3M9QA

Drosophila msl3 chromodomain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
LRDETPLFHKGEIVLCYEPDKSKARVLYTSKVLNVFERRNEHGLRFYEYKIHFQGWRPSYDRAVRATVLLKDTEENRQLQRELAEAAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein male-specific lethal-3
publication title Corecognition of DNA and a methylated histone tail by the MSL3 chromodomain.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 22
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3m9qA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3m9qA01
2R58A 4C5EA 2M16A 3FC3A 5FROA 1NTMK 3DB4A 3H6ZA 2X4XA 2HQEA 3OYIA 3L42A 2FYUK 2E5QA 2LDMA 3NTIA 3NTHA 4IURA 2OARA 3FEOA 2DIGA 3PFSA 3QKJA 2LCCA 4QQGA 4A4GA 5D6YA 3LW5H 3OYDA 2B8AA 2K3YA 3ME9A 4HCZA 5IN1A 4N4GA 4UC4A 2DIQA 3META 3EAEA 3OYMA 1OZ2A 3MP8A 3LX7A 3OY9A 2EQMA 2F5KA 2D9TA 2LVMA 2BIVA 2EQUA 2FHDA 3H8ZA 2QQRA 3OQ5A 4BDYA 2XDPA 3MEAA 5J26A 3OS1A 2EFIA 3UT1A 3OYHA 2RHXA 3E9GA 5KH6A 3PMIA 5IAYA 3MEWA 3PNWC 2BUDA 3OYNA 3DLMA 3P8HA 2J59M 1NTZK 2M1HA 2P0KA 3LLRA 2R5MA 3C4SA 5CIUA 2LTOA 5KE3A 2EQKA 2JTFA 2RHIA 3LH0A 2XK0A 3OYGA 2RO0A 4QQ6A 1SQPK 3ASKA 2JZ2A 3L2QA 2EKOA 3F70A 4QQDA 4L59A 4BACA 4Z02A 1L0LK 3BDLA 4NS5A 3S6WA 2WSEH 4Q5WA 4IKFA 4GY5A 4IUPA 2LRQA 4BE0A 3P8DA 2EQJA 2RI3A 3MEVA 5D6WA 2G3RA 2HQXA 1SQQK 1SSFA 2WACA 3CEYA 4IUTA 4A4HA 2RI2A 4LD6A 2L89A 4IFDK 2IG0A 5C0MA 4E7IA 5KE2A 1SQVK 2RJDA 2QQSA 5KCOA 1SQXK 1WJRA 2WSCH 3UWNA 5J39A 3OYKA 3OYCA 3L2VA 4N4IA 2MWOA 3S3MA 3ZEHA 3OS0A 3OMGA 4E7JA 1RI0A 3KUFA 4IUQA 1NTKK 3LGFA 3MP6A 4EDUA 2E6NA 4BE2A 1OYXA 2X35A 3OYLA 1OI1A 2M0OA 3L2UA 1WJSA 4ZTFA 2VYTA 4X34A 4C5HA 2R57A 1N27A 3QJ6A 4BE1A 4BDZA 2RJEA 3MO8A 2GFUA 3M9QA 4FL6A 4OVAA 2RI5A 3E9FA 3OS2A 3S3OA 4PLIA 4E7LA 1OZ3A 2CKKA 2RHYA 3GOXA 1WJQA 5M9OA 3CLQA 2RJFA 4N4HA 3OYEA 2RHUA 5FRNA 2BKDN 4A4EA 2X4WA 3FDRA 1XNIA 4PL6A 4PLLA 3OYFA 3S3NA 2O4XB 3G3ZA 2GF7A 4QW2A 3MP1A 1L0NK 1SQBK 3FLGA 4BD3A 1G5VA 5C6SA 1MHNA 2GFAA 2RHZA 2RJCA 4A4FA 2YRVA 3QIIA 3OB9A 4B9XA 3OYBA 4B9WA 2LKMA 1H3ZA 4C5GA 2X4YA 2L8DA 3DB3A 2O01H 5D6XA 5FRMA 3NTKA 2DAQA 4CRIA 4II1A 2L3RA 3MEUA 4E7KA 3OMCA 2WSFH 4IUUA 3LGLA 4RG2A 3OYAA 3Q1JA 3L2WA 2MWPA 4IUVA 3OYJA 3LYIA 3QBYA 4FU6A 3SD4A 1WGSA 3O8VA 4QVZA 3OA6A 1KHCA 4E7HA 3PMTA 4ZTJA 3L2RA 2NLUA 1NU1K 5KLVK 5KCHA 2O4XA 2R5AA 2PQWA 2K3XA 4C5IA
chains in the Genus database with same CATH superfamily
4C5EA 1IHWA 4Y28J 5FROA 3CX5I 4KUIA 2V8IA 2Z0WA 2AXTE 4Z88A 3NTHA 3MTUE 2K2MA 2KVQG 2V1QA 4TT3H 2G8YA 2SPZA 3JCUE 1I81A 2KT8A 3RBBB 3A8HB 5LJ3e 1A02J 1JQQA 3PGGA 2HBWA 1SRLA 2D6FA 5EG2A 1FZGA 2EJFA 2VWFA 3CXHD 5IN1A 5E79E 4U3FE 4UC4A 2QGFB 3CCMQ 2W8ZA 3LW5J 1GCQC 1YCSB 1LTIC 2EQUA 2L5QA 1EZVD 5CCGD 2KOGA 3WUUA 1N9SA 5CKBA 3OYNA 5I22A 4C92E 3H32B 1NZ9A 1YJWA 3CC7Q 1Q2NA 4OB3B 2Q1KA 4OMLA 2OAUA 1FAVA 4PJLA 3UATA 1RAHB 1A02F 1NTKD 2LMJA 3VYHB 1KSWA 2C9LY 2LRQA 1NYGA 3HRTA 5HKCA 1NBEB 3F5HA 1QP3A 4F17A 3RKXA 2YXQB 4HB1A 1D1BA 2NWMA 4C92B 2RI2A 1IXDA 1LT9A 3Q5RA 4IFDK 1G3TA 1U7MA 1QKWA 3CCUT 4M77F 3UWNA 5CKHA 5FWBA 3L2VA 3ZEHA 1WNLA 1MFTA 4XTYA 2H7HA 1RUWA 1BE3E 3OYLA 3KQGA 2JJ9A 4KH0B 5GAMh 1FZCA 3L75G 1H92A 3RMQA 1ZR2A 2ZT9B 1N27A 5KKZC 3MO8A 1MMNA 2WWWA 1ZA1B 3GNFB 1VQMT 1L2PA 4WCIA 2KS1A 5M9OA 3MUDC 4L73A 2K5LA 4WY4A 3A2AA 4Y91A 4OB0B 4RMOA 4UB8H 1VA7A 4AFSC 1TOVA 3D6YA 2YMYA 3A8OB 1TU3F 1NKZB 5KTBA 3O5ZA 3RGUA 1AVZC 1SQBG 5LJ5j 4A4FA 1KFZA 3HRSA 3N7NA 3EHQA 3HUSA 1D0ZA 2JM8A 1LJ2A 2DYBA 4OMPA 2DAQA 1TU0B 2LX7A 4E7KA 3CMAQ 1G3YA 5GAMj 2CK3H 3QWYA 3L2WA 2W0ZA 1YHQA 2CP5A 3AEEC 1T3SA 2K4YA 2FYNC 5HY6A 3IR9A 3CCET 1N7SA 3PVQA 4EMHA 4BUGA 3UA6A 1NU1G 1IREB 4M75D 2NZ2A 2J06A 2A45I 2RK2A 1HTLC 2ZCFB 2ZVOB 3IF4A 4WB4A 3RNJA 5GAN7 3VS3A 2FB7A 2B9BA 1JXMA 1J1DC 3JCMV 3OJAB 1LP1A 1RH5B 3M58A 2K6DA 3CCSP 2K3YA 3VS7A 1Q7YC 2LXBA 3G6EA 4DJGA 2GGRA 1LT1A 3B71A 1HWTC 2JDIH 3CL3D 1UEBA 5BU8B 3OAKA 1K9MQ 2D0NA 2K3RA 3A8MB 1GMJA 2ABLA 4LN2A 4CC2A 3L75J 1OVVA 1FZAA 2IBZD 3CMAT 2GUVA 2W10A 5GANg 5HCKA 2RHXA 4ZMDA 4AYCA 2LQ8A 2PVDB 3T97A 1FWZA 4JYCA 1NH4A 2RN8A 3I55P 3CX5H 1BIBA 3CC2A 1SQXD 3LH0A 2BTTA 3ITKA 1WHLA 1FDIA 2QXFA 2WSEE 3QZ9B 1D0YA 4D8DA 2E3HA 5M1BA 1RLQC 3CCRQ 2M51A 2CH4A 2QTXA 4PJ0E 3I56P 1SQBJ 2DLPA 4M75C 1M1KQ 3CPFA 1XOVA 3P8DA 1FZCB 5C39A 1IZNB 2K7AA 1S3JA 1NOHA 2KSEA 2LCSA 3OA7A 2AT1B 3CEYA 2QASA 2IG0A 5AVVB 5KE2A 1UG1A 2KS1B 2QQSA 1Q81R 3L72G 4WY4B 3REBB 4B6MA 2K5FA 2A06G 2ED0A 3OYCA 1HSQA 2L2PA 4M7DD 2QEXA 1NTMD 3KUFA 1RAGB 1V76A 2XG8D 1NU1J 2PTKA 1KZUB 3M0RA 2DA9A 4Z8AA 2KNBB 5CR2A 1SQPG 2BEQD 2EWNA 3HUSB 2QQAA 2RD1A 4OWFA 1I5OB 1PPJD 2E12A 5B5EE 3OW2S 3QJ6A 1YQ4C 1S5LH 2RI5A 2EGCA 3CCVA 3RK3E 3CCRT 4K11A 5AVRB 1VQ8Q 1VQKT 1N7SB 1Q7YU 4QVCA 1IGQA 3OYFA 2CGHA 4XA4A 2R3SA 3EH1A 2NUTA 1JJ2A 3U59A 3AT1B 2FFDA 4WWIA 2IPPA 3H1IE 1JY2N 2Y4XA 3A8LB 1LP1B 1N8RQ 1KFMA 2O01H 2Q5UA 2HR3A 1QMCA 5GTHE 1UGVA 3VS5A 2PUKB 2E75B 4C0GA 3OMCA 3WVDB 4OMOA 3CPWS 3QYHB 1Y9BA 2N1TD 3II6A 1YJ9T 1R5SA 3EGUA 3EGXA 3G4SA 4L6V5 4JLGA 1VQ9T 4XAXB 1M1JA 1Z9ZA 1XTCC 2R5AA 2ESWA 3H0HA 1UGPB 4FW2A 1GL5A 2ROTA 4DZOA 2YUPA 2YUNA 4R4MA 4XK8E 3H1LD 3T97B 4FSXA 1VQ8T 1NTZE 1EXJA 1UIIA 3ZL7C 1K8AR 5BVZA 2RQVA 2FKWB 4QQGA 3QKJA 3L72J 1AA0A 1MV3A 2CPSA 3LW5H 3JB9G 1WHKA 1ZN5A 2LR2A 1HJDA 1SQPJ 3L73E 4XTXA 4FW1A 4RO0A 1OWAA 2WMMA 1OV3A 5FU6B 2EGAA 3G4ST 5J26A 3NMDA 3H1HG 4BRYA 2R44A 1W1FA 2C0XA 2IZ0A 1PHTA 2DILA 3C95A 3EFSA 1K73Q 2A45H 2Q3IA 5IH2A 4FYVB 1VYTA 4M77A 4N3YB 2LTOA 1FMVA 1LVKA 2N1TC 1M27C 3QH9A 4C8QG 1T8ZA 1FBMA 5AVUB 1M90C 1VQ6A 1K0SA 4PJOD 4NS5A 2E5TA 1LWUB 4NPFX 2RI3A 1VQ4P 3PIOA 3HFOA 2AZVA 1E6GA 1Y07A 1QX8A 2LNVA 3SHWA 3J80E 2HYNA 1Y8AA 3EFFK 3RIRA 1VQ5Q 1GFDA 1YYCA 3CMET 1KD1Q 3OS0A 3HE5A 1MKMA 2ECZA 1WHGA 2DTHA 4RKUJ 5APUA 2BCCE 2FYUE 1HXDA 2VGNA 2NUTB 4HCKA 1WHJA 3LIEA 1VQNP 2FFDB 1NJIQ 3EG3A 2FPDA 4KGXB 1FXXA 2CDTA 4A54A 5GAOq 1WX6A 2I1JA 3S3OA 3CCLT 3JB9J 1WJQA 1X2KA 1XJWB 2P4RA 2RHUA 3QG1A 2BKDN 4A4EA 1QVFS 1M1JB 4OP0A 3EFGA 1PZQA 2JKVA 2QG9B 1LT9C 3WXMB 5AW1B 2E74D 1JY3P 2F2WA 3DKMA 1VF5B 3INZA 3CCJP 3H1HJ 3L70G 2X4YA 1JB0J 1VQ5T 2QJKB 1VQLP 1X22A 1GL2D 1W2EA 3H1KD 5AVTB 5H2FH 1M1GA 1M3BA 1ZSZC 5LJ3g 3RESA 4C7NA 1IFPA 3VOPA 2O88A 4JBZA 4K35A 2AKKA 2XNDH 2QJPC 1JNMA 1FZCC 1AWJA 3JB9F 3MHXA 1IK9A 4ASVA 2WPSA 1M90U 2Y0EA 3PLNA 4U3FJ 4M4ZA 1AD5A 3AEFC 1EDLA 2KYBA 1X79B 2QYZA 4FM4B 4XFJA 1QVFO 4M7AD 1SQVD 4BRYB 1LTBC 3MGNA 3FJ5A 1GTWA 2KYVA 1VYUA 2ZJSE 2CP3A 3CCSQ 1KFNA 1S9KD 3TQ7P 3RL0B 1PRMC 2RF0A 3X25B 1UIXA 2HBPA 1YJNT 4W7YA 4J9CA 3A0HH 3HSBA 3HUSC 5L8RJ 1EDKA 1LTGC 5DLOA 2NPSB 4Z1MH 4FYXB 3EFOA 4C8QF 1YITA 3EAEA 3OBYA 3OYMA 2QG4A 2XICA 2CREA 2PUOB 2E74C 4OVNF 4AFZC 3OQ5A 1RE4A 5APXA 5AW9B 2QQRA 3M55A 2EYYA 2YRDA 3I55Q 1J3TA 2DJZA 1MMDA 2O9VA 3GG2A 3VUZA 2NUZA 2D2CB 1AOJA 3PP5A 4JS5A 1NTZK 3CX5D 2P0KA 1OOTA 3VMYA 3HE5B 3NXSA 1KQFB 1W2BS 1OQKA 2AKLA 3U23A 3I56Q 3MP7B 4I7ZB 2GQIA 3URGA 1VQ7T 4AQRD 4D6WA 1NEGA 1H8KA 1QKXA 3REAB 3FB9A 4LUDA 2HODA 4BE0A 3L70J 4H44B 2RM4A 2ZZDA 5D6WA 4HYTB 1W2BP 1YFNA 2B87A 4GOFA 4MMKA 5A0LA 1M9SA 4B86A 3H0IA 1HYOA 3HE4A 5KLIB 4N6JA 3CCUP 2HAXA 3MIWA 1X43A 4D6TG 2KXDA 4RTZA 2RNAA 4IUQA 2IIMA 1G1JA 2Q7CA 5CCGA 3BFMA 2H3JA 3EG9A 3M0TA 1RE3A 2EAYA 2CSIA 1C0MA 1CZQA 2OYIB 1Y7XA 2DFUA 2QQ9A 2ZYGA 2KDSA 3PHLA 2KNCA 1VQMP 4D8KA 3MUDA 3OS2A 1QL2A 2L5GB 4C7NB 4ZNCA 1X6BA 3LWHA 2COYA 3HL8A 4OB1B 4EDFA 3VUBA 2VUBA 1KQSS 3V2PA 1OU8A 5GMKh 4BD3A 4FT2A 1T6AA 2WPRA 2HSPA 2I0NA 3GF5A 3KFVA 2DL8A 3JCMh 1MMGA 1QVGA 3RK2D 2CP2A 1RF0A 3C94A 4RESB 3BCCE 3CCEP 2OTLT 2RMZA 3EFOB 1VF5D 2P84A 4JJDA 5GMKl 3A8GB 2JS2A 4HVVA 2M8RA 3PTZA 2KSJA 4HJGH 2DE0X 4AUWA 1H0TA 2Y0CA 4H13D 2W83C 2Z4EA 1BCOA 3H1IG 3V7RA 2B86A 2DIGA 1PM3A 2D8JA 4D6TJ 1K0XA 2FFDC 2YDLA 2BZXA 3CXHE 3R4YA 3EHRA 2JNGA 2AXCA 2GQVA 1QWEA 2ZPEB 2HODB 4M77D 3CMAP 2D9TA 1EZVE 1G2BA 2B87B 2P0PA 3Q5PA 1SQQD 2VB6A 3HE4B 3JRZA 1BDCA 2XDJA 3G9RA 5IHNA 3RK2C 2OTJT 2DTOA 1JO8A 3GPLA 2RHIA 4O6JA 2H43A 3CCQA 1NTKE 1VF5C 1QLYA 3NMZC 1W6XA 4M75A 2OAWA 3VKIA 1VQ4Q 5DJUB 2QJKC 2D0QB 1VQOT 5CVIA 2KZJA 5KKZB 1YI2Q 3AHUA 2MIOA 1N9RA 2WACA 3L73G 2KNCB 4CC4B 4H13C 3VYIA 1OMIA 1QW1A 5GMKi 4PJNA 1RABB 4LD6A 3FIFA 5AVZB 3L74E 1TUCA 1BKBA 2QI2A 1KB9H 5APSA 1MFZA 2Y9YA 3CD6A 3Q2YA 4X1VA 4N4IA 3OMGA 1VQNQ 1Y96A 3S4RA 4BWNA 3QWXX 4OMMA 3G1JA 3MP6A 1GU5A 3B8EB 2FYZA 2X35A 4M7AF 5GANd 3BVHA 4M77C 2DL5A 4PFPA 3E19A 1YNZA 3JB9H 4Y99C 3H1IJ 2K9JA 4FL6A 3BE3A 3CCRP 5APQA 1VQKP 1PRLC 2QA4A 1M8MA 2KAFA 4OGEA 2UWJE 3OYEA 4XTZA 3G71Q 1YI2T 3AE9C 3L71G 1Y0MA 2P2UA 4XTVA 1BCCG 4ZGJB 5CBOA 4QW2A 3FXDA 1NWQA 2D2CC 1MMAA 1J1DB 2CP6A 2GFAA 2K79A 1H0TB 2CS7A 3OB9A 3QIIA 1VQLQ 1QCNA 2ED1A 5DLQE 2FXOA 3QDRB 2DO3A 3CXCP 1NG2A 3JCMf 2YNYA 2XHCA 1TUDA 1WDXA 1JEGA 4M7DA 1YJ9P 3CCMA 5BU5A 5E79H 1G83A 1VQ9P 1J1EB 3GF7A 3L36A 2IFMA 5AW5B 2XNXA 4M75E 1JTHA 1K05A 1GK6A 3Q3DA 3L73J 1U57A 3O6QA 1VQ8P 3GNGA 2DTIA 2VXEA 3M91A 3DLLA 3C12A 1YIJT 1D0XA 1AHJB 4YTLA 1JRIA 2SEMA 3FEOA 3QPHA 4XU2A 3VU3C 3X28B 3CC7A 1Q82C 3BY7A 3PE0A 1UE9A 1O9SA 1QL1A 3SFDC 3OYDA 1EX4A 1G3WA 4M75B 2WPVB 3L75D 2DL4A 3GHGA 3G4SP 3HP9A 3FJPA 2IBZE 1AZGB 1RACB 3H8ZA 4X9DA 2RQRA 1I5LA 1MGQA 3UT1A 3OYHA 3SDZA 3GLMA 1M56D 4JLIA 3TGUG 2KZIA 1SQXE 2B89A 2N1TA 3M0SA 1SQBD 1QP2A 3L2QA 1Y96B 4W80A 2HL5C 5IXBA 3L71J 2BE7D 4LDXA 1BCCJ 2Z5IA 1CW5A 2FVUA 1Q86C 4R4LA 2YXYA 4GY5A 4EYYQ 3NFQA 3FWLA 1G1IA 3CCUQ 3SFMA 2K9JB 3IQLA 2PZ1A 1VQPT 2DXUA 4L75A 3JCMW 2LCLA 3V5BA 1Q81Q 2AHJB 1NU1D 3CMEP 8AT1B 1KC8C 1YTZT 1RE4C 2E41A 2JUFA 4M7DE 2AZSA 1NTME 3VP9A 2DF6A 4VUBA 1IFJA 3SWNA 2YKPA 2J6OA 1NTKK 3LGFA 2A36A 1UECA 2JS0A 1CSKA 2E6NA 1KYOH 3C1LA 2JXBA 4R55A 1PPJE 1VQMQ 3JCMc 2LZ6B 1AV1A 1L0LG 4HKEA 2N9BA 3CCLP 5GAOr 2DX1A 3EG1A 5B66E 4ELYC 5GANj 1Q82U 3SB2A 4ZN1A 4M7DB 1DD4A 3KZIH 2V7QJ 2FPEA 1JJ2S 5APWA 4AFUC 4PJOA 4J6YA 5I2SA 2J5UA 1JTHB 2GF7A 5LJ5h 2ZXXA 3N5BB 3O6QB 3TEEA 2OI3A 4RTXA 2LKMA 5GTIE 1VQ5P 1M4ZA 4B9WA 4ESRA 4N78D 2L8DA 1ZSZA 3TGUJ 4W7ZA 1HD3A 1OEBA 2HL3A 4ELZC 5FRMA 4JUVA 3CCEQ 1HH0A 2CH4W 2QSIA 5CCGC 1M30A 5AT1B 1R8EA 2DD5A 1VIEA 1RE3C 2Y4YA 3V7CA 4NOYA 1L4AD 1X75C 1JO5A 4XTWA 3CWBG 3GHGB 3KDPB 5KCHA 4E2FB 3MCAB 1Q86U 3H0FA 4IL6H 1D7MA 3QXEB 1P84E 3L72D 3H1LE 2A06D 1YBKA 2A37A 4JQ0D 2ZPHB 3U1AA 3I35A 1L0NG 1LNQA 2N1TB 1K8AQ 1NLOC 1Q7YR 1AWOA 1GBRA 4NL2A 1YJNP 1AWWA 2F69A 1KC8U 2RKLA 1D1CA 3CC4T 1SQPD 1M3AA 1BGYG 2LJ0A 3X24B 3HD7A 2BZYA 1PGOA 2L91A 3VN0A 2E76D 1VL2A 1PD0A 2DIQA 2L0AA 2HMAA 5CMZA 4LDYA 2EQMA 4HKZH 1SHFA 2F5KA 1RF0C 4CPGA 1PNJA 1L0LJ 1GL2A 1WPYA 4KGZB 3RDVA 5LJ3d 3PMIA 2XDDA 1PP9G 3H1JE 1NPPA 3M9BA 5DY9A 4PV1D 4EIJA 2PVOB 4YTPC 2EQKA 1GDTA 4KULA 1OW8A 3SWNB 1VQ7P 3VS1A 1Y47A 1L4AC 4IOIH 1FOSF 4PJOE 1LCKA 1BYMA 1QVPA 1MV8A 2DZ9A 4M7AA 3X20B 2HKNA 2DRKA 4IKFA 1ZW0A 3A0BH 3VP8A 1J1EC 2J7IA 1M5Q1 3RL0g 1OXZA 1KB9D 2RJDA 4UB6H 1IZ6A 4PJOB 2KLUA 1SQXK 1LT9B 2KEAA 1X01A 3QYGB 3CWBJ 2O2OA 1URQA 2ITAA 3RBZA 2K3BA 2E76C 2DL7A 4PD4I 4YXWH 2LX9A 4ZKUA 3M5AA 1FMWA 1BCMA 5A0GA 2ZAEA 1YJWT 1ZSZB 3JB9D 1IJDB 1FU1A 2E5KA 2RH0A 1CI6A 2EBPA 2FZKB 4J6WA 1L0NJ 4C5HA 1VQKQ 4KJMA 2G3AA 3BASA 2C0TA 2QJPB 4PV1C 1ZBJA 1M1FA 4UB8E 2JJLA 1BGYJ 2KMTA 4DEYA 3L74G 3K5BA 5KLVE 1XNIA 2MK5A 2VC8A 3H1HD 1BDDA 1SG5A 5AVSB 1IRXA 3MP1A 4DBHA 1H3HA 5LJ5f 1K1ZA 1H3ZA 1RAIB 3IAOA 3E1SA 3P7KA 4ME7A 1PP9J 1S72A 4C8QD 5GJWB 1YJ9Q 1VQ9Q 2OTLP 4C0FA 2WSFH 2JEEA 4DEXA 5GAMf 2XIDA 2EYQA 1T2KD 1EIFA 3HD7B 3JSVC 2XZRA 3LIDA 3V6IA 2E74B 3P8CD 1WGSA 4Z89A 5A0DA 4ZTJA 2E5YA 4X9CA 4RTVA 2LQWA 4IL6X 2YUOA 1SQVE 2K3XA 1GL2B 3OW2P 3HRUA 4AMCA 1S9KE 2E42A 5LJ3h 5TJHA 2V8KA 3NHNA 4I2LC 5L23A 2LCCA 1K4US 2P1JA 2ZXEB 4HT9A 3GLXA 2A28A 1WYXA 1N86A 5KYWA 4M78G 2MYSA 4M7AB 2YT6A 3G4SQ 1WA7A 5CHXA 5GAMg 2WITA 1I07A 4PKCC 5GAN4 3OY9A 3V4WA 2LVMA 4M7DC 2JTMA 5CKFA 5KAFH 4KBMB 1AT1B 3TCJA 1YHQT 2QQBA 2ZFCA 4F7UG 2OTJP 1WQ7A 3QZ5B 1NEBA 3TREA 4C8QC 5APYA 2BUDA 3CX5E 3CPWP 2J59M 1UHCA 3NGPA 1M90R 3R2PA 5CCHD 3L74J 1YWPA 2RO0A 4QQ6A 1E5WA 2DKGA 1ZMEC 1OPKA 2WSSH 3AEGC 1WRGA 4KHXA 3L70D 4AG2C 5LJ3j 4BACA 4KT0J 1VQOP 3P32A 1AVOA 2IPOB 4LLHA 2ZAEB 2HEQA 4IUPA 1CI6B 2E6ZA 3L35A 2HZYA 2CSQA 3UF4A 3G6ET 3CMEQ 1AWXA 2LP5A 3MD0A 2POHA 3GHGC 4HXJA 4PFZA 1WZOA 1KQGB 3E1RA 3UA7A 4GKGA 1D09B 1BIAA 1KIKA 2YHTA 3B5ND 1JBMA 5FWCA 1DEEG 1KYOD 2IYPA 3CCLQ 3CC2T 3W67A 3JCMe 2V7QH 1S5LE 2A7YA 4U3FG 4OF1A 5CBNA 2CZ6B 5CCHC 2NYSA 4OGCA 1QLED 1YI2P 1BBZA 4FCYA 4MZPA 3AEAC 4JZ3A 4PL6A 2HPCA 5CO7A 3V8LA 1QVGS 1USDA 3AE7C 2OYOA 4C92G 1TS9A 3TVTA 2O01E 3CCSA 2FZCB 2P67A 3GF3A 4PD4H 1N6AA 3SWNC 2FXMA 2QEXT 2H8HA 4II1A 3WUVA 3M54A 2WTYA 2RQUA 3LGLA 3MJXA 1YN8A 3THKA 3V7SA 4BB7A 4Y28E 1ARKA 1OVRA 3O8VA 3B5NC 2GNCA 2KI7A 1KQLA 2MOXA 4M78F 5KLVK 3EGXB 2WZ7A 4AFQC 1NYFA 3I55A 3CCVT 4E6RA 3RK2B 3VMZA 1SKUB 1YIJP 4PJOC 4D6TD 1CKBA 2X4XA 1YJNQ 3TNUA 2I8DA 3G71P 1QVGO 3HD7D 1S1NA 3L42A 2Y9ZA 1FZFA 4F7UF 3LW5E 1BE3G 2YXRB 4A4GA 3I56A 1QVFP 1X6OA 1IC2A 3E2UA 1JY2P 1YWOA 3D6ZA 3WMM0 1KILA 4M77E 1OZ2A 4H13B 4NPDA 1RAAB 3MKDA 1SQQE 3VRYA 3L37A 1FX7A 2JWAA 5EC7A 4XE5B 1K9MC 1LTAC 4MMLA 1ZUKA 2LC4A 2M1HA 3LLRA 1VQ7Q 3C4SA 1GBQA 1PIXA 1IFDA 2ZPIB 4M77B 1ABQA 5AW3B 4QQDA 4QKUA 1NO4A 4RTWA 3ZDMA 1QCFA 1N73C 5KYUA 3HPWA 2LJ1A 4Y99B 5FU7C 3V2QA 1PGJA 4J9GA 2CP7A 1VQPP 4OGQB 1GW4A 1SSFA 1JY3O 1URQD 3HD7C 1M1KC 1PKSA 2WVRA 5KYXA 2K2VA 1OVUA 2HDAA 3H1JG 1G3SA 4JZ4A 1GL2C 3JCMb 4AG1C 2YLBA 1TSFA 3A5ZB 3TSIA 2W90A 1YTZI 3H1ID 1I1JA 1OYXA 4A4KA 2V26A 4PJMA 4OMFB 1D1AA 2VKNA 4C92F 4DT0A 1OX9A 3TK1A 2R57A 1VQ6T 1PCXA 3M9QA 4M7AC 1BE3J 1SVFA 2FEIA 1UTIA 1OZ3A 1X9VA 3JC22 1PC0A 2VRSA 4YPCA 2DVJA 4H0LD 3AEBC 2KI7B 5DJTB 1IO4A 4L76A 3FDRA 1G8XA 2DEUA 2E1HA 1M7LA 4HH2A 5C6SA 1UDLA 2OX7A 4GLKA 2Q3EA 1U8RA 2YRVA 2NUPA 3TNUB 2RK1A 3EH2A 1ZA2B 2R5DA 3A1PA 2OTLQ 4JYBA 2KGTA 1URQC 1K9MU 2QE7H 1FZBA 3BRVB 2AEJA 5H2FE 5D6XA 4E47A 5GAOp 3KYQA 2K57A 2ZPBB 1N8RC 4F16A 2I1KA 1T3LA 3LYIA 4FU6A 1ZUYA 3L73D 4PK4A 3OA6A 2AK5A 3RMSA 2HCKA 2BZ8A 4DOVA 5KLVG 1LGHB 2EVRA 1U7JA 5DM7R 4J83A 2QK0A 2CYZB 2LT1A 1SLQA 1UFFA 2HQEA 1SS1A 1W4SA 2FYUK 2FO0A 1IFNA 2H8PD 5EFWB 4RG8A 2OARA 1M1KU 1E7OA 1SEMA 1U06A 3CC4P 3A0HE 3H1JJ 3AE3C 1LPLA 2B8AA 1KQSP 3L75E 4H0LC 1VQ4A 1G2CA 5KYUB 2QJYC 1RY3A 1N7LA 4HT8A 1S1CX 2CZ7B 1VIFA 1Q95G 4J7FA 2BIVA 4BDYA 2OTJQ 1EFNA 3VRZA 2W27A 1S2EA 2PNIA 3E9GA 5IAYA 1EDIA 1SHGA 3L71D 5KYXB 1BCCD 4PJJA 1FC2C 2H89C 3BW1A 1L4AA 4J9EA 4JJNK 3EFRA 1VQOQ 1VQNA 5CQYA 1MZ9A 5KAIH 1KV4A 2JZ2A 1B7TA 3KBGA 3M4YA 3HKSA 1K73C 3AE2C 1UB4A 2MMPA 3M0UA 4PNOA 2VASA 1NLPC 2XI9A 3S6WA 2P58A 1VUBA 2EQJA 2QVAA 4GODA 1SQQK 2WSEJ 1Y71A 4E7IA 4LDUA 1YITT 2QGGA 1FZEA 1AZEA 4K3AA 1X6GA 3G71A 4V2SA 1P84I 1N8RU 3S3MA 1I8FA 4J5YA 3CCJA 1ZLLA 1RAFB 2PFXA 2DBKA 2PAJA 3N4XA 4OGQD 1NTZG 2NRGA 5KLVJ 1VQLA 4ATOA 1ZP0C 5LJ5e 3V8JA 2KUBA 3OSSC 2DL3A 1KD1C 2NUPB 2LQKA 2GUSA 3EG9B 1RHZB 2EKHA 1U1SA 5GAMe 2GFUA 3JCMJ 1NJIC 4E7SA 1JMMA 1ACMB 3HRNA 1UUEA 3WU2H 2YIUB 1LTJA 4JRPA 4FYWB 4N4HA 1BK2A 1VYVA 2COWA 4M78A 1J2JB 4LDVA 2YLCA 2MCNA 3PTAA 5IHIA 3TGUD 3B4SA 1WIEA 5TISH 3QDFA 3NPFA 4N78E 2F2VA 3HTRA 4JRQA 2CPBA 3GP8A 4PD4D 1CKAA 4LD9K 4LE9A 5CJ0A 1TXQA 1LTSC 4RCCA 2LJ3A 3RR6A 1XTDA 4RG2A 3SEMA 2JR8A 2KR3A 2MWPA 1M8VA 1MV0B 1K73U 2KE9A 3VJPA 4OGQC 1JU5C 3HTKA 1YIJQ 2PQWA 2E70A 3M0DC 5AVQB 3L72E 3RBXA 1HF9A 2R58A 4J9BA 2A06E 2EJ9A 3VS0A 1SFCD 3FC3A 2EYXA 1Q82R 2E10A 4ASWA 4IURA 3BATA 1Q7YQ 2E5QA 3PVLA 1L4AB 1KILD 2BCCG 2AXTH 2FYUG 5AW2B 1AJYA 4HVWA 2P7JA 1D3BA 1SQPE 1EQ7A 1OW6A 1OX8A 1QQJA 1YQ3C 3H6PA 3JCUH 2DVEA 4LNPA 1K04A 1WXBA 1W2BA 1NTZJ 1L0LD 2C0WA 2M02A 1CSBA 2O01N 2ZYAA 3CCUA 1KD1U 2DXTA 1YHQP 2XMFA 3HHTB 4C8QA 3MEAA 2C9NY 4WF2A 5I2MA 2E64A 3MEWA 3JCMP 3H32A 2VV5A 2MPXC 1OX3A 1ZRTD 2K37A 3USSA 4FYYB 1NJIU 1JM0A 2E76B 1R0CB 3OYGA 1Q86R 2EKOA 6AT1B 5IHKA 2O9SA 3BDLA 1GFCA 5AVWB 1VQMA 2V8JA 1VQPQ 4Q5WA 3OS5A 1WXTA 2F2XA 3GBQA 3JCMg 1SFCC 4PV1B 3G6EP 2G3RA 1KC8R 2FY8A 4IUTA 4LXCA 1NKNA 1KB9E 3CWBD 4RKUE 1KILC 5C0MA 5AW6B 3SWYA 4ZN3A 2WPQA 1LTJB 2LXCB 2DRMA 2MWOA 4MN4C 2KRSA 5GAMd 3MZWB 5A2QE 1L0ND 4DBQA 3CC2P 4EMGA 5CKDA 2BE9B 2R3CA 2HQHA 1SPKA 1UHFA 2QDYB 2J58A 1WJSA 3E1IA 3V8KA 3CCEA 1GW3A 1PGQA 3AECC 5KJ7A 1M3CA 1BGYD 3I5SA 3CCQT 1AEYA 3RKWA 2BCCJ 2FYUJ 4M3LA 5CCHA 3RKYA 1BI1A 4BI4A 5GANh 5AVYB 2H3EB 4R0KA 1ZR4A 2RJFA 4RTTA 5FRNA 3H1HE 4QT7A 2GBQA 2X4WA 1NGMB 1JB0E 3HTKB 2WSCE 1GK4A 1PP9D 1P84H 2E3IA 3C0CA 3PIPA 3QO3A 2JMCA 1WMKA 2FRYA 3CD6T 1AFOA 4C8QE 2QEXP 3QWOC 2J6FA 2OJ2A 1RQVA 2ZGWA 3DB3A 1LNXA 4EMKB 2MKVA 1FDMA 2B88A 2JVVA 4LDWA 1D3BB 2KK4A 2YSQA 2F1LA 4XU0A 3B5NA 3CMAA 5APTA 3P8CE 2H88C 2VVKA 3M0PA 3QBYA 5KH6A 1KHCA 2LNHB 2NLUA 4OB2B 5GAN3 1XQHA 3CCVP 2EQIA 3F89A 5AW7B 4C8QB 1T3UA 2QA4T 5FW9A 3VMAA 3DB4A 1SQQJ 3CC4Q 3H6ZA 1I0CA 5L8RE 2KQWA 2LDMA 4AT1B 1JJ2P 2JO1A 2KXCA 2IYOA 3GMAA 1ZLMA 4IFMA 2XKOC 2OQQA 5KYYA 4N4GA 4I6MC 3RERA 2M0YA 5GJVB 3META 4NL3A 3LX7A 2DERA 5GAN2 1KJWA 1B34A 3UIAA 3CCMT 2YIUC 2EFIA 1E6HA 2EYZA 2KXPB 3L74D 3JV3A 4KH1B 1IHVA 4QMAA 3DLMA 2O31A 1M90Q 5CIUA 2M3BA 3ZBDA 4MZMA 2WT7A 2KY9A 4LUEA 4DCKA 2OGUA 3L70E 1SQPK 1B07A 1N73A 4XU1A 2HNIA 1X0TA 2YRCA 2ATCB 4ZGDB 1RI9A 1Y57A 2WSEH 2QRXA 4TLFA 3CCRA 3CC7T 1VQKA 4PJ0H 2FRWA 1FS0E 3PRJA 1MUUA 3BCCG 1FJPA 2RQWA 3V2RA 3NFCA 2RH2A 3WVEB 4RTUA 3J81E 4J6XA 1EDJA 4L74A 1IB8A 4HCCA 3V2NA 5K5GB 3PT9A 2IVWA 4PFOA 1DH3A 3SSUA 3AEDC 3SFEC 4EI2A 1M2VA 3AE8C 4MDWA 2FBWC 3GIBA 4DQ2A 1YJWQ 1KYOE 1IFIA 3CXCA 4DBRA 5HK0A 5AVXB 1QWFA 1K76A 4ZTFA 1YJ9A 2VYTA 3OBWA 1VQ6P 1VQ9A 1X2QA 4M78D 3JAME 3M56A 3KHUA 1BI0A 3A98A 3TDKA 5B5EH 1OULA 4BY6C 3KZIE 1RF1A 3B5NB 3FXEA 3EQ2A 1GD2E 5GANf 1EZVG 4GT1A 2QM7A 3H41A 2M3EA 3GW6A 1VQ8A 3VV0A 1FE6A 3G3ZA 3H25A 3VS4A 1ABOA 2CZ1B 2K5IA 1DJ7B 2IFNA 2R5BA 1T0JA 4CI0C 2HG5D 1NTKG 1RADB 1B3QA 1HBWA 1WHHA 3OYYA 3CBPA 4OMNA 5GTHH 3Q1JA 4O5VA 1VPCA 1VDFA 5KYYB 2XU8A 1SP4A 2CUDA 2VGMA 4IUVA 1TUGB 1PSEA 4C0DC 1ZSGA 4E7HA 2COZA 3PMTA 4GOEA 3L2RA 4RTYA 4IL6E 1IFMA 2O4XA 1YP5A 1B34B 2O1KA 2QM8A 1R5LA 3BCCJ 1LTJC 1ZBXA 4D6TE 2QDLA 1NTMK 3MPUB 4M78C 4L5GA 1HJBA 2XV5A 4U7JA 2WT7B 1GXIE 4F14A 3KXDA 3M06A 1H88A 2Y90A 1IGUA 1N73B 3CBMA 5FU7B 3H1KE 4HCZA 1YHQQ 2YMKA 4U3FD 3MP8A 2BEZF 1NVOA 3I5CA 2DNUA 2ROLA 3JCMQ 1E79H 3CMEA 3M9HA 3G7ZA 4ANJA 3PJSK 4EIKA 1R8OB 4JS4A 2KYMA 3J7AF 3EWKA 2OYHA 1EXIA 4M7AE 2EIFA 1KMIZ 1M2VB 2XK0A 4C92D 1R0BG 1SSHA 4KUDK 1LWUA 4J8OA 2JN0A 5LJ5g 2QTVA 1F1BB 1JCCA 1EZZB 3CCLA 3G6EQ 2MI6A 4EMKC 1QCOA 3A0BE 3MEVA 4MDXA 1FYNA 1NTKJ 2K1AA 2HQXA 1YITP 2DXBA 1RF1B 4UB6E 3E7KA 3P8MC 5AW0B 2P0QA 4M75G 4Y92A 1JY3N 1OU9A 2ZT9D 4DBFA 1YCYA 4P5NA 1BSHA 2AIRB 1VQ5A 3CC2Q 5AYFA 5KJ7D 1Q81C 2W6AA 2KK7A 1PGPA 3D70A 3KXTA 1A0NB 4EDUA 1T2KC 3EG0A 1URQB 3RK3B 1X27A 2DPPB 3UPUA 1S72Q 1BE3D 3JCMX 3MHVA 3FX0A 4N0AA 1P92A 4LGDE 1PG5B 3OW2O 2M9UA 1FJKA 2RJEA 4BDZA 2C0OA 2RMOA 3ULRB 2CUBA 4JPBW 3CLQA 4C92C 2IBZG 1NE8A 4JRIA 2PRRA 1KTMA 3S3NA 1NM7A 4DOWA 2O4XB 1P84D 4JDSA 1TTHB 5AW8B 4BXLA 2YKQA 2V1RA 2QEXQ 1SQXG 4B9XA 1YJNA 3OYBA 2YKOA 4C5GA 4HCBA 3ABVC 4HVUA 5GMKe 2HSEB 4LC1A 2FYKA 2KSSA 2WSFE 4KGVB 4H0LB 2Q6QA 2ZVNB 3MEUA 2DD4A 4IUUA 3CXHI 2QJYB 2ZT9C 3CPWO 5GAN5 5IT9E 1X8YA 2PU9B 3OYJA 3CCVQ 3SD4A 1S72T 5KJ7C 2KBTA 4J9FA 3M0DA 2HLOA 1EZVI 2KLVA 1KORA 2Z5HA 1BI2A 2DYIA 1C1AA 4RJTA 5D7UA 3VYGA 2XD0A 2V4HA 4KRTA 3CI9A 3VS6A 3H1JD 2OYHB 1BB9A 2YWWA 4M7DG 1NTMG 1VQ7A 2DZCA 1LTTC 1KN7A 1PWTA 4IIOA 1ZX6A 2NPSA 2M5AA 2DK3A 2I2LA 1U1TA 1PPJG 2A0FB 1K8AC 3ME9A 1QVGP 1MNDA 1Q81U 4JJBA 2JWDA 2EW3A 2CT4A 2D8HA 5KYWB 1WLPB 4RUGA 4FSSA 1K9MR 5KAFE 4J9IA 4EMKA 4JF7A 2A3LA 4WBAA 1YBYA 4ZKPA 1QGKB 2XDPA 1IK7A 1KG1A 4BI3A 1WQWA 3FWNA 3L71E 3VMXA 4GDOA 5CAIA 1BCCE 3PNWC 2DMOA 2MJZA 1WXUA 1XTGB 4EOTA 1VOMA 2R5MA 5I11A 4RCBA 2GTOA 4M75F 1UGSB 3R6NA 1AQTA 1T0HA 3D71A 4FT4A 5IXFA 5LJ3f 3BDUA 4Z02A 1V29B 2K9GA 4WY4D 2EGEA 1SFCA 1EC5A 1SQXJ 1WI7A 3AE1C 1M1KR 1S5LX 2E65A 1S4XA 2XKMA 3QSUA 4A4HA 2RB6A 1SQVK 2KB7P 5CKEA 5KLVD 3FGAD 4GBQA 4WVZA 5KCOA 1LOJA 2O3JA 3AE5C 1Q90D 3H1LG 1OFCX 1HVVA 4OMQA 4E7JA 1RI0A 2EJGA 2P10A 3M53A 2WSCJ 2QIWA 4C7RA 1JMBA 4ZNXA 1N7SD 2OYIA 4WTOB 1VQ6Q 2OTLA 3S1KA 2GTJA 4ZGEB 3C8VA 2E4HA 3M0AA 3CCQP 2MAMA 1NTMJ 3WUTA 2N9YB 4BE1A 2JM9A 1KHIA 4A53A 3CQTA 1MNEA 4YXDC 1X69A 3GOXA 1GZLA 3RK3D 2JTEA 5HK3A 3L1AA 2L3PA 4XU3A 3OW2A 1K8AU 3M0QA 2E75D 4PLLA 5GAOm 2GCXA 3TGUE 4WY4C 4O9BA 2FZGB 3JCMd 1JY2O 2ZPGB 1G5VA 3CD6P 2HPCB 1MHNA 2RJCA 2KP8A 2XU6A 4PD4E 4C46A 5GAOl 4IIMA 3X26B 2EPDA 2PVGB 4PJOG 4QVDA 1N8RR 3TYYA 2MF2A 4M7DF 1PSFA 1GCQA 4CRIA 2J6KA 1RLPC 2M5AB 3A5TA 3OYAA 1W5CE 4R56A 2DEQA 1RQUA 2OTJA 2JP3A 1KB9I 2HD0A 2IBZI 1RF1C 2QA4P 1N7SC 4TVRA 3CPWA 2DBMA 4JPZB 5KYNA 1H8AA 1HJ0A 1FOSE 1I4K1 2M16A 1Q82Q 1GRIA 2VXFA 1JUNA 2CT3A 3HFNA 1GCPA 1OW7A 1KILE 4A7PA 3NTIA 1C6VX 1TWBA 1VQOA 3ER0A 1NTZD 2BASA 3W68A 4DOJA 3PFSA 4EPCA 5D6YA 3JB9I 1M8OB 3RK3C 3H1LJ 2JW4A 1L0LE 3R6OA 3CCST 2E75C 2IX7C 4MZTA 1SFCB 3CXHH 2PP6A 1V1CA 2C0IA 2QAZA 3ZFJA 4ORZA 5CQXA 3M4GA 2XDBA 2O1JA 3CCMP 1KQ1A 4CC3A 1KILB 2IZ1A 1NYHA 1ZRTE 5APVA 1K73R 3P8HA 3U1CA 5GAN8 1MUZA 1N2DC 3A3YB 2M0BA 2IDBA 1W70A 1UJ0A 3I55T 1Q86Q 4IFFA 3ASKA 3TU4K 1W2BO 1PL5A 2W6BA 2GA1A 1PKTA 1T3JA 2SRCA 3CC7P 5CJ4A 3H1KG 5GAOn 1YITQ 3I56T 1NAYA 9ATCB 1AQ5A 1KC8Q 2D1XA 2YUQA 1YI2A 3CWBE 2KT1A 5GANe 4NPEA 2L89A 1Z9QA 5FU6C 5J3BA 1PV3A 2RN0A 4M7AG 1SQVG 3OYKA 1HGVA 3BRTB 1WJRA 5J39A 2WQYC 3UDCA 5GAN6 2A08A 1KD1R 3FRNA 1U5SA 1L0NE 1SQBE 2OYHC 3T9NA 5I21A 4JJCA 1ZOYC 4CC7A 4F04B 2BCCD 2FYUD 1BI3A 3KPEA 1KK7A 2ENMA 1OI1A 5GMKm 3L2UA 2JMAA 1NPRA 1K9AA 4FIBA 1NJIR 1BGYE 1LWUC 1Z56A 4X34A 4GIFA 5LL6S 1WT6A 2X3XD 1PD1A 4HA8A 1ZXGA 2DW3A 4PJOF 4E7LA 5ECAA 3M59A 2CKKA 2DETA 8ATCB 1OPLA 1NU1E 1YIJA 2E43A 1PP9E 2CZ0B 3TF5A 1KQSO 1UJYA 2CP0A 2GM4A 5GMKj 3AE4C 2HKQB 3LH5A 1QVFA 2RA2A 4GLMA 2RQTA 2K9YA 1NHLA 3NTKA 2X4JA 1YJWP 2FG0A 1WFWA 3IFMA 4E7ZA 4BI8B 3L4FA 5FLXE 4I1LA 2FL7A 3V4QA 4N0AC 3RL0D 1SF9A 3H1KJ 1FMKA 2L3SA 3O8ZA 3EGDA 1H89A 2RPNA 2DM1A 3VTPC 1BU1A 1M1JC 5AW4B 4JRKA 2NPSD 3IN6A 2LQNA 2KRMA 3TSWA 3OYIA 1KYOI 1U3OA 2R32A 1SQVJ 3Q5SA 1JOCA 2X3WD 1HUCA 1RL2A 4F7UA 1DX7A 2D2CD 3M57A 1JEKA 1UGRB 1DEBA 2ZYDA 2HFED 2FXPA 4C0ZA 1VQPA 1PFIA 3NTNA 1G2CB 4J9HA 1M2OA 1HK9A 2FHDA 2KROA 1N5ZA 2KRNA 3OS1A 3AE6C 2AEMA 3H9NA 3QJYA 3OSVA 4KT0E 4H44D 5KAIE 1M57D 2K88A 1IO6A 2JOYA 2JTFA 2LT4A 5KE3A 2KIKA 2DXCA 2Q9IA 3C9IA 3RL0C 1OIPA 3F70A 1JCDA 2J05A 4L59A 1L0LK 5CCAA 4DA4A 1OZHA 1WHMA 2OTKE 2FYNB 3A7OA 2NPSC 2P4TA 4BY6B 1KQ2A 4A63B 1VQ4T 4OH8B 3VS2A 2X9HA 2W6JH 1ZV8A 3SWFA 3CXCS 1GU4A 1R77A 1ZQ1A 2DJQA 3CCJQ 2WSCH 2FPFA 2C06A 3S9OA 7AT1B 3CCQQ 2PGDA 4BE2A 1NAFA 4I7ZC 2M0OA 3QHSA 1VQNT 2EYWA 4M78E 1LJOA 4H44C 3WU2E 4OVAA 2F5TX 4C0DB 3E9FA 4J9DA 4C92A 4M77G 4PLIA 2WSFJ 2RHYA 3I9QA 5B66H 1QEXA 1SQQG 5LJ5d 5KLIC 1H641 1ZHIA 4XQ3A 3CBOA 3I5RA 4F7UE 1BSNA 2A45G 3EGDB 3JSCA 3CD6Q 1TG0A 2JT4A 5TISE 1L0NK 1SQBK 2YO2A 3FLGA 3PH0A 1O75A 4M78B 1RAEB 2RHZA 3CC4A 1DIPA 3G71T 3EG2A 3D7SB 1HGZA 1KQSA 1USEA 2X51A 2YO3A 5GTIH 3CCJT 2Y0DA 3QUIA 3Q1MA 2AEFA 2L3RA 1TH7A 1VQLT 1FDOA 4J7IA 3RUXA 1ZUUA 4F7UB 2OYIC 3TSZA 3LWIA 2L3QA 1AVYA 2O01J 1S72P 1JXOA 4XTUA 1UGQB 3P8BB 3BCCD 2ZPFB 2QA4Q 4QVZA 1DD3A 5CK9A 1NU1K 3L2ZA 3SWKA 2G6FX 1SRMA 4C5IA
chains in the Genus database with same CATH topology
4C5EA 5FROA 4KUIA 2V8IA 3NTHA 3MTUE 2KVQG 1I81A 3A8HB 5LJ3e 1A02J 3PGGA 2D6FA 5EG2A 1FZGA 2EJFA 5IN1A 4UC4A 1LTIC 2EQUA 2L5QA 5CCGD 2KOGA 1N9SA 5CKBA 3OYNA 4C92E 3H32B 1NZ9A 1YJWA 4OB3B 2OAUA 1FAVA 1A02F 3VYHB 2C9LY 2LRQA 3HRTA 5HKCA 1QP3A 3RKXA 4C92B 2RI2A 1LT9A 4IFDK 1G3TA 3CCUT 4M77F 3UWNA 5CKHA 3L2VA 3ZEHA 1WNLA 4XTYA 2H7HA 3OYLA 3KQGA 5GAMh 1FZCA 3RMQA 1ZR2A 1N27A 3MO8A 2WWWA 3GNFB 1VQMT 5M9OA 2K5LA 4WY4A 3A2AA 4Y91A 4OB0B 4RMOA 2YMYA 3A8OB 1NKZB 5KTBA 5LJ5j 4A4FA 3HRSA 3N7NA 3HUSA 2DAQA 4E7KA 1G3YA 5GAMj 3L2WA 1YHQA 2K4YA 5HY6A 3IR9A 3CCET 1N7SA 4EMHA 4BUGA 1IREB 4M75D 2A45I 2RK2A 1HTLC 2ZCFB 4WB4A 5GAN7 2FB7A 3JCMV 1J1DC 3OJAB 3M58A 2K3YA 1Q7YC 3G6EA 1HWTC 3CL3D 1UEBA 5BU8B 3OAKA 3A8MB 1FZAA 3CMAT 2GUVA 5GANg 2RHXA 4AYCA 2LQ8A 2PVDB 3T97A 1FWZA 4JYCA 1NH4A 1BIBA 3CC2A 3LH0A 2QXFA 2WSEE 3QZ9B 2QTXA 4M75C 3CPFA 1XOVA 3P8DA 1FZCB 1NOHA 3OA7A 3CEYA 2IG0A 5AVVB 5KE2A 2QQSA 4WY4B 2K5FA 3OYCA 4M7DD 2QEXA 3KUFA 2XG8D 1KZUB 5CR2A 2EWNA 3HUSB 2QQAA 2RD1A 2E12A 3OW2S 3QJ6A 2RI5A 3CCVA 3CCRT 1VQKT 5AVRB 1N7SB 1Q7YU 4QVCA 3OYFA 2CGHA 4XA4A 1JJ2A 3U59A 2FFDA 2IPPA 1JY2N 2Y4XA 3A8LB 1KFMA 2O01H 2Q5UA 2PUKB 4C0GA 3OMCA 3WVDB 3CPWS 3QYHB 2N1TD 3II6A 1YJ9T 4L6V5 4JLGA 1VQ9T 4XAXB 1M1JA 1XTCC 2R5AA 1UGPB 4DZOA 4XK8E 4FSXA 1VQ8T 5BVZA 2FKWB 4QQGA 3QKJA 2CPSA 3LW5H 3JB9G 1ZN5A 4XTXA 1OWAA 5FU6B 3G4ST 5J26A 3NMDA 2C0XA 3C95A 3EFSA 2A45H 2Q3IA 4M77A 4N3YB 2LTOA 2N1TC 4C8QG 1T8ZA 1FBMA 5AVUB 1M90C 1VQ6A 4PJOD 4NS5A 1LWUB 2RI3A 3PIOA 3HFOA 1Y07A 2LNVA 3J80E 2HYNA 3RIRA 1YYCA 3CMET 3OS0A 3HE5A 2DTHA 5APUA 2VGNA 1HXDA 3LIEA 2FFDB 1FXXA 4A54A 5GAOq 2I1JA 3S3OA 3CCLT 3JB9J 1WJQA 2RHUA 3QG1A 2BKDN 4A4EA 1QVFS 1M1JB 4OP0A 3EFGA 1LT9C 3WXMB 5AW1B 1JY3P 3DKMA 3INZA 2X4YA 1VQ5T 1GL2D 1W2EA 5AVTB 1M1GA 5LJ3g 3RESA 4C7NA 3VOPA 1JNMA 1FZCC 3JB9F 3MHXA 1IK9A 2WPSA 1M90U 4FM4B 1X79B 4M7AD 1LTBC 3MGNA 1GTWA 2KYVA 1KFNA 1S9KD 3RL0B 3X25B 2HBPA 1YJNT 4W7YA 3HSBA 3HUSC 5DLOA 1LTGC 2NPSB 4C8QF 1YITA 3EAEA 3OBYA 3OYMA 2XICA 2PUOB 3OQ5A 1RE4A 5APXA 5AW9B 2QQRA 3M55A 2DJZA 3VUZA 3PP5A 4JS5A 1NTZK 2P0KA 3VMYA 3HE5B 3NXSA 1W2BS 3URGA 1VQ7T 4AQRD 4D6WA 3FB9A 2HODA 4BE0A 2ZZDA 2RM4A 5D6WA 4HYTB 4MMKA 5A0LA 1M9SA 4B86A 3HE4A 4N6JA 2HAXA 3MIWA 4IUQA 1G1JA 2Q7CA 5CCGA 3BFMA 2H3JA 1RE3A 2EAYA 1CZQA 2OYIB 1Y7XA 2QQ9A 2KDSA 3MUDA 3OS2A 1QL2A 2L5GB 4C7NB 3LWHA 3HL8A 4OB1B 3VUBA 2VUBA 1KQSS 3V2PA 5GMKh 4BD3A 4FT2A 2WPRA 3GF5A 3JCMh 1QVGA 3RK2D 1RF0A 3C94A 4RESB 2OTLT 5GMKl 2M8RA 2KSJA 4AUWA 2Z4EA 3V7RA 2DIGA 2FFDC 2JNGA 2GQVA 2ZPEB 2HODB 4M77D 2D9TA 2P0PA 3HE4B 3JRZA 2XDJA 3RK2C 2OTJT 2DTOA 3GPLA 2RHIA 4O6JA 2H43A 3CCQA 4M75A 3VKIA 2D0QB 1VQOT 5CVIA 3AHUA 1N9RA 2WACA 3VYIA 1QW1A 5GMKi 4LD6A 3FIFA 5AVZB 1BKBA 2QI2A 5APSA 1MFZA 3CD6A 4N4IA 3OMGA 1Y96A 3MP6A 1GU5A 3B8EB 2FYZA 2X35A 4M7AF 5GANd 3BVHA 4M77C 3E19A 3JB9H 4Y99C 4FL6A 5APQA 2QA4A 2KAFA 4OGEA 3OYEA 4XTZA 1YI2T 4ZGJB 4XTVA 2P2UA 4QW2A 1NWQA 1J1DB 2GFAA 2CS7A 3OB9A 3QIIA 5DLQE 3QDRB 2DO3A 3JCMf 2YNYA 2XHCA 4M7DA 3CCMA 5BU5A 1J1EB 3L36A 2IFMA 5AW5B 2XNXA 4M75E 1JTHA 1GK6A 3GNGA 2DTIA 2VXEA 3M91A 3DLLA 3C12A 1YIJT 1AHJB 4YTLA 1JRIA 3FEOA 3QPHA 4XU2A 3VU3C 3X28B 3CC7A 1Q82C 3BY7A 1O9SA 1QL1A 3OYDA 1G3WA 4M75B 3GHGA 3HP9A 3FJPA 4X9DA 3H8ZA 1I5LA 1MGQA 3UT1A 3OYHA 3SDZA 4JLIA 2N1TA 1QP2A 3L2QA 1Y96B 4W80A 4LDXA 2Z5IA 1CW5A 2FVUA 1Q86C 4GY5A 3NFQA 1G1IA 3SFMA 1VQPT 2DXUA 3JCMW 2LCLA 3V5BA 2AHJB 1KC8C 1YTZT 1RE4C 2E41A 2JUFA 4M7DE 3VP9A 4VUBA 1IFJA 3SWNA 2YKPA 1NTKK 3LGFA 2E6NA 4R55A 3JCMc 4HKEA 2N9BA 5GAOr 5GANj 4ELYC 1Q82U 4M7DB 3SB2A 4ZN1A 1JJ2S 5APWA 4PJOA 4J6YA 5I2SA 1JTHB 2GF7A 5LJ5h 3N5BB 3TEEA 4B9WA 2LKMA 1M4ZA 4N78D 2L8DA 5FRMA 4W7ZA 4ELZC 4JUVA 1HH0A 5CCGC 2DD5A 1VIEA 1RE3C 2Y4YA 3V7CA 4NOYA 1L4AD 1X75C 1JO5A 4XTWA 3GHGB 3KDPB 5KCHA 1Q86U 3MCAB 3QXEB 2ZPHB 3U1AA 2N1TB 4NL2A 2F69A 1KC8U 3CC4T 3X24B 3HD7A 3VN0A 2DIQA 5CMZA 4LDYA 2EQMA 2F5KA 1RF0C 1GL2A 1WPYA 5LJ3d 3PMIA 2XDDA 1NPPA 3M9BA 5DY9A 4EIJA 2PVOB 2EQKA 1GDTA 4KULA 3SWNB 1L4AC 1FOSF 4PJOE 1BYMA 1QVPA 1MV8A 2DZ9A 4M7AA 3X20B 4IKFA 3VP8A 1J1EC 1M5Q1 1OXZA 2RJDA 1IZ6A 4PJOB 1SQXK 1LT9B 1X01A 3QYGB 1URQA 2LX9A 4ZKUA 3M5AA 5A0GA 1YJWT 3JB9D 1S72A 1IJDB 1FU1A 4C5HA 1CI6A 4J6WA 3BASA 1M1FA 2JJLA 2KMTA 2VC8A 1XNIA 5AVSB 3MP1A 5LJ5f 1H3ZA 3E1SA 3P7KA 4ME7A 4C8QD 4C0FA 2WSFH 2JEEA 5GAMf 2XIDA 2EYQA 1T2KD 1EIFA 3HD7B 3LIDA 2XZRA 1WGSA 3P8CD 4ZTJA 5A0DA 4X9CA 2K3XA 1GL2B 3HRUA 1S9KE 2E42A 5LJ3h 2V8KA 4I2LC 2LCCA 2P1JA 2ZXEB 4HT9A 3GLXA 1N86A 4M78G 4M7AB 5CHXA 5GAMg 2WITA 5GAN4 4PKCC 3OY9A 3V4WA 2LVMA 4M7DC 2JTMA 5CKFA 4KBMB 3TCJA 1YHQT 2QQBA 2ZFCA 4F7UG 3QZ5B 1WQ7A 4C8QC 5KH6A 3TREA 5APYA 2BUDA 2J59M 3R2PA 5CCHD 2RO0A 4QQ6A 1E5WA 2DKGA 5LJ3j 1WRGA 4KHXA 4BACA 3P32A 4LLHA 4IUPA 1CI6B 2E6ZA 3L35A 3G6ET 3MD0A 2POHA 3GHGC 4GKGA 1BIAA 2YHTA 3B5ND 1JBMA 3CC2T 3JCMe 2A7YA 4OF1A 2CZ6B 5CCHC 4OGCA 4MZPA 4PL6A 2HPCA 5CO7A 3V8LA 1QVGS 4C92G 2O01E 3CCSA 2P67A 1N6AA 3SWNC 2FXMA 2QEXT 4II1A 3M54A 2WTYA 3LGLA 3V7SA 4BB7A 4Y28E 3O8VA 3B5NC 1KQLA 4M78F 5KLVK 2WZ7A 3I55A 3CCVT 3RK2B 3VMZA 4PJOC 2X4XA 3TNUA 3HD7D 3L42A 4F7UF 1FZFA 3LW5E 3I56A 4A4GA 1X6OA 1IC2A 1JY2P 3WMM0 1KILA 4M77E 1OZ2A 3L37A 1FX7A 4XE5B 1K9MC 1LTAC 4MMLA 2LC4A 2M1HA 3LLRA 3C4SA 1IFDA 2ZPIB 4M77B 5AW3B 4QQDA 1NO4A 1N73C 3HPWA 4Y99B 5FU7C 3V2QA 1SSFA 1GW4A 1JY3O 1URQD 3HD7C 1M1KC 2K2VA 1G3SA 1GL2C 3JCMb 2YLBA 3A5ZB 3TSIA 1YTZI 1OYXA 4A4KA 4OMFB 4C92F 2R57A 3TK1A 1VQ6T 3M9QA 4M7AC 1SVFA 1OZ3A 1X9VA 2VRSA 1IO4A 3FDRA 2E1HA 1M7LA 4HH2A 5C6SA 4GLKA 1U8RA 2YRVA 3TNUB 2RK1A 2R5DA 4JYBA 1K9MU 1URQC 5D6XA 1FZBA 3BRVB 4E47A 5GAOp 3KYQA 2K57A 2ZPBB 1N8RC 2I1KA 3LYIA 4FU6A 3OA6A 3RMSA 4DOVA 1LGHB 5DM7R 4J83A 2CYZB 2LT1A 1SLQA 2HQEA 1W4SA 4RG8A 2FYUK 1M1KU 1IFNA 2H8PD 2OARA 2B8AA 1VQ4A 1G2CA 1RY3A 1N7LA 4HT8A 2CZ7B 1VIFA 4J7FA 4BDYA 2BIVA 2W27A 3E9GA 5IAYA 3BW1A 1L4AA 4JJNK 1VQNA 3EFRA 5CQYA 1MZ9A 3KBGA 2JZ2A 3M4YA 1K73C 3HKSA 1UB4A 2MMPA 4PNOA 2XI9A 3S6WA 1VUBA 2EQJA 1SQQK 1Y71A 4E7IA 4LDUA 1YITT 1FZEA 3G71A 4V2SA 1N8RU 3S3MA 1I8FA 4J5YA 3CCJA 1ZLLA 2PAJA 3N4XA 4ATOA 1VQLA 5LJ5e 3V8JA 3OSSC 1KD1C 2LQKA 2GUSA 1U1SA 5GAMe 2GFUA 3JCMJ 1NJIC 1JMMA 3HRNA 1LTJA 4JRPA 4N4HA 4M78A 1J2JB 4LDVA 2YLCA 3PTAA 4N78E 4JRQA 2CPBA 3GP8A 4LD9K 5CJ0A 1LTSC 4RCCA 1XTDA 4RG2A 2MWPA 1M8VA 1K73U 3VJPA 3HTKA 2PQWA 2E70A 3M0DC 5AVQB 2R58A 2EJ9A 1SFCD 3FC3A 2E10A 4IURA 3BATA 2E5QA 1L4AB 1KILD 5AW2B 4EMKA 2P7JA 1D3BA 1EQ7A 3H6PA 2DVEA 1W2BA 2C0WA 1CSBA 3CCUA 1KD1U 2DXTA 3HHTB 4C8QA 3MEAA 2C9NY 4WF2A 5I2MA 2E64A 3MEWA 3JCMP 3H32A 2VV5A 1NJIU 3OYGA 2EKOA 3BDLA 5AVWB 1VQMA 2V8JA 4Q5WA 3OS5A 3JCMg 1SFCC 2G3RA 4IUTA 1NKNA 4RKUE 1KILC 5C0MA 5AW6B 3SWYA 4ZN3A 2WPQA 1LTJB 2MWOA 5GAMd 5A2QE 4EMGA 5CKDA 2R3CA 2QDYB 2J58A 1WJSA 3E1IA 3V8KA 3CCEA 1GW3A 5KJ7A 3CCQT 3RKWA 4BI4A 4M3LA 5CCHA 3RKYA 5GANh 1BI1A 5AVYB 1ZR4A 2RJFA 5FRNA 2X4WA 1JB0E 2WSCE 3HTKB 1GK4A 3PIPA 3QO3A 3CD6T 1AFOA 4C8QE 2ZGWA 3DB3A 1LNXA 4EMKB 1FDMA 2JVVA 4LDWA 1D3BB 2KK4A 4XU0A 3B5NA 3CMAA 5APTA 3P8CE 3QBYA 1KHCA 2NLUA 4OB2B 5GAN3 1XQHA 5AW7B 4C8QB 1T3UA 2QA4T 3DB4A 3H6ZA 5L8RE 2KQWA 2LDMA 4IFMA 2XKOC 4N4GA 4I6MC 3RERA 3META 4NL3A 3LX7A 5GAN2 1B34A 3UIAA 3CCMT 2EFIA 3DLMA 5CIUA 2M3BA 3ZBDA 4MZMA 2WT7A 2KY9A 1SQPK 1N73A 4XU1A 2HNIA 4ZGDB 2WSEH 3CCRA 3CC7T 1VQKA 1MUUA 1FJPA 3NFCA 3V2RA 3J81E 2RH2A 3WVEB 4J6XA 4HCCA 3V2NA 3PT9A 2IVWA 1DH3A 4MDWA 3GIBA 4DQ2A 1IFIA 3CXCA 5HK0A 5AVXB 1YJ9A 4ZTFA 2VYTA 3OBWA 1VQ9A 4M78D 3JAME 3M56A 1BI0A 4BY6C 1RF1A 3B5NB 3EQ2A 1GD2E 5GANf 4GT1A 2QM7A 1VQ8A 3VV0A 3G3ZA 2CZ1B 2K5IA 1DJ7B 2IFNA 2R5BA 4CI0C 2HG5D 1HBWA 3OYYA 3CBPA 3Q1JA 4O5VA 1VPCA 1VDFA 3G4SA 2XU8A 1SP4A 2VGMA 4IUVA 4C0DC 4E7HA 1PSEA 3PMTA 3L2RA 1IFMA 2O4XA 1B34B 2O1KA 2QM8A 1LTJC 1ZBXA 1NTMK 4M78C 4L5GA 1HJBA 2XV5A 2WT7B 1GXIE 3M06A 1H88A 2Y90A 1N73B 3CBMA 5FU7B 4HCZA 3MP8A 3I5CA 3JCMQ 3CMEA 3M9HA 3G7ZA 1R8OB 4JS4A 3J7AF 2OYHA 4M7AE 2EIFA 2XK0A 4C92D 4KUDK 1LWUA 4J8OA 2JN0A 5LJ5g 1JCCA 3CCLA 2MI6A 4EMKC 3MEVA 4MDXA 2HQXA 2DXBA 1RF1B 3P8MC 5AW0B 2P0QA 4M75G 1JY3N 1YCYA 4P5NA 1VQ5A 5AYFA 5KJ7D 1Q81C 2W6AA 3KXTA 4EDUA 1T2KC 1URQB 3RK3B 3UPUA 2DPPB 3JCMX 4N0AA 1P92A 4LGDE 2M9UA 1FJKA 2RJEA 4BDZA 3CLQA 4C92C 1NE8A 4JRIA 3S3NA 4DOWA 2O4XB 4JDSA 5AW8B 2YKQA 4B9XA 1YJNA 3OYBA 2YKOA 4C5GA 4HCBA 5GMKe 4LC1A 2FYKA 2KSSA 2WSFE 3MEUA 2DD4A 4IUUA 5GAN5 5IT9E 1X8YA 2PU9B 3OYJA 3SD4A 1S72T 5KJ7C 3M0DA 2HLOA 2KLVA 2Z5HA 1BI2A 2XD0A 3VYGA 3CI9A 2OYHB 4M7DG 1VQ7A 2DZCA 1LTTC 2NPSA 2I2LA 2DK3A 1U1TA 1K8AC 3ME9A 1Q81U 4JF7A 2A3LA 4WBAA 1YBYA 4ZKPA 2XDPA 1KG1A 4BI3A 1WQWA 3VMXA 5CAIA 3PNWC 2MJZA 1XTGB 4EOTA 2R5MA 4RCBA 4M75F 1UGSB 4FT4A 5LJ3f 3BDUA 4Z02A 1V29B 4WY4D 1SFCA 2E65A 2XKMA 3QSUA 4A4HA 2RB6A 1SQVK 2KB7P 5CKEA 5KCOA 1LOJA 1HVVA 4E7JA 1RI0A 2EJGA 3M53A 4C7RA 1N7SD 2OYIA 2OTLA 4ZGEB 2MAMA 3M0AA 4BE1A 1KHIA 4A53A 3GOXA 1GZLA 3RK3D 5HK3A 3L1AA 4XU3A 3OW2A 1K8AU 4PLLA 5GAOm 2GCXA 4WY4C 4O9BA 3JCMd 1JY2O 2ZPGB 1G5VA 2HPCB 1MHNA 2RJCA 2KP8A 2XU6A 4C46A 5GAOl 3X26B 2PVGB 4PJOG 4QVDA 3TYYA 2MF2A 4M7DF 1PSFA 4CRIA 3A5TA 3OYAA 4R56A 2DEQA 2OTJA 2HD0A 1RF1C 1N7SC 4TVRA 3CPWA 1H8AA 1FOSE 1I4K1 2M16A 2VXFA 1JUNA 3HFNA 3NTIA 1VQOA 3ER0A 2BASA 4DOJA 3PFSA 4EPCA 5D6YA 3JB9I 3RK3C 3R6OA 3CCST 2IX7C 4MZTA 1SFCB 2PP6A 3ZFJA 5CQXA 2XDBA 3M4GA 2O1JA 1KQ1A 1KILB 5APVA 3P8HA 3U1CA 5GAN8 1N2DC 3A3YB 3I55T 4IFFA 3ASKA 3TU4K 2W6BA 1T3JA 5CJ4A 5GAOn 3I56T 1AQ5A 1YI2A 5GANe 2L89A 5FU6C 5J3BA 4M7AG 3OYKA 1HGVA 3BRTB 1WJRA 5J39A 3UDCA 5GAN6 3FRNA 2OYHC 3T9NA 5I21A 1BI3A 3KPEA 1OI1A 5GMKm 3L2UA 1NPRA 4FIBA 4X34A 1LWUC 1Z56A 4GIFA 5LL6S 1WT6A 4HA8A 4PJOF 4E7LA 3M59A 2CKKA 1YIJA 2E43A 2CZ0B 2GM4A 5GMKj 1QVFA 2RA2A 1NHLA 3NTKA 2X4JA 3IFMA 4BI8B 3L4FA 5FLXE 4I1LA 2FL7A 3V4QA 4N0AC 3RL0D 3O8ZA 1H89A 3VTPC 1M1JC 5AW4B 4JRKA 2NPSD 3OYIA 2R32A 1JOCA 1HUCA 1RL2A 4F7UA 1DX7A 3M57A 1UGRB 1DEBA 2HFED 4C0ZA 1VQPA 1PFIA 3NTNA 1G2CB 1HK9A 2FHDA 3OS1A 3QJYA 3OSVA 4KT0E 5KE3A 2JTFA 2JOYA 2LT4A 2DXCA 2Q9IA 3C9IA 3RL0C 3F70A 1JCDA 4L59A 1L0LK 5CCAA 4DA4A 3A7OA 2P4TA 4BY6B 2NPSC 1KQ2A 1VQ4T 4OH8B 1ZV8A 3SWFA 3CXCS 1GU4A 1ZQ1A 2WSCH 2C06A 4BE2A 1NAFA 2M0OA 3QHSA 1VQNT 4M78E 1LJOA 4C0DB 4OVAA 2F5TX 4C92A 3E9FA 4M77G 4PLIA 2RHYA 5LJ5d 1H641 1ZHIA 4XQ3A 3CBOA 4F7UE 2A45G 3JSCA 1L0NK 1SQBK 2YO2A 3FLGA 1O75A 4M78B 2RHZA 3CC4A 3G71T 1HGZA 1KQSA 2YO3A 3CCJT 3QUIA 2L3RA 1TH7A 1VQLT 3RUXA 4J7IA 4F7UB 2OYIC 3LWIA 4XTUA 1UGQB 3P8BB 2ZPFB 4QVZA 5CK9A 1NU1K 3L2ZA 3A8GB 4C5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R58 A;  4C5E A;  2M16 A;  3FC3 A;  5FRO A;  1NTM K;  3DB4 A;  3H6Z A;  2X4X A;  2HQE A;  3OYI A;  3L42 A;  2FYU K;  2E5Q A;  2LDM A;  3NTI A;  3NTH A;  4IUR A;  2OAR A;  3FEO A;  2DIG A;  3PFS A;  3QKJ A;  2LCC A;  4QQG A;  4A4G A;  5D6Y A;  3LW5 H;  3OYD A;  2B8A A;  2K3Y A;  3ME9 A;  4HCZ A;  5IN1 A;  4N4G A;  4UC4 A;  2DIQ A;  3MET A;  3EAE A;  3OYM A;  1OZ2 A;  3MP8 A;  3LX7 A;  3OY9 A;  2EQM A;  2F5K A;  2D9T A;  2LVM A;  2BIV A;  2EQU A;  2FHD A;  3H8Z A;  2QQR A;  3OQ5 A;  4BDY A;  2XDP A;  3MEA A;  5J26 A;  3OS1 A;  2EFI A;  3UT1 A;  3OYH A;  2RHX A;  3E9G A;  5KH6 A;  3PMI A;  5IAY A;  3MEW A;  3PNW C;  2BUD A;  3OYN A;  3DLM A;  3P8H A;  2J59 M;  1NTZ K;  2M1H A;  2P0K A;  3LLR A;  2R5M A;  3C4S A;  5CIU A;  2LTO A;  5KE3 A;  2EQK A;  2JTF A;  2RHI A;  3LH0 A;  2XK0 A;  3OYG A;  2RO0 A;  4QQ6 A;  1SQP K;  3ASK A;  2JZ2 A;  3L2Q A;  2EKO A;  3F70 A;  4QQD A;  4L59 A;  4BAC A;  4Z02 A;  1L0L K;  3BDL A;  4NS5 A;  3S6W A;  2WSE H;  4Q5W A;  4IKF A;  4GY5 A;  4IUP A;  2LRQ A;  4BE0 A;  3P8D A;  2EQJ A;  2RI3 A;  3MEV A;  5D6W A;  2G3R A;  2HQX A;  1SQQ K;  1SSF A;  2WAC A;  3CEY A;  4IUT A;  4A4H A;  2RI2 A;  4LD6 A;  2L89 A;  4IFD K;  2IG0 A;  5C0M A;  4E7I A;  5KE2 A;  1SQV K;  2RJD A;  2QQS A;  5KCO A;  1SQX K;  1WJR A;  2WSC H;  3UWN A;  5J39 A;  3OYK A;  3OYC A;  3L2V A;  4N4I A;  2MWO A;  3S3M A;  3ZEH A;  3OS0 A;  3OMG A;  4E7J A;  1RI0 A;  3KUF A;  4IUQ A;  1NTK K;  3LGF A;  3MP6 A;  4EDU A;  2E6N A;  4BE2 A;  1OYX A;  2X35 A;  3OYL A;  1OI1 A;  2M0O A;  3L2U A;  1WJS A;  4ZTF A;  2VYT A;  4X34 A;  4C5H A;  2R57 A;  1N27 A;  3QJ6 A;  4BE1 A;  4BDZ A;  2RJE A;  3MO8 A;  2GFU A;  3M9Q A;  4FL6 A;  4OVA A;  2RI5 A;  3E9F A;  3OS2 A;  3S3O A;  4PLI A;  4E7L A;  1OZ3 A;  2CKK A;  2RHY A;  3GOX A;  1WJQ A;  5M9O A;  3CLQ A;  2RJF A;  4N4H A;  3OYE A;  2RHU A;  5FRN A;  2BKD N;  4A4E A;  2X4W A;  3FDR A;  1XNI A;  4PL6 A;  4PLL A;  3OYF A;  3S3N A;  2O4X B;  3G3Z A;  2GF7 A;  4QW2 A;  3MP1 A;  1L0N K;  1SQB K;  3FLG A;  4BD3 A;  1G5V A;  5C6S A;  1MHN A;  2GFA A;  2RHZ A;  2RJC A;  4A4F A;  2YRV A;  3QII A;  3OB9 A;  4B9X A;  3OYB A;  4B9W A;  2LKM A;  1H3Z A;  4C5G A;  2X4Y A;  2L8D A;  3DB3 A;  2O01 H;  5D6X A;  5FRM A;  3NTK A;  2DAQ A;  4CRI A;  4II1 A;  2L3R A;  3MEU A;  4E7K A;  3OMC A;  2WSF H;  4IUU A;  3LGL A;  4RG2 A;  3OYA A;  3Q1J A;  3L2W A;  2MWP A;  4IUV A;  3OYJ A;  3LYI A;  3QBY A;  4FU6 A;  3SD4 A;  1WGS A;  3O8V A;  4QVZ A;  3OA6 A;  1KHC A;  4E7H A;  3PMT A;  4ZTJ A;  3L2R A;  2NLU A;  1NU1 K;  5KLV K;  5KCH A;  2O4X A;  2R5A A;  2PQW A;  2K3X A;  4C5I A; 
#chains in the Genus database with same CATH topology
 4C5E A;  1IHW A;  4Y28 J;  5FRO A;  3CX5 I;  4KUI A;  2V8I A;  2Z0W A;  2AXT E;  4Z88 A;  3NTH A;  3MTU E;  2K2M A;  2KVQ G;  2V1Q A;  4TT3 H;  2G8Y A;  2SPZ A;  3JCU E;  1I81 A;  2KT8 A;  3RBB B;  3A8H B;  5LJ3 e;  1A02 J;  1JQQ A;  3PGG A;  2HBW A;  1SRL A;  2D6F A;  5EG2 A;  1FZG A;  2EJF A;  2VWF A;  3CXH D;  5IN1 A;  5E79 E;  4U3F E;  4UC4 A;  2QGF B;  3CCM Q;  2W8Z A;  3LW5 J;  1GCQ C;  1YCS B;  1LTI C;  2EQU A;  2L5Q A;  1EZV D;  5CCG D;  2KOG A;  3WUU A;  1N9S A;  5CKB A;  3OYN A;  5I22 A;  4C92 E;  3H32 B;  1NZ9 A;  1YJW A;  3CC7 Q;  1Q2N A;  4OB3 B;  2Q1K A;  4OML A;  2OAU A;  1FAV A;  4PJL A;  3UAT A;  1RAH B;  1A02 F;  1NTK D;  2LMJ A;  3VYH B;  1KSW A;  2C9L Y;  2LRQ A;  1NYG A;  3HRT A;  5HKC A;  1NBE B;  3F5H A;  1QP3 A;  4F17 A;  3RKX A;  2YXQ B;  4HB1 A;  1D1B A;  2NWM A;  4C92 B;  2RI2 A;  1IXD A;  1LT9 A;  3Q5R A;  4IFD K;  1G3T A;  1U7M A;  1QKW A;  3CCU T;  4M77 F;  3UWN A;  5CKH A;  5FWB A;  3L2V A;  3ZEH A;  1WNL A;  1MFT A;  4XTY A;  2H7H A;  1RUW A;  1BE3 E;  3OYL A;  3KQG A;  2JJ9 A;  4KH0 B;  5GAM h;  1FZC A;  3L75 G;  1H92 A;  3RMQ A;  1ZR2 A;  2ZT9 B;  1N27 A;  5KKZ C;  3MO8 A;  1MMN A;  2WWW A;  1ZA1 B;  3GNF B;  1VQM T;  1L2P A;  4WCI A;  2KS1 A;  5M9O A;  3MUD C;  4L73 A;  2K5L A;  4WY4 A;  3A2A A;  4Y91 A;  4OB0 B;  4RMO A;  4UB8 H;  1VA7 A;  4AFS C;  1TOV A;  3D6Y A;  2YMY A;  3A8O B;  1TU3 F;  1NKZ B;  5KTB A;  3O5Z A;  3RGU A;  1AVZ C;  1SQB G;  5LJ5 j;  4A4F A;  1KFZ A;  3HRS A;  3N7N A;  3EHQ A;  3HUS A;  1D0Z A;  2JM8 A;  1LJ2 A;  2DYB A;  4OMP A;  2DAQ A;  1TU0 B;  2LX7 A;  4E7K A;  3CMA Q;  1G3Y A;  5GAM j;  2CK3 H;  3QWY A;  3L2W A;  2W0Z A;  1YHQ A;  2CP5 A;  3AEE C;  1T3S A;  2K4Y A;  2FYN C;  5HY6 A;  3IR9 A;  3CCE T;  1N7S A;  3PVQ A;  4EMH A;  4BUG A;  3UA6 A;  1NU1 G;  1IRE B;  4M75 D;  2NZ2 A;  2J06 A;  2A45 I;  2RK2 A;  1HTL C;  2ZCF B;  2ZVO B;  3IF4 A;  4WB4 A;  3RNJ A;  5GAN 7;  3VS3 A;  2FB7 A;  2B9B A;  1JXM A;  1J1D C;  3JCM V;  3OJA B;  1LP1 A;  1RH5 B;  3M58 A;  2K6D A;  3CCS P;  2K3Y A;  3VS7 A;  1Q7Y C;  2LXB A;  3G6E A;  4DJG A;  2GGR A;  1LT1 A;  3B71 A;  1HWT C;  2JDI H;  3CL3 D;  1UEB A;  5BU8 B;  3OAK A;  1K9M Q;  2D0N A;  2K3R A;  3A8M B;  1GMJ A;  2ABL A;  4LN2 A;  4CC2 A;  3L75 J;  1OVV A;  1FZA A;  2IBZ D;  3CMA T;  2GUV A;  2W10 A;  5GAN g;  5HCK A;  2RHX A;  4ZMD A;  4AYC A;  2LQ8 A;  2PVD B;  3T97 A;  1FWZ A;  4JYC A;  1NH4 A;  2RN8 A;  3I55 P;  3CX5 H;  1BIB A;  3CC2 A;  1SQX D;  3LH0 A;  2BTT A;  3ITK A;  1WHL A;  1FDI A;  2QXF A;  2WSE E;  3QZ9 B;  1D0Y A;  4D8D A;  2E3H A;  5M1B A;  1RLQ C;  3CCR Q;  2M51 A;  2CH4 A;  2QTX A;  4PJ0 E;  3I56 P;  1SQB J;  2DLP A;  4M75 C;  1M1K Q;  3CPF A;  1XOV A;  3P8D A;  1FZC B;  5C39 A;  1IZN B;  2K7A A;  1S3J A;  1NOH A;  2KSE A;  2LCS A;  3OA7 A;  2AT1 B;  3CEY A;  2QAS A;  2IG0 A;  5AVV B;  5KE2 A;  1UG1 A;  2KS1 B;  2QQS A;  1Q81 R;  3L72 G;  4WY4 B;  3REB B;  4B6M A;  2K5F A;  2A06 G;  2ED0 A;  3OYC A;  1HSQ A;  2L2P A;  4M7D D;  2QEX A;  1NTM D;  3KUF A;  1RAG B;  1V76 A;  2XG8 D;  1NU1 J;  2PTK A;  1KZU B;  3M0R A;  2DA9 A;  4Z8A A;  2KNB B;  5CR2 A;  1SQP G;  2BEQ D;  2EWN A;  3HUS B;  2QQA A;  2RD1 A;  4OWF A;  1I5O B;  1PPJ D;  2E12 A;  5B5E E;  3OW2 S;  3QJ6 A;  1YQ4 C;  1S5L H;  2RI5 A;  2EGC A;  3CCV A;  3RK3 E;  3CCR T;  4K11 A;  5AVR B;  1VQ8 Q;  1VQK T;  1N7S B;  1Q7Y U;  4QVC A;  1IGQ A;  3OYF A;  2CGH A;  4XA4 A;  2R3S A;  3EH1 A;  2NUT A;  1JJ2 A;  3U59 A;  3AT1 B;  2FFD A;  4WWI A;  2IPP A;  3H1I E;  1JY2 N;  2Y4X A;  3A8L B;  1LP1 B;  1N8R Q;  1KFM A;  2O01 H;  2Q5U A;  2HR3 A;  1QMC A;  5GTH E;  1UGV A;  3VS5 A;  2PUK B;  2E75 B;  4C0G A;  3OMC A;  3WVD B;  4OMO A;  3CPW S;  3QYH B;  1Y9B A;  2N1T D;  3II6 A;  1YJ9 T;  1R5S A;  3EGU A;  3EGX A;  3G4S A;  4L6V 5;  4JLG A;  1VQ9 T;  4XAX B;  1M1J A;  1Z9Z A;  1XTC C;  2R5A A;  2ESW A;  3H0H A;  1UGP B;  4FW2 A;  1GL5 A;  2ROT A;  4DZO A;  2YUP A;  2YUN A;  4R4M A;  4XK8 E;  3H1L D;  3T97 B;  4FSX A;  1VQ8 T;  1NTZ E;  1EXJ A;  1UII A;  3ZL7 C;  1K8A R;  5BVZ A;  2RQV A;  2FKW B;  4QQG A;  3QKJ A;  3L72 J;  1AA0 A;  1MV3 A;  2CPS A;  3LW5 H;  3JB9 G;  1WHK A;  1ZN5 A;  2LR2 A;  1HJD A;  1SQP J;  3L73 E;  4XTX A;  4FW1 A;  4RO0 A;  1OWA A;  2WMM A;  1OV3 A;  5FU6 B;  2EGA A;  3G4S T;  5J26 A;  3NMD A;  3H1H G;  4BRY A;  2R44 A;  1W1F A;  2C0X A;  2IZ0 A;  1PHT A;  2DIL A;  3C95 A;  3EFS A;  1K73 Q;  2A45 H;  2Q3I A;  5IH2 A;  4FYV B;  1VYT A;  4M77 A;  4N3Y B;  2LTO A;  1FMV A;  1LVK A;  2N1T C;  1M27 C;  3QH9 A;  4C8Q G;  1T8Z A;  1FBM A;  5AVU B;  1M90 C;  1VQ6 A;  1K0S A;  4PJO D;  4NS5 A;  2E5T A;  1LWU B;  4NPF X;  2RI3 A;  1VQ4 P;  3PIO A;  3HFO A;  2AZV A;  1E6G A;  1Y07 A;  1QX8 A;  2LNV A;  3SHW A;  3J80 E;  2HYN A;  1Y8A A;  3EFF K;  3RIR A;  1VQ5 Q;  1GFD A;  1YYC A;  3CME T;  1KD1 Q;  3OS0 A;  3HE5 A;  1MKM A;  2ECZ A;  1WHG A;  2DTH A;  4RKU J;  5APU A;  2BCC E;  2FYU E;  1HXD A;  2VGN A;  2NUT B;  4HCK A;  1WHJ A;  3LIE A;  1VQN P;  2FFD B;  1NJI Q;  3EG3 A;  2FPD A;  4KGX B;  1FXX A;  2CDT A;  4A54 A;  5GAO q;  1WX6 A;  2I1J A;  3S3O A;  3CCL T;  3JB9 J;  1WJQ A;  1X2K A;  1XJW B;  2P4R A;  2RHU A;  3QG1 A;  2BKD N;  4A4E A;  1QVF S;  1M1J B;  4OP0 A;  3EFG A;  1PZQ A;  2JKV A;  2QG9 B;  1LT9 C;  3WXM B;  5AW1 B;  2E74 D;  1JY3 P;  2F2W A;  3DKM A;  1VF5 B;  3INZ A;  3CCJ P;  3H1H J;  3L70 G;  2X4Y A;  1JB0 J;  1VQ5 T;  2QJK B;  1VQL P;  1X22 A;  1GL2 D;  1W2E A;  3H1K D;  5AVT B;  5H2F H;  1M1G A;  1M3B A;  1ZSZ C;  5LJ3 g;  3RES A;  4C7N A;  1IFP A;  3VOP A;  2O88 A;  4JBZ A;  4K35 A;  2AKK A;  2XND H;  2QJP C;  1JNM A;  1FZC C;  1AWJ A;  3JB9 F;  3MHX A;  1IK9 A;  4ASV A;  2WPS A;  1M90 U;  2Y0E A;  3PLN A;  4U3F J;  4M4Z A;  1AD5 A;  3AEF C;  1EDL A;  2KYB A;  1X79 B;  2QYZ A;  4FM4 B;  4XFJ A;  1QVF O;  4M7A D;  1SQV D;  4BRY B;  1LTB C;  3MGN A;  3FJ5 A;  1GTW A;  2KYV A;  1VYU A;  2ZJS E;  2CP3 A;  3CCS Q;  1KFN A;  1S9K D;  3TQ7 P;  3RL0 B;  1PRM C;  2RF0 A;  3X25 B;  1UIX A;  2HBP A;  1YJN T;  4W7Y A;  4J9C A;  3A0H H;  3HSB A;  3HUS C;  5L8R J;  1EDK A;  1LTG C;  5DLO A;  2NPS B;  4Z1M H;  4FYX B;  3EFO A;  4C8Q F;  1YIT A;  3EAE A;  3OBY A;  3OYM A;  2QG4 A;  2XIC A;  2CRE A;  2PUO B;  2E74 C;  4OVN F;  4AFZ C;  3OQ5 A;  1RE4 A;  5APX A;  5AW9 B;  2QQR A;  3M55 A;  2EYY A;  2YRD A;  3I55 Q;  1J3T A;  2DJZ A;  1MMD A;  2O9V A;  3GG2 A;  3VUZ A;  2NUZ A;  2D2C B;  1AOJ A;  3PP5 A;  4JS5 A;  1NTZ K;  3CX5 D;  2P0K A;  1OOT A;  3VMY A;  3HE5 B;  3NXS A;  1KQF B;  1W2B S;  1OQK A;  2AKL A;  3U23 A;  3I56 Q;  3MP7 B;  4I7Z B;  2GQI A;  3URG A;  1VQ7 T;  4AQR D;  4D6W A;  1NEG A;  1H8K A;  1QKX A;  3REA B;  3FB9 A;  4LUD A;  2HOD A;  4BE0 A;  3L70 J;  4H44 B;  2RM4 A;  2ZZD A;  5D6W A;  4HYT B;  1W2B P;  1YFN A;  2B87 A;  4GOF A;  4MMK A;  5A0L A;  1M9S A;  4B86 A;  3H0I A;  1HYO A;  3HE4 A;  5KLI B;  4N6J A;  3CCU P;  2HAX A;  3MIW A;  1X43 A;  4D6T G;  2KXD A;  4RTZ A;  2RNA A;  4IUQ A;  2IIM A;  1G1J A;  2Q7C A;  5CCG A;  3BFM A;  2H3J A;  3EG9 A;  3M0T A;  1RE3 A;  2EAY A;  2CSI A;  1C0M A;  1CZQ A;  2OYI B;  1Y7X A;  2DFU A;  2QQ9 A;  2ZYG A;  2KDS A;  3PHL A;  2KNC A;  1VQM P;  4D8K A;  3MUD A;  3OS2 A;  1QL2 A;  2L5G B;  4C7N B;  4ZNC A;  1X6B A;  3LWH A;  2COY A;  3HL8 A;  4OB1 B;  4EDF A;  3VUB A;  2VUB A;  1KQS S;  3V2P A;  1OU8 A;  5GMK h;  4BD3 A;  4FT2 A;  1T6A A;  2WPR A;  2HSP A;  2I0N A;  3GF5 A;  3KFV A;  2DL8 A;  3JCM h;  1MMG A;  1QVG A;  3RK2 D;  2CP2 A;  1RF0 A;  3C94 A;  4RES B;  3BCC E;  3CCE P;  2OTL T;  2RMZ A;  3EFO B;  1VF5 D;  2P84 A;  4JJD A;  5GMK l;  3A8G B;  2JS2 A;  4HVV A;  2M8R A;  3PTZ A;  2KSJ A;  4HJG H;  2DE0 X;  4AUW A;  1H0T A;  2Y0C A;  4H13 D;  2W83 C;  2Z4E A;  1BCO A;  3H1I G;  3V7R A;  2B86 A;  2DIG A;  1PM3 A;  2D8J A;  4D6T J;  1K0X A;  2FFD C;  2YDL A;  2BZX A;  3CXH E;  3R4Y A;  3EHR A;  2JNG A;  2AXC A;  2GQV A;  1QWE A;  2ZPE B;  2HOD B;  4M77 D;  3CMA P;  2D9T A;  1EZV E;  1G2B A;  2B87 B;  2P0P A;  3Q5P A;  1SQQ D;  2VB6 A;  3HE4 B;  3JRZ A;  1BDC A;  2XDJ A;  3G9R A;  5IHN A;  3RK2 C;  2OTJ T;  2DTO A;  1JO8 A;  3GPL A;  2RHI A;  4O6J A;  2H43 A;  3CCQ A;  1NTK E;  1VF5 C;  1QLY A;  3NMZ C;  1W6X A;  4M75 A;  2OAW A;  3VKI A;  1VQ4 Q;  5DJU B;  2QJK C;  2D0Q B;  1VQO T;  5CVI A;  2KZJ A;  5KKZ B;  1YI2 Q;  3AHU A;  2MIO A;  1N9R A;  2WAC A;  3L73 G;  2KNC B;  4CC4 B;  4H13 C;  3VYI A;  1OMI A;  1QW1 A;  5GMK i;  4PJN A;  1RAB B;  4LD6 A;  3FIF A;  5AVZ B;  3L74 E;  1TUC A;  1BKB A;  2QI2 A;  1KB9 H;  5APS A;  1MFZ A;  2Y9Y A;  3CD6 A;  3Q2Y A;  4X1V A;  4N4I A;  3OMG A;  1VQN Q;  1Y96 A;  3S4R A;  4BWN A;  3QWX X;  4OMM A;  3G1J A;  3MP6 A;  1GU5 A;  3B8E B;  2FYZ A;  2X35 A;  4M7A F;  5GAN d;  3BVH A;  4M77 C;  2DL5 A;  4PFP A;  3E19 A;  1YNZ A;  3JB9 H;  4Y99 C;  3H1I J;  2K9J A;  4FL6 A;  3BE3 A;  3CCR P;  5APQ A;  1VQK P;  1PRL C;  2QA4 A;  1M8M A;  2KAF A;  4OGE A;  2UWJ E;  3OYE A;  4XTZ A;  3G71 Q;  1YI2 T;  3AE9 C;  3L71 G;  1Y0M A;  2P2U A;  4XTV A;  1BCC G;  4ZGJ B;  5CBO A;  4QW2 A;  3FXD A;  1NWQ A;  2D2C C;  1MMA A;  1J1D B;  2CP6 A;  2GFA A;  2K79 A;  1H0T B;  2CS7 A;  3OB9 A;  3QII A;  1VQL Q;  1QCN A;  2ED1 A;  5DLQ E;  2FXO A;  3QDR B;  2DO3 A;  3CXC P;  1NG2 A;  3JCM f;  2YNY A;  2XHC A;  1TUD A;  1WDX A;  1JEG A;  4M7D A;  1YJ9 P;  3CCM A;  5BU5 A;  5E79 H;  1G83 A;  1VQ9 P;  1J1E B;  3GF7 A;  3L36 A;  2IFM A;  5AW5 B;  2XNX A;  4M75 E;  1JTH A;  1K05 A;  1GK6 A;  3Q3D A;  3L73 J;  1U57 A;  3O6Q A;  1VQ8 P;  3GNG A;  2DTI A;  2VXE A;  3M91 A;  3DLL A;  3C12 A;  1YIJ T;  1D0X A;  1AHJ B;  4YTL A;  1JRI A;  2SEM A;  3FEO A;  3QPH A;  4XU2 A;  3VU3 C;  3X28 B;  3CC7 A;  1Q82 C;  3BY7 A;  3PE0 A;  1UE9 A;  1O9S A;  1QL1 A;  3SFD C;  3OYD A;  1EX4 A;  1G3W A;  4M75 B;  2WPV B;  3L75 D;  2DL4 A;  3GHG A;  3G4S P;  3HP9 A;  3FJP A;  2IBZ E;  1AZG B;  1RAC B;  3H8Z A;  4X9D A;  2RQR A;  1I5L A;  1MGQ A;  3UT1 A;  3OYH A;  3SDZ A;  3GLM A;  1M56 D;  4JLI A;  3TGU G;  2KZI A;  1SQX E;  2B89 A;  2N1T A;  3M0S A;  1SQB D;  1QP2 A;  3L2Q A;  1Y96 B;  4W80 A;  2HL5 C;  5IXB A;  3L71 J;  2BE7 D;  4LDX A;  1BCC J;  2Z5I A;  1CW5 A;  2FVU A;  1Q86 C;  4R4L A;  2YXY A;  4GY5 A;  4EYY Q;  3NFQ A;  3FWL A;  1G1I A;  3CCU Q;  3SFM A;  2K9J B;  3IQL A;  2PZ1 A;  1VQP T;  2DXU A;  4L75 A;  3JCM W;  2LCL A;  3V5B A;  1Q81 Q;  2AHJ B;  1NU1 D;  3CME P;  8AT1 B;  1KC8 C;  1YTZ T;  1RE4 C;  2E41 A;  2JUF A;  4M7D E;  2AZS A;  1NTM E;  3VP9 A;  2DF6 A;  4VUB A;  1IFJ A;  3SWN A;  2YKP A;  2J6O A;  1NTK K;  3LGF A;  2A36 A;  1UEC A;  2JS0 A;  1CSK A;  2E6N A;  1KYO H;  3C1L A;  2JXB A;  4R55 A;  1PPJ E;  1VQM Q;  3JCM c;  2LZ6 B;  1AV1 A;  1L0L G;  4HKE A;  2N9B A;  3CCL P;  5GAO r;  2DX1 A;  3EG1 A;  5B66 E;  4ELY C;  5GAN j;  1Q82 U;  3SB2 A;  4ZN1 A;  4M7D B;  1DD4 A;  3KZI H;  2V7Q J;  2FPE A;  1JJ2 S;  5APW A;  4AFU C;  4PJO A;  4J6Y A;  5I2S A;  2J5U A;  1JTH B;  2GF7 A;  5LJ5 h;  2ZXX A;  3N5B B;  3O6Q B;  3TEE A;  2OI3 A;  4RTX A;  2LKM A;  5GTI E;  1VQ5 P;  1M4Z A;  4B9W A;  4ESR A;  4N78 D;  2L8D A;  1ZSZ A;  3TGU J;  4W7Z A;  1HD3 A;  1OEB A;  2HL3 A;  4ELZ C;  5FRM A;  4JUV A;  3CCE Q;  1HH0 A;  2CH4 W;  2QSI A;  5CCG C;  1M30 A;  5AT1 B;  1R8E A;  2DD5 A;  1VIE A;  1RE3 C;  2Y4Y A;  3V7C A;  4NOY A;  1L4A D;  1X75 C;  1JO5 A;  4XTW A;  3CWB G;  3GHG B;  3KDP B;  5KCH A;  4E2F B;  3MCA B;  1Q86 U;  3H0F A;  4IL6 H;  1D7M A;  3QXE B;  1P84 E;  3L72 D;  3H1L E;  2A06 D;  1YBK A;  2A37 A;  4JQ0 D;  2ZPH B;  3U1A A;  3I35 A;  1L0N G;  1LNQ A;  2N1T B;  1K8A Q;  1NLO C;  1Q7Y R;  1AWO A;  1GBR A;  4NL2 A;  1YJN P;  1AWW A;  2F69 A;  1KC8 U;  2RKL A;  1D1C A;  3CC4 T;  1SQP D;  1M3A A;  1BGY G;  2LJ0 A;  3X24 B;  3HD7 A;  2BZY A;  1PGO A;  2L91 A;  3VN0 A;  2E76 D;  1VL2 A;  1PD0 A;  2DIQ A;  2L0A A;  2HMA A;  5CMZ A;  4LDY A;  2EQM A;  4HKZ H;  1SHF A;  2F5K A;  1RF0 C;  4CPG A;  1PNJ A;  1L0L J;  1GL2 A;  1WPY A;  4KGZ B;  3RDV A;  5LJ3 d;  3PMI A;  2XDD A;  1PP9 G;  3H1J E;  1NPP A;  3M9B A;  5DY9 A;  4PV1 D;  4EIJ A;  2PVO B;  4YTP C;  2EQK A;  1GDT A;  4KUL A;  1OW8 A;  3SWN B;  1VQ7 P;  3VS1 A;  1Y47 A;  1L4A C;  4IOI H;  1FOS F;  4PJO E;  1LCK A;  1BYM A;  1QVP A;  1MV8 A;  2DZ9 A;  4M7A A;  3X20 B;  2HKN A;  2DRK A;  4IKF A;  1ZW0 A;  3A0B H;  3VP8 A;  1J1E C;  2J7I A;  1M5Q 1;  3RL0 g;  1OXZ A;  1KB9 D;  2RJD A;  4UB6 H;  1IZ6 A;  4PJO B;  2KLU A;  1SQX K;  1LT9 B;  2KEA A;  1X01 A;  3QYG B;  3CWB J;  2O2O A;  1URQ A;  2ITA A;  3RBZ A;  2K3B A;  2E76 C;  2DL7 A;  4PD4 I;  4YXW H;  2LX9 A;  4ZKU A;  3M5A A;  1FMW A;  1BCM A;  5A0G A;  2ZAE A;  1YJW T;  1ZSZ B;  3JB9 D;  1IJD B;  1FU1 A;  2E5K A;  2RH0 A;  1CI6 A;  2EBP A;  2FZK B;  4J6W A;  1L0N J;  4C5H A;  1VQK Q;  4KJM A;  2G3A A;  3BAS A;  2C0T A;  2QJP B;  4PV1 C;  1ZBJ A;  1M1F A;  4UB8 E;  2JJL A;  1BGY J;  2KMT A;  4DEY A;  3L74 G;  3K5B A;  5KLV E;  1XNI A;  2MK5 A;  2VC8 A;  3H1H D;  1BDD A;  1SG5 A;  5AVS B;  1IRX A;  3MP1 A;  4DBH A;  1H3H A;  5LJ5 f;  1K1Z A;  1H3Z A;  1RAI B;  3IAO A;  3E1S A;  3P7K A;  4ME7 A;  1PP9 J;  1S72 A;  4C8Q D;  5GJW B;  1YJ9 Q;  1VQ9 Q;  2OTL P;  4C0F A;  2WSF H;  2JEE A;  4DEX A;  5GAM f;  2XID A;  2EYQ A;  1T2K D;  1EIF A;  3HD7 B;  3JSV C;  2XZR A;  3LID A;  3V6I A;  2E74 B;  3P8C D;  1WGS A;  4Z89 A;  5A0D A;  4ZTJ A;  2E5Y A;  4X9C A;  4RTV A;  2LQW A;  4IL6 X;  2YUO A;  1SQV E;  2K3X A;  1GL2 B;  3OW2 P;  3HRU A;  4AMC A;  1S9K E;  2E42 A;  5LJ3 h;  5TJH A;  2V8K A;  3NHN A;  4I2L C;  5L23 A;  2LCC A;  1K4U S;  2P1J A;  2ZXE B;  4HT9 A;  3GLX A;  2A28 A;  1WYX A;  1N86 A;  5KYW A;  4M78 G;  2MYS A;  4M7A B;  2YT6 A;  3G4S Q;  1WA7 A;  5CHX A;  5GAM g;  2WIT A;  1I07 A;  4PKC C;  5GAN 4;  3OY9 A;  3V4W A;  2LVM A;  4M7D C;  2JTM A;  5CKF A;  5KAF H;  4KBM B;  1AT1 B;  3TCJ A;  1YHQ T;  2QQB A;  2ZFC A;  4F7U G;  2OTJ P;  1WQ7 A;  3QZ5 B;  1NEB A;  3TRE A;  4C8Q C;  5APY A;  2BUD A;  3CX5 E;  3CPW P;  2J59 M;  1UHC A;  3NGP A;  1M90 R;  3R2P A;  5CCH D;  3L74 J;  1YWP A;  2RO0 A;  4QQ6 A;  1E5W A;  2DKG A;  1ZME C;  1OPK A;  2WSS H;  3AEG C;  1WRG A;  4KHX A;  3L70 D;  4AG2 C;  5LJ3 j;  4BAC A;  4KT0 J;  1VQO P;  3P32 A;  1AVO A;  2IPO B;  4LLH A;  2ZAE B;  2HEQ A;  4IUP A;  1CI6 B;  2E6Z A;  3L35 A;  2HZY A;  2CSQ A;  3UF4 A;  3G6E T;  3CME Q;  1AWX A;  2LP5 A;  3MD0 A;  2POH A;  3GHG C;  4HXJ A;  4PFZ A;  1WZO A;  1KQG B;  3E1R A;  3UA7 A;  4GKG A;  1D09 B;  1BIA A;  1KIK A;  2YHT A;  3B5N D;  1JBM A;  5FWC A;  1DEE G;  1KYO D;  2IYP A;  3CCL Q;  3CC2 T;  3W67 A;  3JCM e;  2V7Q H;  1S5L E;  2A7Y A;  4U3F G;  4OF1 A;  5CBN A;  2CZ6 B;  5CCH C;  2NYS A;  4OGC A;  1QLE D;  1YI2 P;  1BBZ A;  4FCY A;  4MZP A;  3AEA C;  4JZ3 A;  4PL6 A;  2HPC A;  5CO7 A;  3V8L A;  1QVG S;  1USD A;  3AE7 C;  2OYO A;  4C92 G;  1TS9 A;  3TVT A;  2O01 E;  3CCS A;  2FZC B;  2P67 A;  3GF3 A;  4PD4 H;  1N6A A;  3SWN C;  2FXM A;  2QEX T;  2H8H A;  4II1 A;  3WUV A;  3M54 A;  2WTY A;  2RQU A;  3LGL A;  3MJX A;  1YN8 A;  3THK A;  3V7S A;  4BB7 A;  4Y28 E;  1ARK A;  1OVR A;  3O8V A;  3B5N C;  2GNC A;  2KI7 A;  1KQL A;  2MOX A;  4M78 F;  5KLV K;  3EGX B;  2WZ7 A;  4AFQ C;  1NYF A;  3I55 A;  3CCV T;  4E6R A;  3RK2 B;  3VMZ A;  1SKU B;  1YIJ P;  4PJO C;  4D6T D;  1CKB A;  2X4X A;  1YJN Q;  3TNU A;  2I8D A;  3G71 P;  1QVG O;  3HD7 D;  1S1N A;  3L42 A;  2Y9Z A;  1FZF A;  4F7U F;  3LW5 E;  1BE3 G;  2YXR B;  4A4G A;  3I56 A;  1QVF P;  1X6O A;  1IC2 A;  3E2U A;  1JY2 P;  1YWO A;  3D6Z A;  3WMM 0;  1KIL A;  4M77 E;  1OZ2 A;  4H13 B;  4NPD A;  1RAA B;  3MKD A;  1SQQ E;  3VRY A;  3L37 A;  1FX7 A;  2JWA A;  5EC7 A;  4XE5 B;  1K9M C;  1LTA C;  4MML A;  1ZUK A;  2LC4 A;  2M1H A;  3LLR A;  1VQ7 Q;  3C4S A;  1GBQ A;  1PIX A;  1IFD A;  2ZPI B;  4M77 B;  1ABQ A;  5AW3 B;  4QQD A;  4QKU A;  1NO4 A;  4RTW A;  3ZDM A;  1QCF A;  1N73 C;  5KYU A;  3HPW A;  2LJ1 A;  4Y99 B;  5FU7 C;  3V2Q A;  1PGJ A;  4J9G A;  2CP7 A;  1VQP P;  4OGQ B;  1GW4 A;  1SSF A;  1JY3 O;  1URQ D;  3HD7 C;  1M1K C;  1PKS A;  2WVR A;  5KYX A;  2K2V A;  1OVU A;  2HDA A;  3H1J G;  1G3S A;  4JZ4 A;  1GL2 C;  3JCM b;  4AG1 C;  2YLB A;  1TSF A;  3A5Z B;  3TSI A;  2W90 A;  1YTZ I;  3H1I D;  1I1J A;  1OYX A;  4A4K A;  2V26 A;  4PJM A;  4OMF B;  1D1A A;  2VKN A;  4C92 F;  4DT0 A;  1OX9 A;  3TK1 A;  2R57 A;  1VQ6 T;  1PCX A;  3M9Q A;  4M7A C;  1BE3 J;  1SVF A;  2FEI A;  1UTI A;  1OZ3 A;  1X9V A;  3JC2 2;  1PC0 A;  2VRS A;  4YPC A;  2DVJ A;  4H0L D;  3AEB C;  2KI7 B;  5DJT B;  1IO4 A;  4L76 A;  3FDR A;  1G8X A;  2DEU A;  2E1H A;  1M7L A;  4HH2 A;  5C6S A;  1UDL A;  2OX7 A;  4GLK A;  2Q3E A;  1U8R A;  2YRV A;  2NUP A;  3TNU B;  2RK1 A;  3EH2 A;  1ZA2 B;  2R5D A;  3A1P A;  2OTL Q;  4JYB A;  2KGT A;  1URQ C;  1K9M U;  2QE7 H;  1FZB A;  3BRV B;  2AEJ A;  5H2F E;  5D6X A;  4E47 A;  5GAO p;  3KYQ A;  2K57 A;  2ZPB B;  1N8R C;  4F16 A;  2I1K A;  1T3L A;  3LYI A;  4FU6 A;  1ZUY A;  3L73 D;  4PK4 A;  3OA6 A;  2AK5 A;  3RMS A;  2HCK A;  2BZ8 A;  4DOV A;  5KLV G;  1LGH B;  2EVR A;  1U7J A;  5DM7 R;  4J83 A;  2QK0 A;  2CYZ B;  2LT1 A;  1SLQ A;  1UFF A;  2HQE A;  1SS1 A;  1W4S A;  2FYU K;  2FO0 A;  1IFN A;  2H8P D;  5EFW B;  4RG8 A;  2OAR A;  1M1K U;  1E7O A;  1SEM A;  1U06 A;  3CC4 P;  3A0H E;  3H1J J;  3AE3 C;  1LPL A;  2B8A A;  1KQS P;  3L75 E;  4H0L C;  1VQ4 A;  1G2C A;  5KYU B;  2QJY C;  1RY3 A;  1N7L A;  4HT8 A;  1S1C X;  2CZ7 B;  1VIF A;  1Q95 G;  4J7F A;  2BIV A;  4BDY A;  2OTJ Q;  1EFN A;  3VRZ A;  2W27 A;  1S2E A;  2PNI A;  3E9G A;  5IAY A;  1EDI A;  1SHG A;  3L71 D;  5KYX B;  1BCC D;  4PJJ A;  1FC2 C;  2H89 C;  3BW1 A;  1L4A A;  4J9E A;  4JJN K;  3EFR A;  1VQO Q;  1VQN A;  5CQY A;  1MZ9 A;  5KAI H;  1KV4 A;  2JZ2 A;  1B7T A;  3KBG A;  3M4Y A;  3HKS A;  1K73 C;  3AE2 C;  1UB4 A;  2MMP A;  3M0U A;  4PNO A;  2VAS A;  1NLP C;  2XI9 A;  3S6W A;  2P58 A;  1VUB A;  2EQJ A;  2QVA A;  4GOD A;  1SQQ K;  2WSE J;  1Y71 A;  4E7I A;  4LDU A;  1YIT T;  2QGG A;  1FZE A;  1AZE A;  4K3A A;  1X6G A;  3G71 A;  4V2S A;  1P84 I;  1N8R U;  3S3M A;  1I8F A;  4J5Y A;  3CCJ A;  1ZLL A;  1RAF B;  2PFX A;  2DBK A;  2PAJ A;  3N4X A;  4OGQ D;  1NTZ G;  2NRG A;  5KLV J;  1VQL A;  4ATO A;  1ZP0 C;  5LJ5 e;  3V8J A;  2KUB A;  3OSS C;  2DL3 A;  1KD1 C;  2NUP B;  2LQK A;  2GUS A;  3EG9 B;  1RHZ B;  2EKH A;  1U1S A;  5GAM e;  2GFU A;  3JCM J;  1NJI C;  4E7S A;  1JMM A;  1ACM B;  3HRN A;  1UUE A;  3WU2 H;  2YIU B;  1LTJ A;  4JRP A;  4FYW B;  4N4H A;  1BK2 A;  1VYV A;  2COW A;  4M78 A;  1J2J B;  4LDV A;  2YLC A;  2MCN A;  3PTA A;  5IHI A;  3TGU D;  3B4S A;  1WIE A;  5TIS H;  3QDF A;  3NPF A;  4N78 E;  2F2V A;  3HTR A;  4JRQ A;  2CPB A;  3GP8 A;  4PD4 D;  1CKA A;  4LD9 K;  4LE9 A;  5CJ0 A;  1TXQ A;  1LTS C;  4RCC A;  2LJ3 A;  3RR6 A;  1XTD A;  4RG2 A;  3SEM A;  2JR8 A;  2KR3 A;  2MWP A;  1M8V A;  1MV0 B;  1K73 U;  2KE9 A;  3VJP A;  4OGQ C;  1JU5 C;  3HTK A;  1YIJ Q;  2PQW A;  2E70 A;  3M0D C;  5AVQ B;  3L72 E;  3RBX A;  1HF9 A;  2R58 A;  4J9B A;  2A06 E;  2EJ9 A;  3VS0 A;  1SFC D;  3FC3 A;  2EYX A;  1Q82 R;  2E10 A;  4ASW A;  4IUR A;  3BAT A;  1Q7Y Q;  2E5Q A;  3PVL A;  1L4A B;  1KIL D;  2BCC G;  2AXT H;  2FYU G;  5AW2 B;  1AJY A;  4HVW A;  2P7J A;  1D3B A;  1SQP E;  1EQ7 A;  1OW6 A;  1OX8 A;  1QQJ A;  1YQ3 C;  3H6P A;  3JCU H;  2DVE A;  4LNP A;  1K04 A;  1WXB A;  1W2B A;  1NTZ J;  1L0L D;  2C0W A;  2M02 A;  1CSB A;  2O01 N;  2ZYA A;  3CCU A;  1KD1 U;  2DXT A;  1YHQ P;  2XMF A;  3HHT B;  4C8Q A;  3MEA A;  2C9N Y;  4WF2 A;  5I2M A;  2E64 A;  3MEW A;  3JCM P;  3H32 A;  2VV5 A;  2MPX C;  1OX3 A;  1ZRT D;  2K37 A;  3USS A;  4FYY B;  1NJI U;  1JM0 A;  2E76 B;  1R0C B;  3OYG A;  1Q86 R;  2EKO A;  6AT1 B;  5IHK A;  2O9S A;  3BDL A;  1GFC A;  5AVW B;  1VQM A;  2V8J A;  1VQP Q;  4Q5W A;  3OS5 A;  1WXT A;  2F2X A;  3GBQ A;  3JCM g;  1SFC C;  4PV1 B;  3G6E P;  2G3R A;  1KC8 R;  2FY8 A;  4IUT A;  4LXC A;  1NKN A;  1KB9 E;  3CWB D;  4RKU E;  1KIL C;  5C0M A;  5AW6 B;  3SWY A;  4ZN3 A;  2WPQ A;  1LTJ B;  2LXC B;  2DRM A;  2MWO A;  4MN4 C;  2KRS A;  5GAM d;  3MZW B;  5A2Q E;  1L0N D;  4DBQ A;  3CC2 P;  4EMG A;  5CKD A;  2BE9 B;  2R3C A;  2HQH A;  1SPK A;  1UHF A;  2QDY B;  2J58 A;  1WJS A;  3E1I A;  3V8K A;  3CCE A;  1GW3 A;  1PGQ A;  3AEC C;  5KJ7 A;  1M3C A;  1BGY D;  3I5S A;  3CCQ T;  1AEY A;  3RKW A;  2BCC J;  2FYU J;  4M3L A;  5CCH A;  3RKY A;  1BI1 A;  4BI4 A;  5GAN h;  5AVY B;  2H3E B;  4R0K A;  1ZR4 A;  2RJF A;  4RTT A;  5FRN A;  3H1H E;  4QT7 A;  2GBQ A;  2X4W A;  1NGM B;  1JB0 E;  3HTK B;  2WSC E;  1GK4 A;  1PP9 D;  1P84 H;  2E3I A;  3C0C A;  3PIP A;  3QO3 A;  2JMC A;  1WMK A;  2FRY A;  3CD6 T;  1AFO A;  4C8Q E;  2QEX P;  3QWO C;  2J6F A;  2OJ2 A;  1RQV A;  2ZGW A;  3DB3 A;  1LNX A;  4EMK B;  2MKV A;  1FDM A;  2B88 A;  2JVV A;  4LDW A;  1D3B B;  2KK4 A;  2YSQ A;  2F1L A;  4XU0 A;  3B5N A;  3CMA A;  5APT A;  3P8C E;  2H88 C;  2VVK A;  3M0P A;  3QBY A;  5KH6 A;  1KHC A;  2LNH B;  2NLU A;  4OB2 B;  5GAN 3;  1XQH A;  3CCV P;  2EQI A;  3F89 A;  5AW7 B;  4C8Q B;  1T3U A;  2QA4 T;  5FW9 A;  3VMA A;  3DB4 A;  1SQQ J;  3CC4 Q;  3H6Z A;  1I0C A;  5L8R E;  2KQW A;  2LDM A;  4AT1 B;  1JJ2 P;  2JO1 A;  2KXC A;  2IYO A;  3GMA A;  1ZLM A;  4IFM A;  2XKO C;  2OQQ A;  5KYY A;  4N4G A;  4I6M C;  3RER A;  2M0Y A;  5GJV B;  3MET A;  4NL3 A;  3LX7 A;  2DER A;  5GAN 2;  1KJW A;  1B34 A;  3UIA A;  3CCM T;  2YIU C;  2EFI A;  1E6H A;  2EYZ A;  2KXP B;  3L74 D;  3JV3 A;  4KH1 B;  1IHV A;  4QMA A;  3DLM A;  2O31 A;  1M90 Q;  5CIU A;  2M3B A;  3ZBD A;  4MZM A;  2WT7 A;  2KY9 A;  4LUE A;  4DCK A;  2OGU A;  3L70 E;  1SQP K;  1B07 A;  1N73 A;  4XU1 A;  2HNI A;  1X0T A;  2YRC A;  2ATC B;  4ZGD B;  1RI9 A;  1Y57 A;  2WSE H;  2QRX A;  4TLF A;  3CCR A;  3CC7 T;  1VQK A;  4PJ0 H;  2FRW A;  1FS0 E;  3PRJ A;  1MUU A;  3BCC G;  1FJP A;  2RQW A;  3V2R A;  3NFC A;  2RH2 A;  3WVE B;  4RTU A;  3J81 E;  4J6X A;  1EDJ A;  4L74 A;  1IB8 A;  4HCC A;  3V2N A;  5K5G B;  3PT9 A;  2IVW A;  4PFO A;  1DH3 A;  3SSU A;  3AED C;  3SFE C;  4EI2 A;  1M2V A;  3AE8 C;  4MDW A;  2FBW C;  3GIB A;  4DQ2 A;  1YJW Q;  1KYO E;  1IFI A;  3CXC A;  4DBR A;  5HK0 A;  5AVX B;  1QWF A;  1K76 A;  4ZTF A;  1YJ9 A;  2VYT A;  3OBW A;  1VQ6 P;  1VQ9 A;  1X2Q A;  4M78 D;  3JAM E;  3M56 A;  3KHU A;  1BI0 A;  3A98 A;  3TDK A;  5B5E H;  1OUL A;  4BY6 C;  3KZI E;  1RF1 A;  3B5N B;  3FXE A;  3EQ2 A;  1GD2 E;  5GAN f;  1EZV G;  4GT1 A;  2QM7 A;  3H41 A;  2M3E A;  3GW6 A;  1VQ8 A;  3VV0 A;  1FE6 A;  3G3Z A;  3H25 A;  3VS4 A;  1ABO A;  2CZ1 B;  2K5I A;  1DJ7 B;  2IFN A;  2R5B A;  1T0J A;  4CI0 C;  2HG5 D;  1NTK G;  1RAD B;  1B3Q A;  1HBW A;  1WHH A;  3OYY A;  3CBP A;  4OMN A;  5GTH H;  3Q1J A;  4O5V A;  1VPC A;  1VDF A;  5KYY B;  2XU8 A;  1SP4 A;  2CUD A;  2VGM A;  4IUV A;  1TUG B;  1PSE A;  4C0D C;  1ZSG A;  4E7H A;  2COZ A;  3PMT A;  4GOE A;  3L2R A;  4RTY A;  4IL6 E;  1IFM A;  2O4X A;  1YP5 A;  1B34 B;  2O1K A;  2QM8 A;  1R5L A;  3BCC J;  1LTJ C;  1ZBX A;  4D6T E;  2QDL A;  1NTM K;  3MPU B;  4M78 C;  4L5G A;  1HJB A;  2XV5 A;  4U7J A;  2WT7 B;  1GXI E;  4F14 A;  3KXD A;  3M06 A;  1H88 A;  2Y90 A;  1IGU A;  1N73 B;  3CBM A;  5FU7 B;  3H1K E;  4HCZ A;  1YHQ Q;  2YMK A;  4U3F D;  3MP8 A;  2BEZ F;  1NVO A;  3I5C A;  2DNU A;  2ROL A;  3JCM Q;  1E79 H;  3CME A;  3M9H A;  3G7Z A;  4ANJ A;  3PJS K;  4EIK A;  1R8O B;  4JS4 A;  2KYM A;  3J7A F;  3EWK A;  2OYH A;  1EXI A;  4M7A E;  2EIF A;  1KMI Z;  1M2V B;  2XK0 A;  4C92 D;  1R0B G;  1SSH A;  4KUD K;  1LWU A;  4J8O A;  2JN0 A;  5LJ5 g;  2QTV A;  1F1B B;  1JCC A;  1EZZ B;  3CCL A;  3G6E Q;  2MI6 A;  4EMK C;  1QCO A;  3A0B E;  3MEV A;  4MDX A;  1FYN A;  1NTK J;  2K1A A;  2HQX A;  1YIT P;  2DXB A;  1RF1 B;  4UB6 E;  3E7K A;  3P8M C;  5AW0 B;  2P0Q A;  4M75 G;  4Y92 A;  1JY3 N;  1OU9 A;  2ZT9 D;  4DBF A;  1YCY A;  4P5N A;  1BSH A;  2AIR B;  1VQ5 A;  3CC2 Q;  5AYF A;  5KJ7 D;  1Q81 C;  2W6A A;  2KK7 A;  1PGP A;  3D70 A;  3KXT A;  1A0N B;  4EDU A;  1T2K C;  3EG0 A;  1URQ B;  3RK3 B;  1X27 A;  2DPP B;  3UPU A;  1S72 Q;  1BE3 D;  3JCM X;  3MHV A;  3FX0 A;  4N0A A;  1P92 A;  4LGD E;  1PG5 B;  3OW2 O;  2M9U A;  1FJK A;  2RJE A;  4BDZ A;  2C0O A;  2RMO A;  3ULR B;  2CUB A;  4JPB W;  3CLQ A;  4C92 C;  2IBZ G;  1NE8 A;  4JRI A;  2PRR A;  1KTM A;  3S3N A;  1NM7 A;  4DOW A;  2O4X B;  1P84 D;  4JDS A;  1TTH B;  5AW8 B;  4BXL A;  2YKQ A;  2V1R A;  2QEX Q;  1SQX G;  4B9X A;  1YJN A;  3OYB A;  2YKO A;  4C5G A;  4HCB A;  3ABV C;  4HVU A;  5GMK e;  2HSE B;  4LC1 A;  2FYK A;  2KSS A;  2WSF E;  4KGV B;  4H0L B;  2Q6Q A;  2ZVN B;  3MEU A;  2DD4 A;  4IUU A;  3CXH I;  2QJY B;  2ZT9 C;  3CPW O;  5GAN 5;  5IT9 E;  1X8Y A;  2PU9 B;  3OYJ A;  3CCV Q;  3SD4 A;  1S72 T;  5KJ7 C;  2KBT A;  4J9F A;  3M0D A;  2HLO A;  1EZV I;  2KLV A;  1KOR A;  2Z5H A;  1BI2 A;  2DYI A;  1C1A A;  4RJT A;  5D7U A;  3VYG A;  2XD0 A;  2V4H A;  4KRT A;  3CI9 A;  3VS6 A;  3H1J D;  2OYH B;  1BB9 A;  2YWW A;  4M7D G;  1NTM G;  1VQ7 A;  2DZC A;  1LTT C;  1KN7 A;  1PWT A;  4IIO A;  1ZX6 A;  2NPS A;  2M5A A;  2DK3 A;  2I2L A;  1U1T A;  1PPJ G;  2A0F B;  1K8A C;  3ME9 A;  1QVG P;  1MND A;  1Q81 U;  4JJB A;  2JWD A;  2EW3 A;  2CT4 A;  2D8H A;  5KYW B;  1WLP B;  4RUG A;  4FSS A;  1K9M R;  5KAF E;  4J9I A;  4EMK A;  4JF7 A;  2A3L A;  4WBA A;  1YBY A;  4ZKP A;  1QGK B;  2XDP A;  1IK7 A;  1KG1 A;  4BI3 A;  1WQW A;  3FWN A;  3L71 E;  3VMX A;  4GDO A;  5CAI A;  1BCC E;  3PNW C;  2DMO A;  2MJZ A;  1WXU A;  1XTG B;  4EOT A;  1VOM A;  2R5M A;  5I11 A;  4RCB A;  2GTO A;  4M75 F;  1UGS B;  3R6N A;  1AQT A;  1T0H A;  3D71 A;  4FT4 A;  5IXF A;  5LJ3 f;  3BDU A;  4Z02 A;  1V29 B;  2K9G A;  4WY4 D;  2EGE A;  1SFC A;  1EC5 A;  1SQX J;  1WI7 A;  3AE1 C;  1M1K R;  1S5L X;  2E65 A;  1S4X A;  2XKM A;  3QSU A;  4A4H A;  2RB6 A;  1SQV K;  2KB7 P;  5CKE A;  5KLV D;  3FGA D;  4GBQ A;  4WVZ A;  5KCO A;  1LOJ A;  2O3J A;  3AE5 C;  1Q90 D;  3H1L G;  1OFC X;  1HVV A;  4OMQ A;  4E7J A;  1RI0 A;  2EJG A;  2P10 A;  3M53 A;  2WSC J;  2QIW A;  4C7R A;  1JMB A;  4ZNX A;  1N7S D;  2OYI A;  4WTO B;  1VQ6 Q;  2OTL A;  3S1K A;  2GTJ A;  4ZGE B;  3C8V A;  2E4H A;  3M0A A;  3CCQ P;  2MAM A;  1NTM J;  3WUT A;  2N9Y B;  4BE1 A;  2JM9 A;  1KHI A;  4A53 A;  3CQT A;  1MNE A;  4YXD C;  1X69 A;  3GOX A;  1GZL A;  3RK3 D;  2JTE A;  5HK3 A;  3L1A A;  2L3P A;  4XU3 A;  3OW2 A;  1K8A U;  3M0Q A;  2E75 D;  4PLL A;  5GAO m;  2GCX A;  3TGU E;  4WY4 C;  4O9B A;  2FZG B;  3JCM d;  1JY2 O;  2ZPG B;  1G5V A;  3CD6 P;  2HPC B;  1MHN A;  2RJC A;  2KP8 A;  2XU6 A;  4PD4 E;  4C46 A;  5GAO l;  4IIM A;  3X26 B;  2EPD A;  2PVG B;  4PJO G;  4QVD A;  1N8R R;  3TYY A;  2MF2 A;  4M7D F;  1PSF A;  1GCQ A;  4CRI A;  2J6K A;  1RLP C;  2M5A B;  3A5T A;  3OYA A;  1W5C E;  4R56 A;  2DEQ A;  1RQU A;  2OTJ A;  2JP3 A;  1KB9 I;  2HD0 A;  2IBZ I;  1RF1 C;  2QA4 P;  1N7S C;  4TVR A;  3CPW A;  2DBM A;  4JPZ B;  5KYN A;  1H8A A;  1HJ0 A;  1FOS E;  1I4K 1;  2M16 A;  1Q82 Q;  1GRI A;  2VXF A;  1JUN A;  2CT3 A;  3HFN A;  1GCP A;  1OW7 A;  1KIL E;  4A7P A;  3NTI A;  1C6V X;  1TWB A;  1VQO A;  3ER0 A;  1NTZ D;  2BAS A;  3W68 A;  4DOJ A;  3PFS A;  4EPC A;  5D6Y A;  3JB9 I;  1M8O B;  3RK3 C;  3H1L J;  2JW4 A;  1L0L E;  3R6O A;  3CCS T;  2E75 C;  2IX7 C;  4MZT A;  1SFC B;  3CXH H;  2PP6 A;  1V1C A;  2C0I A;  2QAZ A;  3ZFJ A;  4ORZ A;  5CQX A;  3M4G A;  2XDB A;  2O1J A;  3CCM P;  1KQ1 A;  4CC3 A;  1KIL B;  2IZ1 A;  1NYH A;  1ZRT E;  5APV A;  1K73 R;  3P8H A;  3U1C A;  5GAN 8;  1MUZ A;  1N2D C;  3A3Y B;  2M0B A;  2IDB A;  1W70 A;  1UJ0 A;  3I55 T;  1Q86 Q;  4IFF A;  3ASK A;  3TU4 K;  1W2B O;  1PL5 A;  2W6B A;  2GA1 A;  1PKT A;  1T3J A;  2SRC A;  3CC7 P;  5CJ4 A;  3H1K G;  5GAO n;  1YIT Q;  3I56 T;  1NAY A;  9ATC B;  1AQ5 A;  1KC8 Q;  2D1X A;  2YUQ A;  1YI2 A;  3CWB E;  2KT1 A;  5GAN e;  4NPE A;  2L89 A;  1Z9Q A;  5FU6 C;  5J3B A;  1PV3 A;  2RN0 A;  4M7A G;  1SQV G;  3OYK A;  1HGV A;  3BRT B;  1WJR A;  5J39 A;  2WQY C;  3UDC A;  5GAN 6;  2A08 A;  1KD1 R;  3FRN A;  1U5S A;  1L0N E;  1SQB E;  2OYH C;  3T9N A;  5I21 A;  4JJC A;  1ZOY C;  4CC7 A;  4F04 B;  2BCC D;  2FYU D;  1BI3 A;  3KPE A;  1KK7 A;  2ENM A;  1OI1 A;  5GMK m;  3L2U A;  2JMA A;  1NPR A;  1K9A A;  4FIB A;  1NJI R;  1BGY E;  1LWU C;  1Z56 A;  4X34 A;  4GIF A;  5LL6 S;  1WT6 A;  2X3X D;  1PD1 A;  4HA8 A;  1ZXG A;  2DW3 A;  4PJO F;  4E7L A;  5ECA A;  3M59 A;  2CKK A;  2DET A;  8ATC B;  1OPL A;  1NU1 E;  1YIJ A;  2E43 A;  1PP9 E;  2CZ0 B;  3TF5 A;  1KQS O;  1UJY A;  2CP0 A;  2GM4 A;  5GMK j;  3AE4 C;  2HKQ B;  3LH5 A;  1QVF A;  2RA2 A;  4GLM A;  2RQT A;  2K9Y A;  1NHL A;  3NTK A;  2X4J A;  1YJW P;  2FG0 A;  1WFW A;  3IFM A;  4E7Z A;  4BI8 B;  3L4F A;  5FLX E;  4I1L A;  2FL7 A;  3V4Q A;  4N0A C;  3RL0 D;  1SF9 A;  3H1K J;  1FMK A;  2L3S A;  3O8Z A;  3EGD A;  1H89 A;  2RPN A;  2DM1 A;  3VTP C;  1BU1 A;  1M1J C;  5AW4 B;  4JRK A;  2NPS D;  3IN6 A;  2LQN A;  2KRM A;  3TSW A;  3OYI A;  1KYO I;  1U3O A;  2R32 A;  1SQV J;  3Q5S A;  1JOC A;  2X3W D;  1HUC A;  1RL2 A;  4F7U A;  1DX7 A;  2D2C D;  3M57 A;  1JEK A;  1UGR B;  1DEB A;  2ZYD A;  2HFE D;  2FXP A;  4C0Z A;  1VQP A;  1PFI A;  3NTN A;  1G2C B;  4J9H A;  1M2O A;  1HK9 A;  2FHD A;  2KRO A;  1N5Z A;  2KRN A;  3OS1 A;  3AE6 C;  2AEM A;  3H9N A;  3QJY A;  3OSV A;  4KT0 E;  4H44 D;  5KAI E;  1M57 D;  2K88 A;  1IO6 A;  2JOY A;  2JTF A;  2LT4 A;  5KE3 A;  2KIK A;  2DXC A;  2Q9I A;  3C9I A;  3RL0 C;  1OIP A;  3F70 A;  1JCD A;  2J05 A;  4L59 A;  1L0L K;  5CCA A;  4DA4 A;  1OZH A;  1WHM A;  2OTK E;  2FYN B;  3A7O A;  2NPS C;  2P4T A;  4BY6 B;  1KQ2 A;  4A63 B;  1VQ4 T;  4OH8 B;  3VS2 A;  2X9H A;  2W6J H;  1ZV8 A;  3SWF A;  3CXC S;  1GU4 A;  1R77 A;  1ZQ1 A;  2DJQ A;  3CCJ Q;  2WSC H;  2FPF A;  2C06 A;  3S9O A;  7AT1 B;  3CCQ Q;  2PGD A;  4BE2 A;  1NAF A;  4I7Z C;  2M0O A;  3QHS A;  1VQN T;  2EYW A;  4M78 E;  1LJO A;  4H44 C;  3WU2 E;  4OVA A;  2F5T X;  4C0D B;  3E9F A;  4J9D A;  4C92 A;  4M77 G;  4PLI A;  2WSF J;  2RHY A;  3I9Q A;  5B66 H;  1QEX A;  1SQQ G;  5LJ5 d;  5KLI C;  1H64 1;  1ZHI A;  4XQ3 A;  3CBO A;  3I5R A;  4F7U E;  1BSN A;  2A45 G;  3EGD B;  3JSC A;  3CD6 Q;  1TG0 A;  2JT4 A;  5TIS E;  1L0N K;  1SQB K;  2YO2 A;  3FLG A;  3PH0 A;  1O75 A;  4M78 B;  1RAE B;  2RHZ A;  3CC4 A;  1DIP A;  3G71 T;  3EG2 A;  3D7S B;  1HGZ A;  1KQS A;  1USE A;  2X51 A;  2YO3 A;  5GTI H;  3CCJ T;  2Y0D A;  3QUI A;  3Q1M A;  2AEF A;  2L3R A;  1TH7 A;  1VQL T;  1FDO A;  4J7I A;  3RUX A;  1ZUU A;  4F7U B;  2OYI C;  3TSZ A;  3LWI A;  2L3Q A;  1AVY A;  2O01 J;  1S72 P;  1JXO A;  4XTU A;  1UGQ B;  3P8B B;  3BCC D;  2ZPF B;  2QA4 Q;  4QVZ A;  1DD3 A;  5CK9 A;  1NU1 K;  3L2Z A;  3SWK A;  2G6F X;  1SRM A;  4C5I A; 
#chains in the Genus database with same CATH homology
 4C5E A;  5FRO A;  4KUI A;  2V8I A;  3NTH A;  3MTU E;  2KVQ G;  1I81 A;  3A8H B;  5LJ3 e;  1A02 J;  3PGG A;  2D6F A;  5EG2 A;  1FZG A;  2EJF A;  5IN1 A;  4UC4 A;  1LTI C;  2EQU A;  2L5Q A;  5CCG D;  2KOG A;  1N9S A;  5CKB A;  3OYN A;  4C92 E;  3H32 B;  1NZ9 A;  1YJW A;  4OB3 B;  2OAU A;  1FAV A;  1A02 F;  3VYH B;  2C9L Y;  2LRQ A;  3HRT A;  5HKC A;  1QP3 A;  3RKX A;  4C92 B;  2RI2 A;  1LT9 A;  4IFD K;  1G3T A;  3CCU T;  4M77 F;  3UWN A;  5CKH A;  3L2V A;  3ZEH A;  1WNL A;  4XTY A;  2H7H A;  3OYL A;  3KQG A;  5GAM h;  1FZC A;  3RMQ A;  1ZR2 A;  1N27 A;  3MO8 A;  2WWW A;  3GNF B;  1VQM T;  5M9O A;  2K5L A;  4WY4 A;  3A2A A;  4Y91 A;  4OB0 B;  4RMO A;  2YMY A;  3A8O B;  1NKZ B;  5KTB A;  5LJ5 j;  4A4F A;  3HRS A;  3N7N A;  3HUS A;  2DAQ A;  4E7K A;  1G3Y A;  5GAM j;  3L2W A;  1YHQ A;  2K4Y A;  5HY6 A;  3IR9 A;  3CCE T;  1N7S A;  4EMH A;  4BUG A;  1IRE B;  4M75 D;  2A45 I;  2RK2 A;  1HTL C;  2ZCF B;  4WB4 A;  5GAN 7;  2FB7 A;  3JCM V;  1J1D C;  3OJA B;  3M58 A;  2K3Y A;  1Q7Y C;  3G6E A;  1HWT C;  3CL3 D;  1UEB A;  5BU8 B;  3OAK A;  3A8M B;  1FZA A;  3CMA T;  2GUV A;  5GAN g;  2RHX A;  4AYC A;  2LQ8 A;  2PVD B;  3T97 A;  1FWZ A;  4JYC A;  1NH4 A;  1BIB A;  3CC2 A;  3LH0 A;  2QXF A;  2WSE E;  3QZ9 B;  2QTX A;  4M75 C;  3CPF A;  1XOV A;  3P8D A;  1FZC B;  1NOH A;  3OA7 A;  3CEY A;  2IG0 A;  5AVV B;  5KE2 A;  2QQS A;  4WY4 B;  2K5F A;  3OYC A;  4M7D D;  2QEX A;  3KUF A;  2XG8 D;  1KZU B;  5CR2 A;  2EWN A;  3HUS B;  2QQA A;  2RD1 A;  2E12 A;  3OW2 S;  3QJ6 A;  2RI5 A;  3CCV A;  3CCR T;  1VQK T;  5AVR B;  1N7S B;  1Q7Y U;  4QVC A;  3OYF A;  2CGH A;  4XA4 A;  1JJ2 A;  3U59 A;  2FFD A;  2IPP A;  1JY2 N;  2Y4X A;  3A8L B;  1KFM A;  2O01 H;  2Q5U A;  2PUK B;  4C0G A;  3OMC A;  3WVD B;  3CPW S;  3QYH B;  2N1T D;  3II6 A;  1YJ9 T;  4L6V 5;  4JLG A;  1VQ9 T;  4XAX B;  1M1J A;  1XTC C;  2R5A A;  1UGP B;  4DZO A;  4XK8 E;  4FSX A;  1VQ8 T;  5BVZ A;  2FKW B;  4QQG A;  3QKJ A;  2CPS A;  3LW5 H;  3JB9 G;  1ZN5 A;  4XTX A;  1OWA A;  5FU6 B;  3G4S T;  5J26 A;  3NMD A;  2C0X A;  3C95 A;  3EFS A;  2A45 H;  2Q3I A;  4M77 A;  4N3Y B;  2LTO A;  2N1T C;  4C8Q G;  1T8Z A;  1FBM A;  5AVU B;  1M90 C;  1VQ6 A;  4PJO D;  4NS5 A;  1LWU B;  2RI3 A;  3PIO A;  3HFO A;  1Y07 A;  2LNV A;  3J80 E;  2HYN A;  3RIR A;  1YYC A;  3CME T;  3OS0 A;  3HE5 A;  2DTH A;  5APU A;  2VGN A;  1HXD A;  3LIE A;  2FFD B;  1FXX A;  4A54 A;  5GAO q;  2I1J A;  3S3O A;  3CCL T;  3JB9 J;  1WJQ A;  2RHU A;  3QG1 A;  2BKD N;  4A4E A;  1QVF S;  1M1J B;  4OP0 A;  3EFG A;  1LT9 C;  3WXM B;  5AW1 B;  1JY3 P;  3DKM A;  3INZ A;  2X4Y A;  1VQ5 T;  1GL2 D;  1W2E A;  5AVT B;  1M1G A;  5LJ3 g;  3RES A;  4C7N A;  3VOP A;  1JNM A;  1FZC C;  3JB9 F;  3MHX A;  1IK9 A;  2WPS A;  1M90 U;  4FM4 B;  1X79 B;  4M7A D;  1LTB C;  3MGN A;  1GTW A;  2KYV A;  1KFN A;  1S9K D;  3RL0 B;  3X25 B;  2HBP A;  1YJN T;  4W7Y A;  3HSB A;  3HUS C;  5DLO A;  1LTG C;  2NPS B;  4C8Q F;  1YIT A;  3EAE A;  3OBY A;  3OYM A;  2XIC A;  2PUO B;  3OQ5 A;  1RE4 A;  5APX A;  5AW9 B;  2QQR A;  3M55 A;  2DJZ A;  3VUZ A;  3PP5 A;  4JS5 A;  1NTZ K;  2P0K A;  3VMY A;  3HE5 B;  3NXS A;  1W2B S;  3URG A;  1VQ7 T;  4AQR D;  4D6W A;  3FB9 A;  2HOD A;  4BE0 A;  2ZZD A;  2RM4 A;  5D6W A;  4HYT B;  4MMK A;  5A0L A;  1M9S A;  4B86 A;  3HE4 A;  4N6J A;  2HAX A;  3MIW A;  4IUQ A;  1G1J A;  2Q7C A;  5CCG A;  3BFM A;  2H3J A;  1RE3 A;  2EAY A;  1CZQ A;  2OYI B;  1Y7X A;  2QQ9 A;  2KDS A;  3MUD A;  3OS2 A;  1QL2 A;  2L5G B;  4C7N B;  3LWH A;  3HL8 A;  4OB1 B;  3VUB A;  2VUB A;  1KQS S;  3V2P A;  5GMK h;  4BD3 A;  4FT2 A;  2WPR A;  3GF5 A;  3JCM h;  1QVG A;  3RK2 D;  1RF0 A;  3C94 A;  4RES B;  2OTL T;  5GMK l;  2M8R A;  2KSJ A;  4AUW A;  2Z4E A;  3V7R A;  2DIG A;  2FFD C;  2JNG A;  2GQV A;  2ZPE B;  2HOD B;  4M77 D;  2D9T A;  2P0P A;  3HE4 B;  3JRZ A;  2XDJ A;  3RK2 C;  2OTJ T;  2DTO A;  3GPL A;  2RHI A;  4O6J A;  2H43 A;  3CCQ A;  4M75 A;  3VKI A;  2D0Q B;  1VQO T;  5CVI A;  3AHU A;  1N9R A;  2WAC A;  3VYI A;  1QW1 A;  5GMK i;  4LD6 A;  3FIF A;  5AVZ B;  1BKB A;  2QI2 A;  5APS A;  1MFZ A;  3CD6 A;  4N4I A;  3OMG A;  1Y96 A;  3MP6 A;  1GU5 A;  3B8E B;  2FYZ A;  2X35 A;  4M7A F;  5GAN d;  3BVH A;  4M77 C;  3E19 A;  3JB9 H;  4Y99 C;  4FL6 A;  5APQ A;  2QA4 A;  2KAF A;  4OGE A;  3OYE A;  4XTZ A;  1YI2 T;  4ZGJ B;  4XTV A;  2P2U A;  4QW2 A;  1NWQ A;  1J1D B;  2GFA A;  2CS7 A;  3OB9 A;  3QII A;  5DLQ E;  3QDR B;  2DO3 A;  3JCM f;  2YNY A;  2XHC A;  4M7D A;  3CCM A;  5BU5 A;  1J1E B;  3L36 A;  2IFM A;  5AW5 B;  2XNX A;  4M75 E;  1JTH A;  1GK6 A;  3GNG A;  2DTI A;  2VXE A;  3M91 A;  3DLL A;  3C12 A;  1YIJ T;  1AHJ B;  4YTL A;  1JRI A;  3FEO A;  3QPH A;  4XU2 A;  3VU3 C;  3X28 B;  3CC7 A;  1Q82 C;  3BY7 A;  1O9S A;  1QL1 A;  3OYD A;  1G3W A;  4M75 B;  3GHG A;  3HP9 A;  3FJP A;  4X9D A;  3H8Z A;  1I5L A;  1MGQ A;  3UT1 A;  3OYH A;  3SDZ A;  4JLI A;  2N1T A;  1QP2 A;  3L2Q A;  1Y96 B;  4W80 A;  4LDX A;  2Z5I A;  1CW5 A;  2FVU A;  1Q86 C;  4GY5 A;  3NFQ A;  1G1I A;  3SFM A;  1VQP T;  2DXU A;  3JCM W;  2LCL A;  3V5B A;  2AHJ B;  1KC8 C;  1YTZ T;  1RE4 C;  2E41 A;  2JUF A;  4M7D E;  3VP9 A;  4VUB A;  1IFJ A;  3SWN A;  2YKP A;  1NTK K;  3LGF A;  2E6N A;  4R55 A;  3JCM c;  4HKE A;  2N9B A;  5GAO r;  5GAN j;  4ELY C;  1Q82 U;  4M7D B;  3SB2 A;  4ZN1 A;  1JJ2 S;  5APW A;  4PJO A;  4J6Y A;  5I2S A;  1JTH B;  2GF7 A;  5LJ5 h;  3N5B B;  3TEE A;  4B9W A;  2LKM A;  1M4Z A;  4N78 D;  2L8D A;  5FRM A;  4W7Z A;  4ELZ C;  4JUV A;  1HH0 A;  5CCG C;  2DD5 A;  1VIE A;  1RE3 C;  2Y4Y A;  3V7C A;  4NOY A;  1L4A D;  1X75 C;  1JO5 A;  4XTW A;  3GHG B;  3KDP B;  5KCH A;  1Q86 U;  3MCA B;  3QXE B;  2ZPH B;  3U1A A;  2N1T B;  4NL2 A;  2F69 A;  1KC8 U;  3CC4 T;  3X24 B;  3HD7 A;  3VN0 A;  2DIQ A;  5CMZ A;  4LDY A;  2EQM A;  2F5K A;  1RF0 C;  1GL2 A;  1WPY A;  5LJ3 d;  3PMI A;  2XDD A;  1NPP A;  3M9B A;  5DY9 A;  4EIJ A;  2PVO B;  2EQK A;  1GDT A;  4KUL A;  3SWN B;  1L4A C;  1FOS F;  4PJO E;  1BYM A;  1QVP A;  1MV8 A;  2DZ9 A;  4M7A A;  3X20 B;  4IKF A;  3VP8 A;  1J1E C;  1M5Q 1;  1OXZ A;  2RJD A;  1IZ6 A;  4PJO B;  1SQX K;  1LT9 B;  1X01 A;  3QYG B;  1URQ A;  2LX9 A;  4ZKU A;  3M5A A;  5A0G A;  1YJW T;  3JB9 D;  1S72 A;  1IJD B;  1FU1 A;  4C5H A;  1CI6 A;  4J6W A;  3BAS A;  1M1F A;  2JJL A;  2KMT A;  2VC8 A;  1XNI A;  5AVS B;  3MP1 A;  5LJ5 f;  1H3Z A;  3E1S A;  3P7K A;  4ME7 A;  4C8Q D;  4C0F A;  2WSF H;  2JEE A;  5GAM f;  2XID A;  2EYQ A;  1T2K D;  1EIF A;  3HD7 B;  3LID A;  2XZR A;  1WGS A;  3P8C D;  4ZTJ A;  5A0D A;  4X9C A;  2K3X A;  1GL2 B;  3HRU A;  1S9K E;  2E42 A;  5LJ3 h;  2V8K A;  4I2L C;  2LCC A;  2P1J A;  2ZXE B;  4HT9 A;  3GLX A;  1N86 A;  4M78 G;  4M7A B;  5CHX A;  5GAM g;  2WIT A;  5GAN 4;  4PKC C;  3OY9 A;  3V4W A;  2LVM A;  4M7D C;  2JTM A;  5CKF A;  4KBM B;  3TCJ A;  1YHQ T;  2QQB A;  2ZFC A;  4F7U G;  3QZ5 B;  1WQ7 A;  4C8Q C;  5KH6 A;  3TRE A;  5APY A;  2BUD A;  2J59 M;  3R2P A;  5CCH D;  2RO0 A;  4QQ6 A;  1E5W A;  2DKG A;  5LJ3 j;  1WRG A;  4KHX A;  4BAC A;  3P32 A;  4LLH A;  4IUP A;  1CI6 B;  2E6Z A;  3L35 A;  3G6E T;  3MD0 A;  2POH A;  3GHG C;  4GKG A;  1BIA A;  2YHT A;  3B5N D;  1JBM A;  3CC2 T;  3JCM e;  2A7Y A;  4OF1 A;  2CZ6 B;  5CCH C;  4OGC A;  4MZP A;  4PL6 A;  2HPC A;  5CO7 A;  3V8L A;  1QVG S;  4C92 G;  2O01 E;  3CCS A;  2P67 A;  1N6A A;  3SWN C;  2FXM A;  2QEX T;  4II1 A;  3M54 A;  2WTY A;  3LGL A;  3V7S A;  4BB7 A;  4Y28 E;  3O8V A;  3B5N C;  1KQL A;  4M78 F;  5KLV K;  2WZ7 A;  3I55 A;  3CCV T;  3RK2 B;  3VMZ A;  4PJO C;  2X4X A;  3TNU A;  3HD7 D;  3L42 A;  4F7U F;  1FZF A;  3LW5 E;  3I56 A;  4A4G A;  1X6O A;  1IC2 A;  1JY2 P;  3WMM 0;  1KIL A;  4M77 E;  1OZ2 A;  3L37 A;  1FX7 A;  4XE5 B;  1K9M C;  1LTA C;  4MML A;  2LC4 A;  2M1H A;  3LLR A;  3C4S A;  1IFD A;  2ZPI B;  4M77 B;  5AW3 B;  4QQD A;  1NO4 A;  1N73 C;  3HPW A;  4Y99 B;  5FU7 C;  3V2Q A;  1SSF A;  1GW4 A;  1JY3 O;  1URQ D;  3HD7 C;  1M1K C;  2K2V A;  1G3S A;  1GL2 C;  3JCM b;  2YLB A;  3A5Z B;  3TSI A;  1YTZ I;  1OYX A;  4A4K A;  4OMF B;  4C92 F;  2R57 A;  3TK1 A;  1VQ6 T;  3M9Q A;  4M7A C;  1SVF A;  1OZ3 A;  1X9V A;  2VRS A;  1IO4 A;  3FDR A;  2E1H A;  1M7L A;  4HH2 A;  5C6S A;  4GLK A;  1U8R A;  2YRV A;  3TNU B;  2RK1 A;  2R5D A;  4JYB A;  1K9M U;  1URQ C;  5D6X A;  1FZB A;  3BRV B;  4E47 A;  5GAO p;  3KYQ A;  2K57 A;  2ZPB B;  1N8R C;  2I1K A;  3LYI A;  4FU6 A;  3OA6 A;  3RMS A;  4DOV A;  1LGH B;  5DM7 R;  4J83 A;  2CYZ B;  2LT1 A;  1SLQ A;  2HQE A;  1W4S A;  4RG8 A;  2FYU K;  1M1K U;  1IFN A;  2H8P D;  2OAR A;  2B8A A;  1VQ4 A;  1G2C A;  1RY3 A;  1N7L A;  4HT8 A;  2CZ7 B;  1VIF A;  4J7F A;  4BDY A;  2BIV A;  2W27 A;  3E9G A;  5IAY A;  3BW1 A;  1L4A A;  4JJN K;  1VQN A;  3EFR A;  5CQY A;  1MZ9 A;  3KBG A;  2JZ2 A;  3M4Y A;  1K73 C;  3HKS A;  1UB4 A;  2MMP A;  4PNO A;  2XI9 A;  3S6W A;  1VUB A;  2EQJ A;  1SQQ K;  1Y71 A;  4E7I A;  4LDU A;  1YIT T;  1FZE A;  3G71 A;  4V2S A;  1N8R U;  3S3M A;  1I8F A;  4J5Y A;  3CCJ A;  1ZLL A;  2PAJ A;  3N4X A;  4ATO A;  1VQL A;  5LJ5 e;  3V8J A;  3OSS C;  1KD1 C;  2LQK A;  2GUS A;  1U1S A;  5GAM e;  2GFU A;  3JCM J;  1NJI C;  1JMM A;  3HRN A;  1LTJ A;  4JRP A;  4N4H A;  4M78 A;  1J2J B;  4LDV A;  2YLC A;  3PTA A;  4N78 E;  4JRQ A;  2CPB A;  3GP8 A;  4LD9 K;  5CJ0 A;  1LTS C;  4RCC A;  1XTD A;  4RG2 A;  2MWP A;  1M8V A;  1K73 U;  3VJP A;  3HTK A;  2PQW A;  2E70 A;  3M0D C;  5AVQ B;  2R58 A;  2EJ9 A;  1SFC D;  3FC3 A;  2E10 A;  4IUR A;  3BAT A;  2E5Q A;  1L4A B;  1KIL D;  5AW2 B;  4EMK A;  2P7J A;  1D3B A;  1EQ7 A;  3H6P A;  2DVE A;  1W2B A;  2C0W A;  1CSB A;  3CCU A;  1KD1 U;  2DXT A;  3HHT B;  4C8Q A;  3MEA A;  2C9N Y;  4WF2 A;  5I2M A;  2E64 A;  3MEW A;  3JCM P;  3H32 A;  2VV5 A;  1NJI U;  3OYG A;  2EKO A;  3BDL A;  5AVW B;  1VQM A;  2V8J A;  4Q5W A;  3OS5 A;  3JCM g;  1SFC C;  2G3R A;  4IUT A;  1NKN A;  4RKU E;  1KIL C;  5C0M A;  5AW6 B;  3SWY A;  4ZN3 A;  2WPQ A;  1LTJ B;  2MWO A;  5GAM d;  5A2Q E;  4EMG A;  5CKD A;  2R3C A;  2QDY B;  2J58 A;  1WJS A;  3E1I A;  3V8K A;  3CCE A;  1GW3 A;  5KJ7 A;  3CCQ T;  3RKW A;  4BI4 A;  4M3L A;  5CCH A;  3RKY A;  5GAN h;  1BI1 A;  5AVY B;  1ZR4 A;  2RJF A;  5FRN A;  2X4W A;  1JB0 E;  2WSC E;  3HTK B;  1GK4 A;  3PIP A;  3QO3 A;  3CD6 T;  1AFO A;  4C8Q E;  2ZGW A;  3DB3 A;  1LNX A;  4EMK B;  1FDM A;  2JVV A;  4LDW A;  1D3B B;  2KK4 A;  4XU0 A;  3B5N A;  3CMA A;  5APT A;  3P8C E;  3QBY A;  1KHC A;  2NLU A;  4OB2 B;  5GAN 3;  1XQH A;  5AW7 B;  4C8Q B;  1T3U A;  2QA4 T;  3DB4 A;  3H6Z A;  5L8R E;  2KQW A;  2LDM A;  4IFM A;  2XKO C;  4N4G A;  4I6M C;  3RER A;  3MET A;  4NL3 A;  3LX7 A;  5GAN 2;  1B34 A;  3UIA A;  3CCM T;  2EFI A;  3DLM A;  5CIU A;  2M3B A;  3ZBD A;  4MZM A;  2WT7 A;  2KY9 A;  1SQP K;  1N73 A;  4XU1 A;  2HNI A;  4ZGD B;  2WSE H;  3CCR A;  3CC7 T;  1VQK A;  1MUU A;  1FJP A;  3NFC A;  3V2R A;  3J81 E;  2RH2 A;  3WVE B;  4J6X A;  4HCC A;  3V2N A;  3PT9 A;  2IVW A;  1DH3 A;  4MDW A;  3GIB A;  4DQ2 A;  1IFI A;  3CXC A;  5HK0 A;  5AVX B;  1YJ9 A;  4ZTF A;  2VYT A;  3OBW A;  1VQ9 A;  4M78 D;  3JAM E;  3M56 A;  1BI0 A;  4BY6 C;  1RF1 A;  3B5N B;  3EQ2 A;  1GD2 E;  5GAN f;  4GT1 A;  2QM7 A;  1VQ8 A;  3VV0 A;  3G3Z A;  2CZ1 B;  2K5I A;  1DJ7 B;  2IFN A;  2R5B A;  4CI0 C;  2HG5 D;  1HBW A;  3OYY A;  3CBP A;  3Q1J A;  4O5V A;  1VPC A;  1VDF A;  3G4S A;  2XU8 A;  1SP4 A;  2VGM A;  4IUV A;  4C0D C;  4E7H A;  1PSE A;  3PMT A;  3L2R A;  1IFM A;  2O4X A;  1B34 B;  2O1K A;  2QM8 A;  1LTJ C;  1ZBX A;  1NTM K;  4M78 C;  4L5G A;  1HJB A;  2XV5 A;  2WT7 B;  1GXI E;  3M06 A;  1H88 A;  2Y90 A;  1N73 B;  3CBM A;  5FU7 B;  4HCZ A;  3MP8 A;  3I5C A;  3JCM Q;  3CME A;  3M9H A;  3G7Z A;  1R8O B;  4JS4 A;  3J7A F;  2OYH A;  4M7A E;  2EIF A;  2XK0 A;  4C92 D;  4KUD K;  1LWU A;  4J8O A;  2JN0 A;  5LJ5 g;  1JCC A;  3CCL A;  2MI6 A;  4EMK C;  3MEV A;  4MDX A;  2HQX A;  2DXB A;  1RF1 B;  3P8M C;  5AW0 B;  2P0Q A;  4M75 G;  1JY3 N;  1YCY A;  4P5N A;  1VQ5 A;  5AYF A;  5KJ7 D;  1Q81 C;  2W6A A;  3KXT A;  4EDU A;  1T2K C;  1URQ B;  3RK3 B;  3UPU A;  2DPP B;  3JCM X;  4N0A A;  1P92 A;  4LGD E;  2M9U A;  1FJK A;  2RJE A;  4BDZ A;  3CLQ A;  4C92 C;  1NE8 A;  4JRI A;  3S3N A;  4DOW A;  2O4X B;  4JDS A;  5AW8 B;  2YKQ A;  4B9X A;  1YJN A;  3OYB A;  2YKO A;  4C5G A;  4HCB A;  5GMK e;  4LC1 A;  2FYK A;  2KSS A;  2WSF E;  3MEU A;  2DD4 A;  4IUU A;  5GAN 5;  5IT9 E;  1X8Y A;  2PU9 B;  3OYJ A;  3SD4 A;  1S72 T;  5KJ7 C;  3M0D A;  2HLO A;  2KLV A;  2Z5H A;  1BI2 A;  2XD0 A;  3VYG A;  3CI9 A;  2OYH B;  4M7D G;  1VQ7 A;  2DZC A;  1LTT C;  2NPS A;  2I2L A;  2DK3 A;  1U1T A;  1K8A C;  3ME9 A;  1Q81 U;  4JF7 A;  2A3L A;  4WBA A;  1YBY A;  4ZKP A;  2XDP A;  1KG1 A;  4BI3 A;  1WQW A;  3VMX A;  5CAI A;  3PNW C;  2MJZ A;  1XTG B;  4EOT A;  2R5M A;  4RCB A;  4M75 F;  1UGS B;  4FT4 A;  5LJ3 f;  3BDU A;  4Z02 A;  1V29 B;  4WY4 D;  1SFC A;  2E65 A;  2XKM A;  3QSU A;  4A4H A;  2RB6 A;  1SQV K;  2KB7 P;  5CKE A;  5KCO A;  1LOJ A;  1HVV A;  4E7J A;  1RI0 A;  2EJG A;  3M53 A;  4C7R A;  1N7S D;  2OYI A;  2OTL A;  4ZGE B;  2MAM A;  3M0A A;  4BE1 A;  1KHI A;  4A53 A;  3GOX A;  1GZL A;  3RK3 D;  5HK3 A;  3L1A A;  4XU3 A;  3OW2 A;  1K8A U;  4PLL A;  5GAO m;  2GCX A;  4WY4 C;  4O9B A;  3JCM d;  1JY2 O;  2ZPG B;  1G5V A;  2HPC B;  1MHN A;  2RJC A;  2KP8 A;  2XU6 A;  4C46 A;  5GAO l;  3X26 B;  2PVG B;  4PJO G;  4QVD A;  3TYY A;  2MF2 A;  4M7D F;  1PSF A;  4CRI A;  3A5T A;  3OYA A;  4R56 A;  2DEQ A;  2OTJ A;  2HD0 A;  1RF1 C;  1N7S C;  4TVR A;  3CPW A;  1H8A A;  1FOS E;  1I4K 1;  2M16 A;  2VXF A;  1JUN A;  3HFN A;  3NTI A;  1VQO A;  3ER0 A;  2BAS A;  4DOJ A;  3PFS A;  4EPC A;  5D6Y A;  3JB9 I;  3RK3 C;  3R6O A;  3CCS T;  2IX7 C;  4MZT A;  1SFC B;  2PP6 A;  3ZFJ A;  5CQX A;  2XDB A;  3M4G A;  2O1J A;  1KQ1 A;  1KIL B;  5APV A;  3P8H A;  3U1C A;  5GAN 8;  1N2D C;  3A3Y B;  3I55 T;  4IFF A;  3ASK A;  3TU4 K;  2W6B A;  1T3J A;  5CJ4 A;  5GAO n;  3I56 T;  1AQ5 A;  1YI2 A;  5GAN e;  2L89 A;  5FU6 C;  5J3B A;  4M7A G;  3OYK A;  1HGV A;  3BRT B;  1WJR A;  5J39 A;  3UDC A;  5GAN 6;  3FRN A;  2OYH C;  3T9N A;  5I21 A;  1BI3 A;  3KPE A;  1OI1 A;  5GMK m;  3L2U A;  1NPR A;  4FIB A;  4X34 A;  1LWU C;  1Z56 A;  4GIF A;  5LL6 S;  1WT6 A;  4HA8 A;  4PJO F;  4E7L A;  3M59 A;  2CKK A;  1YIJ A;  2E43 A;  2CZ0 B;  2GM4 A;  5GMK j;  1QVF A;  2RA2 A;  1NHL A;  3NTK A;  2X4J A;  3IFM A;  4BI8 B;  3L4F A;  5FLX E;  4I1L A;  2FL7 A;  3V4Q A;  4N0A C;  3RL0 D;  3O8Z A;  1H89 A;  3VTP C;  1M1J C;  5AW4 B;  4JRK A;  2NPS D;  3OYI A;  2R32 A;  1JOC A;  1HUC A;  1RL2 A;  4F7U A;  1DX7 A;  3M57 A;  1UGR B;  1DEB A;  2HFE D;  4C0Z A;  1VQP A;  1PFI A;  3NTN A;  1G2C B;  1HK9 A;  2FHD A;  3OS1 A;  3QJY A;  3OSV A;  4KT0 E;  5KE3 A;  2JTF A;  2JOY A;  2LT4 A;  2DXC A;  2Q9I A;  3C9I A;  3RL0 C;  3F70 A;  1JCD A;  4L59 A;  1L0L K;  5CCA A;  4DA4 A;  3A7O A;  2P4T A;  4BY6 B;  2NPS C;  1KQ2 A;  1VQ4 T;  4OH8 B;  1ZV8 A;  3SWF A;  3CXC S;  1GU4 A;  1ZQ1 A;  2WSC H;  2C06 A;  4BE2 A;  1NAF A;  2M0O A;  3QHS A;  1VQN T;  4M78 E;  1LJO A;  4C0D B;  4OVA A;  2F5T X;  4C92 A;  3E9F A;  4M77 G;  4PLI A;  2RHY A;  5LJ5 d;  1H64 1;  1ZHI A;  4XQ3 A;  3CBO A;  4F7U E;  2A45 G;  3JSC A;  1L0N K;  1SQB K;  2YO2 A;  3FLG A;  1O75 A;  4M78 B;  2RHZ A;  3CC4 A;  3G71 T;  1HGZ A;  1KQS A;  2YO3 A;  3CCJ T;  3QUI A;  2L3R A;  1TH7 A;  1VQL T;  3RUX A;  4J7I A;  4F7U B;  2OYI C;  3LWI A;  4XTU A;  1UGQ B;  3P8B B;  2ZPF B;  4QVZ A;  5CK9 A;  1NU1 K;  3L2Z A;  3A8G B;  4C5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...