOA 3LIDA 4E6RA 2QQSA 1YJNP 2K2VA 4DOJA 3F70A 1QWEA 2KSJA 2LT1A 4ATOA 3OY9A 1BE3G 1M1KQ 2HZYA 3G71P 5IXBA 3A0HH 1AFOA 4M7DB 4Z1MH 3L2WA 3CCSP 3PVQA 1BCOA 5L23A 3H1IE 4H0LB 3HSBA 4EDUA 2XDDA 2QA4T 3IAOA 4LUDA 2QIWA 3TSZA 3CWBE 3JCMQ 2EQJA 2N1TD 4RJTA 3SWNC 5CAIA 2E5TA 1XOVA 4JRPA 2BCCD 1DD3A 2ZXXA 2OYIC 2QTXA 3V8JA 3HL8A 3SHWA 2RB6A 1M5Q1 2CUBA 3I56P 1QGKB 2PVOB 1T6AA 3IR9A 2ROTA 1FMWA 2P10A 1IRXA 3WUTA 3CX5D 2EPDA 2GTOA 2V1QA 1VQ4A 1VF5B 2F2WA 3QH9A 4PLLA 2DIQA 4U7JA 1KD1R 2RJCA 3U1CA 3FDRA 1IHWA 4F16A 2FYUG 1UDLA 1K9MQ 3E2UA 1KC8U 3L74G 2ED1A 3E19A 1L4AC 2OX7A 3VYGA 4M78D 1VQLQ 1Y47A 1JO8A 3H1HG 1L0LJ 3CCJQ 3CCVQ 4YPCA 2ATCB 2YIUB 3L75E 2H88C 2O1JA 2DVEA 1EX4A 2DJZA 1KIKA 2WZ7A 2E75B 4E47A 4LC1A 1AQ5A 5FRNA 1BI3A 2FO0A 1B7TA 1FDMA 1SQXG 1YN8A 4CI0C 1PPJE 2FEIA 1DEBA 1HWTC 1Q7YQ 3X24B 1O75A 3MP7B 1NPPA 1M3AA 4LDVA 3CPFA 3S6WA 2GTJA 1SVFA 1JY2P 3H6PA 4BUGA 1IZ6A 3R4YA 3OBYA 3QBYA 1HH0A 1KQ1A 2RJEA 3OS1A 3P8BB 3CC4P 4ME7A 3CMAA 4QW2A 3CC7T 1QLED 1M27C 2GUSA 1FC2C 4ZKUA 2X4WA 1Y7XA 2FYNC 1L0NK 3JCMV 1FZEA 1NTZJ 4OB2B 2ZJSE 2YRVA 2CP0A 2A06D 4JLIA 1G2CB 1VQLT 1Q82Q 4OH8B 3QWYA 3KBGA 1MGQA 4Y92A 2EGEA 3CXCS 2PUOB 3CCJT 4BRYB 5KLVE 2LRQA 2QTVA 5I2MA 2CK3H 4BI4A 2KQWA 4CC2A 3F5HA 3H1IJ 2JTFA 1OXZA 2JN0A 1M1FA 4JYCA 1X2QA 1VQMA 1ZQ1A 1PM3A 4R56A 2HODB 2BIVA 2Z0WA 1GCQC 3CWBJ 3X25B 3KUFA 2QQBA 4JJBA 2EQUA 5GTHE 1AVYA 4M3LA 3JCMb 2K3YA 3EG0A 2RO0A 2ZPGB 2IZ0A 2WSEE 1IGUA 2FZKB 2A37A 2QJPB 1ZR2A 2WPSA 1QVFO 4C92D 2EYXA 2K3XA 1K0XA 1HGVA 4AT1B 2JP3A 3CCQQ 4FYVB 4XTZA 1ZUUA 2YO2A 4JDSA 2OAUA 4EPCA 2QEXP 4M75E 5HY6A 2Q9IA 3CPWO 1P84E 5CMZA 2VYTA 2NPSB 2LT4A 1EFNA 4C8QB 3OW2S 2DFUA 2RHXA 4IIOA 2E74D 1VUBA 1LTJA 3QYGB 3AEBC 2M8RA 4PV1D 5KYWA 2A45G 3J81E 4IURA 1OV3A 3CC2P 3RNJA 1BI0A 3L73D 1BI1A 5AVVB 5GAN7 2OTLA 2KMTA 1H8KA 3HTKA 1LWUB 1XNIA 3L75J 3QJ6A 4PD4I 1RE3A 4JZ4A 2CP3A 2LCCA 2OGUA 4NPEA 1TSFA 1XTDA 1ZSGA 1M7LA 2A45I 2K88A 1YWOA 2DO3A 5GAOn 3CMET 2K3RA 4LDWA 4M77C 1URQA 4F7UE 1OU8A 1QVGO 4N4HA 4RTYA 5FROA 3H1JE 4AFSC 4NL3A 5AVXB 1YJ9A 2IYPA 2R32A 1PD0A 2VGNA 2JOYA 1X69A 3MPUB 1QWFA 5EG2A 5EC7A 3CCQT 2HKQB 2WSCE 1YHQA 1BCCD 3FLGA 1HTLC 3LYIA 1TU3F 1KYOD 4J9CA 1KC8Q 4LUEA 1SG5A 1V1CA 2GFAA 2GA1A 5A0LA 1Q2NA 5HKCA 2B87B 2HNIA 5AW5B 1N9RA 2ZPBB 5LL6S 3RKXA 3AE8C 5C6SA 3HE5B 5DLQE 2OQQA 2I0NA 3VS1A 1KB9D 1PV3A 4F14A 5DM7R 1FZGA 2XDBA 4WB4A 2B9BA 3CCEA 2LP5A 4I2LC 4NPFX 4QQGA 1FZCA 1NYHA 2DBMA 2RPNA 1S72A 1N73C 3HKSA 3MHVA 4AG2C 1K4US 2XIDA 3CCMA 1PP9D 1VQ9A 5GAMd 2Y0EA 5KLVJ 2E3IA 1LGHB 3CD6T 3RL0B 3V2RA 1D0YA 1K9AA 1DIPA 5HK3A 2MI6A 3OYEA 2D1XA 1VQ8A 2H8PD 1L4AD 1W2BO 1FMVA 1PP9E 2K7AA 2G3RA 3HRTA 3JCUH 4QT7A 1K73U 4JJNK 3G9RA 1FE6A 5APQA 2JT4A 3QSUA 2WSEJ 2LC4A 2I1JA 4BWNA 1JMMA 4M7AE 1AA0A 2PQWA 4IFFA 1LNQA 3VRYA 3E1IA 1GK4A 2L91A 4PJOD 1OMIA 3KHUA 3EGXA 4JYBA 1IGQA 5CO7A 3AE9C 5DJUB 3OS2A 2QSIA 1USEA 3HD7A 3IF4A 1IK7A 2W6AA 3L70D 3A0HE 2E3HA 4GIFA 2FFDC 1UE9A 1ACMB 1SQPG 1UB4A 4J5YA 1R5LA 2O9SA 2ZT9C 1T2KC 1GFCA 3M5AA 5KAFH 3VMAA 1FZFA 3LH5A 2D6FA 2O3JA 1WJSA 1KILA 1AWWA 5GTIH 1NLOC 3A8MB 1NTMG 3ZEHA 1EDIA 3CXHI 1M1KC 3CCRA 1RE4C 2K57A 2F5TX 3J80E 1VQ4T 3ASKA 2AXCA 4WCIA 2DA9A 2M0YA 2DL3A 1E79H 3H1JJ 2FB7A 3H32A 4ORZA 5AVQB 2BEZF 3M06A 1C0MA 1T3UA 2DJQA 1WHLA 2WSCJ 3OYIA 2HKNA 2PVGB 1ZXGA 5AW8B 5TJHA 2V7QJ 5AVTB 1NJIU 2YXRB 4R55A 1QVFP 3CCLA 4M75F 5IN1A 2QDYB 2Z5HA 1YI2A 3HE4A 1VQ7T 5LJ5g 3X26B 2WITA 3QJYA 3PP5A 4UC4A 4RESB 4C0ZA 1JB0E 2NUPA 3H1IG 3BY7A 3R6NA 1VQMQ 3C1LA 3EQ2A 2L3PA 3RMSA 1NOHA 2H3JA 1H88A 5KTBA 5ECAA 2MK5A 3VMXA 1UGPB 2CZ0B 1U1SA 1YIJP 2XZRA 1K9MC 1AVOA 3OMGA 4N0AA 2NZ2A 4C5EA 2C9NY 2K1AA 1MNDA 1WPYA 2HEQA 3II6A 4EMGA 3AEAC 4J6XA 2RF0A 2AEJA 3CMAT 4F7UF 1JRIA 4NPDA 3G6EA 5APTA 2ZYDA 3H1LD 3QWOC 1D7MA 2ZAEA 3M59A 5CKHA 3H1HD 2MJZA 1KQLA 2BCCG 3TDKA 3KXDA 2AXTE 1UJYA 3PGGA 4XFJA 1EDJA 1U06A 2XK0A 3WXMB 1Y9BA 2HDAA 4PV1B 4M77D 2EAYA 3TREA 2BZYA 1JCDA 4JLGA 1QCOA 3W68A 4K3AA 3OB9A 3H1KJ 4H44B 4DJGA 3JCMW 2EQKA 2OTJP 1WGSA 3B4SA 2KOGA 3GF5A 2M0BA 5KYWB 3FGAD 2M5AA 4M77E 3WUVA 1M1KR 3CX5I 1NO4A 1FMKA 2QA4A 1K73Q 4XQ3A 3VS7A 3L72E 4M78G 4QVZA 3L2RA 1NU1D 5IH2A 1YJ9Q 3O6QA 1PCXA 2KT8A 1S4XA 4KJMA 3EGDA 3A0BE 2GBQA 1SFCA 1N8RR 3NFQA 2C0WA 2HBPA 1D0XA 1YHQQ 3MP8A 5FWBA 4EMHA 2HLOA 3ZDMA 1URQB 2PGDA 2K9JB 4WWIA 3ABVC 3A8HB 2LNVA 3QZ5B 2F5KA 5AVYB 1OW6A 1VQOA 2RH0A 3AECC 4UB6E 3OA7A 3OYCA 1GU5A 2COWA 2ED0A 2DILA 3M4GA 3CCEQ 3G3ZA 4M7AF 4M7DA 4IFDK 2HL3A 1WHKA 3EFRA 4RTWA 1TH7A 1Y57A 3G71A 1BBZA 3KQGA 1IZNB 1UJ0A 3EH1A 3CCMQ 3CCSA 2OTLT 2Q5UA 2AIRB 3AE1C 1MNEA 1JXMA 4AMCA 1E6HA 4I7ZB 3SSUA 1PRMC 5KLVG 1FZCB 3NTKA 5GAMj 1K9MR 3A8LB 1RABB 1M1JA 4C8QC 2W27A 1E6GA 1WI7A 1N7LA 4C5HA 4YTPC 1VQ8Q 3BCCE 1OULA 2A06G 4PKCC 5GJWB 3D71A 2YUOA 1YJ9T 1N7SC 1J1DC 3BRTB 2Y0DA 3NGPA 1FOSE 2V1RA 2FY8A 2KSSA 5FU6B 1BI2A 1EZVE 2HR3A 2K4YA 5E79E 4J9GA 1VQNP 2ZT9D 1T2KD 1I8FA 5I11A 1NJIQ 4U3FD 2OJ2A 3C12A 3V7SA 3OYMA 3H9NA 3JB9J 5KLIB 2HPCA 2DMOA 5TISE 2KXDA 3JSCA 1ZBXA 3TK1A 3CC7A 1S72T 3HRSA 1VQKP 3VMZA 1H3ZA 2O88A 3CCMT 2CP6A 4C92G 1BGYE 2DL5A 1VQ9T 1X01A 2DYBA 4ESRA 3EGXB 2ZPIB 3OYJA 2D2CB 2L2PA 3K5BA 1OZ3A 2JKVA 1NTKK 5CJ4A 3FXDA 1KC8C 3BDUA 5GAMe 4O6JA 3AE6C 3TYYA 2H89C 4KH0B 4BI8B 4LD6A 3CCRQ 3I55P 3L36A 4HXJA 5KYNA 2LJ3A 1BB9A 3RL0C 4HB1A 1R5SA 4J8OA 2CDTA 2XV5A 3L73G 5GAMh 3AEDC 2W8ZA 1DJ7B 4RTVA 4J7FA 1RF0A 3CC4A 1LP1A 1VQKT 2ZVNB 1X2KA 2EYWA 2V8IA 5GAMf 3CCLQ 1P84H 2RQVA 1G2CA 1JBMA 3JB9F 4X34A 1YI2Q 4DA4A 4A4GA 3DB4A 2H8HA 4IUTA 5CCGD 2CH4A 4KRTA 1W1FA 1M8VA 1BCCG 2E76B 2GF7A 1AVZC 1X27A 3G1JA 3HE4B 3OYNA 3QXEB 1LPLA 2NUPB 5H2FE 2XU6A 3L71J 1RF1A 4L76A 5CKDA 3CCRT 2DRKA 1RHZB 3AEFC 5AW4B 3L35A 3RK3D 4OMPA 1KYOI 1LCKA 2HSEB 1NH4A 1MV3A 3QDRB 3BCCJ 5CCHA 2CSIA 1SQQK 5GTIE 2QG9B 3MEAA 2P67A 1PP9G 2DEQA 1Z9QA 3G6EQ 4PFPA 1KB9I 2WSCH 3P7KA 1H0TA 2LDMA 4WBAA 2LXBA 1NKZB 3U59A 2V7QH 1IREB 1B3QA 1L0LD 4FM4B 1RUWA 2W6JH 4PJJA 2KNBB 2QEXA 1ZSZC 2YUPA 1TOVA 4LDYA 2ZAEB 4Y99C 1HJDA 4IL6E 3JRZA 1C1AA 5IXFA 2MCNA 2HAXA 1PD1A 1X75C 1GTWA 1RAGB 3QWXX 3JCMX 1EZZB 2P0QA 4BB7A 2F2VA 3MCAB 3JCMe 2ZYAA 3M57A 5J3BA 4XE5B 2ZZDA 2I2LA 1KC8R 2VXFA 3SDZA 1PC0A 1BGYJ 2IBZD 3P8MC 1IFIA 1R8OB 2UWJE 3CC2A 2IIMA 3N4XA 3G4ST 2QA4Q 2RKLA 4PJOG 1WHMA 1IK9A 3RDVA 3F89A 4ZGJB 1YITP 2C0OA 4OGQB 2A36A 1V29B 2C0TA 2B8AA 3HTRA 3VS6A 3M0UA 3CD6A 4FU6A 4BY6B 3L70G 2LNHB 3RK2B 4J83A 3P8CE 3OAKA 2YRCA 3JCMf 1FOSF 1PSFA 4C7NB 2VXEA 3JCMJ 3IQLA 3B5ND 3EGDB 1OEBA 1WIEA 5CVIA 1U3OA 1BSNA 4N78E 2YDLA 2FPEA 1HJBA 3N5BB 1R77A 4X9CA 3MKDA 5FLXE 5DY9A 1X79B 2QRXA 4E7ZA 2DEUA 3HFOA 2KRSA 3HE5A 3H1ID 3PMIA 2AZVA 1S2EA 5HK0A 7AT1B 2LXCB 1QW1A 1NTZE 2A28A 2CT3A 2FZGB 4DCKA 3VJPA 2F1LA 3S4RA 2D9TA 3VV0A 1LJ2A 3RKWA 3G71Q 3A3YB 3CWBD 1G8XA 3CCSQ 1JY3O 2N1TA 3D6YA 3J7AF 1GL2C 4C8QE 5GAOq 2VVKA 3MUDA 3KZIE 1QVPA 2E70A 2M51A 3AE3C 4HCZA 5DJTB 2KLVA 1VIEA 2V26A 2VGMA 1SQVK 5AW9B 1UUEA 4H44C 1JJ2P 1VPCA 3L37A 2RK1A 1M1JB 1Y07A 1NLPC 2WQYC 1LTJC 3QZ9B 2ZCFB 2NRGA 3PE0A 1H89A 3V5BA 1NEGA 2RHIA 3RGUA 3CQTA 1AD5A 3WMM0 3D7SB 3L2UA 1VQOT 4BDYA 3VS5A 1RE3C 4OGEA 2KI7A 1YJNT 4M78A 2E12A 1OZ2A 2O01E 3M0TA 4RTXA 4E7SA 3OBWA 4Y28E 1Q81U 1K73C 1K0SA 3M9HA 2DNUA 3CC7Q 3TGUE 2A0FB 3G71T 3L75D 4RO0A 2DIGA 3JCMP 2FVUA 4H13C 3CCST 5IAYA 1KFMA 1YP5A 3C4SA 1SRMA 3AE4C 3META 4HT9A 4M7AC 2RQWA 1YJWP 2HPCB 1SQVE 3H1LG 1TG0A 1NYFA 2OI3A 1PPJD 3A8GB 2RH2A 2KY9A 1VQ7A 4J9HA 1Y0MA 5AVRB 4EMKB 3QUIA 2QJKB 2F69A 1AEYA 4FYYB 4YXDC 3HRNA 4A53A 3RKYA 4WY4C 4KULA 4M77G 1SQQJ 2P4TA 3RBZA 5M9OA 3I56T 4E2FB 3L72G 4ZKPA 3QKJA 1NGMB 1SS1A 4EDFA 1KQSP 2LTOA 3CC4Q 1I5LA 2RA2A 2RQUA 1LT9B 2FRYA 3JB9H 2AXTH 5IHNA 1SQBK 3CCVP 4JJDA 1KTMA 1BCMA 3CXCA 1K8AU 1NU1G 5KLVD 1IC2A 4JPZB 1SSHA 1LP1B 3H0IA 3V4QA 5I21A 2KYMA 2FHDA 1KSWA 1AWXA 2WPRA 4X9DA 3AHUA 1UG1A 4JQ0D 2QGGA 3UATA 2E5YA 1G2BA 2JEEA 3OS0A 1WXTA 1NJIC 3RK3B 4JF7A 4L6V5 1QVFS 5CBNA 2XG8D 1CSKA 3GF3A 1U7MA 5KJ7D 1YIJA 3M0AA 3OYFA 2D2CC 4AYCA 4C92A 3HD7C 3UA7A 3BCCG 4D8DA 1IO6A 2L5GB 1NBEB 3A0BH 4DT0A 1RF1B 2AHJB 3CPWS 1KQ2A 2KT1A 3CMEQ 4M75D 2QJYB 3TSWA 5GANe 1SQBE 3FIFA 3CCUP 1XTGB 4PJ0H 3CC4T 1P84D 2YO3A 1G3TA 1IFDA 2IPPA 4R4LA 1JUNA 3L2VA 1K73R 1L0NE 2D0QB 4FT4A 1QP2A 5IHIA 2CZ1B 1J1EB 2YRDA 3WVEB 1KILC 3D6ZA 4D6TE 1G83A 2C9LY 3TQ7P 3C8VA 1H0TB 3OW2A 3UWNA 3GHGB 1PZQA 4UB6H 1NG2A 2WWWA 4B86A 2A7YA 1EC5A 2O01J 1RI9A 4Y28J 2RN8A 3ER0A 3TGUJ 1JXOA 1MMNA 5APUA 1HXDA 2CGHA 2L0AA 1TTHB 3EWKA 3M0SA 1GBRA 2JDIH 4KGXB 4JS4A 1RACB 4OGCA 5GANf 3OA6A 1VIFA 1QVGS 1SQVJ 4U3FG 4C8QF 2Y0CA 5KYYA 1OX8A 1QL1A 3H1JD 1JY2N 3BE3A 1G1JA 4PK4A 1JY3P 5AW2B 5APWA 2YT6A 3VUZA 3CCUT 3CD6Q 4N4GA 3VKIA 4C0FA 1OQKA 2CREA 3B5NB 5EFWB 1GL2D 2XMFA 2K9JA 2QVAA 3KPEA 2GM4A 5E79H 4RKUE 4GLKA 2OYHC 2QEXT 1Q81Q 2WPQA 4N0AC 2WSFE 1WLPB 1IJDB 2KK4A 2IVWA 2HFED 1FYNA 2JZ2A 1X8YA 5AVUB 1B34A 5TISH 3Q1JA 1UIIA 2FRWA 2EWNA 3BRVB 4DBQA 2K79A 4OMFB 5D7UA 3QPHA 3N7NA 2BE7D 2DL4A 1NJIR 3CC2T 3VP8A 1H92A 2DTHA 1UIXA 1W2BS 1LTTC 1FBMA 4ZN3A 1OVVA 4B9XA 2N1TB 2JNGA 1DD4A 3Q5RA 2YMYA 3PRJA 1RY3A 3LLRA 1SHGA 2J6FA 1OVUA 3EG2A 4H13D 4OVNF 4TVRA 2NUTB 3NXSA 4LGDE 3TF5A 2K3BA 2R58A 4M7AD 1HF9A 3GNGA 5FU7C 3M58A 1G3SA 3GPLA 1XQHA 1KMIZ 3PT9A 1R0CB 3HFNA 3QIIA 1VQ4Q 4PJOA 3WVDB 1BDDA 2L3QA 1SQBJ 1EXIA 2COZA 1I4K1 1K8AQ 1IB8A 1BU1A 3H1KD 3GOXA 3RK2C 3OYLA 1L0NJ 4JJCA 1KHIA 4WY4D 3TVTA 3RERA 4D6TJ 2KI7B 3HUSB 1SFCC 4M78B 1ZOYC 4I6MC 1VQKA 1UGSB 3CL3D 2FYKA 2PZ1A 1AQTA 1IFNA 3H1KE 2EGAA 1TU0B 1VQ7Q 1RH5B 1L0LG 5C39A 4KGVB 2B88A 2ZXEB 1D1AA 4N4IA 2C0XA 5H2FH 2L3RA 4GOEA 2E65A 1X6OA 1QKXA 1RAAB 4M7DC 2YKQA 1TUCA 2SEMA 4CPGA 4E7KA 4HH2A 2JS2A 5KKZB 4H0LC 3QHSA 2E6ZA 1X9VA 1HD3A 3I55A 4M4ZA 3FB9A 3JSVC 2EYZA 1SP4A 2M0OA 2CSQA 1QQJA 4UB8E 1GCQA 2IBZG 5I22A 2XNDH 1M1JC 2HL5C 1FWZA 4BI3A 4NOYA 5GAN6 3CMAQ 3Q1MA 4A4EA 4RKUJ 1SPKA 4DOVA 1OW8A 4EOTA 5D6YA 1AT1B 3A7OA 2P84A 1M8OB 2JJLA 2IBZI 2WSFJ 4IL6H 3OS5A 3SWFA 2R57A 1OOTA 1OFCX 4LN2A 1NTZG 1T3JA 5GAMg 1VF5C 5J26A 1FJPA 3URGA 2GCXA 2QK0A 4OWFA 2E42A 4J9IA 1T8ZA 3JCMd 1GMJA 1N6AA 5A0DA 2JXBA 3H0FA 4C0DB 2OAWA 1QKWA 4DOWA 4C5IA 2W0ZA 2GUVA 3A5TA 1AZGB 4OP0A 5CIUA 3CPWP 1YIJQ 1WA7A 4YXWH 3MEWA 3CWBG 3R2PA 5AW0B 1RAIB 2YIUC 3G4SA 3PTAA 3JB9D 4K11A 4GT1A 4RMOA 1BE3E 4KUDK 4OMLA 4C92B 2E75C 2W90A 1KILE 1RLPC 2WVRA 2D8HA 5I2SA 4L5GA 1BYMA 4R4MA 2FYUK 1GFDA 3RMQA 4OB0B 4BD3A 3SEMA 3JC22 1ZP0C 1FU1A 4AFUC 1VQMP 4GY5A 8ATCB 3LW5E 3V4WA 1QVGP 2AT1B 1NHLA 1HJ0A 2JW4A 3HHTB 5APVA 2V8KA 2E74B 2JM9A 1Q7YC 3FRNA 2AZSA 2DD5A 3KZIH 1RF0C 2RN0A 1NVOA 1ZX6A 2HYNA 1YYCA 5GAN8 3L72D 1SQXK 2K2MA 2KYVA 6AT1B 4XTYA 1YIJT 2OTLQ 2WPVB 3MTUE 3RESA 1M2OA 4E7HA 5BVZA 1CW5A 3L75G 2RJDA 1RLQC 2MYSA 4IOIH 4XU2A 5LJ3d 4E7LA 4O5VA 5KYYB 1YITA 2FYUE 1FDIA 3C95A 3HRUA 1FX7A 4O9BA 3L74E 3MP1A 2YWWA 4JRKA 1Q82C 4C7NA 2K9YA 4F17A 5APSA 1PPJG 1HK9A 3FX0A 1B07A 2RHZA 1WHHA 3I9QA 1ARKA 1HGZA 1DH3A 4E7IA 4RG8A 3I5RA 4PJ0E 4EIKA 1RF1C 3HPWA 1WZOA 2O01H 3AE7C 3SFEC 4PFZA 4OMQA 1QP3A 5AT1B 3M9BA 1FZAA 1AHJB 5D6XA 1W2BP 1MMAA 2QJPC 1T0JA 4ASWA 1SQXE 4GLMA 3VOPA 4QQDA 2QAZA 1YJNA 1G5VA 1GD2E 1UHFA 1B34B 3UF4A 2Z4EA 3UT1A 1JM0A 2OTJT 1S72Q 1I5OB 1WYXA 3BCCD 2YXYA 4TT3H 3H41A 3ZL7C 4MMKA 5J39A 4W7YA 3S9OA 5GMKi 1Q86U 4OMMA 1VQ9Q 5CKBA 2MPXC 3UA6A 4GDOA 1YHQP 1VQ6P 2NPSC 3L42A 3L71E 1EZVD 5APYA 2JJ9A 1XJWB 1L4AB 1U7JA 4W7ZA 3ULRB 2VRSA 2EBPA 2E64A 2G3AA 1KJWA 1GXIE 3CX5H 4Z89A 4XTWA 3VS4A 1HYOA 4N6JA 3CI9A 2E1HA 1LWUC 1MUZA 3CCEP 1BE3J 3I56A 2RK2A 1BIAA 4RUGA 5GMKl 1JJ2S 1RQUA 1KK7A 4EYYQ 1L0NG 1BGYD 2R5MA 4PJOB 1FZBA 2ESWA 1QX8A 1Y71A 4JZ3A 4OF1A 2DX1A 4WTOB 4H0LD 2EJ9A 1Q7YR 4RCCA 2R5DA 1VQKQ 1YQ3C 2EIFA 2J6KA 4M75G 1WMKA 3LW5J 2KDSA 4BE2A 2MAMA 4X1VA 1VQ8P 5GAN2 4GBQA 4D8KA 1YJWA 2Q3EA 1N9SA 2K9GA 3C94A 3TU4K 4M7DE 2HG5D 4XTUA 4EMKA 1IXDA 1Q81C 5B5EE 1ZV8A 2JMCA 2SRCA 4QMAA 4Z88A 4CC3A 1OIPA 2FYNB 2CYZB 5CBOA 1M90U 3KYQA 4IKFA 4DEXA 3E7KA 3GBQA 1P84I 1X6GA 2PUKB 3L2ZA 1T0HA 2ZVOB 2LCSA 1PL5A 3I55Q 1Q82R 5C0MA 3EH2A 4XA4A 3A1PA 1NYGA 2YLBA 2H7HA 3LWHA 2DK3A 3MUDC 2XD0A 2FYUJ 1GBQA 3M56A 1VQ5P 2I1KA 3L74J 4PD4E 1EXJA 4KT0E 5GANd 1RI0A 2KSEA 1LT9A 1RAEB 4LNPA 3M0DA 1VQNT 4F7UG 1TWBA 3H1JG 3EG9B 1U5SA 1S9KD 2XICA 1ZLLA 4DZOA 5CCGA 2KP8A 3VTPC 1M1KU 3M0PA 1UEBA 2ZPFB 3CCVA 3WUUA 3SFMA 1IFPA 4ZGDB 1LTSC 5CCAA 5CK9A 1M57D 3PH0A 4ZNXA 1GW4A 2NLUA 2W6BA 1KQSS 1N8RU 1NTKE 1SQXJ 1S9KE 1VQPP 2JVVA 2P0PA 1SLQA 2KZIA 2L3SA 1K8AC 3A2AA 1ZRTE 3TNUA 4C7RA 4PL6A 2KXPB 4RTZA 2I8DA 2PAJA 3I55T 2F2XA 4Z8AA 5GAN5 3Q3DA 2LJ0A 4BE0A 3G4SQ 1VQ5T 1K76A 2DKGA 3PMTA 2EKOA 3SD4A 4KBMB 2YMKA 2KGTA 1HUCA 3P32A 3CCLP 2KR3A 3P8HA 3PVLA 1BKBA 2M1HA 2WSSH 1YI2P 2ITAA 2M02A 3BW1A 4CC4B 3CCUA 2XU8A 2W83C 2L8DA 4FL6A 2IYOA 2DXBA 2RNAA 3VS0A 2E10A 2WSFH 3SWKA 1WXBA 3GHGA 2RD1A 1U57A 2M9UA 3E1SA 4M77B 4M7AG 1VL2A 2C0IA 2HQXA 1PKTA 1SQPK 2WTYA 1ZLMA 4OB1B 2ENMA 2X4XA 4ZGEB 5A2QE 1Q81R 2KRNA 2KAFA 2H3EB 1Q86Q 1YWPA 3LGFA 1G3YA 4ELYC 4AUWA 2O9VA 3NFCA 1BDCA 3H1KG 1WHGA 1BSHA 2M16A 1NTMK 2Y9ZA 1RAFB 5FRMA 1KV4A 1W6XA 1VA7A 3G6EP 5GAOp 3KFVA 1GK6A 3P8CD 5LJ3j 1SQQE 2J59M 2Q6QA 3SFDC 2D0NA 3X20B 3BVHA 4IUQA 3B5NA 2CKKA 3JCMh 2J7IA 4N78D 2KS1A 1M2VA 1OI1A 1N73B 1GU4A 3FWLA 2Q7CA 3S3MA 3PLNA 4V2SA 4FW1A 3EG1A 1YTZI 1KYOH 1IFJA 2FZCB 4IFMA 3FJPA 1NTZD 2GQIA 3IN6A 3OMCA 2JWDA 1OU9A 4AG1C 5GAN3 4KT0J 1EQ7A 1UGVA 3CXHE 4DBRA 9ATCB 1SQPE 1CKBA 4PJLA 5KYXA 2QG4A 4JBZA 2NPSD 2COYA 5GMKj 1JTHB 2LCLA 4C8QD 1VQOQ 4MZMA 2QE7H 1TS9A 2FBWC 1YJNQ 3B71A 1J3TA 2BASA 1PG5B 5KH6A 2QA4P 4C46A 2ABLA 1N7SD 1NTME 1X22A 1OX3A 5A0GA 1N2DC 1K8AR 3M55A 2H43A 1FDOA 2JMAA 1NTKJ 2PTKA 1M90Q 3MIWA 3GMAA 2FXMA 5GAOm 4FYXB 4PV1C 1SEMA 4M7DF 1YITT 1J2JB 3HP9A 3PIPA 2NUTA 2L89A 2DVJA 2RHYA 2JWAA 2AKLA 5LJ3e 1CI6A 2LX9A 4VUBA 1S3JA 4IL6X 1ABOA 1M3BA 1UECA 1KG1A 1LJOA 4UB8H 1PGOA 4KGZB 1LT1A 2FFDB 2Y90A 3EHQA 1BK2A 5KYUA 1MZ9A 5AW7B 2BZ8A 4IUVA 3I56Q 1WHJA 3TGUD 2ZT9B 4CC7A 4J6WA 5LJ3h 3PNWC 3UDCA 2IDBA 2QGFB 3RIRA 5CHXA 1LNXA 1SQVD 3HUSA 4FCYA 5GMKe 4NS5A 1N8RQ 2P1JA 2QQRA 3EFSA 5K5GB 2KRMA 3JB9G 3AEGC 2YHTA 2KUBA 2EGCA 4LD9K 1URQC 3AE2C 5LJ3f 1R0BG 1TUGB 1YJWQ 3EAEA 1QMCA 2NYSA 1KZUB 3RL0D 2J5UA 3C9IA 4GODA 1CKAA 1I81A 2WACA 3MJXA 4NL2A 1GDTA 3VRZA 5IT9E 3JB9I 5GMKh 2P2UA 2YNYA 2KZJA 1G3WA 1WJQA 5KCHA 1H3HA 2DZCA 1N27A 5AW6B 2BCCE 1Q95G 3H8ZA 1Y96B 3NPFA 2PU9B 2PP6A 4J6YA 1SSFA 3V8KA 4I7ZC 1LTAC 1FZCC 4DEYA 1KORA 3CC7P 2QYZA 3FEOA 3O8ZA 3MHXA 4HA8A 3ZFJA 3L1AA 2CP2A 2X4YA 4JUVA 3CX5E 2CP5A 5GANj 2X3XD 1FXXA 1YQ4C 1WJRA 1AV1A 1GL5A 1M56D 2LVMA 1VQLP 2ECZA 1RL2A 1Y8AA 5FU6C 1SQPJ 3LW5H 4AQRD 3CCJP 1WXUA 3OYAA 1YJWT 4LLHA 5KLVK 4M78E 2A08A 2EJGA 4DBHA 3BDLA 1QVFA 2K5FA 4PJOC 2J58A 1N86A 2FYZA 1NTMJ 5KJ7A 1ZSZA 1S1NA 3VP9A 3PFSA 5GAN4 5KLIC 2K6DA 2XKMA 2DRMA 2O31A 2ZFCA 3CPWA 4M75A 1SQBD 3FC3A 3BASA 3EG3A 2RHUA 1X43A 4D6WA 4FT2A 3L71G 1A0NB 3TNUB 2CPBA 1OW7A 1WT6A 1YNZA 1L0ND 2ZPEB 2RQRA 4GOFA 2JS0A 1H641 4D6TD 3CCUQ 3OYGA 5M1BA 1UGRB 2DXCA 2EW3A 2O1KA 4A7PA 2LQ8A 1S5LE 3TSIA 2R5AA 2XDPA 1KFZA 5AW3B 5CQYA 3CCVT 1KQFB 2HCKA 1EZVG 2E6NA 4ZMDA 1M3CA 2DXTA 2VV5A 1DEEG 2N9YB 2QEXQ 4PLIA 2QI2A 2ROLA 2VASA 4L74A 2A06E 3B8EB 1LVKA 1Z9ZA 1QVGA 3RR6A 1RAHB 2PNIA 5GANh 1WDXA 1LOJA 1JOCA 4F7UA 1EZVI 1D09B 2M3EA 4BXLA 3EFOB 3AT1B 2WT7A 3LGLA 3ITKA 1E7OA 4OMNA 1MV0B 1SF9A 3PHLA 1BGYG 4FW2A 3CC2Q 4M7DG 3CMEP 1KD1U 1WRGA 1VYUA 2DM1A 2JTEA 4J9EA 2OTJA 4QQ6A 4J9DA 1GL2A 3RUXA 3THKA 2DYIA 2IG0A 2IPOB 2E76C 1PKSA 1SHFA 1WQ7A 2DTOA 2BCCJ 3CCQP 1ZHIA 2CZ7B 1CZQA 4B6MA 1CSBA 5KAIE 4II1A 3E9FA 2XKOC 4FSSA 4C92E 3LH0A 3INZA 2VKNA 3V8LA 1D1CA 3SWNA 2KS1B 1M2VB 2X51A 3V2QA 2QQAA 1ZUKA 3RBBB 1VYVA 3AEEC 2YKPA 4EI2A 4JRQA 1D3BA 2OYIA 1UTIA 5CJ0A 1YCYA 1PGQA 2D8JA 1N7SB 1J1DB 3I5CA 3L4FA 2KYBA 1W2BA 3V7RA 4H44D 2NUZA 5KYXB 1YCSB 2DL7A 2FPFA 4QKUA 2QDLA 2QXFA 3EFGA 2R3CA 1D1BA 1KHCA 1M8MA 4LDXA 1NE8A 4OB3B 1S5LX 3CD6P 4K35A 3OW2O 3OQ5A 1NTKG 3UIAA 3L73E 5B5EH 2FPDA 2HSPA 2JUFA 3E9GA 1PRLC 4PJNA 4KHXA 5B66E 5GMKm 3T97A 1JNMA 4M7AA 1I07A 1L4AA 1P92A 2YUNA 2JR8A 3OYYA 1VQ6A 4RTUA 2MOXA 1GW3A 2Y9YA 3LX7A 1NZ9A 1I0CA 3OJAB 2O4XB 3GNFB 3QG1A 1URQD 1JQQA 3M53A 3E1RA 1Q86C 3MEVA 4PD4H 4EIJA 2EYYA 2VC8A 1CI6B 3PJSK 4AFQC 4A4HA 4WY4A 3QDFA 2A45H 1K05A 3A98A 1BCCE 1LTGC 1KYOE 3PTZA 4OGQC 2VB6A 5KYUB 4A63B 2IX7C 5GAOl 3NTIA 1TUDA 2YSQA 4BY6C 1VQNA 2HQEA 4Z02A 5D6WA 3G7ZA 4C5GA 4L73A 3OYBA 2FG0A 1T3SA 1KB9E 1MHNA 2RI3A 1ABQA 3NTNA 5LJ5d 1JY3N 1NM7A 3VN0A 1ZR4A 2R3SA 3VMYA 4M78F 2W10A 1UGQB 4FYWB 1MFTA 1PGJA 2J06A 2KB7P 2G6FX 3WU2E 3V6IA 1ZN5A 1GRIA 2HQHA 1D0ZA 1OPLA 1RQVA 4W80A 2CUDA 3FJ5A 1VQ4P 1AJYA 2G8YA 1MMDA 4FIBA 1MKMA 4HKEA 4C0GA 3M4YA 4MDWA 1SQQG 4ANJA 3MO8A 3BFMA 1ZUYA 2YLCA 5HCKA 4DQ2A 5CQXA 3EG9A 1VQ5A 1M90C 2MF2A 4BE1A 2LQWA 3M0RA 1SRLA 3L2QA 2X3WD 3Q5SA 1V76A 2Y4XA 1G1IA 2KROA 2OTKE 1VQ7P 2RI2A 4PJOE 2HBWA 2JTMA 2O01N 2D2CD 3VUBA 1NPRA 3HD7D 1W4SA 2DW3A 2DF6A 1QLYA 2Q1KA 3L70E 3DKMA 1VQPA 2DERA 3VU3C 1KD1Q 3OSVA 2B89A 3S3NA 3X28B 2OARA 1ZW0A 1OWAA 3ME9A 4TLFA 1VYTA 2E41A 2LJ1A 3EHRA 3GP8A 1PFIA 2KXCA 4C8QG 4RCBA 1ZSZB 1BE3D 2WMMA 3L73J 4MZTA 3M54A 4Y99B 1USDA 1QEXA 2VWFA 5CKFA 1KILD 4I1LA 1N8RC 1N5ZA 1Q86R
chains in the Genus database with same CATH topology
1O9SA 1PSEA 2KVQG 4N3YB 4M75B 3H6ZA 1HBWA 3BATA 4EMKC 3PIOA 4HCBA 4C92F 2V8JA 3MEUA 4HT8A 4M77A 5DLOA 5GAOr 4B9WA 4ELZC 4BACA 2P0KA 2OYHA 3O8VA 3OYDA 1MFZA 1LT9C 2DXUA 3M0DC 5APXA 3VYHB 2MWOA 5CCGC 4F7UB 4PNOA 4IUUA 4L59A 5BU8B 5KE2A 2CPSA 2WT7B 3CBPA 2L5QA 2Q3IA 1N73A 1GL2B 1MUUA 4MMLA 3RK3C 5AVZB 4YTLA 1NU1K 3DB3A 3JAME 1JTHA 1M9SA 1VQMT 3SWNB 2Z5IA 4JRIA 2POHA 3GLXA 3JCMg 4OVAA 1LTJB 4XAXB 1D3BB 2OYIB 5CCHC 2EJFA 3QYHB 2GFUA 1U8RA 1BIBA 3CEYA 1J1EC 3HTKB 1DX7A 1NWQA 4XTVA 3GHGC 1IO4A 2CZ6B 2EFIA 1LTBC 5CKEA 3LIEA 3RK2D 2MMPA 2LKMA 1HVVA 2QM8A 4M7AB 3CLQA 4ZTFA 2FFDA 1JJ2A 1Z56A 1SFCD 2XNXA 5BU5A 2XDJA 4XU0A 1NAFA 3M9QA 4FSXA 5KCOA 2N9BA 2X35A 4WY4B 4XU3A 1RE4A 3B5NC 4CRIA 1NKNA 4M7DD 3R6OA 1A02J 2DD4A 5LJ5j 3KXTA 4PJOF 3QO3A 3P8DA 1H8AA 5AVSB 3ZBDA 5LJ3g 3V2NA 2ZPHB 1YHQT 1VQ6T 4RG2A 1Y96A 2C06A 5L8RE 1XTCC 5AW1B 2DTIA 4KUIA 2K5IA 3JCMc 3V2PA 3CBMA 2VUBA 1M4ZA 2N1TC 3CCET 1YTZT 4JS5A 1FAVA 1OYXA 2HD0A 4Q5WA 5KE3A 1KQSA 2ZGWA 2CS7A 1VQLA 3HD7B 3LWIA 3GIBA 3CCJA 1A02F 1VQ8T 2FKWB 3MP6A 2YKOA 3OSSC 2A3LA 5LJ5e 4E7JA 1JCCA 2IFMA 3KDPB 2EQMA 1E5WA 2WSEH 1IFMA 1KILB 1QL2A 3HUSC 4M78C 3V7CA 1W2EA 4ZTJA 5CR2A 2E43A 2DZ9A 2GQVA 5LJ5h 4QVCA 4Y91A 3T9NA 3A8OB 1JO5A 3H32B 1FJKA 4A4KA 4XTXA 5LJ5f 3TCJA 4IUPA 2PVDB 3MD0A 3DLLA 1K9MU 2EYQA 3VYIA 3OYKA 2HODA 2RM4A 2BUDA 4A4FA 4GKGA 2X4JA 1L0LK 2E5QA 4WF2A 1KFNA 1VQPT 1JY2O 3UPUA 2XHCA 3DLMA 4M77F 4QVDA 2OYHB 4BDZA 5AYFA 2QQ9A 3A5ZB 4P5NA 3NTHA 3S3OA 3CMEA 3MGNA 4ZN1A 4HYTB 2RI5A 5GANg 2LQKA 1Q7YU 1LTIC 5CCHD 2K5LA 3CCLT 3CCQA 5KJ7C 2FL7A 1YI2T 4C0DC 2NPSA 4MDXA 4C8QA 5AVWB 1GZLA 1KD1C 4LDUA 3SWYA 4M75C 4XU1A 4A54A 1N7SA 1NTZK 3IFMA 3TEEA 1LWUA 3NMDA 3U1AA 2MWPA 1Q82U 4C92C 3CBOA 5FU7B 3OYHA 3SB2A 1YBYA 2R5BA 1VDFA 1MV8A 3M91A 4XK8E 1M1GA 4HCCA 1EIFA 1U1TA 3G6ET 2DPPB 2RJFA 4MZPA 1WNLA 2BKDN 2O4XA 1SFCB 2IFNA 2DAQA 2P7JA 2QM7A 2XI9A 4J7IA 2M3BA 2Y4YA 1WQWA 3LIDA 2QQSA 2K2VA 4DOJA 3F70A 2KSJA 2LT1A 4ATOA 3OY9A 1AFOA 4M7DB 3L2WA 3HSBA 4EDUA 2XDDA 2QA4T 3JCMQ 2EQJA 2N1TD 3SWNC 5CAIA 1XOVA 4JRPA 2OYIC 2QTXA 3V8JA 3HL8A 2RB6A 1M5Q1 2PVOB 3IR9A 1VQ4A 4PLLA 2DIQA 2RJCA 3U1CA 3FDRA 1KC8U 3E19A 1L4AC 3VYGA 4M78D 2O1JA 2DVEA 2DJZA 2WZ7A 4E47A 4LC1A 1AQ5A 5FRNA 1BI3A 1FDMA 4CI0C 1DEBA 1HWTC 3X24B 1O75A 1NPPA 4LDVA 3CPFA 3S6WA 1SVFA 1JY2P 3H6PA 4BUGA 1IZ6A 3OBYA 3QBYA 1HH0A 1KQ1A 2RJEA 3OS1A 3P8BB 4ME7A 3CMAA 4QW2A 3CC7T 2GUSA 2X4WA 4ZKUA 1Y7XA 1L0NK 3JCMV 1FZEA 4OB2B 2YRVA 4JLIA 1G2CB 1VQLT 4OH8B 3KBGA 1MGQA 3CXCS 3CCJT 2PUOB 2LRQA 5I2MA 4BI4A 2KQWA 2JTFA 1OXZA 2JN0A 1M1FA 4JYCA 1VQMA 1ZQ1A 4R56A 2HODB 2BIVA 3X25B 3KUFA 2QQBA 2EQUA 3JCMb 4M3LA 2K3YA 2RO0A 2ZPGB 2WSEE 1ZR2A 2WPSA 4C92D 2K3XA 1HGVA 4XTZA 2YO2A 4JDSA 2OAUA 4EPCA 4M75E 5HY6A 2Q9IA 5CMZA 2VYTA 2NPSB 2LT4A 4C8QB 3OW2S 2RHXA 3QYGB 1VUBA 1LTJA 2M8RA 3J81E 2A45G 4IURA 1BI0A 5GAN7 1BI1A 5AVVB 2OTLA 2KMTA 3HTKA 1LWUB 1XNIA 3QJ6A 1RE3A 2LCCA 1XTDA 1M7LA 2A45I 2DO3A 5GAOn 3CMET 4LDWA 4M77C 1URQA 4F7UE 4NL3A 4N4HA 5FROA 1YJ9A 5AVXB 2R32A 2VGNA 2JOYA 5EG2A 3CCQT 2WSCE 1YHQA 3FLGA 1HTLC 3LYIA 2GFAA 5A0LA 5HKCA 2HNIA 5AW5B 1N9RA 2ZPBB 5LL6S 3RKXA 5C6SA 3HE5B 5DLQE 5DM7R 2XDBA 1FZGA 4WB4A 3CCEA 4I2LC 4QQGA 1FZCA 1S72A 1N73C 3HKSA 2XIDA 3CCMA 1VQ9A 5GAMd 1LGHB 3CD6T 3RL0B 3V2RA 5HK3A 2MI6A 3OYEA 1VQ8A 2H8PD 1L4AD 3HRTA 2G3RA 1K73U 4JJNK 5APQA 3QSUA 2LC4A 2I1JA 1JMMA 4M7AE 2PQWA 4IFFA 3E1IA 1GK4A 4PJOD 4JYBA 5CO7A 3OS2A 3HD7A 2W6AA 4GIFA 2FFDC 1UB4A 4J5YA 1T2KC 3M5AA 1FZFA 2D6FA 1WJSA 1KILA 3A8MB 3ZEHA 1M1KC 3CCRA 1RE4C 2K57A 2F5TX 3J80E 1VQ4T 3ASKA 2FB7A 3H32A 5AVQB 3M06A 1T3UA 3OYIA 2PVGB 5AW8B 5AVTB 1NJIU 4R55A 3CCLA 4M75F 5IN1A 2QDYB 2Z5HA 1YI2A 3HE4A 1VQ7T 5LJ5g 3X26B 2WITA 3QJYA 3PP5A 4UC4A 4RESB 4C0ZA 1JB0E 3BY7A 3EQ2A 3RMSA 1NOHA 2H3JA 1H88A 5KTBA 3VMXA 1UGPB 2CZ0B 1U1SA 2XZRA 1K9MC 3OMGA 4N0AA 4C5EA 2C9NY 1WPYA 3II6A 4EMGA 4J6XA 3CMAT 4F7UF 1JRIA 3G6EA 5APTA 3M59A 5CKHA 2MJZA 1KQLA 3PGGA 2XK0A 3WXMB 4M77D 2EAYA 3TREA 1JCDA 4JLGA 3OB9A 3JCMW 2EQKA 1WGSA 2KOGA 3GF5A 4M77E 1NO4A 2QA4A 4XQ3A 4M78G 4QVZA 3L2RA 1SFCA 3NFQA 2C0WA 2HBPA 3MP8A 4EMHA 2HLOA 1URQB 3A8HB 2LNVA 3QZ5B 2F5KA 5AVYB 1VQOA 3OA7A 3OYCA 1GU5A 4M7AF 3M4GA 3G3ZA 4M7DA 4IFDK 3EFRA 1TH7A 3G71A 3KQGA 3CCSA 2OTLT 2Q5UA 5GAMj 1FZCB 3NTKA 3A8LB 1M1JA 4C8QC 2W27A 1N7LA 4C5HA 4PKCC 1YJ9T 1N7SC 1J1DC 3BRTB 1FOSE 2KSSA 5FU6B 1BI2A 2K4YA 1T2KD 1I8FA 3C12A 3V7SA 3OYMA 3JB9J 2HPCA 3JSCA 1ZBXA 3TK1A 3CC7A 1S72T 3HRSA 3VMZA 1H3ZA 3CCMT 4C92G 1VQ9T 1X01A 2ZPIB 3OYJA 1OZ3A 1NTKK 5CJ4A 1KC8C 3BDUA 5GAMe 4O6JA 3TYYA 4BI8B 4LD6A 3L36A 3RL0C 4J8OA 2XV5A 5GAMh 1DJ7B 4J7FA 1RF0A 3CC4A 1VQKT 2V8IA 5GAMf 1G2CA 1JBMA 3JB9F 4X34A 4DA4A 4A4GA 3DB4A 4IUTA 5CCGD 1M8VA 2GF7A 3HE4B 3OYNA 3QXEB 2XU6A 3CCRT 1RF1A 5CKDA 5AW4B 3RK3D 3L35A 1NH4A 3QDRB 5CCHA 1SQQK 3MEAA 2P67A 2DEQA 2WSCH 3P7KA 2LDMA 4WBAA 3U59A 1NKZB 1IREB 4FM4B 2QEXA 4LDYA 4Y99C 3JRZA 2HAXA 1X75C 1GTWA 3JCMX 2P0QA 4BB7A 3MCAB 3JCMe 3M57A 5J3BA 4XE5B 2ZZDA 2I2LA 2VXFA 3SDZA 3P8MC 1IFIA 1R8OB 3CC2A 3N4XA 3G4ST 4PJOG 1IK9A 4ZGJB 1V29B 2B8AA 3CD6A 4FU6A 4BY6B 3RK2B 4J83A 3P8CE 3OAKA 3JCMf 1FOSF 1PSFA 4C7NB 2VXEA 3JCMJ 3B5ND 5CVIA 4X9CA 4N78E 5FLXE 1HJBA 3N5BB 5DY9A 1X79B 3HFOA 3HE5A 3PMIA 5HK0A 1QW1A 3VJPA 2D9TA 3VV0A 3RKWA 3A3YB 1JY3O 2N1TA 3J7AF 1GL2C 4C8QE 5GAOq 3MUDA 1QVPA 2E70A 4HCZA 2KLVA 1VIEA 2VGMA 1SQVK 5AW9B 1VPCA 3L37A 2RK1A 1M1JB 1Y07A 1LTJC 3QZ9B 2ZCFB 1H89A 3V5BA 2RHIA 3WMM0 3L2UA 1VQOT 4BDYA 1RE3C 4OGEA 1YJNT 4M78A 2E12A 1OZ2A 2O01E 3OBWA 4Y28E 1Q81U 1K73C 3M9HA 3G71T 2DIGA 3JCMP 2FVUA 3CCST 5IAYA 1KFMA 3C4SA 3META 4HT9A 4M7AC 2HPCB 3A8GB 2RH2A 2KY9A 1VQ7A 5AVRB 4EMKB 3QUIA 2F69A 3HRNA 4A53A 3RKYA 4WY4C 4KULA 4M77G 5M9OA 2P4TA 3I56T 4ZKPA 3QKJA 2LTOA 1I5LA 2RA2A 1LT9B 3JB9H 1SQBK 3CXCA 1K8AU 1IC2A 3V4QA 5I21A 2FHDA 2WPRA 4X9DA 3AHUA 2JEEA 3OS0A 1NJIC 3RK3B 4JF7A 4L6V5 1QVFS 2XG8D 5KJ7D 1YIJA 3M0AA 3OYFA 4AYCA 4C92A 3HD7C 2L5GB 2AHJB 1RF1B 1KQ2A 3CPWS 4M75D 5GANe 3FIFA 1XTGB 3CC4T 2YO3A 1G3TA 1IFDA 2IPPA 1JUNA 3L2VA 4FT4A 2D0QB 1QP2A 2CZ1B 1J1EB 3WVEB 1KILC 2C9LY 3OW2A 3UWNA 3GHGB 2WWWA 4B86A 2A7YA 3ER0A 5APUA 1HXDA 2CGHA 4JS4A 4OGCA 5GANf 3OA6A 1VIFA 1QVGS 4C8QF 1QL1A 1JY2N 1G1JA 1JY3P 5AW2B 5APWA 3VUZA 3CCUT 4N4GA 3VKIA 4C0FA 3B5NB 1GL2D 3KPEA 2GM4A 4RKUE 4GLKA 2OYHC 2QEXT 2WPQA 4N0AC 2WSFE 1IJDB 2KK4A 2IVWA 2HFED 2JZ2A 1X8YA 5AVUB 1B34A 3Q1JA 2EWNA 3BRVB 4OMFB 3QPHA 3N7NA 3CC2T 3VP8A 2DTHA 1W2BS 1LTTC 1FBMA 4ZN3A 4B9XA 2N1TB 2JNGA 2YMYA 3LLRA 1RY3A 4TVRA 3NXSA 4LGDE 2R58A 4M7AD 5FU7C 3GNGA 3M58A 1G3SA 3GPLA 1XQHA 3PT9A 3HFNA 3QIIA 4PJOA 3WVDB 1I4K1 3GOXA 3RK2C 3OYLA 1KHIA 4WY4D 3RERA 3HUSB 1SFCC 4M78B 4I6MC 1VQKA 1UGSB 3CL3D 2FYKA 1IFNA 2ZXEB 4N4IA 2C0XA 2L3RA 2E65A 1X6OA 4M7DC 2YKQA 4E7KA 4HH2A 3QHSA 2E6ZA 1X9VA 3I55A 3FB9A 1SP4A 2M0OA 1M1JC 1FWZA 4BI3A 4NOYA 5GAN6 4A4EA 4DOVA 4EOTA 5D6YA 3A7OA 2JJLA 3OS5A 3SWFA 2R57A 1T3JA 5GAMg 5J26A 1FJPA 3URGA 2GCXA 2E42A 1T8ZA 3JCMd 1N6AA 5A0DA 4C0DB 4DOWA 4C5IA 2GUVA 3A5TA 4OP0A 5CIUA 3MEWA 3R2PA 5AW0B 3G4SA 3PTAA 3JB9D 4GT1A 4RMOA 4KUDK 4C92B 5I2SA 4L5GA 1BYMA 2FYUK 3RMQA 4OB0B 4BD3A 1FU1A 4GY5A 3LW5E 3V4WA 1NHLA 3HHTB 5APVA 2V8KA 1Q7YC 3FRNA 2DD5A 1RF0C 2HYNA 1YYCA 5GAN8 1SQXK 2KYVA 4XTYA 1YIJT 3MTUE 3RESA 4E7HA 5BVZA 1CW5A 5LJ3d 2RJDA 4XU2A 4E7LA 4O5VA 1YITA 3C95A 3HRUA 1FX7A 4O9BA 3MP1A 4JRKA 1Q82C 4C7NA 5APSA 1HK9A 2RHZA 1HGZA 1DH3A 4E7IA 4RG8A 1RF1C 3HPWA 2O01H 1QP3A 3M9BA 1FZAA 1AHJB 5D6XA 3VOPA 4QQDA 1YJNA 1G5VA 1GD2E 1B34B 2Z4EA 3UT1A 2OTJT 4MMKA 5J39A 4W7YA 5GMKi 1Q86U 5CKBA 3L42A 2NPSC 5APYA 1L4AB 4W7ZA 2VRSA 2E64A 1GXIE 4XTWA 4N6JA 3CI9A 2E1HA 1LWUC 3I56A 2RK2A 1BIAA 5GMKl 1JJ2S 2R5MA 4PJOB 1FZBA 1Y71A 4OF1A 2EJ9A 4RCCA 2R5DA 2EIFA 4M75G 2KDSA 4BE2A 2MAMA 5GAN2 1YJWA 1N9SA 3C94A 3TU4K 4M7DE 2HG5D 4XTUA 4EMKA 1Q81C 1ZV8A 2CYZB 1M90U 3KYQA 4IKFA 2PUKB 3L2ZA 5C0MA 4XA4A 2YLBA 2H7HA 3LWHA 2DK3A 2XD0A 3M56A 2I1KA 4KT0E 5GANd 1RI0A 1LT9A 1VQNT 3M0DA 4F7UG 1S9KD 2XICA 1ZLLA 4DZOA 5CCGA 2KP8A 3VTPC 1M1KU 1UEBA 2ZPFB 3CCVA 3SFMA 4ZGDB 1LTSC 5CCAA 5CK9A 1GW4A 2NLUA 2W6BA 1KQSS 1N8RU 1S9KE 2JVVA 2P0PA 1SLQA 1K8AC 3A2AA 3TNUA 4C7RA 4PL6A 2PAJA 3I55T 5GAN5 4BE0A 1VQ5T 2DKGA 3PMTA 2EKOA 3SD4A 4KBMB 1HUCA 3P32A 3P8HA 1BKBA 2M1HA 3BW1A 3CCUA 2XU8A 2L8DA 4FL6A 2DXBA 2E10A 2WSFH 2RD1A 3GHGA 2M9UA 3E1SA 4M77B 4M7AG 2HQXA 1SQPK 2WTYA 4OB1B 2X4XA 4ZGEB 5A2QE 2KAFA 3LGFA 1G3YA 4ELYC 4AUWA 3NFCA 2M16A 1NTMK 5FRMA 5GAOp 1GK6A 3P8CD 5LJ3j 2J59M 3X20B 3BVHA 4IUQA 3B5NA 2CKKA 3JCMh 4N78D 1OI1A 1N73B 1GU4A 2Q7CA 3S3MA 4V2SA 1YTZI 1IFJA 4IFMA 3FJPA 3OMCA 5GAN3 1EQ7A 2NPSD 5GMKj 1JTHB 2LCLA 4C8QD 4MZMA 2BASA 5KH6A 4C46A 5A0GA 1N7SD 1N2DC 3M55A 2H43A 3MIWA 2FXMA 5GAOm 4M7DF 1YITT 1J2JB 3HP9A 3PIPA 2L89A 2RHYA 5LJ3e 1CI6A 2LX9A 4VUBA 1KG1A 1LJOA 2Y90A 2FFDB 1MZ9A 5AW7B 4IUVA 4J6WA 5LJ3h 3PNWC 3UDCA 3RIRA 5CHXA 1LNXA 3HUSA 5GMKe 4NS5A 2P1JA 2QQRA 3EFSA 3JB9G 2YHTA 4LD9K 1URQC 5LJ3f 3EAEA 1KZUB 3RL0D 4NL2A 3C9IA 1I81A 2WACA 1GDTA 5IT9E 3JB9I 5GMKh 2P2UA 2YNYA 1G3WA 1WJQA 5KCHA 2DZCA 1N27A 5AW6B 3H8ZA 1Y96B 2PU9B 2PP6A 4J6YA 1SSFA 3V8KA 1LTAC 1FZCC 3FEOA 3MHXA 3O8ZA 4HA8A 3ZFJA 5GANj 3L1AA 2X4YA 4JUVA 1FXXA 1WJRA 2LVMA 1RL2A 5FU6C 3LW5H 4AQRD 3OYAA 1YJWT 4LLHA 5KLVK 4M78E 2EJGA 3BDLA 1QVFA 2K5FA 4PJOC 2J58A 1N86A 2FYZA 5KJ7A 3VP9A 3PFSA 5GAN4 2XKMA 2ZFCA 3CPWA 4M75A 3FC3A 3BASA 2RHUA 4D6WA 4FT2A 3TNUB 2CPBA 1WT6A 2ZPEB 1H641 3OYGA 1UGRB 2DXCA 2O1KA 2LQ8A 3TSIA 2R5AA 2XDPA 5AW3B 5CQYA 3CCVT 2E6NA 2DXTA 2VV5A 4PLIA 2QI2A 3B8EB 1QVGA 5GANh 1LOJA 1JOCA 4F7UA 2WT7A 3LGLA 4M7DG 1KD1U 1WRGA 2OTJA 4QQ6A 3RUXA 1GL2A 2IG0A 1WQ7A 2DTOA 1ZHIA 2CZ7B 1CZQA 1CSBA 4II1A 3E9FA 2XKOC 4C92E 3LH0A 3INZA 3V8LA 3SWNA 3V2QA 2QQAA 2YKPA 4JRQA 1D3BA 2OYIA 5CJ0A 1YCYA 1N7SB 1J1DB 3I5CA 3L4FA 1W2BA 3V7RA 2QXFA 3EFGA 2R3CA 1KHCA 4LDXA 1NE8A 4OB3B 3OQ5A 3UIAA 3E9GA 2JUFA 4KHXA 5GMKm 3T97A 1JNMA 4M7AA 1L4AA 1P92A 3OYYA 1VQ6A 1GW3A 3LX7A 1NZ9A 2O4XB 3OJAB 3QG1A 3GNFB 1URQD 3M53A 1Q86C 3MEVA 4EIJA 2VC8A 1CI6B 4A4HA 4WY4A 2A45H 1LTGC 2IX7C 5GAOl 3NTIA 4BY6C 1VQNA 2HQEA 4Z02A 5D6WA 3G7ZA 4C5GA 3OYBA 1MHNA 2RI3A 5LJ5d 3NTNA 1JY3N 3VN0A 1ZR4A 3VMYA 4M78F 1UGQB 2KB7P 1ZN5A 4W80A 4FIBA 4HKEA 4C0GA 3M4YA 4MDWA 3MO8A 3BFMA 2YLCA 4DQ2A 5CQXA 1VQ5A 1M90C 2MF2A 4BE1A 3L2QA 2Y4XA 1G1IA 2RI2A 4PJOE 2JTMA 3VUBA 1NPRA 3HD7D 1W4SA 3DKMA 1VQPA 3VU3C 3S3NA 3OSVA 3X28B 2OARA 1OWAA 3ME9A 2E41A 3GP8A 1PFIA 4C8QG 4RCBA 4MZTA 3M54A 4Y99B 5CKFA 1KILD 4I1LA 1N8RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OQ5 A;  3M9Q A;  3OYF A;  5KCO A;  3S3M A;  3LW5 H;  2X35 A;  3E9G A;  4IKF A;  3DLM A;  3H6Z A;  2VYT A;  3OMC A;  4PLL A;  4CRI A;  3OYA A;  2DIQ A;  3GOX A;  4X34 A;  4BDZ A;  3MP8 A;  5KLV K;  4HCZ A;  2RHX A;  5C0M A;  1WJS A;  4A4G A;  3DB4 A;  3OYL A;  2RJC A;  3BDL A;  3FDR A;  4IUT A;  1SQX K;  3NTH A;  4IUR A;  3S3O A;  3ZEH A;  1SQV K;  3LX7 A;  2F5K A;  2O4X B;  3PFS A;  3P8D A;  3L2V A;  2RI5 A;  4E7H A;  3ASK A;  2GF7 A;  3MEU A;  1RI0 A;  1XNI A;  2RJD A;  5KH6 A;  3OYC A;  3MEV A;  3QJ6 A;  3OYN A;  4E7L A;  3G3Z A;  4B9W A;  2LCC A;  3UWN A;  4A4H A;  4IFD K;  3FC3 A;  2P0K A;  4BAC A;  3O8V A;  2RHI A;  4RG2 A;  2RHU A;  3MP1 A;  3OYD A;  4N4I A;  2L3R A;  3OYI A;  3L2U A;  4N4H A;  5FRO A;  4BDY A;  2RHZ A;  3NTI A;  2MWO A;  4E7K A;  5FRN A;  3OYG A;  2NLU A;  2HQE A;  4Z02 A;  1NTZ K;  5D6W A;  1SQQ K;  3NTK A;  4C5G A;  1OZ2 A;  3OYB A;  4E7I A;  5IN1 A;  4IUU A;  3MEA A;  4L59 A;  3OA6 A;  1MHN A;  1OI1 A;  2R5A A;  3FLG A;  2MWP A;  2XDP A;  2RI3 A;  2O01 H;  2L89 A;  3LYI A;  2RHY A;  2DIG A;  4C5H A;  2WSC H;  5KE2 A;  2M0O A;  1OYX A;  2LDM A;  4UC4 A;  2E6N A;  2GFA A;  5IAY A;  3C4S A;  5D6X A;  4Q5W A;  3OYH A;  3MET A;  5C6S A;  3S6W A;  4PLI A;  5KE3 A;  4QQD A;  4PL6 A;  1G5V A;  4IUV A;  4N4G A;  4A4E A;  3QBY A;  2RJE A;  3OS1 A;  3UT1 A;  4BE0 A;  5D6Y A;  4QQG A;  4QW2 A;  3OMG A;  3PMT A;  2EKO A;  3PNW C;  2X4W A;  3SD4 A;  1NU1 K;  2RJF A;  3DB3 A;  3MP6 A;  4C5E A;  5J39 A;  4E7J A;  1L0N K;  2R57 A;  2BKD N;  5M9O A;  2O4X A;  3LGL A;  3P8H A;  2QQR A;  3L42 A;  2M1H A;  2YRV A;  3MO8 A;  4NS5 A;  5J26 A;  2DAQ A;  2EQM A;  3OYM A;  2L8D A;  4FL6 A;  2WSE H;  4OVA A;  4QQ6 A;  2WSF H;  2JZ2 A;  3OYE A;  3EAE A;  2IG0 A;  3QKJ A;  3L2R A;  3Q1J A;  1H3Z A;  2LRQ A;  2QQS A;  4BE1 A;  4ZTJ A;  3F70 A;  3L2Q A;  2LTO A;  2JTF A;  2GFU A;  2WAC A;  4C5I A;  5CIU A;  2G3R A;  3CEY A;  3OYJ A;  3OY9 A;  1OZ3 A;  2HQX A;  2XK0 A;  3E9F A;  2B8A A;  2BIV A;  1NTK K;  2RI2 A;  4II1 A;  1SQP K;  1SQB K;  3MEW A;  1WJQ A;  4FU6 A;  5KCH A;  3L2W A;  3LH0 A;  2X4X A;  3KUF A;  1N27 A;  2EFI A;  3H8Z A;  4B9X A;  2EQU A;  4EDU A;  2R5M A;  2K3Y A;  3LGF A;  2PQW A;  4LD6 A;  2RO0 A;  3LLR A;  1SSF A;  2FHD A;  2M16 A;  3OB9 A;  4IUP A;  2LKM A;  2EQJ A;  1NTM K;  2EQK A;  5FRM A;  3S3N A;  2FYU K;  2OAR A;  3CLQ A;  1WGS A;  3FEO A;  4ZTF A;  3PMI A;  2K3X A;  3ME9 A;  2X4Y A;  4BE2 A;  4BD3 A;  3OYK A;  2J59 M;  3OS2 A;  2D9T A;  2R58 A;  3OS0 A;  1WJR A;  1KHC A;  2BUD A;  4IUQ A;  4A4F A;  2CKK A;  4GY5 A;  1L0L K;  2E5Q A;  3QII A;  2LVM A;  4QVZ A; 
#chains in the Genus database with same CATH topology
 1WX6 A;  1O9S A;  1PSE A;  3S1K A;  3CMA P;  1UHC A;  2KVQ G;  2R44 A;  4N3Y B;  3CXC P;  1ZME C;  1RAD B;  4M75 B;  3AE5 C;  3H6Z A;  1HBW A;  3BAT A;  2AK5 A;  4EMK C;  2QJK C;  2OYO A;  4HVV A;  1JEG A;  3PIO A;  2NWM A;  2HMA A;  4HCB A;  3CXH H;  5GJV B;  1FS0 E;  4C92 F;  4HKZ H;  2V8J A;  2KBT A;  1BCC J;  3MEU A;  4HT8 A;  4M77 A;  5FW9 A;  5DLO A;  5GAO r;  4B9W A;  4ELZ C;  2E76 D;  4BAC A;  2P0K A;  2OYH A;  3REB B;  3O8V A;  4PJM A;  3OYD A;  1SKU B;  1MFZ A;  1LT9 C;  4DBF A;  2DXU A;  3M0D C;  3TGU G;  2X9H A;  5APX A;  1QCF A;  3VYH B;  3FWN A;  4IIM A;  2MWO A;  5CCG C;  2FYU D;  4MN4 C;  4LE9 A;  1L2P A;  4F7U B;  2J05 A;  4PNO A;  4IUU A;  4L59 A;  2OTJ Q;  3L74 D;  3EGU A;  1PP9 J;  1SQV G;  5BU8 B;  1F1B B;  1HSQ A;  5KE2 A;  2CPS A;  2WT7 B;  2GGR A;  3CBP A;  4F04 B;  1JEK A;  2L5Q A;  2Q3I A;  2KLU A;  1EDK A;  1N73 A;  3VS2 A;  3OW2 P;  3EFF K;  3GG2 A;  1M90 R;  1GL2 B;  3M0Q A;  3C0C A;  1MUU A;  4MML A;  4ZNC A;  1K04 A;  3RK3 C;  2LX7 A;  2O2O A;  5AVZ B;  1KN7 A;  4YTL A;  3REA B;  4PFO A;  1GCP A;  1NU1 K;  3DB3 A;  1EDL A;  3H1L E;  1SQX D;  4L75 A;  3JAM E;  1JTH A;  3H1H E;  1M9S A;  1VQM T;  3RBX A;  3SWN B;  2KNC A;  2Z5I A;  3JV3 A;  2E4H A;  4JRI A;  2POH A;  3GLX A;  3JCM g;  2QJY C;  4OVA A;  1LTJ B;  2OTL P;  4XAX B;  1D3B B;  2OYI B;  5CCH C;  1I1J A;  2EJF A;  2YXQ B;  2JO1 A;  1WFW A;  2J6O A;  3QYH B;  2GFU A;  1U8R A;  1BIB A;  3CEY A;  1J1E C;  1OZH A;  3HTK B;  3L71 D;  1DX7 A;  1S1C X;  3GF7 A;  1NWQ A;  1K1Z A;  2FXP A;  4XTV A;  3GHG C;  1IO4 A;  3NHN A;  4HVW A;  3L70 J;  4OGQ D;  1AOJ A;  1QCN A;  2CZ6 B;  3D70 A;  1YJ9 P;  4KH1 B;  2EFI A;  1LTB C;  1VQ6 Q;  5CKE A;  2GNC A;  3LIE A;  3W67 A;  3RK2 D;  1NEB A;  4H13 B;  2MMP A;  3I5S A;  2LQN A;  2LKM A;  3T97 B;  1HVV A;  1NU1 E;  2QM8 A;  4M7A B;  1W70 A;  3CLQ A;  3I35 A;  4ZTF A;  2FFD A;  1JJ2 A;  1Z56 A;  1SFC D;  2XNX A;  3GW6 A;  2EVR A;  5BU5 A;  2FXO A;  2XDJ A;  4XU0 A;  1OX9 A;  2SPZ A;  1UFF A;  2AEM A;  2RQT A;  1NAF A;  1IHV A;  2B86 A;  4JPB W;  2BZX A;  1KQG B;  3M9Q A;  2KEA A;  4FSX A;  4RTT A;  1M30 A;  5KCO A;  1SQB G;  2KIK A;  2N9B A;  2X35 A;  1VQN Q;  1S72 P;  4WY4 B;  2BTT A;  1RE4 A;  3B5N C;  1ZA2 B;  3CCM P;  4XU3 A;  1NKN A;  4CRI A;  1JB0 J;  2JM8 A;  2CH4 W;  1VQ9 P;  4M7D D;  3R6O A;  2ZYG A;  1A02 J;  4D6T G;  2DD4 A;  5LJ5 j;  3KXT A;  4PJO F;  3QO3 A;  3P8D A;  1H8A A;  5AVS B;  2P4R A;  2DL8 A;  3ZBD A;  4HCK A;  5LJ3 g;  3V2N A;  2ZPH B;  1YHQ T;  1VQ6 T;  1YBK A;  2AKK A;  4RG2 A;  2PFX A;  1Y96 A;  2C06 A;  5L8R E;  4AFZ C;  1AZE A;  2K37 A;  1XTC C;  1NAY A;  5AW1 B;  4PD4 D;  1T3L A;  2IZ1 A;  2DTI A;  4KUI A;  2K5I A;  3JCM c;  3V2P A;  3FXE A;  3CBM A;  2VUB A;  1M4Z A;  2CT4 A;  2N1T C;  4HJG H;  3CCE T;  1YTZ T;  1VQ5 Q;  1VF5 D;  4JS5 A;  2DET A;  1FAV A;  1S5L H;  3NMZ C;  1OYX A;  2HD0 A;  4Q5W A;  2CP7 A;  2BEQ D;  5KE3 A;  4U3F E;  1KQS A;  2V4H A;  3H1L J;  1NTK D;  2ZGW A;  2CS7 A;  1VQL A;  3HD7 B;  3LWI A;  3H1H J;  3MZW B;  1AWJ A;  3GIB A;  3CCJ A;  1A02 F;  1VQ8 T;  2FKW B;  3MP6 A;  2YKO A;  3OSS C;  1ZRT D;  3USS A;  2A3L A;  1VQP Q;  5LJ5 e;  5GTH H;  4E7J A;  1JCC A;  2IFM A;  3KDP B;  2EQM A;  2BE9 B;  2E75 D;  1E5W A;  2WSE H;  3CCR P;  1IFM A;  3L72 J;  1KIL B;  1QL2 A;  3HUS C;  4M78 C;  3V7C A;  3JCU E;  1OPK A;  1W2E A;  4ZTJ A;  5CR2 A;  2E43 A;  2DZ9 A;  2EQI A;  2GQV A;  5LJ5 h;  4QVC A;  8AT1 B;  4Y91 A;  3T9N A;  4OMO A;  3H0H A;  3A8O B;  4J9F A;  5KAI H;  2MKV A;  3H32 B;  1R8E A;  1JO5 A;  5FWC A;  1NU1 J;  1FJK A;  1X0T A;  1X6B A;  4WVZ A;  4A4K A;  4XTX A;  2LMJ A;  2LZ6 B;  5IHK A;  5LJ5 f;  2EKH A;  3TCJ A;  4BRY A;  4IUP A;  2PVD B;  3MD0 A;  5KKZ C;  3DLL A;  1C6V X;  1ZBJ A;  1K9M U;  2EYQ A;  1PHT A;  3VYI A;  1ZA1 B;  3OYK A;  2HOD A;  2E5K A;  2RM4 A;  2BUD A;  4A4F A;  4GKG A;  2X4J A;  1L0L K;  2P58 A;  1JU5 C;  2E5Q A;  4WF2 A;  1KFN A;  1VQP T;  1KQS O;  1JY2 O;  3EFO A;  3UPU A;  2XHC A;  5KAF E;  3DLM A;  4M77 F;  4QVD A;  3G4S P;  2OYH B;  1SQQ D;  4BDZ A;  5B66 H;  5AYF A;  2QQ9 A;  2YUQ A;  3A5Z B;  3O5Z A;  4P5N A;  3NTH A;  3S3O A;  3CME A;  3MGN A;  1YFN A;  4ZN1 A;  4HYT B;  1PIX A;  2RI5 A;  5GAN g;  2LQK A;  3RK3 E;  1VOM A;  1Q7Y U;  1LTI C;  5L8R J;  1YIT Q;  5CCH D;  2K5L A;  3CCL T;  3CXH D;  2RMO A;  1SQP D;  5KJ7 C;  2FL7 A;  3CCQ A;  1YI2 T;  1PWT A;  4C0D C;  2NPS A;  1TXQ A;  1JMB A;  4MDX A;  4C8Q A;  5AVW B;  1GZL A;  1KD1 C;  2DLP A;  3VS3 A;  1PNJ A;  4LDU A;  1OVR A;  3RL0 g;  3SWY A;  1AWO A;  1L0L E;  3GLM A;  4M75 C;  4XU1 A;  1NTM D;  4A54 A;  1N7S A;  1NTZ K;  2DE0 X;  1Q90 D;  1W5C E;  3IFM A;  3H25 A;  3TEE A;  1LWU A;  3NMD A;  4R0K A;  3U1A A;  2DBK A;  2MWP A;  1Q82 U;  4C92 C;  4U3F J;  1KB9 H;  2KE9 A;  3CBO A;  5FU7 B;  4ASV A;  3OYH A;  2KNC B;  2RMZ A;  3Q5P A;  3SB2 A;  1YBY A;  4HVU A;  2R5B A;  1VDF A;  1MV8 A;  3M91 A;  2AEF A;  4XK8 E;  2M5A B;  1M1G A;  4HCC A;  2IBZ E;  2PRR A;  1EIF A;  1U1T A;  3G6E T;  4LXC A;  2DPP B;  3WU2 H;  2RJF A;  4MZP A;  1MMG A;  3O6Q B;  3Q2Y A;  1WNL A;  2E74 C;  2BKD N;  2KK7 A;  1PGP A;  2O4X A;  1SFC B;  2QAS A;  2IFN A;  3U23 A;  2DAQ A;  2LR2 A;  2B87 A;  2P7J A;  2QM7 A;  4J9B A;  2XI9 A;  4J7I A;  2M3B A;  2Y4Y A;  1WQW A;  1VQO P;  2MIO A;  3LID A;  4E6R A;  2QQS A;  1YJN P;  2K2V A;  4DOJ A;  3F70 A;  1QWE A;  2KSJ A;  2LT1 A;  4ATO A;  3OY9 A;  1BE3 G;  1M1K Q;  2HZY A;  3G71 P;  5IXB A;  3A0H H;  1AFO A;  4M7D B;  4Z1M H;  3L2W A;  3CCS P;  3PVQ A;  1BCO A;  5L23 A;  3H1I E;  4H0L B;  3HSB A;  4EDU A;  2XDD A;  2QA4 T;  3IAO A;  4LUD A;  2QIW A;  3TSZ A;  3CWB E;  3JCM Q;  2EQJ A;  2N1T D;  4RJT A;  3SWN C;  5CAI A;  2E5T A;  1XOV A;  4JRP A;  2BCC D;  1DD3 A;  2ZXX A;  2OYI C;  2QTX A;  3V8J A;  3HL8 A;  3SHW A;  2RB6 A;  1M5Q 1;  2CUB A;  3I56 P;  1QGK B;  2PVO B;  1T6A A;  3IR9 A;  2ROT A;  1FMW A;  2P10 A;  1IRX A;  3WUT A;  3CX5 D;  2EPD A;  2GTO A;  2V1Q A;  1VQ4 A;  1VF5 B;  2F2W A;  3QH9 A;  4PLL A;  2DIQ A;  4U7J A;  1KD1 R;  2RJC A;  3U1C A;  3FDR A;  1IHW A;  4F16 A;  2FYU G;  1UDL A;  1K9M Q;  3E2U A;  1KC8 U;  3L74 G;  2ED1 A;  3E19 A;  1L4A C;  2OX7 A;  3VYG A;  4M78 D;  1VQL Q;  1Y47 A;  1JO8 A;  3H1H G;  1L0L J;  3CCJ Q;  3CCV Q;  4YPC A;  2ATC B;  2YIU B;  3L75 E;  2H88 C;  2O1J A;  2DVE A;  1EX4 A;  2DJZ A;  1KIK A;  2WZ7 A;  2E75 B;  4E47 A;  4LC1 A;  1AQ5 A;  5FRN A;  1BI3 A;  2FO0 A;  1B7T A;  1FDM A;  1SQX G;  1YN8 A;  4CI0 C;  1PPJ E;  2FEI A;  1DEB A;  1HWT C;  1Q7Y Q;  3X24 B;  1O75 A;  3MP7 B;  1NPP A;  1M3A A;  4LDV A;  3CPF A;  3S6W A;  2GTJ A;  1SVF A;  1JY2 P;  3H6P A;  4BUG A;  1IZ6 A;  3R4Y A;  3OBY A;  3QBY A;  1HH0 A;  1KQ1 A;  2RJE A;  3OS1 A;  3P8B B;  3CC4 P;  4ME7 A;  3CMA A;  4QW2 A;  3CC7 T;  1QLE D;  1M27 C;  2GUS A;  1FC2 C;  4ZKU A;  2X4W A;  1Y7X A;  2FYN C;  1L0N K;  3JCM V;  1FZE A;  1NTZ J;  4OB2 B;  2ZJS E;  2YRV A;  2CP0 A;  2A06 D;  4JLI A;  1G2C B;  1VQL T;  1Q82 Q;  4OH8 B;  3QWY A;  3KBG A;  1MGQ A;  4Y92 A;  2EGE A;  3CXC S;  2PUO B;  3CCJ T;  4BRY B;  5KLV E;  2LRQ A;  2QTV A;  5I2M A;  2CK3 H;  4BI4 A;  2KQW A;  4CC2 A;  3F5H A;  3H1I J;  2JTF A;  1OXZ A;  2JN0 A;  1M1F A;  4JYC A;  1X2Q A;  1VQM A;  1ZQ1 A;  1PM3 A;  4R56 A;  2HOD B;  2BIV A;  2Z0W A;  1GCQ C;  3CWB J;  3X25 B;  3KUF A;  2QQB A;  4JJB A;  2EQU A;  5GTH E;  1AVY A;  4M3L A;  3JCM b;  2K3Y A;  3EG0 A;  2RO0 A;  2ZPG B;  2IZ0 A;  2WSE E;  1IGU A;  2FZK B;  2A37 A;  2QJP B;  1ZR2 A;  2WPS A;  1QVF O;  4C92 D;  2EYX A;  2K3X A;  1K0X A;  1HGV A;  4AT1 B;  2JP3 A;  3CCQ Q;  4FYV B;  4XTZ A;  1ZUU A;  2YO2 A;  4JDS A;  2OAU A;  4EPC A;  2QEX P;  4M75 E;  5HY6 A;  2Q9I A;  3CPW O;  1P84 E;  5CMZ A;  2VYT A;  2NPS B;  2LT4 A;  1EFN A;  4C8Q B;  3OW2 S;  2DFU A;  2RHX A;  4IIO A;  2E74 D;  1VUB A;  1LTJ A;  3QYG B;  3AEB C;  2M8R A;  4PV1 D;  5KYW A;  2A45 G;  3J81 E;  4IUR A;  1OV3 A;  3CC2 P;  3RNJ A;  1BI0 A;  3L73 D;  1BI1 A;  5AVV B;  5GAN 7;  2OTL A;  2KMT A;  1H8K A;  3HTK A;  1LWU B;  1XNI A;  3L75 J;  3QJ6 A;  4PD4 I;  1RE3 A;  4JZ4 A;  2CP3 A;  2LCC A;  2OGU A;  4NPE A;  1TSF A;  1XTD A;  1ZSG A;  1M7L A;  2A45 I;  2K88 A;  1YWO A;  2DO3 A;  5GAO n;  3CME T;  2K3R A;  4LDW A;  4M77 C;  1URQ A;  4F7U E;  1OU8 A;  1QVG O;  4N4H A;  4RTY A;  5FRO A;  3H1J E;  4AFS C;  4NL3 A;  5AVX B;  1YJ9 A;  2IYP A;  2R32 A;  1PD0 A;  2VGN A;  2JOY A;  1X69 A;  3MPU B;  1QWF A;  5EG2 A;  5EC7 A;  3CCQ T;  2HKQ B;  2WSC E;  1YHQ A;  1BCC D;  3FLG A;  1HTL C;  3LYI A;  1TU3 F;  1KYO D;  4J9C A;  1KC8 Q;  4LUE A;  1SG5 A;  1V1C A;  2GFA A;  2GA1 A;  5A0L A;  1Q2N A;  5HKC A;  2B87 B;  2HNI A;  5AW5 B;  1N9R A;  2ZPB B;  5LL6 S;  3RKX A;  3AE8 C;  5C6S A;  3HE5 B;  5DLQ E;  2OQQ A;  2I0N A;  3VS1 A;  1KB9 D;  1PV3 A;  4F14 A;  5DM7 R;  1FZG A;  2XDB A;  4WB4 A;  2B9B A;  3CCE A;  2LP5 A;  4I2L C;  4NPF X;  4QQG A;  1FZC A;  1NYH A;  2DBM A;  2RPN A;  1S72 A;  1N73 C;  3HKS A;  3MHV A;  4AG2 C;  1K4U S;  2XID A;  3CCM A;  1PP9 D;  1VQ9 A;  5GAM d;  2Y0E A;  5KLV J;  2E3I A;  1LGH B;  3CD6 T;  3RL0 B;  3V2R A;  1D0Y A;  1K9A A;  1DIP A;  5HK3 A;  2MI6 A;  3OYE A;  2D1X A;  1VQ8 A;  2H8P D;  1L4A D;  1W2B O;  1FMV A;  1PP9 E;  2K7A A;  2G3R A;  3HRT A;  3JCU H;  4QT7 A;  1K73 U;  4JJN K;  3G9R A;  1FE6 A;  5APQ A;  2JT4 A;  3QSU A;  2WSE J;  2LC4 A;  2I1J A;  4BWN A;  1JMM A;  4M7A E;  1AA0 A;  2PQW A;  4IFF A;  1LNQ A;  3VRY A;  3E1I A;  1GK4 A;  2L91 A;  4PJO D;  1OMI A;  3KHU A;  3EGX A;  4JYB A;  1IGQ A;  5CO7 A;  3AE9 C;  5DJU B;  3OS2 A;  2QSI A;  1USE A;  3HD7 A;  3IF4 A;  1IK7 A;  2W6A A;  3L70 D;  3A0H E;  2E3H A;  4GIF A;  2FFD C;  1UE9 A;  1ACM B;  1SQP G;  1UB4 A;  4J5Y A;  1R5L A;  2O9S A;  2ZT9 C;  1T2K C;  1GFC A;  3M5A A;  5KAF H;  3VMA A;  1FZF A;  3LH5 A;  2D6F A;  2O3J A;  1WJS A;  1KIL A;  1AWW A;  5GTI H;  1NLO C;  3A8M B;  1NTM G;  3ZEH A;  1EDI A;  3CXH I;  1M1K C;  3CCR A;  1RE4 C;  2K57 A;  2F5T X;  3J80 E;  1VQ4 T;  3ASK A;  2AXC A;  4WCI A;  2DA9 A;  2M0Y A;  2DL3 A;  1E79 H;  3H1J J;  2FB7 A;  3H32 A;  4ORZ A;  5AVQ B;  2BEZ F;  3M06 A;  1C0M A;  1T3U A;  2DJQ A;  1WHL A;  2WSC J;  3OYI A;  2HKN A;  2PVG B;  1ZXG A;  5AW8 B;  5TJH A;  2V7Q J;  5AVT B;  1NJI U;  2YXR B;  4R55 A;  1QVF P;  3CCL A;  4M75 F;  5IN1 A;  2QDY B;  2Z5H A;  1YI2 A;  3HE4 A;  1VQ7 T;  5LJ5 g;  3X26 B;  2WIT A;  3QJY A;  3PP5 A;  4UC4 A;  4RES B;  4C0Z A;  1JB0 E;  2NUP A;  3H1I G;  3BY7 A;  3R6N A;  1VQM Q;  3C1L A;  3EQ2 A;  2L3P A;  3RMS A;  1NOH A;  2H3J A;  1H88 A;  5KTB A;  5ECA A;  2MK5 A;  3VMX A;  1UGP B;  2CZ0 B;  1U1S A;  1YIJ P;  2XZR A;  1K9M C;  1AVO A;  3OMG A;  4N0A A;  2NZ2 A;  4C5E A;  2C9N Y;  2K1A A;  1MND A;  1WPY A;  2HEQ A;  3II6 A;  4EMG A;  3AEA C;  4J6X A;  2RF0 A;  2AEJ A;  3CMA T;  4F7U F;  1JRI A;  4NPD A;  3G6E A;  5APT A;  2ZYD A;  3H1L D;  3QWO C;  1D7M A;  2ZAE A;  3M59 A;  5CKH A;  3H1H D;  2MJZ A;  1KQL A;  2BCC G;  3TDK A;  3KXD A;  2AXT E;  1UJY A;  3PGG A;  4XFJ A;  1EDJ A;  1U06 A;  2XK0 A;  3WXM B;  1Y9B A;  2HDA A;  4PV1 B;  4M77 D;  2EAY A;  3TRE A;  2BZY A;  1JCD A;  4JLG A;  1QCO A;  3W68 A;  4K3A A;  3OB9 A;  3H1K J;  4H44 B;  4DJG A;  3JCM W;  2EQK A;  2OTJ P;  1WGS A;  3B4S A;  2KOG A;  3GF5 A;  2M0B A;  5KYW B;  3FGA D;  2M5A A;  4M77 E;  3WUV A;  1M1K R;  3CX5 I;  1NO4 A;  1FMK A;  2QA4 A;  1K73 Q;  4XQ3 A;  3VS7 A;  3L72 E;  4M78 G;  4QVZ A;  3L2R A;  1NU1 D;  5IH2 A;  1YJ9 Q;  3O6Q A;  1PCX A;  2KT8 A;  1S4X A;  4KJM A;  3EGD A;  3A0B E;  2GBQ A;  1SFC A;  1N8R R;  3NFQ A;  2C0W A;  2HBP A;  1D0X A;  1YHQ Q;  3MP8 A;  5FWB A;  4EMH A;  2HLO A;  3ZDM A;  1URQ B;  2PGD A;  2K9J B;  4WWI A;  3ABV C;  3A8H B;  2LNV A;  3QZ5 B;  2F5K A;  5AVY B;  1OW6 A;  1VQO A;  2RH0 A;  3AEC C;  4UB6 E;  3OA7 A;  3OYC A;  1GU5 A;  2COW A;  2ED0 A;  2DIL A;  3M4G A;  3CCE Q;  3G3Z A;  4M7A F;  4M7D A;  4IFD K;  2HL3 A;  1WHK A;  3EFR A;  4RTW A;  1TH7 A;  1Y57 A;  3G71 A;  1BBZ A;  3KQG A;  1IZN B;  1UJ0 A;  3EH1 A;  3CCM Q;  3CCS A;  2OTL T;  2Q5U A;  2AIR B;  3AE1 C;  1MNE A;  1JXM A;  4AMC A;  1E6H A;  4I7Z B;  3SSU A;  1PRM C;  5KLV G;  1FZC B;  3NTK A;  5GAM j;  1K9M R;  3A8L B;  1RAB B;  1M1J A;  4C8Q C;  2W27 A;  1E6G A;  1WI7 A;  1N7L A;  4C5H A;  4YTP C;  1VQ8 Q;  3BCC E;  1OUL A;  2A06 G;  4PKC C;  5GJW B;  3D71 A;  2YUO A;  1YJ9 T;  1N7S C;  1J1D C;  3BRT B;  2Y0D A;  3NGP A;  1FOS E;  2V1R A;  2FY8 A;  2KSS A;  5FU6 B;  1BI2 A;  1EZV E;  2HR3 A;  2K4Y A;  5E79 E;  4J9G A;  1VQN P;  2ZT9 D;  1T2K D;  1I8F A;  5I11 A;  1NJI Q;  4U3F D;  2OJ2 A;  3C12 A;  3V7S A;  3OYM A;  3H9N A;  3JB9 J;  5KLI B;  2HPC A;  2DMO A;  5TIS E;  2KXD A;  3JSC A;  1ZBX A;  3TK1 A;  3CC7 A;  1S72 T;  3HRS A;  1VQK P;  3VMZ A;  1H3Z A;  2O88 A;  3CCM T;  2CP6 A;  4C92 G;  1BGY E;  2DL5 A;  1VQ9 T;  1X01 A;  2DYB A;  4ESR A;  3EGX B;  2ZPI B;  3OYJ A;  2D2C B;  2L2P A;  3K5B A;  1OZ3 A;  2JKV A;  1NTK K;  5CJ4 A;  3FXD A;  1KC8 C;  3BDU A;  5GAM e;  4O6J A;  3AE6 C;  3TYY A;  2H89 C;  4KH0 B;  4BI8 B;  4LD6 A;  3CCR Q;  3I55 P;  3L36 A;  4HXJ A;  5KYN A;  2LJ3 A;  1BB9 A;  3RL0 C;  4HB1 A;  1R5S A;  4J8O A;  2CDT A;  2XV5 A;  3L73 G;  5GAM h;  3AED C;  2W8Z A;  1DJ7 B;  4RTV A;  4J7F A;  1RF0 A;  3CC4 A;  1LP1 A;  1VQK T;  2ZVN B;  1X2K A;  2EYW A;  2V8I A;  5GAM f;  3CCL Q;  1P84 H;  2RQV A;  1G2C A;  1JBM A;  3JB9 F;  4X34 A;  1YI2 Q;  4DA4 A;  4A4G A;  3DB4 A;  2H8H A;  4IUT A;  5CCG D;  2CH4 A;  4KRT A;  1W1F A;  1M8V A;  1BCC G;  2E76 B;  2GF7 A;  1AVZ C;  1X27 A;  3G1J A;  3HE4 B;  3OYN A;  3QXE B;  1LPL A;  2NUP B;  5H2F E;  2XU6 A;  3L71 J;  1RF1 A;  4L76 A;  5CKD A;  3CCR T;  2DRK A;  1RHZ B;  3AEF C;  5AW4 B;  3L35 A;  3RK3 D;  4OMP A;  1KYO I;  1LCK A;  2HSE B;  1NH4 A;  1MV3 A;  3QDR B;  3BCC J;  5CCH A;  2CSI A;  1SQQ K;  5GTI E;  2QG9 B;  3MEA A;  2P67 A;  1PP9 G;  2DEQ A;  1Z9Q A;  3G6E Q;  4PFP A;  1KB9 I;  2WSC H;  3P7K A;  1H0T A;  2LDM A;  4WBA A;  2LXB A;  1NKZ B;  3U59 A;  2V7Q H;  1IRE B;  1B3Q A;  1L0L D;  4FM4 B;  1RUW A;  2W6J H;  4PJJ A;  2KNB B;  2QEX A;  1ZSZ C;  2YUP A;  1TOV A;  4LDY A;  2ZAE B;  4Y99 C;  1HJD A;  4IL6 E;  3JRZ A;  1C1A A;  5IXF A;  2MCN A;  2HAX A;  1PD1 A;  1X75 C;  1GTW A;  1RAG B;  3QWX X;  3JCM X;  1EZZ B;  2P0Q A;  4BB7 A;  2F2V A;  3MCA B;  3JCM e;  2ZYA A;  3M57 A;  5J3B A;  4XE5 B;  2ZZD A;  2I2L A;  1KC8 R;  2VXF A;  3SDZ A;  1PC0 A;  1BGY J;  2IBZ D;  3P8M C;  1IFI A;  1R8O B;  2UWJ E;  3CC2 A;  2IIM A;  3N4X A;  3G4S T;  2QA4 Q;  2RKL A;  4PJO G;  1WHM A;  1IK9 A;  3RDV A;  3F89 A;  4ZGJ B;  1YIT P;  2C0O A;  4OGQ B;  2A36 A;  1V29 B;  2C0T A;  2B8A A;  3HTR A;  3VS6 A;  3M0U A;  3CD6 A;  4FU6 A;  4BY6 B;  3L70 G;  2LNH B;  3RK2 B;  4J83 A;  3P8C E;  3OAK A;  2YRC A;  3JCM f;  1FOS F;  1PSF A;  4C7N B;  2VXE A;  3JCM J;  3IQL A;  3B5N D;  3EGD B;  1OEB A;  1WIE A;  5CVI A;  1U3O A;  1BSN A;  4N78 E;  2YDL A;  2FPE A;  1HJB A;  3N5B B;  1R77 A;  4X9C A;  3MKD A;  5FLX E;  5DY9 A;  1X79 B;  2QRX A;  4E7Z A;  2DEU A;  3HFO A;  2KRS A;  3HE5 A;  3H1I D;  3PMI A;  2AZV A;  1S2E A;  5HK0 A;  7AT1 B;  2LXC B;  1QW1 A;  1NTZ E;  2A28 A;  2CT3 A;  2FZG B;  4DCK A;  3VJP A;  2F1L A;  3S4R A;  2D9T A;  3VV0 A;  1LJ2 A;  3RKW A;  3G71 Q;  3A3Y B;  3CWB D;  1G8X A;  3CCS Q;  1JY3 O;  2N1T A;  3D6Y A;  3J7A F;  1GL2 C;  4C8Q E;  5GAO q;  2VVK A;  3MUD A;  3KZI E;  1QVP A;  2E70 A;  2M51 A;  3AE3 C;  4HCZ A;  5DJT B;  2KLV A;  1VIE A;  2V26 A;  2VGM A;  1SQV K;  5AW9 B;  1UUE A;  4H44 C;  1JJ2 P;  1VPC A;  3L37 A;  2RK1 A;  1M1J B;  1Y07 A;  1NLP C;  2WQY C;  1LTJ C;  3QZ9 B;  2ZCF B;  2NRG A;  3PE0 A;  1H89 A;  3V5B A;  1NEG A;  2RHI A;  3RGU A;  3CQT A;  1AD5 A;  3WMM 0;  3D7S B;  3L2U A;  1VQO T;  4BDY A;  3VS5 A;  1RE3 C;  4OGE A;  2KI7 A;  1YJN T;  4M78 A;  2E12 A;  1OZ2 A;  2O01 E;  3M0T A;  4RTX A;  4E7S A;  3OBW A;  4Y28 E;  1Q81 U;  1K73 C;  1K0S A;  3M9H A;  2DNU A;  3CC7 Q;  3TGU E;  2A0F B;  3G71 T;  3L75 D;  4RO0 A;  2DIG A;  3JCM P;  2FVU A;  4H13 C;  3CCS T;  5IAY A;  1KFM A;  1YP5 A;  3C4S A;  1SRM A;  3AE4 C;  3MET A;  4HT9 A;  4M7A C;  2RQW A;  1YJW P;  2HPC B;  1SQV E;  3H1L G;  1TG0 A;  1NYF A;  2OI3 A;  1PPJ D;  3A8G B;  2RH2 A;  2KY9 A;  1VQ7 A;  4J9H A;  1Y0M A;  5AVR B;  4EMK B;  3QUI A;  2QJK B;  2F69 A;  1AEY A;  4FYY B;  4YXD C;  3HRN A;  4A53 A;  3RKY A;  4WY4 C;  4KUL A;  4M77 G;  1SQQ J;  2P4T A;  3RBZ A;  5M9O A;  3I56 T;  4E2F B;  3L72 G;  4ZKP A;  3QKJ A;  1NGM B;  1SS1 A;  4EDF A;  1KQS P;  2LTO A;  3CC4 Q;  1I5L A;  2RA2 A;  2RQU A;  1LT9 B;  2FRY A;  3JB9 H;  2AXT H;  5IHN A;  1SQB K;  3CCV P;  4JJD A;  1KTM A;  1BCM A;  3CXC A;  1K8A U;  1NU1 G;  5KLV D;  1IC2 A;  4JPZ B;  1SSH A;  1LP1 B;  3H0I A;  3V4Q A;  5I21 A;  2KYM A;  2FHD A;  1KSW A;  1AWX A;  2WPR A;  4X9D A;  3AHU A;  1UG1 A;  4JQ0 D;  2QGG A;  3UAT A;  2E5Y A;  1G2B A;  2JEE A;  3OS0 A;  1WXT A;  1NJI C;  3RK3 B;  4JF7 A;  4L6V 5;  1QVF S;  5CBN A;  2XG8 D;  1CSK A;  3GF3 A;  1U7M A;  5KJ7 D;  1YIJ A;  3M0A A;  3OYF A;  2D2C C;  4AYC A;  4C92 A;  3HD7 C;  3UA7 A;  3BCC G;  4D8D A;  1IO6 A;  2L5G B;  1NBE B;  3A0B H;  4DT0 A;  1RF1 B;  2AHJ B;  3CPW S;  1KQ2 A;  2KT1 A;  3CME Q;  4M75 D;  2QJY B;  3TSW A;  5GAN e;  1SQB E;  3FIF A;  3CCU P;  1XTG B;  4PJ0 H;  3CC4 T;  1P84 D;  2YO3 A;  1G3T A;  1IFD A;  2IPP A;  4R4L A;  1JUN A;  3L2V A;  1K73 R;  1L0N E;  2D0Q B;  4FT4 A;  1QP2 A;  5IHI A;  2CZ1 B;  1J1E B;  2YRD A;  3WVE B;  1KIL C;  3D6Z A;  4D6T E;  1G83 A;  2C9L Y;  3TQ7 P;  3C8V A;  1H0T B;  3OW2 A;  3UWN A;  3GHG B;  1PZQ A;  4UB6 H;  1NG2 A;  2WWW A;  4B86 A;  2A7Y A;  1EC5 A;  2O01 J;  1RI9 A;  4Y28 J;  2RN8 A;  3ER0 A;  3TGU J;  1JXO A;  1MMN A;  5APU A;  1HXD A;  2CGH A;  2L0A A;  1TTH B;  3EWK A;  3M0S A;  1GBR A;  2JDI H;  4KGX B;  4JS4 A;  1RAC B;  4OGC A;  5GAN f;  3OA6 A;  1VIF A;  1QVG S;  1SQV J;  4U3F G;  4C8Q F;  2Y0C A;  5KYY A;  1OX8 A;  1QL1 A;  3H1J D;  1JY2 N;  3BE3 A;  1G1J A;  4PK4 A;  1JY3 P;  5AW2 B;  5APW A;  2YT6 A;  3VUZ A;  3CCU T;  3CD6 Q;  4N4G A;  3VKI A;  4C0F A;  1OQK A;  2CRE A;  3B5N B;  5EFW B;  1GL2 D;  2XMF A;  2K9J A;  2QVA A;  3KPE A;  2GM4 A;  5E79 H;  4RKU E;  4GLK A;  2OYH C;  2QEX T;  1Q81 Q;  2WPQ A;  4N0A C;  2WSF E;  1WLP B;  1IJD B;  2KK4 A;  2IVW A;  2HFE D;  1FYN A;  2JZ2 A;  1X8Y A;  5AVU B;  1B34 A;  5TIS H;  3Q1J A;  1UII A;  2FRW A;  2EWN A;  3BRV B;  4DBQ A;  2K79 A;  4OMF B;  5D7U A;  3QPH A;  3N7N A;  2BE7 D;  2DL4 A;  1NJI R;  3CC2 T;  3VP8 A;  1H92 A;  2DTH A;  1UIX A;  1W2B S;  1LTT C;  1FBM A;  4ZN3 A;  1OVV A;  4B9X A;  2N1T B;  2JNG A;  1DD4 A;  3Q5R A;  2YMY A;  3PRJ A;  1RY3 A;  3LLR A;  1SHG A;  2J6F A;  1OVU A;  3EG2 A;  4H13 D;  4OVN F;  4TVR A;  2NUT B;  3NXS A;  4LGD E;  3TF5 A;  2K3B A;  2R58 A;  4M7A D;  1HF9 A;  3GNG A;  5FU7 C;  3M58 A;  1G3S A;  3GPL A;  1XQH A;  1KMI Z;  3PT9 A;  1R0C B;  3HFN A;  3QII A;  1VQ4 Q;  4PJO A;  3WVD B;  1BDD A;  2L3Q A;  1SQB J;  1EXI A;  2COZ A;  1I4K 1;  1K8A Q;  1IB8 A;  1BU1 A;  3H1K D;  3GOX A;  3RK2 C;  3OYL A;  1L0N J;  4JJC A;  1KHI A;  4WY4 D;  3TVT A;  3RER A;  4D6T J;  2KI7 B;  3HUS B;  1SFC C;  4M78 B;  1ZOY C;  4I6M C;  1VQK A;  1UGS B;  3CL3 D;  2FYK A;  2PZ1 A;  1AQT A;  1IFN A;  3H1K E;  2EGA A;  1TU0 B;  1VQ7 Q;  1RH5 B;  1L0L G;  5C39 A;  4KGV B;  2B88 A;  2ZXE B;  1D1A A;  4N4I A;  2C0X A;  5H2F H;  2L3R A;  4GOE A;  2E65 A;  1X6O A;  1QKX A;  1RAA B;  4M7D C;  2YKQ A;  1TUC A;  2SEM A;  4CPG A;  4E7K A;  4HH2 A;  2JS2 A;  5KKZ B;  4H0L C;  3QHS A;  2E6Z A;  1X9V A;  1HD3 A;  3I55 A;  4M4Z A;  3FB9 A;  3JSV C;  2EYZ A;  1SP4 A;  2M0O A;  2CSQ A;  1QQJ A;  4UB8 E;  1GCQ A;  2IBZ G;  5I22 A;  2XND H;  1M1J C;  2HL5 C;  1FWZ A;  4BI3 A;  4NOY A;  5GAN 6;  3CMA Q;  3Q1M A;  4A4E A;  4RKU J;  1SPK A;  4DOV A;  1OW8 A;  4EOT A;  5D6Y A;  1AT1 B;  3A7O A;  2P84 A;  1M8O B;  2JJL A;  2IBZ I;  2WSF J;  4IL6 H;  3OS5 A;  3SWF A;  2R57 A;  1OOT A;  1OFC X;  4LN2 A;  1NTZ G;  1T3J A;  5GAM g;  1VF5 C;  5J26 A;  1FJP A;  3URG A;  2GCX A;  2QK0 A;  4OWF A;  2E42 A;  4J9I A;  1T8Z A;  3JCM d;  1GMJ A;  1N6A A;  5A0D A;  2JXB A;  3H0F A;  4C0D B;  2OAW A;  1QKW A;  4DOW A;  4C5I A;  2W0Z A;  2GUV A;  3A5T A;  1AZG B;  4OP0 A;  5CIU A;  3CPW P;  1YIJ Q;  1WA7 A;  4YXW H;  3MEW A;  3CWB G;  3R2P A;  5AW0 B;  1RAI B;  2YIU C;  3G4S A;  3PTA A;  3JB9 D;  4K11 A;  4GT1 A;  4RMO A;  1BE3 E;  4KUD K;  4OML A;  4C92 B;  2E75 C;  2W90 A;  1KIL E;  1RLP C;  2WVR A;  2D8H A;  5I2S A;  4L5G A;  1BYM A;  4R4M A;  2FYU K;  1GFD A;  3RMQ A;  4OB0 B;  4BD3 A;  3SEM A;  3JC2 2;  1ZP0 C;  1FU1 A;  4AFU C;  1VQM P;  4GY5 A;  8ATC B;  3LW5 E;  3V4W A;  1QVG P;  2AT1 B;  1NHL A;  1HJ0 A;  2JW4 A;  3HHT B;  5APV A;  2V8K A;  2E74 B;  2JM9 A;  1Q7Y C;  3FRN A;  2AZS A;  2DD5 A;  3KZI H;  1RF0 C;  2RN0 A;  1NVO A;  1ZX6 A;  2HYN A;  1YYC A;  5GAN 8;  3L72 D;  1SQX K;  2K2M A;  2KYV A;  6AT1 B;  4XTY A;  1YIJ T;  2OTL Q;  2WPV B;  3MTU E;  3RES A;  1M2O A;  4E7H A;  5BVZ A;  1CW5 A;  3L75 G;  2RJD A;  1RLQ C;  2MYS A;  4IOI H;  4XU2 A;  5LJ3 d;  4E7L A;  4O5V A;  5KYY B;  1YIT A;  2FYU E;  1FDI A;  3C95 A;  3HRU A;  1FX7 A;  4O9B A;  3L74 E;  3MP1 A;  2YWW A;  4JRK A;  1Q82 C;  4C7N A;  2K9Y A;  4F17 A;  5APS A;  1PPJ G;  1HK9 A;  3FX0 A;  1B07 A;  2RHZ A;  1WHH A;  3I9Q A;  1ARK A;  1HGZ A;  1DH3 A;  4E7I A;  4RG8 A;  3I5R A;  4PJ0 E;  4EIK A;  1RF1 C;  3HPW A;  1WZO A;  2O01 H;  3AE7 C;  3SFE C;  4PFZ A;  4OMQ A;  1QP3 A;  5AT1 B;  3M9B A;  1FZA A;  1AHJ B;  5D6X A;  1W2B P;  1MMA A;  2QJP C;  1T0J A;  4ASW A;  1SQX E;  4GLM A;  3VOP A;  4QQD A;  2QAZ A;  1YJN A;  1G5V A;  1GD2 E;  1UHF A;  1B34 B;  3UF4 A;  2Z4E A;  3UT1 A;  1JM0 A;  2OTJ T;  1S72 Q;  1I5O B;  1WYX A;  3BCC D;  2YXY A;  4TT3 H;  3H41 A;  3ZL7 C;  4MMK A;  5J39 A;  4W7Y A;  3S9O A;  5GMK i;  1Q86 U;  4OMM A;  1VQ9 Q;  5CKB A;  2MPX C;  3UA6 A;  4GDO A;  1YHQ P;  1VQ6 P;  2NPS C;  3L42 A;  3L71 E;  1EZV D;  5APY A;  2JJ9 A;  1XJW B;  1L4A B;  1U7J A;  4W7Z A;  3ULR B;  2VRS A;  2EBP A;  2E64 A;  2G3A A;  1KJW A;  1GXI E;  3CX5 H;  4Z89 A;  4XTW A;  3VS4 A;  1HYO A;  4N6J A;  3CI9 A;  2E1H A;  1LWU C;  1MUZ A;  3CCE P;  1BE3 J;  3I56 A;  2RK2 A;  1BIA A;  4RUG A;  5GMK l;  1JJ2 S;  1RQU A;  1KK7 A;  4EYY Q;  1L0N G;  1BGY D;  2R5M A;  4PJO B;  1FZB A;  2ESW A;  1QX8 A;  1Y71 A;  4JZ3 A;  4OF1 A;  2DX1 A;  4WTO B;  4H0L D;  2EJ9 A;  1Q7Y R;  4RCC A;  2R5D A;  1VQK Q;  1YQ3 C;  2EIF A;  2J6K A;  4M75 G;  1WMK A;  3LW5 J;  2KDS A;  4BE2 A;  2MAM A;  4X1V A;  1VQ8 P;  5GAN 2;  4GBQ A;  4D8K A;  1YJW A;  2Q3E A;  1N9S A;  2K9G A;  3C94 A;  3TU4 K;  4M7D E;  2HG5 D;  4XTU A;  4EMK A;  1IXD A;  1Q81 C;  5B5E E;  1ZV8 A;  2JMC A;  2SRC A;  4QMA A;  4Z88 A;  4CC3 A;  1OIP A;  2FYN B;  2CYZ B;  5CBO A;  1M90 U;  3KYQ A;  4IKF A;  4DEX A;  3E7K A;  3GBQ A;  1P84 I;  1X6G A;  2PUK B;  3L2Z A;  1T0H A;  2ZVO B;  2LCS A;  1PL5 A;  3I55 Q;  1Q82 R;  5C0M A;  3EH2 A;  4XA4 A;  3A1P A;  1NYG A;  2YLB A;  2H7H A;  3LWH A;  2DK3 A;  3MUD C;  2XD0 A;  2FYU J;  1GBQ A;  3M56 A;  1VQ5 P;  2I1K A;  3L74 J;  4PD4 E;  1EXJ A;  4KT0 E;  5GAN d;  1RI0 A;  2KSE A;  1LT9 A;  1RAE B;  4LNP A;  3M0D A;  1VQN T;  4F7U G;  1TWB A;  3H1J G;  3EG9 B;  1U5S A;  1S9K D;  2XIC A;  1ZLL A;  4DZO A;  5CCG A;  2KP8 A;  3VTP C;  1M1K U;  3M0P A;  1UEB A;  2ZPF B;  3CCV A;  3WUU A;  3SFM A;  1IFP A;  4ZGD B;  1LTS C;  5CCA A;  5CK9 A;  1M57 D;  3PH0 A;  4ZNX A;  1GW4 A;  2NLU A;  2W6B A;  1KQS S;  1N8R U;  1NTK E;  1SQX J;  1S9K E;  1VQP P;  2JVV A;  2P0P A;  1SLQ A;  2KZI A;  2L3S A;  1K8A C;  3A2A A;  1ZRT E;  3TNU A;  4C7R A;  4PL6 A;  2KXP B;  4RTZ A;  2I8D A;  2PAJ A;  3I55 T;  2F2X A;  4Z8A A;  5GAN 5;  3Q3D A;  2LJ0 A;  4BE0 A;  3G4S Q;  1VQ5 T;  1K76 A;  2DKG A;  3PMT A;  2EKO A;  3SD4 A;  4KBM B;  2YMK A;  2KGT A;  1HUC A;  3P32 A;  3CCL P;  2KR3 A;  3P8H A;  3PVL A;  1BKB A;  2M1H A;  2WSS H;  1YI2 P;  2ITA A;  2M02 A;  3BW1 A;  4CC4 B;  3CCU A;  2XU8 A;  2W83 C;  2L8D A;  4FL6 A;  2IYO A;  2DXB A;  2RNA A;  3VS0 A;  2E10 A;  2WSF H;  3SWK A;  1WXB A;  3GHG A;  2RD1 A;  1U57 A;  2M9U A;  3E1S A;  4M77 B;  4M7A G;  1VL2 A;  2C0I A;  2HQX A;  1PKT A;  1SQP K;  2WTY A;  1ZLM A;  4OB1 B;  2ENM A;  2X4X A;  4ZGE B;  5A2Q E;  1Q81 R;  2KRN A;  2KAF A;  2H3E B;  1Q86 Q;  1YWP A;  3LGF A;  1G3Y A;  4ELY C;  4AUW A;  2O9V A;  3NFC A;  1BDC A;  3H1K G;  1WHG A;  1BSH A;  2M16 A;  1NTM K;  2Y9Z A;  1RAF B;  5FRM A;  1KV4 A;  1W6X A;  1VA7 A;  3G6E P;  5GAO p;  3KFV A;  1GK6 A;  3P8C D;  5LJ3 j;  1SQQ E;  2J59 M;  2Q6Q A;  3SFD C;  2D0N A;  3X20 B;  3BVH A;  4IUQ A;  3B5N A;  2CKK A;  3JCM h;  2J7I A;  4N78 D;  2KS1 A;  1M2V A;  1OI1 A;  1N73 B;  1GU4 A;  3FWL A;  2Q7C A;  3S3M A;  3PLN A;  4V2S A;  4FW1 A;  3EG1 A;  1YTZ I;  1KYO H;  1IFJ A;  2FZC B;  4IFM A;  3FJP A;  1NTZ D;  2GQI A;  3IN6 A;  3OMC A;  2JWD A;  1OU9 A;  4AG1 C;  5GAN 3;  4KT0 J;  1EQ7 A;  1UGV A;  3CXH E;  4DBR A;  9ATC B;  1SQP E;  1CKB A;  4PJL A;  5KYX A;  2QG4 A;  4JBZ A;  2NPS D;  2COY A;  5GMK j;  1JTH B;  2LCL A;  4C8Q D;  1VQO Q;  4MZM A;  2QE7 H;  1TS9 A;  2FBW C;  1YJN Q;  3B71 A;  1J3T A;  2BAS A;  1PG5 B;  5KH6 A;  2QA4 P;  4C46 A;  2ABL A;  1N7S D;  1NTM E;  1X22 A;  1OX3 A;  5A0G A;  1N2D C;  1K8A R;  3M55 A;  2H43 A;  1FDO A;  2JMA A;  1NTK J;  2PTK A;  1M90 Q;  3MIW A;  3GMA A;  2FXM A;  5GAO m;  4FYX B;  4PV1 C;  1SEM A;  4M7D F;  1YIT T;  1J2J B;  3HP9 A;  3PIP A;  2NUT A;  2L89 A;  2DVJ A;  2RHY A;  2JWA A;  2AKL A;  5LJ3 e;  1CI6 A;  2LX9 A;  4VUB A;  1S3J A;  4IL6 X;  1ABO A;  1M3B A;  1UEC A;  1KG1 A;  1LJO A;  4UB8 H;  1PGO A;  4KGZ B;  1LT1 A;  2FFD B;  2Y90 A;  3EHQ A;  1BK2 A;  5KYU A;  1MZ9 A;  5AW7 B;  2BZ8 A;  4IUV A;  3I56 Q;  1WHJ A;  3TGU D;  2ZT9 B;  4CC7 A;  4J6W A;  5LJ3 h;  3PNW C;  3UDC A;  2IDB A;  2QGF B;  3RIR A;  5CHX A;  1LNX A;  1SQV D;  3HUS A;  4FCY A;  5GMK e;  4NS5 A;  1N8R Q;  2P1J A;  2QQR A;  3EFS A;  5K5G B;  2KRM A;  3JB9 G;  3AEG C;  2YHT A;  2KUB A;  2EGC A;  4LD9 K;  1URQ C;  3AE2 C;  5LJ3 f;  1R0B G;  1TUG B;  1YJW Q;  3EAE A;  1QMC A;  2NYS A;  1KZU B;  3RL0 D;  2J5U A;  3C9I A;  4GOD A;  1CKA A;  1I81 A;  2WAC A;  3MJX A;  4NL2 A;  1GDT A;  3VRZ A;  5IT9 E;  3JB9 I;  5GMK h;  2P2U A;  2YNY A;  2KZJ A;  1G3W A;  1WJQ A;  5KCH A;  1H3H A;  2DZC A;  1N27 A;  5AW6 B;  2BCC E;  1Q95 G;  3H8Z A;  1Y96 B;  3NPF A;  2PU9 B;  2PP6 A;  4J6Y A;  1SSF A;  3V8K A;  4I7Z C;  1LTA C;  1FZC C;  4DEY A;  1KOR A;  3CC7 P;  2QYZ A;  3FEO A;  3O8Z A;  3MHX A;  4HA8 A;  3ZFJ A;  3L1A A;  2CP2 A;  2X4Y A;  4JUV A;  3CX5 E;  2CP5 A;  5GAN j;  2X3X D;  1FXX A;  1YQ4 C;  1WJR A;  1AV1 A;  1GL5 A;  1M56 D;  2LVM A;  1VQL P;  2ECZ A;  1RL2 A;  1Y8A A;  5FU6 C;  1SQP J;  3LW5 H;  4AQR D;  3CCJ P;  1WXU A;  3OYA A;  1YJW T;  4LLH A;  5KLV K;  4M78 E;  2A08 A;  2EJG A;  4DBH A;  3BDL A;  1QVF A;  2K5F A;  4PJO C;  2J58 A;  1N86 A;  2FYZ A;  1NTM J;  5KJ7 A;  1ZSZ A;  1S1N A;  3VP9 A;  3PFS A;  5GAN 4;  5KLI C;  2K6D A;  2XKM A;  2DRM A;  2O31 A;  2ZFC A;  3CPW A;  4M75 A;  1SQB D;  3FC3 A;  3BAS A;  3EG3 A;  2RHU A;  1X43 A;  4D6W A;  4FT2 A;  3L71 G;  1A0N B;  3TNU B;  2CPB A;  1OW7 A;  1WT6 A;  1YNZ A;  1L0N D;  2ZPE B;  2RQR A;  4GOF A;  2JS0 A;  1H64 1;  4D6T D;  3CCU Q;  3OYG A;  5M1B A;  1UGR B;  2DXC A;  2EW3 A;  2O1K A;  4A7P A;  2LQ8 A;  1S5L E;  3TSI A;  2R5A A;  2XDP A;  1KFZ A;  5AW3 B;  5CQY A;  3CCV T;  1KQF B;  2HCK A;  1EZV G;  2E6N A;  4ZMD A;  1M3C A;  2DXT A;  2VV5 A;  1DEE G;  2N9Y B;  2QEX Q;  4PLI A;  2QI2 A;  2ROL A;  2VAS A;  4L74 A;  2A06 E;  3B8E B;  1LVK A;  1Z9Z A;  1QVG A;  3RR6 A;  1RAH B;  2PNI A;  5GAN h;  1WDX A;  1LOJ A;  1JOC A;  4F7U A;  1EZV I;  1D09 B;  2M3E A;  4BXL A;  3EFO B;  3AT1 B;  2WT7 A;  3LGL A;  3ITK A;  1E7O A;  4OMN A;  1MV0 B;  1SF9 A;  3PHL A;  1BGY G;  4FW2 A;  3CC2 Q;  4M7D G;  3CME P;  1KD1 U;  1WRG A;  1VYU A;  2DM1 A;  2JTE A;  4J9E A;  2OTJ A;  4QQ6 A;  4J9D A;  1GL2 A;  3RUX A;  3THK A;  2DYI A;  2IG0 A;  2IPO B;  2E76 C;  1PKS A;  1SHF A;  1WQ7 A;  2DTO A;  2BCC J;  3CCQ P;  1ZHI A;  2CZ7 B;  1CZQ A;  4B6M A;  1CSB A;  5KAI E;  4II1 A;  3E9F A;  2XKO C;  4FSS A;  4C92 E;  3LH0 A;  3INZ A;  2VKN A;  3V8L A;  1D1C A;  3SWN A;  2KS1 B;  1M2V B;  2X51 A;  3V2Q A;  2QQA A;  1ZUK A;  3RBB B;  1VYV A;  3AEE C;  2YKP A;  4EI2 A;  4JRQ A;  1D3B A;  2OYI A;  1UTI A;  5CJ0 A;  1YCY A;  1PGQ A;  2D8J A;  1N7S B;  1J1D B;  3I5C A;  3L4F A;  2KYB A;  1W2B A;  3V7R A;  4H44 D;  2NUZ A;  5KYX B;  1YCS B;  2DL7 A;  2FPF A;  4QKU A;  2QDL A;  2QXF A;  3EFG A;  2R3C A;  1D1B A;  1KHC A;  1M8M A;  4LDX A;  1NE8 A;  4OB3 B;  1S5L X;  3CD6 P;  4K35 A;  3OW2 O;  3OQ5 A;  1NTK G;  3UIA A;  3L73 E;  5B5E H;  2FPD A;  2HSP A;  2JUF A;  3E9G A;  1PRL C;  4PJN A;  4KHX A;  5B66 E;  5GMK m;  3T97 A;  1JNM A;  4M7A A;  1I07 A;  1L4A A;  1P92 A;  2YUN A;  2JR8 A;  3OYY A;  1VQ6 A;  4RTU A;  2MOX A;  1GW3 A;  2Y9Y A;  3LX7 A;  1NZ9 A;  1I0C A;  3OJA B;  2O4X B;  3GNF B;  3QG1 A;  1URQ D;  1JQQ A;  3M53 A;  3E1R A;  1Q86 C;  3MEV A;  4PD4 H;  4EIJ A;  2EYY A;  2VC8 A;  1CI6 B;  3PJS K;  4AFQ C;  4A4H A;  4WY4 A;  3QDF A;  2A45 H;  1K05 A;  3A98 A;  1BCC E;  1LTG C;  1KYO E;  3PTZ A;  4OGQ C;  2VB6 A;  5KYU B;  4A63 B;  2IX7 C;  5GAO l;  3NTI A;  1TUD A;  2YSQ A;  4BY6 C;  1VQN A;  2HQE A;  4Z02 A;  5D6W A;  3G7Z A;  4C5G A;  4L73 A;  3OYB A;  2FG0 A;  1T3S A;  1KB9 E;  1MHN A;  2RI3 A;  1ABQ A;  3NTN A;  5LJ5 d;  1JY3 N;  1NM7 A;  3VN0 A;  1ZR4 A;  2R3S A;  3VMY A;  4M78 F;  2W10 A;  1UGQ B;  4FYW B;  1MFT A;  1PGJ A;  2J06 A;  2KB7 P;  2G6F X;  3WU2 E;  3V6I A;  1ZN5 A;  1GRI A;  2HQH A;  1D0Z A;  1OPL A;  1RQV A;  4W80 A;  2CUD A;  3FJ5 A;  1VQ4 P;  1AJY A;  2G8Y A;  1MMD A;  4FIB A;  1MKM A;  4HKE A;  4C0G A;  3M4Y A;  4MDW A;  1SQQ G;  4ANJ A;  3MO8 A;  3BFM A;  1ZUY A;  2YLC A;  5HCK A;  4DQ2 A;  5CQX A;  3EG9 A;  1VQ5 A;  1M90 C;  2MF2 A;  4BE1 A;  2LQW A;  3M0R A;  1SRL A;  3L2Q A;  2X3W D;  3Q5S A;  1V76 A;  2Y4X A;  1G1I A;  2KRO A;  2OTK E;  1VQ7 P;  2RI2 A;  4PJO E;  2HBW A;  2JTM A;  2O01 N;  2D2C D;  3VUB A;  1NPR A;  3HD7 D;  1W4S A;  2DW3 A;  2DF6 A;  1QLY A;  2Q1K A;  3L70 E;  3DKM A;  1VQP A;  2DER A;  3VU3 C;  1KD1 Q;  3OSV A;  2B89 A;  3S3N A;  3X28 B;  2OAR A;  1ZW0 A;  1OWA A;  3ME9 A;  4TLF A;  1VYT A;  2E41 A;  2LJ1 A;  3EHR A;  3GP8 A;  1PFI A;  2KXC A;  4C8Q G;  4RCB A;  1ZSZ B;  1BE3 D;  2WMM A;  3L73 J;  4MZT A;  3M54 A;  4Y99 B;  1USD A;  1QEX A;  2VWF A;  5CKF A;  1KIL D;  4I1L A;  1N8R C;  1N5Z A;  1Q86 R; 
#chains in the Genus database with same CATH homology
 1O9S A;  1PSE A;  2KVQ G;  4N3Y B;  4M75 B;  3H6Z A;  1HBW A;  3BAT A;  4EMK C;  3PIO A;  4HCB A;  4C92 F;  2V8J A;  3MEU A;  4HT8 A;  4M77 A;  5DLO A;  5GAO r;  4B9W A;  4ELZ C;  4BAC A;  2P0K A;  2OYH A;  3O8V A;  3OYD A;  1MFZ A;  1LT9 C;  2DXU A;  3M0D C;  5APX A;  3VYH B;  2MWO A;  5CCG C;  4F7U B;  4PNO A;  4IUU A;  4L59 A;  5BU8 B;  5KE2 A;  2CPS A;  2WT7 B;  3CBP A;  2L5Q A;  2Q3I A;  1N73 A;  1GL2 B;  1MUU A;  4MML A;  3RK3 C;  5AVZ B;  4YTL A;  1NU1 K;  3DB3 A;  3JAM E;  1JTH A;  1M9S A;  1VQM T;  3SWN B;  2Z5I A;  4JRI A;  2POH A;  3GLX A;  3JCM g;  4OVA A;  1LTJ B;  4XAX B;  1D3B B;  2OYI B;  5CCH C;  2EJF A;  3QYH B;  2GFU A;  1U8R A;  1BIB A;  3CEY A;  1J1E C;  3HTK B;  1DX7 A;  1NWQ A;  4XTV A;  3GHG C;  1IO4 A;  2CZ6 B;  2EFI A;  1LTB C;  5CKE A;  3LIE A;  3RK2 D;  2MMP A;  2LKM A;  1HVV A;  2QM8 A;  4M7A B;  3CLQ A;  4ZTF A;  2FFD A;  1JJ2 A;  1Z56 A;  1SFC D;  2XNX A;  5BU5 A;  2XDJ A;  4XU0 A;  1NAF A;  3M9Q A;  4FSX A;  5KCO A;  2N9B A;  2X35 A;  4WY4 B;  4XU3 A;  1RE4 A;  3B5N C;  4CRI A;  1NKN A;  4M7D D;  3R6O A;  1A02 J;  2DD4 A;  5LJ5 j;  3KXT A;  4PJO F;  3QO3 A;  3P8D A;  1H8A A;  5AVS B;  3ZBD A;  5LJ3 g;  3V2N A;  2ZPH B;  1YHQ T;  1VQ6 T;  4RG2 A;  1Y96 A;  2C06 A;  5L8R E;  1XTC C;  5AW1 B;  2DTI A;  4KUI A;  2K5I A;  3JCM c;  3V2P A;  3CBM A;  2VUB A;  1M4Z A;  2N1T C;  3CCE T;  1YTZ T;  4JS5 A;  1FAV A;  1OYX A;  2HD0 A;  4Q5W A;  5KE3 A;  1KQS A;  2ZGW A;  2CS7 A;  1VQL A;  3HD7 B;  3LWI A;  3GIB A;  3CCJ A;  1A02 F;  1VQ8 T;  2FKW B;  3MP6 A;  2YKO A;  3OSS C;  2A3L A;  5LJ5 e;  4E7J A;  1JCC A;  2IFM A;  3KDP B;  2EQM A;  1E5W A;  2WSE H;  1IFM A;  1KIL B;  1QL2 A;  3HUS C;  4M78 C;  3V7C A;  1W2E A;  4ZTJ A;  5CR2 A;  2E43 A;  2DZ9 A;  2GQV A;  5LJ5 h;  4QVC A;  4Y91 A;  3T9N A;  3A8O B;  1JO5 A;  3H32 B;  1FJK A;  4A4K A;  4XTX A;  5LJ5 f;  3TCJ A;  4IUP A;  2PVD B;  3MD0 A;  3DLL A;  1K9M U;  2EYQ A;  3VYI A;  3OYK A;  2HOD A;  2RM4 A;  2BUD A;  4A4F A;  4GKG A;  2X4J A;  1L0L K;  2E5Q A;  4WF2 A;  1KFN A;  1VQP T;  1JY2 O;  3UPU A;  2XHC A;  3DLM A;  4M77 F;  4QVD A;  2OYH B;  4BDZ A;  5AYF A;  2QQ9 A;  3A5Z B;  4P5N A;  3NTH A;  3S3O A;  3CME A;  3MGN A;  4ZN1 A;  4HYT B;  2RI5 A;  5GAN g;  2LQK A;  1Q7Y U;  1LTI C;  5CCH D;  2K5L A;  3CCL T;  3CCQ A;  5KJ7 C;  2FL7 A;  1YI2 T;  4C0D C;  2NPS A;  4MDX A;  4C8Q A;  5AVW B;  1GZL A;  1KD1 C;  4LDU A;  3SWY A;  4M75 C;  4XU1 A;  4A54 A;  1N7S A;  1NTZ K;  3IFM A;  3TEE A;  1LWU A;  3NMD A;  3U1A A;  2MWP A;  1Q82 U;  4C92 C;  3CBO A;  5FU7 B;  3OYH A;  3SB2 A;  1YBY A;  2R5B A;  1VDF A;  1MV8 A;  3M91 A;  4XK8 E;  1M1G A;  4HCC A;  1EIF A;  1U1T A;  3G6E T;  2DPP B;  2RJF A;  4MZP A;  1WNL A;  2BKD N;  2O4X A;  1SFC B;  2IFN A;  2DAQ A;  2P7J A;  2QM7 A;  2XI9 A;  4J7I A;  2M3B A;  2Y4Y A;  1WQW A;  3LID A;  2QQS A;  2K2V A;  4DOJ A;  3F70 A;  2KSJ A;  2LT1 A;  4ATO A;  3OY9 A;  1AFO A;  4M7D B;  3L2W A;  3HSB A;  4EDU A;  2XDD A;  2QA4 T;  3JCM Q;  2EQJ A;  2N1T D;  3SWN C;  5CAI A;  1XOV A;  4JRP A;  2OYI C;  2QTX A;  3V8J A;  3HL8 A;  2RB6 A;  1M5Q 1;  2PVO B;  3IR9 A;  1VQ4 A;  4PLL A;  2DIQ A;  2RJC A;  3U1C A;  3FDR A;  1KC8 U;  3E19 A;  1L4A C;  3VYG A;  4M78 D;  2O1J A;  2DVE A;  2DJZ A;  2WZ7 A;  4E47 A;  4LC1 A;  1AQ5 A;  5FRN A;  1BI3 A;  1FDM A;  4CI0 C;  1DEB A;  1HWT C;  3X24 B;  1O75 A;  1NPP A;  4LDV A;  3CPF A;  3S6W A;  1SVF A;  1JY2 P;  3H6P A;  4BUG A;  1IZ6 A;  3OBY A;  3QBY A;  1HH0 A;  1KQ1 A;  2RJE A;  3OS1 A;  3P8B B;  4ME7 A;  3CMA A;  4QW2 A;  3CC7 T;  2GUS A;  2X4W A;  4ZKU A;  1Y7X A;  1L0N K;  3JCM V;  1FZE A;  4OB2 B;  2YRV A;  4JLI A;  1G2C B;  1VQL T;  4OH8 B;  3KBG A;  1MGQ A;  3CXC S;  3CCJ T;  2PUO B;  2LRQ A;  5I2M A;  4BI4 A;  2KQW A;  2JTF A;  1OXZ A;  2JN0 A;  1M1F A;  4JYC A;  1VQM A;  1ZQ1 A;  4R56 A;  2HOD B;  2BIV A;  3X25 B;  3KUF A;  2QQB A;  2EQU A;  3JCM b;  4M3L A;  2K3Y A;  2RO0 A;  2ZPG B;  2WSE E;  1ZR2 A;  2WPS A;  4C92 D;  2K3X A;  1HGV A;  4XTZ A;  2YO2 A;  4JDS A;  2OAU A;  4EPC A;  4M75 E;  5HY6 A;  2Q9I A;  5CMZ A;  2VYT A;  2NPS B;  2LT4 A;  4C8Q B;  3OW2 S;  2RHX A;  3QYG B;  1VUB A;  1LTJ A;  2M8R A;  3J81 E;  2A45 G;  4IUR A;  1BI0 A;  5GAN 7;  1BI1 A;  5AVV B;  2OTL A;  2KMT A;  3HTK A;  1LWU B;  1XNI A;  3QJ6 A;  1RE3 A;  2LCC A;  1XTD A;  1M7L A;  2A45 I;  2DO3 A;  5GAO n;  3CME T;  4LDW A;  4M77 C;  1URQ A;  4F7U E;  4NL3 A;  4N4H A;  5FRO A;  1YJ9 A;  5AVX B;  2R32 A;  2VGN A;  2JOY A;  5EG2 A;  3CCQ T;  2WSC E;  1YHQ A;  3FLG A;  1HTL C;  3LYI A;  2GFA A;  5A0L A;  5HKC A;  2HNI A;  5AW5 B;  1N9R A;  2ZPB B;  5LL6 S;  3RKX A;  5C6S A;  3HE5 B;  5DLQ E;  5DM7 R;  2XDB A;  1FZG A;  4WB4 A;  3CCE A;  4I2L C;  4QQG A;  1FZC A;  1S72 A;  1N73 C;  3HKS A;  2XID A;  3CCM A;  1VQ9 A;  5GAM d;  1LGH B;  3CD6 T;  3RL0 B;  3V2R A;  5HK3 A;  2MI6 A;  3OYE A;  1VQ8 A;  2H8P D;  1L4A D;  3HRT A;  2G3R A;  1K73 U;  4JJN K;  5APQ A;  3QSU A;  2LC4 A;  2I1J A;  1JMM A;  4M7A E;  2PQW A;  4IFF A;  3E1I A;  1GK4 A;  4PJO D;  4JYB A;  5CO7 A;  3OS2 A;  3HD7 A;  2W6A A;  4GIF A;  2FFD C;  1UB4 A;  4J5Y A;  1T2K C;  3M5A A;  1FZF A;  2D6F A;  1WJS A;  1KIL A;  3A8M B;  3ZEH A;  1M1K C;  3CCR A;  1RE4 C;  2K57 A;  2F5T X;  3J80 E;  1VQ4 T;  3ASK A;  2FB7 A;  3H32 A;  5AVQ B;  3M06 A;  1T3U A;  3OYI A;  2PVG B;  5AW8 B;  5AVT B;  1NJI U;  4R55 A;  3CCL A;  4M75 F;  5IN1 A;  2QDY B;  2Z5H A;  1YI2 A;  3HE4 A;  1VQ7 T;  5LJ5 g;  3X26 B;  2WIT A;  3QJY A;  3PP5 A;  4UC4 A;  4RES B;  4C0Z A;  1JB0 E;  3BY7 A;  3EQ2 A;  3RMS A;  1NOH A;  2H3J A;  1H88 A;  5KTB A;  3VMX A;  1UGP B;  2CZ0 B;  1U1S A;  2XZR A;  1K9M C;  3OMG A;  4N0A A;  4C5E A;  2C9N Y;  1WPY A;  3II6 A;  4EMG A;  4J6X A;  3CMA T;  4F7U F;  1JRI A;  3G6E A;  5APT A;  3M59 A;  5CKH A;  2MJZ A;  1KQL A;  3PGG A;  2XK0 A;  3WXM B;  4M77 D;  2EAY A;  3TRE A;  1JCD A;  4JLG A;  3OB9 A;  3JCM W;  2EQK A;  1WGS A;  2KOG A;  3GF5 A;  4M77 E;  1NO4 A;  2QA4 A;  4XQ3 A;  4M78 G;  4QVZ A;  3L2R A;  1SFC A;  3NFQ A;  2C0W A;  2HBP A;  3MP8 A;  4EMH A;  2HLO A;  1URQ B;  3A8H B;  2LNV A;  3QZ5 B;  2F5K A;  5AVY B;  1VQO A;  3OA7 A;  3OYC A;  1GU5 A;  4M7A F;  3M4G A;  3G3Z A;  4M7D A;  4IFD K;  3EFR A;  1TH7 A;  3G71 A;  3KQG A;  3CCS A;  2OTL T;  2Q5U A;  5GAM j;  1FZC B;  3NTK A;  3A8L B;  1M1J A;  4C8Q C;  2W27 A;  1N7L A;  4C5H A;  4PKC C;  1YJ9 T;  1N7S C;  1J1D C;  3BRT B;  1FOS E;  2KSS A;  5FU6 B;  1BI2 A;  2K4Y A;  1T2K D;  1I8F A;  3C12 A;  3V7S A;  3OYM A;  3JB9 J;  2HPC A;  3JSC A;  1ZBX A;  3TK1 A;  3CC7 A;  1S72 T;  3HRS A;  3VMZ A;  1H3Z A;  3CCM T;  4C92 G;  1VQ9 T;  1X01 A;  2ZPI B;  3OYJ A;  1OZ3 A;  1NTK K;  5CJ4 A;  1KC8 C;  3BDU A;  5GAM e;  4O6J A;  3TYY A;  4BI8 B;  4LD6 A;  3L36 A;  3RL0 C;  4J8O A;  2XV5 A;  5GAM h;  1DJ7 B;  4J7F A;  1RF0 A;  3CC4 A;  1VQK T;  2V8I A;  5GAM f;  1G2C A;  1JBM A;  3JB9 F;  4X34 A;  4DA4 A;  4A4G A;  3DB4 A;  4IUT A;  5CCG D;  1M8V A;  2GF7 A;  3HE4 B;  3OYN A;  3QXE B;  2XU6 A;  3CCR T;  1RF1 A;  5CKD A;  5AW4 B;  3RK3 D;  3L35 A;  1NH4 A;  3QDR B;  5CCH A;  1SQQ K;  3MEA A;  2P67 A;  2DEQ A;  2WSC H;  3P7K A;  2LDM A;  4WBA A;  3U59 A;  1NKZ B;  1IRE B;  4FM4 B;  2QEX A;  4LDY A;  4Y99 C;  3JRZ A;  2HAX A;  1X75 C;  1GTW A;  3JCM X;  2P0Q A;  4BB7 A;  3MCA B;  3JCM e;  3M57 A;  5J3B A;  4XE5 B;  2ZZD A;  2I2L A;  2VXF A;  3SDZ A;  3P8M C;  1IFI A;  1R8O B;  3CC2 A;  3N4X A;  3G4S T;  4PJO G;  1IK9 A;  4ZGJ B;  1V29 B;  2B8A A;  3CD6 A;  4FU6 A;  4BY6 B;  3RK2 B;  4J83 A;  3P8C E;  3OAK A;  3JCM f;  1FOS F;  1PSF A;  4C7N B;  2VXE A;  3JCM J;  3B5N D;  5CVI A;  4X9C A;  4N78 E;  5FLX E;  1HJB A;  3N5B B;  5DY9 A;  1X79 B;  3HFO A;  3HE5 A;  3PMI A;  5HK0 A;  1QW1 A;  3VJP A;  2D9T A;  3VV0 A;  3RKW A;  3A3Y B;  1JY3 O;  2N1T A;  3J7A F;  1GL2 C;  4C8Q E;  5GAO q;  3MUD A;  1QVP A;  2E70 A;  4HCZ A;  2KLV A;  1VIE A;  2VGM A;  1SQV K;  5AW9 B;  1VPC A;  3L37 A;  2RK1 A;  1M1J B;  1Y07 A;  1LTJ C;  3QZ9 B;  2ZCF B;  1H89 A;  3V5B A;  2RHI A;  3WMM 0;  3L2U A;  1VQO T;  4BDY A;  1RE3 C;  4OGE A;  1YJN T;  4M78 A;  2E12 A;  1OZ2 A;  2O01 E;  3OBW A;  4Y28 E;  1Q81 U;  1K73 C;  3M9H A;  3G71 T;  2DIG A;  3JCM P;  2FVU A;  3CCS T;  5IAY A;  1KFM A;  3C4S A;  3MET A;  4HT9 A;  4M7A C;  2HPC B;  3A8G B;  2RH2 A;  2KY9 A;  1VQ7 A;  5AVR B;  4EMK B;  3QUI A;  2F69 A;  3HRN A;  4A53 A;  3RKY A;  4WY4 C;  4KUL A;  4M77 G;  5M9O A;  2P4T A;  3I56 T;  4ZKP A;  3QKJ A;  2LTO A;  1I5L A;  2RA2 A;  1LT9 B;  3JB9 H;  1SQB K;  3CXC A;  1K8A U;  1IC2 A;  3V4Q A;  5I21 A;  2FHD A;  2WPR A;  4X9D A;  3AHU A;  2JEE A;  3OS0 A;  1NJI C;  3RK3 B;  4JF7 A;  4L6V 5;  1QVF S;  2XG8 D;  5KJ7 D;  1YIJ A;  3M0A A;  3OYF A;  4AYC A;  4C92 A;  3HD7 C;  2L5G B;  2AHJ B;  1RF1 B;  1KQ2 A;  3CPW S;  4M75 D;  5GAN e;  3FIF A;  1XTG B;  3CC4 T;  2YO3 A;  1G3T A;  1IFD A;  2IPP A;  1JUN A;  3L2V A;  4FT4 A;  2D0Q B;  1QP2 A;  2CZ1 B;  1J1E B;  3WVE B;  1KIL C;  2C9L Y;  3OW2 A;  3UWN A;  3GHG B;  2WWW A;  4B86 A;  2A7Y A;  3ER0 A;  5APU A;  1HXD A;  2CGH A;  4JS4 A;  4OGC A;  5GAN f;  3OA6 A;  1VIF A;  1QVG S;  4C8Q F;  1QL1 A;  1JY2 N;  1G1J A;  1JY3 P;  5AW2 B;  5APW A;  3VUZ A;  3CCU T;  4N4G A;  3VKI A;  4C0F A;  3B5N B;  1GL2 D;  3KPE A;  2GM4 A;  4RKU E;  4GLK A;  2OYH C;  2QEX T;  2WPQ A;  4N0A C;  2WSF E;  1IJD B;  2KK4 A;  2IVW A;  2HFE D;  2JZ2 A;  1X8Y A;  5AVU B;  1B34 A;  3Q1J A;  2EWN A;  3BRV B;  4OMF B;  3QPH A;  3N7N A;  3CC2 T;  3VP8 A;  2DTH A;  1W2B S;  1LTT C;  1FBM A;  4ZN3 A;  4B9X A;  2N1T B;  2JNG A;  2YMY A;  3LLR A;  1RY3 A;  4TVR A;  3NXS A;  4LGD E;  2R58 A;  4M7A D;  5FU7 C;  3GNG A;  3M58 A;  1G3S A;  3GPL A;  1XQH A;  3PT9 A;  3HFN A;  3QII A;  4PJO A;  3WVD B;  1I4K 1;  3GOX A;  3RK2 C;  3OYL A;  1KHI A;  4WY4 D;  3RER A;  3HUS B;  1SFC C;  4M78 B;  4I6M C;  1VQK A;  1UGS B;  3CL3 D;  2FYK A;  1IFN A;  2ZXE B;  4N4I A;  2C0X A;  2L3R A;  2E65 A;  1X6O A;  4M7D C;  2YKQ A;  4E7K A;  4HH2 A;  3QHS A;  2E6Z A;  1X9V A;  3I55 A;  3FB9 A;  1SP4 A;  2M0O A;  1M1J C;  1FWZ A;  4BI3 A;  4NOY A;  5GAN 6;  4A4E A;  4DOV A;  4EOT A;  5D6Y A;  3A7O A;  2JJL A;  3OS5 A;  3SWF A;  2R57 A;  1T3J A;  5GAM g;  5J26 A;  1FJP A;  3URG A;  2GCX A;  2E42 A;  1T8Z A;  3JCM d;  1N6A A;  5A0D A;  4C0D B;  4DOW A;  4C5I A;  2GUV A;  3A5T A;  4OP0 A;  5CIU A;  3MEW A;  3R2P A;  5AW0 B;  3G4S A;  3PTA A;  3JB9 D;  4GT1 A;  4RMO A;  4KUD K;  4C92 B;  5I2S A;  4L5G A;  1BYM A;  2FYU K;  3RMQ A;  4OB0 B;  4BD3 A;  1FU1 A;  4GY5 A;  3LW5 E;  3V4W A;  1NHL A;  3HHT B;  5APV A;  2V8K A;  1Q7Y C;  3FRN A;  2DD5 A;  1RF0 C;  2HYN A;  1YYC A;  5GAN 8;  1SQX K;  2KYV A;  4XTY A;  1YIJ T;  3MTU E;  3RES A;  4E7H A;  5BVZ A;  1CW5 A;  5LJ3 d;  2RJD A;  4XU2 A;  4E7L A;  4O5V A;  1YIT A;  3C95 A;  3HRU A;  1FX7 A;  4O9B A;  3MP1 A;  4JRK A;  1Q82 C;  4C7N A;  5APS A;  1HK9 A;  2RHZ A;  1HGZ A;  1DH3 A;  4E7I A;  4RG8 A;  1RF1 C;  3HPW A;  2O01 H;  1QP3 A;  3M9B A;  1FZA A;  1AHJ B;  5D6X A;  3VOP A;  4QQD A;  1YJN A;  1G5V A;  1GD2 E;  1B34 B;  2Z4E A;  3UT1 A;  2OTJ T;  4MMK A;  5J39 A;  4W7Y A;  5GMK i;  1Q86 U;  5CKB A;  3L42 A;  2NPS C;  5APY A;  1L4A B;  4W7Z A;  2VRS A;  2E64 A;  1GXI E;  4XTW A;  4N6J A;  3CI9 A;  2E1H A;  1LWU C;  3I56 A;  2RK2 A;  1BIA A;  5GMK l;  1JJ2 S;  2R5M A;  4PJO B;  1FZB A;  1Y71 A;  4OF1 A;  2EJ9 A;  4RCC A;  2R5D A;  2EIF A;  4M75 G;  2KDS A;  4BE2 A;  2MAM A;  5GAN 2;  1YJW A;  1N9S A;  3C94 A;  3TU4 K;  4M7D E;  2HG5 D;  4XTU A;  4EMK A;  1Q81 C;  1ZV8 A;  2CYZ B;  1M90 U;  3KYQ A;  4IKF A;  2PUK B;  3L2Z A;  5C0M A;  4XA4 A;  2YLB A;  2H7H A;  3LWH A;  2DK3 A;  2XD0 A;  3M56 A;  2I1K A;  4KT0 E;  5GAN d;  1RI0 A;  1LT9 A;  1VQN T;  3M0D A;  4F7U G;  1S9K D;  2XIC A;  1ZLL A;  4DZO A;  5CCG A;  2KP8 A;  3VTP C;  1M1K U;  1UEB A;  2ZPF B;  3CCV A;  3SFM A;  4ZGD B;  1LTS C;  5CCA A;  5CK9 A;  1GW4 A;  2NLU A;  2W6B A;  1KQS S;  1N8R U;  1S9K E;  2JVV A;  2P0P A;  1SLQ A;  1K8A C;  3A2A A;  3TNU A;  4C7R A;  4PL6 A;  2PAJ A;  3I55 T;  5GAN 5;  4BE0 A;  1VQ5 T;  2DKG A;  3PMT A;  2EKO A;  3SD4 A;  4KBM B;  1HUC A;  3P32 A;  3P8H A;  1BKB A;  2M1H A;  3BW1 A;  3CCU A;  2XU8 A;  2L8D A;  4FL6 A;  2DXB A;  2E10 A;  2WSF H;  2RD1 A;  3GHG A;  2M9U A;  3E1S A;  4M77 B;  4M7A G;  2HQX A;  1SQP K;  2WTY A;  4OB1 B;  2X4X A;  4ZGE B;  5A2Q E;  2KAF A;  3LGF A;  1G3Y A;  4ELY C;  4AUW A;  3NFC A;  2M16 A;  1NTM K;  5FRM A;  5GAO p;  1GK6 A;  3P8C D;  5LJ3 j;  2J59 M;  3X20 B;  3BVH A;  4IUQ A;  3B5N A;  2CKK A;  3JCM h;  4N78 D;  1OI1 A;  1N73 B;  1GU4 A;  2Q7C A;  3S3M A;  4V2S A;  1YTZ I;  1IFJ A;  4IFM A;  3FJP A;  3OMC A;  5GAN 3;  1EQ7 A;  2NPS D;  5GMK j;  1JTH B;  2LCL A;  4C8Q D;  4MZM A;  2BAS A;  5KH6 A;  4C46 A;  5A0G A;  1N7S D;  1N2D C;  3M55 A;  2H43 A;  3MIW A;  2FXM A;  5GAO m;  4M7D F;  1YIT T;  1J2J B;  3HP9 A;  3PIP A;  2L89 A;  2RHY A;  5LJ3 e;  1CI6 A;  2LX9 A;  4VUB A;  1KG1 A;  1LJO A;  2Y90 A;  2FFD B;  1MZ9 A;  5AW7 B;  4IUV A;  4J6W A;  5LJ3 h;  3PNW C;  3UDC A;  3RIR A;  5CHX A;  1LNX A;  3HUS A;  5GMK e;  4NS5 A;  2P1J A;  2QQR A;  3EFS A;  3JB9 G;  2YHT A;  4LD9 K;  1URQ C;  5LJ3 f;  3EAE A;  1KZU B;  3RL0 D;  4NL2 A;  3C9I A;  1I81 A;  2WAC A;  1GDT A;  5IT9 E;  3JB9 I;  5GMK h;  2P2U A;  2YNY A;  1G3W A;  1WJQ A;  5KCH A;  2DZC A;  1N27 A;  5AW6 B;  3H8Z A;  1Y96 B;  2PU9 B;  2PP6 A;  4J6Y A;  1SSF A;  3V8K A;  1LTA C;  1FZC C;  3FEO A;  3MHX A;  3O8Z A;  4HA8 A;  3ZFJ A;  5GAN j;  3L1A A;  2X4Y A;  4JUV A;  1FXX A;  1WJR A;  2LVM A;  1RL2 A;  5FU6 C;  3LW5 H;  4AQR D;  3OYA A;  1YJW T;  4LLH A;  5KLV K;  4M78 E;  2EJG A;  3BDL A;  1QVF A;  2K5F A;  4PJO C;  2J58 A;  1N86 A;  2FYZ A;  5KJ7 A;  3VP9 A;  3PFS A;  5GAN 4;  2XKM A;  2ZFC A;  3CPW A;  4M75 A;  3FC3 A;  3BAS A;  2RHU A;  4D6W A;  4FT2 A;  3TNU B;  2CPB A;  1WT6 A;  2ZPE B;  1H64 1;  3OYG A;  1UGR B;  2DXC A;  2O1K A;  2LQ8 A;  3TSI A;  2R5A A;  2XDP A;  5AW3 B;  5CQY A;  3CCV T;  2E6N A;  2DXT A;  2VV5 A;  4PLI A;  2QI2 A;  3B8E B;  1QVG A;  5GAN h;  1LOJ A;  1JOC A;  4F7U A;  2WT7 A;  3LGL A;  4M7D G;  1KD1 U;  1WRG A;  2OTJ A;  4QQ6 A;  3RUX A;  1GL2 A;  2IG0 A;  1WQ7 A;  2DTO A;  1ZHI A;  2CZ7 B;  1CZQ A;  1CSB A;  4II1 A;  3E9F A;  2XKO C;  4C92 E;  3LH0 A;  3INZ A;  3V8L A;  3SWN A;  3V2Q A;  2QQA A;  2YKP A;  4JRQ A;  1D3B A;  2OYI A;  5CJ0 A;  1YCY A;  1N7S B;  1J1D B;  3I5C A;  3L4F A;  1W2B A;  3V7R A;  2QXF A;  3EFG A;  2R3C A;  1KHC A;  4LDX A;  1NE8 A;  4OB3 B;  3OQ5 A;  3UIA A;  3E9G A;  2JUF A;  4KHX A;  5GMK m;  3T97 A;  1JNM A;  4M7A A;  1L4A A;  1P92 A;  3OYY A;  1VQ6 A;  1GW3 A;  3LX7 A;  1NZ9 A;  2O4X B;  3OJA B;  3QG1 A;  3GNF B;  1URQ D;  3M53 A;  1Q86 C;  3MEV A;  4EIJ A;  2VC8 A;  1CI6 B;  4A4H A;  4WY4 A;  2A45 H;  1LTG C;  2IX7 C;  5GAO l;  3NTI A;  4BY6 C;  1VQN A;  2HQE A;  4Z02 A;  5D6W A;  3G7Z A;  4C5G A;  3OYB A;  1MHN A;  2RI3 A;  5LJ5 d;  3NTN A;  1JY3 N;  3VN0 A;  1ZR4 A;  3VMY A;  4M78 F;  1UGQ B;  2KB7 P;  1ZN5 A;  4W80 A;  4FIB A;  4HKE A;  4C0G A;  3M4Y A;  4MDW A;  3MO8 A;  3BFM A;  2YLC A;  4DQ2 A;  5CQX A;  1VQ5 A;  1M90 C;  2MF2 A;  4BE1 A;  3L2Q A;  2Y4X A;  1G1I A;  2RI2 A;  4PJO E;  2JTM A;  3VUB A;  1NPR A;  3HD7 D;  1W4S A;  3DKM A;  1VQP A;  3VU3 C;  3S3N A;  3OSV A;  3X28 B;  2OAR A;  1OWA A;  3ME9 A;  2E41 A;  3GP8 A;  1PFI A;  4C8Q G;  4RCB A;  4MZT A;  3M54 A;  4Y99 B;  5CKF A;  1KIL D;  4I1L A;  1N8R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...