3M9QA

Drosophila msl3 chromodomain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
89
structure length
89
Chain Sequence
LRDETPLFHKGEIVLCYEPDKSKARVLYTSKVLNVFERRNEHGLRFYEYKIHFQGWRPSYDRAVRATVLLKDTEENRQLQRELAEAAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Corecognition of DNA and a methylated histone tail by the MSL3 chromodomain.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords Protein male-specific lethal-3
total genus 22
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3m9qA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3m9qA01
5IAYA 3DLMA 3S3MA 4IUTA 5KCHA 2K3XA 3E9FA 5J26A 1SQQK 3P8DA 4UC4A 4A4FA 2WSEH 2JTFA 4IUVA 4QW2A 3NTHA 4PL6A 1L0NK 2EQMA 1NTMK 3OA6A 2RHYA 4IKFA 3MEWA 4IUQA 3ME9A 1OI1A 1NU1K 1WJRA 2MWOA 3OYDA 1SQXK 4A4HA 4IURA 2M0OA 2O4XA 4E7IA 2LDMA 2RHZA 3KUFA 3OMCA 3QJ6A 4PLIA 3S6WA 3P8HA 4QVZA 3OYBA 2O4XB 1NTZK 2FYUK 2PQWA 1NTKK 1WJQA 5D6XA 2HQEA 2DIQA 3LLRA 3OYHA 2DAQA 3MEAA 4E7KA 5KLVK 2R57A 3OYMA 2MWPA 3MP6A 4IFDK 4II1A 3UWNA 2NLUA 3MEVA 3MEUA 3F70A 2RJCA 3EAEA 3LGLA 4IUPA 3S3NA 3OYIA 2RJFA 3CLQA 2J59M 2RHXA 3OB9A 5IN1A 1SQVK 4QQ6A 3OS0A 3DB3A 3OS1A 2L8DA 4ZTJA 3PFSA 3MP8A 4C5GA 2BKDN 2GFUA 2HQXA 3LGFA 3Q1JA 4B9WA 5D6WA 5KH6A 4C5HA 2RHIA 3NTKA 3OYGA 5D6YA 3OYAA 4A4GA 2F5KA 1SSFA 3ASKA 3M9QA 3BDLA 5M9OA 4BD3A 3FLGA 3OMGA 4BE1A 2RHUA 2E6NA 2D9TA 2FHDA 2BUDA 2LRQA 2GF7A 2O01H 3MO8A 3O8VA 3LW5H 3ZEHA 2RI3A 2CKKA 2LVMA 2X4WA 3NTIA 3OYFA 2X4XA 5KE2A 3META 4E7JA 2BIVA 4C5EA 4E7LA 3OYNA 3OYLA 3UT1A 3GOXA 2JZ2A 5FROA 4BE0A 1G5VA 1XNIA 3LYIA 4QQGA 3FEOA 3H8ZA 3PMTA 2G3RA 4FL6A 4N4HA 5KCOA 2R5AA 4BDZA 4ZTFA 5C0MA 2M16A 2RI5A 4EDUA 3L2QA 2L89A 2X4YA 3FDRA 4NS5A 3OS2A 3LX7A 1RI0A 3LH0A 4BACA 3OYCA 3G3ZA 2M1HA 3QKJA 1SQBK 4BDYA 2WSFH 4RG2A 2QQSA 2EQUA 2R58A 1MHNA 4GY5A 4OVAA 4B9XA 3L2RA 2IG0A 3L2VA 2VYTA 4C5IA 2RI2A 4X34A 3SD4A 2DIGA 2RJEA 2OARA 3DB4A 2GFAA 3H6ZA 2P0KA 4QQDA 2XDPA 4Z02A 3L42A 5FRMA 2EQJA 2QQRA 1WJSA 2R5MA 1SQPK 3QBYA 5J39A 3OYKA 2L3RA 2LKMA 4L59A 2WSCH 5KE3A 5C6SA 4Q5WA 4E7HA 1L0LK 2YRVA 3MP1A 3OY9A 2RJDA 3PNWC 1OYXA 2B8AA 1OZ2A 3CEYA 5FRNA 2EKOA 4N4GA 2X35A 3OYJA 3FC3A 4CRIA 4BE2A 3S3OA 2K3YA 3E9GA 4FU6A 1WGSA 1OZ3A 4PLLA 3OYEA 3L2UA 2WACA 3L2WA 2EQKA 2LCCA 1H3ZA 2E5QA 2XK0A 4A4EA 3OQ5A 1KHCA 3QIIA 1N27A 3PMIA 4N4IA 4IUUA 4HCZA 2RO0A 5CIUA 2EFIA 4LD6A 3C4SA 2LTOA
chains in the Genus database with same CATH superfamily
2NYSA 2K57A 3HSBA 4M75C 3A98A 3VUZA 4NPDA 1BCOA 5DJTB 4QW2A 1HXDA 1L0LE 1URQC 1ZA2B 2RHYA 3V8KA 1Q81C 1PP9G 3GLMA 3WUUA 2K79A 3LH5A 4ZKPA 2LJ3A 1FBMA 1ZR2A 2I8DA 1KMIZ 1HJDA 4QVZA 4C7NB 2A36A 1DD3A 3PE0A 5AVUB 3LLRA 1BSNA 5LJ3j 2E76C 2GM4A 1WYXA 1GW4A 1V29B 5K5GB 1W70A 4M75A 4C0ZA 1X2QA 1KILC 1U7JA 1N7LA 3SFMA 1M1KR 2RJFA 3M4GA 3H9NA 1KQSS 1YN8A 1H88A 2V8JA 1YJNP 1KC8C 2A45G 1VDFA 3PFSA 1JBMA 3I56Q 3CCUA 4DOJA 1NYHA 2YO2A 4FW2A 2QEXQ 4H0LC 5D6YA 1C1AA 1VQ6Q 5KAFE 1PD0A 3L70G 1Q81U 1UHCA 1S72P 5L23A 3M54A 4U3FG 2V26A 3AEBC 3HPWA 3FWNA 4BY6C 2C0XA 3PHLA 1TSFA 1VYUA 3TF5A 1VQ8P 4E7HA 1J1EB 2RNAA 3NTIA 1M8VA 3CCMP 3CC7Q 4IOIH 1H0TB 4ELYC 5KLVD 3NPFA 1Q7YC 3CXHH 4PJ0E 2OTJT 3I56P 3OW2P 1BSHA 4R55A 4DA4A 3H25A 3QWOC 3K5BA 1TUGB 4D8KA 1SS1A 2PP6A 4RTZA 4M7AA 2K7AA 3DLLA 1YJ9A 1W2BO 4M78G 3JCMh 1NEGA 1JEKA 3M59A 3CL3D 1PP9D 2JOYA 2HAXA 1SVFA 3MUDC 4BI4A 2HMAA 1G3YA 1RAEB 3GBQA 4M7AB 1W2EA 2KK7A 2CS7A 1SQXD 1JU5C 2XIDA 3GLXA 5EC7A 1Q82U 4PJ0H 1BIBA 4RTTA 1YJNA 4L59A 1QLED 2EYZA 5C39A 4EMGA 4D6TJ 3EG3A 1UJ0A 3CEYA 3QZ5B 1YJ9T 1RADB 3GHGB 4J5YA 5CCHD 4M7DD 1UG1A 3MGNA 2POHA 3HRUA 2HL5C 1VF5D 2FYUE 3MJXA 1KG1A 2WACA 4PJOE 3A8MB 2C0TA 3UF4A 3QIIA 4ATOA 1NAFA 2KYMA 1GBRA 2DTOA 3RR6A 2JS2A 3HUSC 4LUEA 2YXQB 3HP9A 1NJIU 3L72D 2KZJA 2F1LA 2KYBA 4M7AF 2FYNB 1GL2B 1W2BP 1SQXK 2N9BA 1PNJA 2VV5A 1LWUC 1SFCC 4OGCA 3G71T 3A8GB 3QPHA 2CH4W 3CD6A 3AEGC 3H1KD 1VQ4P 3EWKA 3VRYA 2N1TB 4OWFA 3E19A 2PRRA 4F14A 1HSQA 2KNBB 1YCYA 1JY2O 1VYVA 4MDWA 3I9QA 4CC7A 4J9EA 2O9VA 4EMKA 1OPLA 2CUBA 2OI3A 1VQOP 1LTSC 3UDCA 1D7MA 4C8QE 4KH1B 3CWBG 3NFQA 3EHQA 1D1AA 1M56D 1Y57A 1D0YA 3TSWA 2JR8A 3MP8A 2ZAEB 4RCBA 2DXTA 3RIRA 2FL7A 1VA7A 1K73C 3DKMA 4MZMA 2QASA 1YJ9P 3SSUA 4A4GA 3CCLQ 3MKDA 5AVQB 4CPGA 2DX1A 2P4RA 3C12A 3CCEP 2KAFA 4FSXA 4M77G 2OAUA 1YJWQ 4M7DB 2IVWA 2OYIC 1M2VB 4RTVA 2J6KA 2AKLA 4M7DG 3BCCE 1Q86C 4RTYA 4BE0A 5GMKj 2FYNC 2G3RA 1X01A 3JB9D 2LR2A 2P4TA 5GJVB 2JO1A 1N2DC 3CD6T 2Z0WA 4C0GA 2ECZA 2K88A 4NOYA 2BEZF 1U5SA 1BCCD 1Y47A 4AFUC 2IYPA 3QUIA 1OOTA 4IIOA 3LW5J 4HB1A 1SQBD 2F5TX 3L2RA 3TGUG 2JS0A 3G6EQ 2B87A 3BASA 2OTJP 1I4K1 1ZLMA 2QM7A 1N5ZA 4HYTB 1MNEA 1KYOI 1SQVJ 1VQLT 4UB8H 4QQDA 4Z02A 3PIPA 5BU5A 1YFNA 4IL6E 3C95A 2YDLA 3OYKA 2HLOA 3M0QA 1VQ6T 2YUOA 2QQBA 2JEEA 3OY9A 2WITA 4AMCA 1K9MU 3AEAC 3OAKA 4QMAA 4EDFA 4XTZA 2G6FX 2JW4A 1KFZA 4OGQD 2VWFA 3JCMd 3EG9B 4C8QA 4J9CA 1BGYJ 4WBAA 1YJNT 1L4AB 5GAOp 4X9CA 1VQ4T 2L0AA 1VQ5A 3CCRP 1JTHB 3VYIA 2RQWA 3EGXB 5KCHA 3KDPB 3H41A 2NUPA 2QVAA 3EG9A 1G1JA 4C8QB 3BATA 3H1JJ 4JPBW 1N9SA 3CCQQ 1NLPC 4IKFA 3A8LB 2BTTA 1YITT 2KR3A 4UB6E 2YXYA 2BCCD 2O4XA 3VYGA 1D1BA 1A0NB 2NUPB 2WPRA 2HPCA 1TS9A 2HBPA 1AHJB 1HWTC 2QTVA 2KNCB 1FC2C 3HRNA 5GMKe 1ZMEC 1R0CB 2E64A 3L2ZA 2A45H 4N78D 3LGLA 3UA7A 3CXHE 2HPCB 3VKIA 1T3JA 2MMPA 3CCUT 1BCCJ 4PJOF 2K37A 3I55Q 1LP1A 4LDXA 1SQVK 4BXLA 1OULA 2QDLA 3DB3A 4ZGDB 1L0LG 2NPSA 1MMAA 2HNIA 3HUSA 4C5GA 2OX7A 1VL2A 1W2BA 5TISH 3MHXA 1VQ9Q 5TISE 1MV3A 5CCHC 4M7DC 1JY2P 2WPSA 2DK3A 1L2PA 1WNLA 1KFMA 3CBMA 2W6AA 1UGPB 2JJLA 1PV3A 2KXDA 4PD4E 2H8HA 4PJOC 2RQRA 1AEYA 1VQPT 4ZN1A 1GL2C 3D7SB 4OGQB 4M77E 3CMEA 1DX7A 1VQ5P 4ORZA 3RNJA 3AE9C 3H1JE 2BIVA 2FYZA 5DJUB 2FZKB 1IGUA 2JZ2A 2HZYA 2Q7CA 4M75F 4BDZA 1AZEA 2K1AA 2R5AA 2SEMA 2M16A 5CCHA 4M7DA 3PT9A 5KAIH 1T3LA 4PD4H 1M27C 4JS4A 4DCKA 3CCSA 1SQBG 5CKHA 1VQ7P 2EQUA 1NYFA 3P32A 3QYGB 1R0BG 1IHVA 1OVUA 1WQWA 1BU1A 4F16A 1WX6A 1CSBA 2YO3A 2KBTA 3NMZC 5KLIB 3U59A 1UECA 2JTEA 1I07A 3EG1A 4OMMA 5GANf 3GF7A 1UFFA 3TQ7P 1W4SA 2HKNA 2LXBA 4D6WA 5CAIA 4XK8E 2CP3A 5CO7A 4HCBA 1MV8A 1SQPJ 2M0YA 5FWCA 3N5BB 1UIXA 3OYJA 1JCDA 3L74D 1VQLA 3LW5E 3CC7T 4BE2A 1FYNA 4QT7A 1H641 2EJFA 1DJ7B 4FU6A 4F04B 4F7UG 2YIUB 4RKUJ 2EQIA 1U3OA 4HCCA 1GRIA 3VS7A 5AW5B 3TREA 5LJ3e 1W2BS 3KFVA 3P7KA 3D6ZA 3T97B 4AUWA 5CMZA 5H2FE 2W0ZA 5IT9E 3MIWA 3H0IA 2X3WD 1KILA 3P8DA 3HD7A 3HTKB 3TEEA 1MUUA 2WSEJ 1VQMQ 3VV0A 1YJ9Q 1S5LX 1DEEG 1JM0A 4IFFA 2FZCB 5KJ7C 1IJDB 3L1AA 1FZFA 1O9SA 2M0OA 3T97A 3USSA 4EI2A 3SFEC 4FM4B 4OMOA 4WY4B 4KULA 2KOGA 2DJQA 5H2FH 3A2AA 1NKNA 3IAOA 1PCXA 1PD1A 2L3PA 4C7RA 2K9GA 5HKCA 1A02F 2CK3H 1BCCG 3RK2B 2CZ6B 1NO4A 4IFDK 4PV1C 3CC2Q 3L71D 2FFDA 3MEUA 1OMIA 1HJBA 5HK3A 1PIXA 3BE3A 2ZPFB 2OTLA 1Z9QA 1N8RU 2XKMA 3GPLA 4WY4C 3OS1A 2BKDN 4C92D 2BCCJ 5CHXA 1T2KD 1PKSA 3AE4C 2WPQA 5CK9A 2I1KA 1RUWA 1LP1B 2WTYA 4XTWA 1ZSZC 2P7JA 1MMNA 1D3BB 1OX9A 1SQQG 1ZQ1A 3RESA 2CZ1B 3B4SA 3RK3D 3CPWA 1KV4A 2I1JA 3CPFA 3X26B 3V6IA 3RKYA 5A0LA 1CW5A 1N8RQ 4M4ZA 3G71Q 1RACB 3CCRQ 5LJ3f 3O6QA 5GAMj 3URGA 3CCJT 1EC5A 2E12A 1WI7A 4OB2B 3LX7A 4GBQA 3LH0A 3RDVA 2B9BA 4IIMA 4OMNA 1BE3G 2WSFH 2QIWA 2FZGB 4CC3A 2A08A 1DD4A 5AW9B 5CBOA 1WHHA 1LTBC 1Q86R 4O5VA 2Y4YA 2DTIA 3I56A 1Q82C 2GTOA 4B86A 2YWWA 1TH7A 1ZW0A 1OZHA 2XHCA 3H6ZA 4NPFX 1VIFA 1ZHIA 5AVXB 3JCMe 1YYCA 5ECAA 4PJNA 5IHKA 3L37A 1JNMA 3M5AA 4DEXA 4K11A 2D8HA 3CD6Q 2QDYB 2YUPA 2K3BA 1LJ2A 1SFCD 1Y96B 4C0DB 3L71G 1SKUB 1ZV8A 4W7ZA 2WSFJ 1RF0C 1NHLA 4L6V5 2DERA 2IBZG 2D1XA 3CCSP 4HT8A 3L73E 3X20B 3LWIA 3CC2A 3JV3A 2COWA 1DEBA 2LCLA 2QQAA 2E6ZA 4PLLA 4M77C 3LWHA 2EQKA 1YWOA 3FIFA 1YTZI 4HCZA 2RKLA 1CI6B 3OBYA 4Z1MH 2DEUA 1Q7YQ 2NUTB 2D0NA 1QP3A 1OU8A 1WHLA 1VQ6A 3KPEA 2A06E 1HH0A 2WSEH 4LDUA 1K04A 2XDBA 1VQ6P 1L0NK 3A8HB 1Q95G 1BIAA 2WZ7A 1AA0A 3HFOA 3SWNA 1YJWA 2HODB 1OWAA 1JO8A 1JJ2S 1VPCA 5B5EE 1SF9A 1X75C 3B5NC 3OMCA 1OQKA 2O4XB 1GL2D 1IC2A 1M90Q 2O31A 1YJNQ 4JDSA 2QJKC 3OYHA 3P8CE 1EFNA 2FYUD 3W68A 3OJAB 2C9LY 2XU6A 1AFOA 1M9SA 5KLVK 3TGUJ 3M0TA 3CCVA 4FSSA 3CPWO 2ZYAA 1RHZB 3SDZA 2P84A 1BK2A 1VQOQ 2VGMA 1GK6A 2J59M 4AG1C 4C92B 1MNDA 5DLOA 1MFTA 1MKMA 4J9GA 4L76A 2RMOA 4QQ6A 2AXTH 3EGDB 3AE8C 3EGUA 3V7SA 6AT1B 1Y07A 5AT1B 2ED0A 3GHGA 4RTWA 1QCOA 2EYXA 4HCKA 2E74D 4FYYB 3VS3A 2OYHB 3L70D 1FAVA 4M78F 3OMGA 3OSSC 1R77A 1NJIR 2KS1A 3QG1A 3CCQT 3L2WA 2CKKA 2X4WA 4Z89A 4C5EA 2VUBA 2GNCA 1XNIA 4XE5B 5B5EH 1WA7A 2E70A 3PMTA 4DT0A 4BI3A 1OXZA 2QI2A 3OS2A 3GF5A 1P84E 1M1KU 1UE9A 4KBMB 1VQ5Q 3EFFK 2KLVA 2R58A 4OVAA 5LJ5g 2DKGA 8AT1B 3CCJP 1PPJE 2AZVA 1K0SA 2IBZE 1AVOA 2DIGA 3FX0A 1IGQA 4E2FB 4JF7A 1VQ9P 2A37A 5LJ5d 1KJWA 2P0KA 3UATA 4XU0A 1VQ9A 5KLVJ 1HJ0A 1U8RA 1XTDA 2KYVA 1JO5A 5KYXA 1AWOA 1OYXA 4O6JA 1OZ2A 3ULRB 5GAMe 2HFED 5GANh 1H92A 3BCCG 1O75A 2IZ0A 3HFNA 2PVDB 1FZGA 4JJBA 2HKQB 2YXRB 3L35A 3RK3C 3RL0g 1QVGO 2I0NA 2QA4T 2D2CC 2DL3A 1OW8A 5AW1B 1JJ2P 2ZZDA 2GCXA 3C0CA 3G7ZA 1EIFA 1L4AD 3CXHD 1T3UA 1WHKA 3CCMQ 3RKXA 1ZR4A 4LLHA 1AJYA 2BZXA 1LTJC 3D71A 3OYDA 3EG0A 1ZN5A 1S72Q 4C8QG 4PJOB 2LDMA 5KLIC 4D6TE 4E7ZA 3Q5SA 2P58A 4I1LA 3VU3C 2ZT9B 2FYUK 1NTKK 2J6FA 2CZ0B 4F7UA 2BE7D 5D6XA 2O01N 1WXUA 2RD1A 4DOWA 1FDMA 3JB9J 4PJOA 4RTXA 2E75B 2RJCA 2OYIB 2XDJA 2YKOA 1RE4C 4U7JA 2A28A 3L72J 4N0AA 1MGQA 1KFNA 2FKWB 3SHWA 4BRYB 3OS0A 4M7AG 4RJTA 4UB6H 4N3YB 2GQVA 3IQLA 5LL6S 5GTIH 1K8AR 1PHTA 2YUQA 3FWLA 4U3FJ 1BCCE 2ZGWA 1H8AA 3HD7B 3HTKA 3OYGA 1NZ9A 2LJ0A 3ASKA 3N7NA 1SSFA 1QVGS 3H6PA 4JUVA 5CKFA 2E42A 2C0WA 4CC4B 3ABVC 4EYYQ 2BUDA 4J8OA 2GF7A 2KSJA 3LW5H 1RE4A 2CSIA 1NTKD 2R3SA 3META 1VF5B 1RH5B 1S4XA 4KJMA 4LC1A 5DLQE 5IHIA 1UTIA 3LYIA 1VQLQ 1FJKA 2K3RA 1SFCA 3H1LD 3HHTB 2RI5A 1YBYA 3T9NA 1YI2Q 3M0RA 2W8ZA 4LDVA 5EFWB 1TUDA 2KRSA 3M0AA 4FYXB 1Q2NA 1PRMC 5AVYB 1IRXA 1TWBA 1QCNA 1QCFA 1WFWA 2M1HA 1K05A 4BDYA 4AT1B 4C92A 2LQWA 3CC2T 1VQKP 3CCEQ 1X8YA 3TYYA 2Y9ZA 1M4ZA 3V4WA 1SQPG 1UHFA 4JLGA 4PJOD 1B34A 2PU9B 4E47A 2A7YA 2RJEA 4L5GA 1M1JB 4MDXA 1IK7A 4H13C 2VB6A 4M7DF 1NYGA 3RL0D 3VS4A 2JTMA 5GANe 5GAMh 3NFCA 1M30A 2IPPA 4GDOA 3EH1A 3QSUA 1RAHB 2QA4A 2R5DA 1P84I 3J7AF 2WPVB 4E7SA 9ATCB 4YXWH 3PNWC 1QWEA 2AEJA 2D0QB 3KXDA 1MMGA 3L74G 2M9UA 4TVRA 4B6MA 1HTLC 1D1CA 2IBZI 4HXJA 1KQSP 5KYXB 1MZ9A 3HD7D 3JCMg 1VQ4Q 4WB4A 1IREB 1KHCA 1K9MQ 4M75G 2DVJA 1K73R 5GTHH 4KHXA 5FLXE 2X51A 1TTHB 5CQYA 1PSEA 4R0KA 1BBZA 2OJ2A 3VTPC 5CKEA 2JTFA 2C06A 3LIDA 3NTHA 3PLNA 3J80E 1KYOE 1NTMK 4KH0B 4M77B 2CH4A 3M53A 5I22A 4R56A 1VQ8A 4OF1A 4LGDE 4C7NA 3P8BB 1Y96A 3IF4A 3HL8A 4JYBA 1L0NJ 3V2RA 3R2PA 3M0UA 1NLOC 3P8HA 2PQWA 3NTNA 3D70A 1WJQA 5I2SA 3ZL7C 3CPWS 2W6BA 3L75E 4RMOA 4E7KA 3CX5E 1J2JB 1AVYA 2L5GB 1I8FA 3L71E 3A3YB 3RL0C 3TK1A 1T0HA 3VP8A 5E79E 4EIKA 2KIKA 2H88C 1PP9J 3JCMW 1RQUA 3JSCA 2DILA 4DBQA 2XG8D 3H1JD 3OB9A 4LE9A 3ZDMA 1VQPA 1EZVE 2HQHA 2ZYGA 3HE4A 2HG5D 3LGFA 2QQ9A 2Y0CA 2D8JA 5KH6A 2E5KA 2DE0X 2CUDA 2OGUA 3NXSA 4PJMA 2A45I 5APXA 1PC0A 2ZPGB 3CCVT 5L8RE 2KVQG 4HVUA 3RMSA 2JUFA 1D0XA 3HE4B 3CMAA 4N6JA 1H0TA 3OYFA 1G5VA 2KQWA 5E79H 5KE2A 2KXCA 1RF1B 5D7UA 3OYNA 3OYLA 1YQ3C 2P1JA 3UT1A 5GANg 1U7MA 4J7FA 1KYOD 2JT4A 5HK0A 3H1LG 2KT1A 1NPPA 1KHIA 1UUEA 2V8IA 4RTUA 4V2SA 1TU0B 2KZIA 2DFUA 2FRYA 2X4YA 3CC4A 1B3QA 2YRDA 3CXCP 2EYQA 1YBKA 4U3FD 1R8EA 4N0AC 3G3ZA 1K76A 1SQBK 4PKCC 1ZP0C 3H1IE 5LJ5e 4MMLA 2CP2A 1NTMJ 2OTLQ 2Q5UA 3L2VA 2Z5IA 3JCMV 2AXCA 2R32A 2QGGA 3RL0B 2OARA 1NTKJ 2QEXP 2ABLA 3PJSK 3A5ZB 3EFOA 2XDPA 1GL2A 1SG5A 1ZOYC 5AVWB 2ZPHB 2Y0EA 1VQ4A 2EPDA 1SRLA 3JCMf 1JUNA 2A3LA 3PTAA 4JQ0D 1QEXA 2NUZA 3H1IG 1A02J 1XTCC 3M55A 1AV1A 5A2QE 5FRNA 2RN8A 3L74E 4AQRD 2DEQA 1SFCB 1USDA 2IYOA 3E9GA 5GAOn 1QKXA 3WXMB 3KBGA 3B5NA 3QH9A 1VF5C 2MF2A 2DL4A 1L4AC 1YTZT 2LTOA 2R44A 2O88A 4JJDA 1T0JA 1NE8A 1S5LE 3JAME 3CQTA 3Q5RA 1SHGA 1YIJT 1YHQA 1EQ7A 4XTYA 1J1EC 3HRSA 4ZGEB 4KT0E 2DZ9A 4M7DE 1BYMA 4ASWA 2AHJB 3JCMb 3LIEA 4A54A 1B07A 3VMAA 1YCSB 2E41A 1SQBJ 4WWIA 1JY2N 1NTZD 4Y28E 2K2VA 1UB4A 4M78E 1Y0MA 1KD1Q 2NZ2A 2FYKA 3M0PA 2VGNA 1H89A 2DJZA 2D6FA 1TXQA 1WXTA 1JB0J 3BY7A 1BI2A 1RAAB 2M0BA 3G4SA 3CWBE 3FB9A 1I1JA 1RABB 3E1RA 1ZA1B 2DVEA 4VUBA 1LCKA 1JJ2A 1YWPA 1U1TA 2KROA 3IFMA 4C5HA 2BCCE 3AE2C 1FZEA 2XNDH 1JQQA 2EKHA 3TCJA 3C9IA 1ABOA 1YITP 3FLGA 5KYUA 1FZAA 4GLKA 2K2MA 2IX7C 4BE1A 1PGOA 3IR9A 4E6RA 2DRMA 2F2XA 4M7AE 1N73C 1WZOA 1WMKA 3I35A 2B86A 4DEYA 4F7UB 1URQA 2OTKE 2PVOB 1G2CA 1KQ1A 3FEOA 3H1LE 4RO0A 3TSZA 4IL6H 5AW6B 2DL7A 2FFDC 4EDUA 4ANJA 2Y9YA 1WHGA 1IFMA 1DH3A 1EDIA 3JSVC 2DL5A 4M78A 3EQ2A 1OU9A 2B89A 3V5BA 1BI0A 5CQXA 3V8LA 1PWTA 3OYCA 4WY4A 1G8XA 3H32A 2OTLP 5HY6A 4BRYA 5DY9A 2L91A 1NTKG 5IXBA 4MN4C 1VQNP 3A0BE 2MIOA 2O1KA 4C5IA 4GIFA 2OYHA 5AVTB 3E2UA 2RI2A 2DM1A 4X34A 2Q3EA 4RG8A 2KEAA 2V7QJ 1N9RA 3VYHB 4CI0C 2ZYDA 2XMFA 2FBWC 3L42A 1GBQA 1G3WA 1Q82Q 4J9IA 3ZBDA 3BVHA 4OMLA 1OFCX 2WSCH 3TDKA 3S1KA 3MP1A 3L72G 4OMQA 1Q90D 2YSQA 2WT7A 3TGUD 1G1IA 4FIBA 2LJ1A 3CD6P 5GAMf 3MHVA 4J9DA 3RBXA 2ROLA 3L2UA 2ZPBB 2XK0A 5GAOr 4W7YA 2XI9A 2ESWA 1YI2A 1Y9BA 2J06A 2WSSH 4A53A 3KYQA 1NU1D 2E3IA 1GCQC 3CCST 2ATCB 1K8AQ 4ESRA 2AK5A 5J26A 2NPSB 3JCUH 2W10A 3CCET 4PL6A 2EQMA 4H0LB 3X28B 1UIIA 1M3AA 3OA6A 1NG2A 1GK4A 2K5IA 3CXHI 1IFIA 4A4HA 4HT9A 4IURA 2M3BA 1N7SD 3JCMX 4PFZA 1NTZK 1FJPA 3CCQA 3L70E 3MTUE 1BE3J 2J6OA 2XV5A 1M1KQ 2GA1A 2QA4P 1WDXA 4Y92A 3L75D 1GZLA 1M8MA 1W1FA 3OW2S 1Q86U 1ZLLA 2MWPA 3PP5A 2ROTA 4II1A 2RPNA 5DM7R 3AEFC 3HRTA 3II6A 2YT6A 3MEVA 3CCLP 1SHFA 1LTJB 2XD0A 1QX8A 3H1HD 3C94A 2MPXC 3V2PA 3WUVA 2EGEA 3AE1C 5CR2A 4ZTJA 2E75D 1FZCC 1AWWA 1JOCA 1EZZB 2YLBA 2V8KA 3L73J 1FOSF 2K4YA 1PG5B 1JMMA 4M77A 5M1BA 2KK4A 4JZ4A 2KXPB 3CX5I 1KC8Q 1YP5A 3BDLA 4LXCA 2AXTE 3FXDA 2E5TA 1OEBA 4J6WA 1RF1C 3EG2A 3L74J 3V4QA 2ZFCA 1G83A 2LRQA 1S72A 1VQPQ 1CI6A 2KDSA 4OMFB 1OVRA 4QVCA 4E7LA 5GAN3 3E7KA 3WUTA 1V1CA 2AEFA 3SWNC 2CZ7B 2KRMA 4C92E 2RK1A 3X24B 3M0DA 2E75C 4I7ZB 3VP9A 2NPSD 4OB1B 5AYFA 3H1KE 4AYCA 1OW6A 2XU8A 2CT3A 1X27A 2OQQA 4RESB 2QQSA 2O01J 1LVKA 3KXTA 1MHNA 1NU1J 1L0ND 4JYCA 5GAN7 3A0BH 5AW4B 5CCGA 5AW3B 1S9KE 1D0ZA 1PM3A 2V4HA 3NHNA 2QM8A 2MI6A 3O8ZA 1LPLA 2NWMA 4HA8A 4Y99C 3Q5PA 1WJSA 2R3CA 1AVZC 3AEEC 4YTLA 1X0TA 3L75G 1E6GA 3CCVQ 5KE3A 4FYWB 1FU1A 2QJPB 3SWNB 3VRZA 2WSCE 2EYWA 2FY8A 1URQB 1MV0B 2FRWA 4MZPA 4PNOA 2H89C 2BZYA 2Q3IA 4J6YA 4C92G 1IK9A 1OPKA 1EXIA 1EDJA 2K5LA 1N8RC 1SQVE 1SQXE 1BB9A 2M3EA 3C4SA 1HUCA 2FPDA 1XJWB 3E9FA 4KUIA 2DD5A 3V2NA 1NJIC 4PK4A 4TT3H 2PVGB 3RBBB 1PFIA 2DZCA 3MEWA 4IUQA 1WJRA 3JB9I 3TU4K 1ZBJA 5APUA 5BVZA 4JRIA 3QO3A 3KUFA 1IHWA 4IFMA 1FXXA 2JM9A 3WVEB 1ZUYA 2Y90A 1UGVA 1EDLA 3O6QB 1LTIC 3B5NB 1KB9I 1XTGB 1VQ7T 3H1HG 3EAEA 4IUPA 2EW3A 1X69A 1NKZB 4ZN3A 1OVVA 2MYSA 1K73Q 3M9BA 5IN1A 1AQ5A 4NPEA 1SQPE 1QL2A 1VYTA 2DTHA 1FMWA 2L8DA 4J9FA 3AE6C 3JB9F 3GG2A 2FB7A 5D6WA 2QJYC 2WVRA 3V2QA 2PTKA 1NGMB 2PAJA 5APQA 2IZ1A 3M9QA 3INZA 2PFXA 1BE3D 3AE3C 2C9NY 4H44B 3RGUA 5AVZB 1M57D 3RBZA 2NRGA 5APSA 2O01H 3O8VA 2B88A 3CBPA 3G4ST 7AT1B 3NGPA 4JS5A 4AG2C 3FGAD 1GD2E 1FZCB 2LQKA 4PJJA 3UPUA 3TNUA 4XFJA 4GLMA 4J9BA 5C0MA 1ZSGA 2KRNA 1QQJA 1IZNB 2GQIA 1Q7YU 2ENMA 1Q86Q 2A0FB 4BB7A 3CCJQ 4BACA 1WXBA 1SQQJ 2XDDA 1LTTC 1OW7A 3VMXA 3GNFB 3VOPA 3RK3E 2J5UA 2RMZA 3G4SP 5FW9A 1WQ7A 1ZXGA 2IG0A 1NPRA 5LJ5f 2RB6A 3QDRB 1GFCA 4Y99B 1PPJD 3RK2C 3MPUB 3SD4A 2ZT9D 2FYUJ 4F7UF 3H1HE 3OSVA 2DRKA 1IZ6A 2GFAA 5KYUB 1CKBA 2H3EB 2FEIA 1M3CA 1URQD 2VVKA 3FRNA 1AWXA 5GMKm 3CI9A 5KKZB 5FU7B 2LT4A 5KYWB 2RJDA 1TU3F 2RA2A 4ELZC 2KGTA 3BW1A 1JTHA 2PGDA 2EKOA 3FC3A 3H1ID 1HVVA 3G9RA 4L75A 1QP2A 2E43A 3HE5A 1K8AC 2NUTA 3A1PA 2KUBA 2M02A 5HCKA 1JXOA 1SQXG 1WLPB 4I2LC 4XAXB 1FX7A 2EGCA 2OYOA 4FT4A 1OV3A 3C1LA 3PVLA 1K9MC 4UC4A 1H8KA 4I7ZC 1N73B 3OS5A 2EJ9A 3QXEB 2KNCA 3QZ9B 1D3BA 1OI1A 2QG4A 3SFDC 1G2BA 4J7IA 3M58A 3QDFA 4JJNK 2I2LA 5APWA 2O2OA 4PLIA 3B5ND 1Z56A 4PD4D 1U06A 1GW3A 2DAQA 2CGHA 3MEAA 2EWNA 1LTAC 4PFPA 3GIBA 4J6XA 2E76D 2Z4EA 1AWJA 3OBWA 3S3NA 3F70A 1WPYA 3EFOB 1UDLA 4Y28J 2OAWA 1KB9H 3AECC 2HCKA 2KY9A 1PPJG 1W5CE 5LJ5h 1EX4A 3H0HA 1IFNA 2Q6QA 3D6YA 2RF0A 1RQVA 3FXEA 2PNIA 3Q1JA 5AW0B 3H1KG 1BCMA 5GAN8 2JM8A 2ZVOB 5KAFH 4JRPA 1KQ2A 3I55A 2LP5A 2E6NA 1KB9E 4MMKA 2M51A 5GAN6 2RI3A 4DOVA 1KQFB 1ZSZA 1YIJA 1BGYD 1SEMA 2VASA 2X3XD 2FXMA 3PGGA 1YITA 4ZTFA 1RLPC 3A0HH 3L2QA 2V1QA 2HEQA 1R5LA 2FO0A 4HVWA 2FVUA 1VQ5T 4GY5A 2FG0A 4M77D 1S1NA 5GTHE 2CP7A 3L71J 1KD1C 3M91A 3QYHB 2AKKA 1KB9D 1HBWA 1PSFA 3BCCJ 1SLQA 2VKNA 4KGVB 2JJ9A 2QSIA 1LNXA 3CXCS 1NTKE 3G71P 1OIPA 2HODA 3F5HA 4YPCA 1VQ9T 1J1DC 3SWFA 2RQVA 4XTXA 5GAN4 1FE6A 3JC22 1M7LA 5GMKi 2DXBA 3H1HJ 4MZTA 3AT1B 5C6SA 4F17A 1YIJQ 1X6BA 2O3JA 2B8AA 3CMEQ 4C8QF 3L73D 4X9DA 4JJCA 3EH2A 4HJGH 2NPSC 1TOVA 3R6OA 3KZIH 1RL2A 1OZ3A 2P67A 5EG2A 1UGSB 3M4YA 4C92F 2CDTA 1I5LA 5J3BA 2EFIA 5GAMd 3QWXX 2IFNA 4Z8AA 2H8PD 2YRVA 1QVFS 3DLMA 5LJ5j 2COZA 3EFGA 4YXDC 1SRMA 4ZNXA 4WCIA 1X9VA 5GTIE 5KLVE 3CWBD 1BGYG 1NU1K 3THKA 3RERA 3ER0A 4GOFA 1MUZA 3TGUE 3CX5H 3CCRT 2HSEB 2E76B 1S1CX 2HQEA 1LWUA 4HKZH 2K9JA 2MKVA 1KN7A 3VMYA 1L0NE 2YMKA 5FU6B 1VQ8Q 2NLUA 2LX9A 4R4MA 1JXMA 3OYIA 2HDAA 1VQKA 2RHXA 2XNXA 3O5ZA 3R6NA 5KLVG 1FS0E 3M0SA 8ATCB 2BE9B 2DPPB 2GGRA 3G6EA 3M56A 4B9WA 4J83A 4W80A 2FFDB 2MOXA 4XU3A 2W83C 4OGQC 1VQLP 5GAOl 1JY3N 3U23A 1GMJA 1G3SA 3A7OA 5KTBA 1YJWT 1NVOA 1X79B 3HUSB 1M1JA 1G3TA 2FHDA 1VQMT 1VQNT 1M3BA 3V7RA 1Q81R 1PZQA 1E5WA 2J05A 1GU5A 2IBZD 1KTMA 1KILE 1ZRTD 2N1TA 5CJ0A 4M75E 5CKBA 3VS1A 4EMKB 5CKDA 2CP6A 1V76A 2WSFE 1K8AU 4PFOA 4JZ3A 5I21A 1JCCA 4XTVA 4DZOA 3FJPA 4NS5A 1P84D 3GP8A 4LN2A 3QKJA 1M1JC 1FMVA 4RG2A 3A0HE 2IIMA 4PD4I 1VQ7Q 3U1CA 1QWFA 5A0GA 2HL3A 4B9XA 2DD4A 2CPSA 2VC8A 1VOMA 4PV1B 1KC8R 2FPFA 3E1IA 4JPZB 2G3AA 2RK2A 1KQGB 3JCUE 2CT4A 5AVSB 2VXFA 3CWBJ 3SB2A 3JB9G 1S5LH 1GU4A 2RQUA 4M75D 1BI1A 1QW1A 1GFDA 2HR3A 2M5AA 4OGEA 1M1FA 1EDKA 3VUBA 4PJOG 3L70J 4JRQA 1J3TA 1VQOT 2QAZA 4N4GA 2SPZA 3G4SQ 1BDCA 2VXEA 2QG9B 2MCNA 2KI7A 1Q7YR 2F2VA 4M78C 4JRKA 2LCCA 4A4EA 1KQSO 4DBHA 2GUVA 3HD7C 4JBZA 3CCSQ 2EJGA 5L8RJ 4C8QC 2YIUC 2VRSA 4IUTA 1P84H 3CC4T 1SQQK 4A4FA 3KQGA 2CP0A 3L72E 1EZVD 2KMTA 3RKWA 1EZVG 3B8EB 2HBWA 4NL2A 3RMQA 5LJ3d 1M90R 3Q1MA 2DW3A 2J58A 2XZRA 4M78B 2QE7H 2EYYA 4E7IA 2JDIH 2X4JA 3I5RA 3S6WA 1EZVI 4HVVA 2DBKA 1YHQQ 1WT6A 1CKAA 1PGQA 2L2PA 1SQVD 2HSPA 1KQLA 4M7AC 3QHSA 3WMM0 1NTMD 5IXFA 2N9YB 4ZGJB 3OYMA 2DBMA 2K5FA 1ZUUA 3CLQA 4YTPC 2GUSA 1R8OB 5FWBA 3REAB 4D8DA 2M8RA 2YMYA 2LZ6B 1UGRB 3WU2H 1AZGB 3NTKA 1OX8A 2UWJE 2QEXT 4ZKUA 1LOJA 4KGXB 1M90U 2JP3A 4M77F 3GW6A 1QMCA 1YQ4C 3RUXA 4H13D 1S9KD 4EIJA 2D9TA 2P10A 2IFMA 2YKQA 1E6HA 5KYNA 2L5QA 4RKUE 2F69A 2ZPIB 2KLUA 4H44D 1KYOH 3H1JG 3GOXA 2DNUA 1IFPA 1L0LD 1HD3A 2BCCG 1NJIQ 4QQGA 5IH2A 4HKEA 1SQXJ 2C0IA 4N4HA 5KCOA 2FYUG 3CCEA 4FW1A 3OA7A 2H3JA 3JCMP 4D6TD 3G6EP 5AVRB 1RI0A 3A5TA 3CC2P 3TVTA 3OW2O 1XQHA 4H0LD 4OVNF 2AIRB 3CCMT 1M5Q1 1I0CA 2AT1B 2FPEA 3JCMJ 1VQ8T 4M78D 1M8OB 1L0NG 4C46A 3AE5C 5TJHA 1GL5A 1X6OA 1N7SB 1PP9E 4M75B 3CCVP 1NTZJ 1RY3A 3F89A 2ZPEB 1SSHA 2Q9IA 1K9AA 1U1SA 4CC2A 3AEDC 2R5MA 1JY3P 1SQPK 4HH2A 1VQMP 2ED1A 4K35A 2L3RA 3G1JA 3MCAB 2KT8A 3TNUB 4Q5WA 1YJWP 5GMKl 1NM7A 2MK5A 2N1TC 2ZAEA 5KAIE 2CPBA 4BUGA 3HKSA 3P8MC 3GNGA 3CCMA 1H3HA 2M5AB 3H1KJ 3HTRA 2K3YA 2GTJA 3EFRA 4EMKC 4ASVA 4A63B 5LJ3g 1GDTA 2DETA 3GHGC 3S9OA 1M2VA 1RAFB 1HGZA 2P0PA 1CZQA 1KSWA 4H13B 3S3MA 3UA6A 1USEA 4U3FE 1J1DB 4IUVA 1VQPP 1NWQA 4C92C 3CMET 2KP8A 4R4LA 1K1ZA 2QXFA 2YHTA 1RE3C 2YKPA 4I6MC 3JCMQ 1AQTA 2WQYC 2P0QA 3NMDA 3JRZA 3QJ6A 1S3JA 1U57A 2OYIA 4X1VA 4KUDK 5KJ7A 4XTUA 2X9HA 1NTMG 3CCJA 1KC8U 3WU2E 1B7TA 1X43A 4AFZC 3CCUP 2K9JB 3MZWB 3BRVB 1RAGB 3UWNA 1PL5A 2ZVNB 3BCCD 1LTGC 3E1SA 2QYZA 1RE3A 1ZBXA 1ZX6A 1VQNA 4AFSC 5GAOq 2W27A 1Y7XA 2OTJA 4BI8B 5A0DA 4ME7A 1SQPD 1KILB 4P5NA 2DA9A 2Z5HA 3CXCA 1E79H 5KYWA 1VUBA 3PH0A 3Q2YA 1BI3A 5IHNA 4NL3A 2DYIA 1HGVA 2EIFA 2XKOC 3R4YA 5GANj 4KT0J 2BASA 3OYAA 2KE9A 3CMAT 1YNZA 4BD3A 2DYBA 3U1AA 4OB3B 1ABQA 2A06G 3KZIE 2LVMA 4C8QD 4IL6X 4E7JA 1VQKT 1BGYE 1G2CB 2RM4A 1WHJA 1HK9A 3AE7C 3EGXA 5FU6C 5FROA 1LWUB 5AW2B 4RCCA 4Y91A 4FL6A 4OB0B 2GBQA 2QGFB 2ITAA 2KS1B 3I55P 1IO6A 2ZXEB 1YHQT 2L89A 3S4RA 1FZBA 1KD1U 1N8RR 1NU1G 3X25B 2JXBA 2KSSA 3CBOA 3CCLT 5GMKh 1T8ZA 4LD9K 5APYA 1VQOA 3UIAA 2BEQD 4UB8E 4M7AD 2D2CB 5LJ3h 2SRCA 1NEBA 2E74C 1IFJA 2F2WA 2E5YA 3L75J 3B71A 4QKUA 4GOEA 5FRMA 1L0LJ 2QQRA 3PRJA 3CCQP 1QLYA 3BDUA 2E65A 1SPKA 3VS0A 1SQQD 1BE3E 1S2EA 3TSIA 2HYNA 4TLFA 3MUDA 4BWNA 3S3OA 1E7OA 4JLIA 4DBFA 3W67A 1RF0A 1NTZE 1MMDA 2JNGA 2MJZA 3OYEA 2CREA 2E5QA 2Y4XA 4N4IA 3REBB 3PMIA 1NH4A 1QL1A 2EBPA 1GCPA 5CIUA 4XU1A 4C0DC 3BRTB 2LX7A 1LJOA 4ZMDA 2JKVA 2K3XA 1M1GA 4WTOB 2DO3A 3JB9H 1SQQE 1UJYA 3VN0A 1NOHA 3KHUA 5KYYB 3ME9A 4LUDA 1ZUKA 2MWOA 3QWYA 1M1KC 2N1TD 2RHZA 4O9BA 1FWZA 1RLQC 2LT1A 2LCSA 3OYBA 2OTJQ 1Q81Q 1BKBA 1EXJA 3P8CD 2KI7B 1TUCA 2O1JA 2RH2A 2WWWA 2IPOB 2QEXA 3MP6A 2OTLT 2D2CD 1M90C 1FZCA 4N78E 3VS6A 2K6DA 1KILD 1ZRTE 4OMPA 3MD0A 4A4KA 2LNHB 3Q3DA 2V7QH 5AW7B 3A8OB 3H32B 1VQ7A 2JWAA 5GJWB 3I5CA 1LT9C 3I55T 1I81A 4KGZB 1HF9A 2GFUA 2HQXA 2QTXA 3EFSA 3L4FA 2EVRA 4WF2A 2QRXA 3GF3A 1RF1A 2RQTA 5CCGD 2V1RA 4FT2A 3CCRA 1I5OB 3BFMA 2JMCA 3PVQA 1HYOA 2B87B 2K9YA 2J7IA 1FDIA 1WHMA 3CC4Q 3VMZA 4DBRA 1LT1A 3MO8A 5I2MA 3ZEHA 4L74A 3CMAP 5B66E 4BY6B 3CCUQ 1LT9A 2ZJSE 3V7CA 1K4US 1UEBA 3L73G 2L3QA 2MAMA 1N86A 2AZSA 1IXDA 1QVGP 3FJ5A 1N73A 1SP4A 4F7UE 4WY4D 3I5SA 2W6JH 4EMHA 3FDRA 1IB8A 1LT9B 2H43A 1P92A 3GMAA 5CCGC 2DLPA 4LDWA 3CC7A 1FDOA 1QVFA 1N7SC 1AT1B 3CX5D 1R5SA 1K9MR 2QJYB 1K0XA 3RK2D 1DIPA 2VYTA 2ZT9C 2E1HA 4AFQC 1X2KA 4L73A 4DQ2A 3PTZA 3DB4A 2PZ1A 4QVDA 2QJKB 4PV1D 4D6TG 1T3SA 3VS2A 1QGKB 4LDYA 1WRGA 2FXOA 1JB0E 3QBYA 3V8JA 5BU8B 2CYZB 2LMJA 1JY3O 2LKMA 3CMEP 2WSCJ 2JVVA 5KJ7D 1YIJP 1KIKA 2H7HA 1CSKA 1SQBE 4FYVB 1C6VX 2QK0A 2X35A 2XICA 2EGAA 4CRIA 3RK3B 1K73U 1XOVA 1PGJA 2QA4Q 5KKZC 4KRTA 5FU7C 3I56T 1Y8AA 1H3ZA 3SEMA 2JMAA 1JMBA 3OQ5A 1M2OA 2KB7P 3M9HA 1N27A 3WVDB 1NU1E 4XU2A 3M06A 3CCLA 5IAYA 2LNVA 1AD5A 1UGQB 2DF6A 1KZUB 3C8VA 3H0FA 5GAMg 3J81E 2W90A 3CPWP 3M57A 3MP7B 4WVZA 4FCYA 1GCQA 1W6XA 1F1BB 1NAYA 1S72T 3N4XA 1Q82R 1JEGA 4K3AA 5AVVB 4DJGA 2JN0A 5CJ4A 2OYHC 1QVPA 1KORA 1RI9A 1LTJA 2DL8A 4LNPA 1VQMA 1N6AA 2DIQA 1KQSA 1LNQA 4J9HA 4A7PA 1Z9ZA 4H44C 2EAYA 2YRCA 1ZSZB 2R57A 5APVA 2LXCB 1KK7A 4C0FA 3PIOA 1PKTA 1QVGA 2AEMA 2CSQA 2COYA 3G6ET 2RH0A 1PRLC 1KD1R 2YNYA 4EPCA 2WMMA 2CP5A 3CC7P 1QVFP 4M3LA 2RHIA 3OYYA 1NBEB 4GODA 2F5KA 1NTME 5M9OA 1ARKA 4RUGA 2E4HA 3H1IJ 1QVFO 5KYYA 1VQNQ 2RHUA 3ITKA 2DXCA 1VIEA 1IFDA 1PGPA 2X4XA 4XQ3A 2C0OA 5CCAA 1T6AA 5GAN2 1QKWA 3H8ZA 4ZNCA 2HD0A 5I11A 1BDDA 1NTZG 3QJYA 1YI2T 1YHQP 1D09B 3SWKA 2PUKB 2Q1KA 3HE5B 2BZ8A 2Y0DA 5CVIA 2A06D 4GKGA 2R5BA 5GAOm 1T2KC 2QJPC 3G71A 5GANd 2LQNA 3IN6A 3L36A 2G8YA 2O9SA 2PUOB 5AW8B 5APTA 1AOJA 1YITQ 1IO4A 2ZCFB 5GAN5 2RN0A 2ZXXA 1GTWA 3VS5A 1OX3A 5B66H 2JWDA 1MFZA 1JRIA 2IDBA 1B34B 2WT7B 1FOSE 3VJPA 1X22A 4PJLA 4Z88A 2EQJA 1WIEA 4OH8B 1RAIB 4OP0A 1TG0A 2E3HA 5J39A 3CMAQ 1ACMB 1Y71A 2L3SA 2DXUA 1SQVG 5CBNA 1L0LK 2YUNA 3CC4P 3EGDA 2E74B 3OW2A 1X6GA 2E10A 4XA4A 2KSEA 3ZFJA 1VQKQ 2O01E 3JCMc 4EOTA 2LC4A 2DMOA 2LQ8A 1L4AA 1GXIE 2P2UA 3EHRA 3AHUA 3SWYA 1WGSA 1YI2P 2YLCA 1C0MA 4GT1A 1N7SA 2FXPA 1LGHB 4IUUA 2WSEE 2RO0A 1FMKA 3H1LJ 4LD6A 3M0DC
chains in the Genus database with same CATH topology
2K57A 3HSBA 4M75C 3VUZA 4QW2A 1HXDA 1URQC 2RHYA 3V8KA 1Q81C 4ZKPA 1FBMA 1ZR2A 4QVZA 4C7NB 5AVUB 3LLRA 5LJ3j 2GM4A 1GW4A 1V29B 4C0ZA 4M75A 1KILC 1N7LA 3SFMA 2RJFA 3M4GA 1KQSS 2V8JA 1H88A 1KC8C 2A45G 1VDFA 3PFSA 1JBMA 3CCUA 4DOJA 2YO2A 5D6YA 1Q81U 3M54A 3HPWA 4BY6C 2C0XA 4E7HA 1J1EB 3NTIA 1M8VA 4ELYC 1Q7YC 2OTJT 4R55A 4DA4A 2PP6A 4M7AA 3DLLA 1YJ9A 4M78G 3JCMh 3M59A 3CL3D 2JOYA 2HAXA 1SVFA 4BI4A 1G3YA 4M7AB 1W2EA 2CS7A 2XIDA 3GLXA 1Q82U 1BIBA 1YJNA 4L59A 4EMGA 3CEYA 3QZ5B 1YJ9T 3GHGB 4J5YA 5CCHD 4M7DD 3MGNA 2POHA 3HRUA 1KG1A 2WACA 4PJOE 3A8MB 3QIIA 4ATOA 1NAFA 2DTOA 3HUSC 3HP9A 1NJIU 4M7AF 1GL2B 1SQXK 2N9BA 2VV5A 1LWUC 1SFCC 4OGCA 3G71T 3A8GB 3QPHA 3CD6A 2N1TB 3E19A 1YCYA 1JY2O 4MDWA 4EMKA 1LTSC 3UDCA 4C8QE 3NFQA 3MP8A 4RCBA 2DXTA 3RIRA 2FL7A 1K73C 3DKMA 4MZMA 4A4GA 5AVQB 3C12A 2KAFA 4FSXA 4M77G 2OAUA 4M7DB 2IVWA 2OYIC 4M7DG 1Q86C 4BE0A 5GMKj 2G3RA 1X01A 3JB9D 2P4TA 1N2DC 3CD6T 4C0GA 4NOYA 3QUIA 2F5TX 3L2RA 3BASA 1I4K1 2QM7A 4HYTB 1VQLT 4QQDA 4Z02A 3PIPA 5BU5A 3C95A 3OYKA 2HLOA 1VQ6T 2QQBA 2JEEA 3OY9A 2WITA 1K9MU 3OAKA 4XTZA 3JCMd 4C8QA 4WBAA 1YJNT 1L4AB 5GAOp 4X9CA 1VQ4T 1VQ5A 1JTHB 3VYIA 5KCHA 3KDPB 4C8QB 1G1JA 3BATA 1N9SA 4IKFA 3A8LB 1YITT 3VYGA 2O4XA 2WPRA 2HPCA 2HBPA 1AHJB 1HWTC 3HRNA 5GMKe 2E64A 3L2ZA 2A45H 4N78D 3LGLA 2HPCB 3VKIA 1T3JA 2MMPA 3CCUT 4PJOF 4LDXA 1SQVK 3DB3A 4ZGDB 2NPSA 2HNIA 3HUSA 4C5GA 1W2BA 3MHXA 5CCHC 4M7DC 1JY2P 2WPSA 2DK3A 1WNLA 1KFMA 3CBMA 2W6AA 1UGPB 2JJLA 4PJOC 1VQPT 4ZN1A 1GL2C 4M77E 3CMEA 1DX7A 2BIVA 2FYZA 2JZ2A 2Q7CA 4M75F 4BDZA 2R5AA 2M16A 5CCHA 4M7DA 3PT9A 4JS4A 3CCSA 5CKHA 2EQUA 3QYGB 3P32A 1WQWA 1CSBA 2YO3A 3U59A 5GANf 1W4SA 4D6WA 5CAIA 4XK8E 4HCBA 5CO7A 1MV8A 3N5BB 3OYJA 1JCDA 1VQLA 3LW5E 3CC7T 4BE2A 1H641 2EJFA 1DJ7B 4FU6A 4F7UG 4HCCA 5AW5B 3TREA 5LJ3e 1W2BS 3P7KA 4AUWA 5CMZA 5IT9E 3MIWA 1KILA 3P8DA 3HD7A 3HTKB 3TEEA 1MUUA 3VV0A 4IFFA 5KJ7C 1IJDB 3L1AA 1FZFA 1O9SA 2M0OA 3T97A 4FM4B 4WY4B 4KULA 2KOGA 3A2AA 1NKNA 4C7RA 5HKCA 1A02F 3RK2B 2CZ6B 1NO4A 4IFDK 2FFDA 3MEUA 1HJBA 5HK3A 2ZPFB 2OTLA 1N8RU 2XKMA 3GPLA 4WY4C 3OS1A 2BKDN 4C92D 5CHXA 1T2KD 2WPQA 5CK9A 2I1KA 2WTYA 4XTWA 2P7JA 1D3BB 1ZQ1A 3RESA 2CZ1B 3RK3D 3CPWA 2I1JA 3CPFA 3X26B 5A0LA 3RKYA 1CW5A 5LJ3f 5GAMj 3URGA 3CCJT 2E12A 4OB2B 3LX7A 3LH0A 2WSFH 5AW9B 1LTBC 4O5VA 2Y4YA 2DTIA 3I56A 1Q82C 4B86A 1TH7A 2XHCA 3H6ZA 1VIFA 1ZHIA 5AVXB 3JCMe 1YYCA 3L37A 1JNMA 3M5AA 2QDYB 1SFCD 1Y96B 4C0DB 1ZV8A 4W7ZA 4L6V5 1RF0C 1NHLA 4HT8A 3X20B 3LWIA 3CC2A 1DEBA 2LCLA 2QQAA 2E6ZA 4PLLA 4M77C 3LWHA 2EQKA 3FIFA 1YTZI 4HCZA 1CI6B 3OBYA 1QP3A 1VQ6A 3KPEA 1HH0A 2WSEH 4LDUA 2XDBA 1L0NK 3A8HB 1BIAA 2WZ7A 3HFOA 3SWNA 1YJWA 2HODB 1OWAA 1JJ2S 1VPCA 1X75C 3B5NC 3OMCA 2O4XB 1GL2D 1IC2A 4JDSA 3OYHA 3P8CE 3OJAB 2C9LY 2XU6A 1AFOA 1M9SA 5KLVK 3CCVA 3SDZA 2VGMA 1GK6A 2J59M 5DLOA 4C92B 4QQ6A 3V7SA 1Y07A 3GHGA 2OYHB 1FAVA 4M78F 3OMGA 3OSSC 3QG1A 3CCQT 3L2WA 2CKKA 2X4WA 4C5EA 2VUBA 1XNIA 4XE5B 2E70A 3PMTA 4BI3A 1OXZA 2QI2A 3OS2A 3GF5A 1M1KU 4KBMB 2KLVA 2R58A 4OVAA 5LJ5g 2DKGA 2DIGA 4JF7A 5LJ5d 2P0KA 4XU0A 1VQ9A 1U8RA 1XTDA 2KYVA 1JO5A 1OYXA 4O6JA 1OZ2A 5GAMe 2HFED 5GANh 1O75A 3HFNA 2PVDB 1FZGA 3L35A 2QA4T 3RK3C 5AW1B 2ZZDA 2GCXA 3G7ZA 1EIFA 1L4AD 1T3UA 3RKXA 1ZR4A 4LLHA 1LTJC 3OYDA 1ZN5A 4C8QG 4PJOB 2LDMA 4I1LA 3VU3C 2FYUK 1NTKK 2CZ0B 4F7UA 5D6XA 2RD1A 4DOWA 1FDMA 3JB9J 4PJOA 2RJCA 2OYIB 2XDJA 2YKOA 1RE4C 4N0AA 1MGQA 1KFNA 2FKWB 3OS0A 4M7AG 4N3YB 2GQVA 5LL6S 2ZGWA 1H8AA 3HD7B 3HTKA 3OYGA 1NZ9A 3ASKA 3N7NA 1SSFA 1QVGS 3H6PA 4JUVA 5CKFA 2E42A 2C0WA 2BUDA 4J8OA 2GF7A 2KSJA 3LW5H 1RE4A 3META 4LC1A 5DLQE 3LYIA 1FJKA 1SFCA 3HHTB 2RI5A 1YBYA 3T9NA 4LDVA 3M0AA 5AVYB 2M1HA 4BDYA 4C92A 3CC2T 1X8YA 3TYYA 1M4ZA 3V4WA 4JLGA 4PJOD 1B34A 2PU9B 4E47A 2A7YA 2RJEA 4L5GA 1M1JB 4MDXA 4M7DF 3RL0D 2JTMA 5GANe 5GAMh 3NFCA 2IPPA 3QSUA 2QA4A 2R5DA 3J7AF 3PNWC 2D0QB 2M9UA 4TVRA 1HTLC 1MZ9A 3HD7D 3JCMg 4WB4A 1IREB 1KHCA 4M75G 4KHXA 5FLXE 5CQYA 1PSEA 5CKEA 3VTPC 2C06A 2JTFA 3LIDA 3NTHA 3J80E 1NTMK 4M77B 3M53A 4R56A 1VQ8A 4OF1A 4LGDE 4C7NA 3P8BB 1Y96A 3HL8A 4JYBA 3V2RA 3R2PA 3P8HA 2PQWA 3NTNA 1WJQA 5I2SA 3CPWS 2W6BA 4RMOA 4E7KA 1J2JB 2L5GB 1I8FA 3A3YB 3RL0C 3TK1A 3VP8A 3JCMW 3JSCA 2XG8D 3OB9A 1VQPA 3HE4A 2HG5D 3LGFA 2QQ9A 5KH6A 3NXSA 2A45I 5APXA 2ZPGB 3CCVT 5L8RE 2KVQG 3RMSA 2JUFA 3HE4B 3CMAA 4N6JA 3OYFA 1G5VA 2KQWA 5KE2A 1RF1B 3OYNA 3OYLA 2P1JA 3UT1A 5GANg 4J7FA 5HK0A 1NPPA 1KHIA 2V8IA 4V2SA 2X4YA 3CC4A 2EYQA 4N0AC 3G3ZA 1SQBK 4PKCC 5LJ5e 4MMLA 2Q5UA 3L2VA 2Z5IA 3JCMV 2R32A 3RL0B 2OARA 3A5ZB 2XDPA 1GL2A 5AVWB 2ZPHB 1VQ4A 3JCMf 1JUNA 2A3LA 3PTAA 1A02J 1XTCC 3M55A 5A2QE 5FRNA 4AQRD 2DEQA 1SFCB 3E9GA 5GAOn 3WXMB 3KBGA 3B5NA 2MF2A 1L4AC 1YTZT 2LTOA 1NE8A 3JAME 1YIJT 1YHQA 1EQ7A 4XTYA 1J1EC 3HRSA 4ZGEB 4KT0E 2DZ9A 4M7DE 1BYMA 2AHJB 3JCMb 3LIEA 4A54A 2E41A 1JY2N 4Y28E 2K2VA 1UB4A 4M78E 2FYKA 2D6FA 2VGNA 1H89A 2DJZA 3BY7A 1BI2A 3G4SA 3FB9A 2DVEA 4VUBA 1JJ2A 1U1TA 3IFMA 4C5HA 1FZEA 3TCJA 3C9IA 3FLGA 1FZAA 4GLKA 2IX7C 4BE1A 3IR9A 4M7AE 1N73C 4F7UB 1URQA 2PVOB 1G2CA 1KQ1A 3FEOA 5AW6B 4EDUA 2FFDC 1IFMA 1DH3A 4M78A 3EQ2A 5CQXA 3V5BA 3OYCA 1BI0A 3V8LA 4WY4A 3H32A 5HY6A 5DY9A 2O1KA 4C5IA 4GIFA 2OYHA 5AVTB 2RI2A 4X34A 4RG8A 1N9RA 3VYHB 4CI0C 3L42A 1G3WA 3ZBDA 3BVHA 2WSCH 3MP1A 2WT7A 1G1IA 4FIBA 5GAMf 3L2UA 2ZPBB 2XK0A 5GAOr 4W7YA 2XI9A 1YI2A 4A53A 3KYQA 3CCST 5J26A 2NPSB 3CCET 4PL6A 2EQMA 3X28B 3OA6A 1GK4A 2K5IA 1IFIA 4A4HA 4HT9A 4IURA 2M3BA 1N7SD 3JCMX 1NTZK 1FJPA 3CCQA 3MTUE 2XV5A 1GZLA 3OW2S 1Q86U 1ZLLA 2MWPA 3PP5A 4II1A 5DM7R 3MEVA 3HRTA 3II6A 1LTJB 2XD0A 3C94A 3V2PA 5CR2A 4ZTJA 1FZCC 1JOCA 2YLBA 2V8KA 1FOSF 2K4YA 1JMMA 4M77A 2KK4A 3BDLA 4J6WA 1RF1C 3V4QA 2ZFCA 1S72A 2LRQA 1CI6A 2KDSA 4OMFB 4QVCA 4E7LA 5GAN3 3SWNC 2CZ7B 4C92E 2RK1A 3X24B 3M0DA 3VP9A 2NPSD 4OB1B 5AYFA 2XU8A 4AYCA 2QQSA 4RESB 3KXTA 1MHNA 4JYCA 5GAN7 5AW4B 5CCGA 5AW3B 1S9KE 2QM8A 2MI6A 3O8ZA 4HA8A 4Y99C 1WJSA 2R3CA 4YTLA 5KE3A 1FU1A 3SWNB 2WSCE 1URQB 4MZPA 4PNOA 2Q3IA 4J6YA 4C92G 1IK9A 2K5LA 1N8RC 3C4SA 1HUCA 3E9FA 4KUIA 2DD5A 3V2NA 1NJIC 2PVGB 1PFIA 2DZCA 3MEWA 4IUQA 1WJRA 3JB9I 3TU4K 5APUA 5BVZA 4JRIA 3QO3A 3KUFA 4IFMA 1FXXA 3WVEB 2Y90A 1LTIC 3B5NB 1XTGB 1VQ7T 3EAEA 4IUPA 1NKZB 4ZN3A 3M9BA 5IN1A 1AQ5A 2DTHA 1QL2A 2L8DA 3JB9F 2FB7A 5D6WA 3V2QA 2PAJA 5APQA 3M9QA 3INZA 2C9NY 5AVZB 5APSA 2O01H 3O8VA 3CBPA 3G4ST 4JS5A 1GD2E 1FZCB 2LQKA 3UPUA 3TNUA 5C0MA 1Q7YU 4BB7A 4BACA 2XDDA 1LTTC 3VMXA 3GNFB 3VOPA 1WQ7A 5LJ5f 2IG0A 1NPRA 2RB6A 3QDRB 4Y99B 3RK2C 3SD4A 4F7UF 3OSVA 1IZ6A 2GFAA 1URQD 3FRNA 5GMKm 3CI9A 5FU7B 2LT4A 2RJDA 2RA2A 4ELZC 3BW1A 1JTHA 2EKOA 3FC3A 1HVVA 1QP2A 2E43A 3HE5A 1K8AC 4XAXB 4I2LC 1FX7A 4FT4A 1K9MC 4UC4A 1N73B 3OS5A 2EJ9A 3QXEB 3QZ9B 1D3BA 1OI1A 4J7IA 3M58A 4JJNK 2I2LA 5APWA 4PLIA 3B5ND 1Z56A 1GW3A 2DAQA 2CGHA 3MEAA 2EWNA 1LTAC 3GIBA 4J6XA 2Z4EA 3OBWA 3S3NA 3F70A 1WPYA 2KY9A 5LJ5h 1IFNA 3Q1JA 5AW0B 5GAN8 4JRPA 1KQ2A 3I55A 2E6NA 4MMKA 5GAN6 2RI3A 4DOVA 1YIJA 2FXMA 3PGGA 1YITA 4ZTFA 3L2QA 2FVUA 1VQ5T 4GY5A 4M77D 1KD1C 3M91A 3QYHB 1HBWA 1PSFA 1SLQA 3CXCS 1LNXA 2HODA 1VQ9T 1J1DC 3SWFA 4XTXA 5GAN4 1M7LA 5GMKi 2DXBA 4MZTA 5C6SA 2B8AA 4C8QF 4X9DA 2NPSC 3R6OA 1RL2A 1OZ3A 2P67A 5EG2A 1UGSB 3M4YA 4C92F 1I5LA 5J3BA 2EFIA 5GAMd 1QVFS 2IFNA 2H8PD 2YRVA 3DLMA 5LJ5j 3EFGA 1X9VA 1NU1K 3RERA 3ER0A 3CCRT 2HQEA 1LWUA 3VMYA 5FU6B 2NLUA 2LX9A 3OYIA 1VQKA 2RHXA 2XNXA 2DPPB 3G6EA 3M56A 4B9WA 4J83A 4W80A 2FFDB 4XU3A 5GAOl 1JY3N 1G3SA 3A7OA 5KTBA 1YJWT 1X79B 3HUSB 1M1JA 1G3TA 2FHDA 1VQMT 1VQNT 3V7RA 1E5WA 1GU5A 5CKBA 4M75E 1K73U 5CJ0A 2N1TA 4EMKB 5CKDA 2WSFE 1K8AU 5I21A 1JCCA 4XTVA 4DZOA 3FJPA 4NS5A 3GP8A 3QKJA 1M1JC 4RG2A 3U1CA 5A0GA 4B9XA 2DD4A 2CPSA 2VC8A 3E1IA 2RK2A 2VXFA 5AVSB 3SB2A 3JB9G 4M75D 1GU4A 1BI1A 1QW1A 4OGEA 1M1FA 3VUBA 4PJOG 4JRQA 1VQOT 4N4GA 2VXEA 4M78C 4JRKA 2LCCA 4A4EA 2GUVA 3HD7C 2EJGA 4C8QC 2VRSA 4IUTA 3CC4T 1SQQK 4A4FA 3KQGA 3RKWA 2KMTA 3B8EB 4NL2A 3RMQA 5LJ3d 2J58A 2XZRA 4M78B 4E7IA 2X4JA 3S6WA 1WT6A 1KQLA 4M7AC 3QHSA 3WMM0 4ZGJB 3OYMA 2K5FA 3CLQA 2GUSA 1R8OB 2M8RA 2YMYA 1UGRB 3NTKA 2QEXT 4ZKUA 1LOJA 1M90U 4M77F 3RUXA 1S9KD 4EIJA 2D9TA 2IFMA 2YKQA 2L5QA 4RKUE 2F69A 2ZPIB 3GOXA 4QQGA 4HKEA 5KCOA 4N4HA 3CCEA 3OA7A 2H3JA 3JCMP 5AVRB 1RI0A 3A5TA 1XQHA 3CCMT 1M5Q1 3JCMJ 1VQ8T 4M78D 4C46A 1X6OA 1N7SB 4M75B 1RY3A 2ZPEB 2Q9IA 1U1SA 2R5MA 1JY3P 1SQPK 4HH2A 2L3RA 3MCAB 3TNUB 4Q5WA 5GMKl 2N1TC 2CPBA 4BUGA 3HKSA 3P8MC 3GNGA 3CCMA 2K3YA 3EFRA 4EMKC 5LJ3g 1GDTA 3GHGC 1HGZA 2P0PA 1CZQA 3S3MA 1J1DB 4IUVA 1NWQA 4C92C 3CMET 2KP8A 2YHTA 2QXFA 3JCMQ 1RE3C 2YKPA 4I6MC 2P0QA 3NMDA 3JRZA 3QJ6A 4KUDK 2OYIA 5KJ7A 4XTUA 3CCJA 1KC8U 3BRVB 3UWNA 1LTGC 3E1SA 1RE3A 1ZBXA 1VQNA 5GAOq 2W27A 1Y7XA 2OTJA 5A0DA 4BI8B 4ME7A 1KILB 4P5NA 2Z5HA 3CXCA 1VUBA 1BI3A 4NL3A 2EIFA 1HGVA 2XKOC 5GANj 2BASA 3OYAA 3CMAT 4BD3A 3U1AA 4OB3B 2LVMA 4C8QD 4E7JA 1VQKT 1G2CB 2RM4A 1HK9A 5FU6C 5FROA 1LWUB 5AW2B 4RCCA 4Y91A 4FL6A 4OB0B 2ZXEB 1YHQT 2L89A 1FZBA 1KD1U 3X25B 2KSSA 3CBOA 3CCLT 5GMKh 1T8ZA 4LD9K 5APYA 1VQOA 3UIAA 4M7AD 5LJ3h 1IFJA 5FRMA 2QQRA 3BDUA 2E65A 3TSIA 2HYNA 3MUDA 3S3OA 4JLIA 1RF0A 2JNGA 3OYEA 2MJZA 2E5QA 2Y4XA 4N4IA 3PMIA 1NH4A 1QL1A 5CIUA 4XU1A 4C0DC 3BRTB 1LJOA 2K3XA 1M1GA 2DO3A 3JB9H 3VN0A 1NOHA 3ME9A 2MWOA 1M1KC 2N1TD 2RHZA 4O9BA 1FWZA 2LT1A 3OYBA 1BKBA 3P8CD 2O1JA 2RH2A 2WWWA 2QEXA 3MP6A 2OTLT 1M90C 1FZCA 4N78E 1KILD 3MD0A 4A4KA 5AW7B 3A8OB 3H32B 1VQ7A 3I5CA 1LT9C 3I55T 1I81A 2GFUA 2HQXA 2QTXA 3EFSA 3L4FA 4WF2A 1RF1A 5CCGD 4FT2A 3CCRA 3BFMA 3VMZA 3MO8A 5I2MA 3ZEHA 4BY6B 1LT9A 3V7CA 1UEBA 2MAMA 1N86A 1N73A 1SP4A 4F7UE 4WY4D 4EMHA 3FDRA 1LT9B 2H43A 1P92A 5CCGC 3CC7A 1QVFA 4LDWA 1N7SC 3RK2D 2VYTA 2E1HA 4DQ2A 3DB4A 4QVDA 4LDYA 1WRGA 1JB0E 3QBYA 3V8JA 5BU8B 2CYZB 1JY3O 2LKMA 2JVVA 5KJ7D 2H7HA 2X35A 2XICA 4CRIA 3RK3B 1XOVA 5FU7C 3I56T 1H3ZA 3OQ5A 1N27A 3M9HA 2KB7P 3WVDB 4XU2A 3M06A 3CCLA 5IAYA 2LNVA 1UGQB 1KZUB 5GAMg 3J81E 3M57A 1S72T 3N4XA 5AVVB 2JN0A 5CJ4A 2OYHC 1QVPA 1LTJA 1VQMA 1N6AA 2DIQA 1KQSA 2EAYA 2R57A 5APVA 4C0FA 3PIOA 1QVGA 3G6ET 2YNYA 4EPCA 4M3LA 2RHIA 3OYYA 2F5KA 5M9OA 2RHUA 2DXCA 1VIEA 1IFDA 2X4XA 4XQ3A 5CCAA 5GAN2 3H8ZA 2HD0A 1YI2T 3QJYA 2PUKB 3HE5B 5CVIA 4GKGA 2R5BA 5GAOm 1T2KC 3G71A 5GANd 3L36A 2PUOB 5AW8B 5APTA 1IO4A 2ZCFB 5GAN5 1GTWA 1MFZA 1JRIA 1B34B 2WT7B 1FOSE 3VJPA 2EQJA 4OH8B 4OP0A 5J39A 1Y71A 2DXUA 1L0LK 3OW2A 2E10A 4XA4A 3ZFJA 2O01E 3JCMc 4EOTA 2LC4A 2LQ8A 1L4AA 1GXIE 2P2UA 3AHUA 3SWYA 1WGSA 2YLCA 4GT1A 4IUUA 1N7SA 1LGHB 2WSEE 2RO0A 4LD6A 3M0DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IAY A;  3DLM A;  3S3M A;  4IUT A;  5KCH A;  2K3X A;  3E9F A;  5J26 A;  1SQQ K;  3P8D A;  4UC4 A;  4A4F A;  2WSE H;  2JTF A;  4IUV A;  4QW2 A;  3NTH A;  4PL6 A;  1L0N K;  2EQM A;  1NTM K;  3OA6 A;  2RHY A;  4IKF A;  3MEW A;  4IUQ A;  3ME9 A;  1OI1 A;  1NU1 K;  1WJR A;  2MWO A;  3OYD A;  1SQX K;  4A4H A;  4IUR A;  2M0O A;  2O4X A;  4E7I A;  2LDM A;  2RHZ A;  3KUF A;  3OMC A;  3QJ6 A;  4PLI A;  3S6W A;  3P8H A;  4QVZ A;  3OYB A;  2O4X B;  1NTZ K;  2FYU K;  2PQW A;  1NTK K;  1WJQ A;  5D6X A;  2HQE A;  2DIQ A;  3LLR A;  3OYH A;  2DAQ A;  3MEA A;  4E7K A;  5KLV K;  2R57 A;  3OYM A;  2MWP A;  3MP6 A;  4IFD K;  4II1 A;  3UWN A;  2NLU A;  3MEV A;  3MEU A;  3F70 A;  2RJC A;  3EAE A;  3LGL A;  4IUP A;  3S3N A;  3OYI A;  2RJF A;  3CLQ A;  2J59 M;  2RHX A;  3OB9 A;  5IN1 A;  1SQV K;  4QQ6 A;  3OS0 A;  3DB3 A;  3OS1 A;  2L8D A;  4ZTJ A;  3PFS A;  3MP8 A;  4C5G A;  2BKD N;  2GFU A;  2HQX A;  3LGF A;  3Q1J A;  4B9W A;  5D6W A;  5KH6 A;  4C5H A;  2RHI A;  3NTK A;  3OYG A;  5D6Y A;  3OYA A;  4A4G A;  2F5K A;  1SSF A;  3ASK A;  3M9Q A;  3BDL A;  5M9O A;  4BD3 A;  3FLG A;  3OMG A;  4BE1 A;  2RHU A;  2E6N A;  2D9T A;  2FHD A;  2BUD A;  2LRQ A;  2GF7 A;  2O01 H;  3MO8 A;  3O8V A;  3LW5 H;  3ZEH A;  2RI3 A;  2CKK A;  2LVM A;  2X4W A;  3NTI A;  3OYF A;  2X4X A;  5KE2 A;  3MET A;  4E7J A;  2BIV A;  4C5E A;  4E7L A;  3OYN A;  3OYL A;  3UT1 A;  3GOX A;  2JZ2 A;  5FRO A;  4BE0 A;  1G5V A;  1XNI A;  3LYI A;  4QQG A;  3FEO A;  3H8Z A;  3PMT A;  2G3R A;  4FL6 A;  4N4H A;  5KCO A;  2R5A A;  4BDZ A;  4ZTF A;  5C0M A;  2M16 A;  2RI5 A;  4EDU A;  3L2Q A;  2L89 A;  2X4Y A;  3FDR A;  4NS5 A;  3OS2 A;  3LX7 A;  1RI0 A;  3LH0 A;  4BAC A;  3OYC A;  3G3Z A;  2M1H A;  3QKJ A;  1SQB K;  4BDY A;  2WSF H;  4RG2 A;  2QQS A;  2EQU A;  2R58 A;  1MHN A;  4GY5 A;  4OVA A;  4B9X A;  3L2R A;  2IG0 A;  3L2V A;  2VYT A;  4C5I A;  2RI2 A;  4X34 A;  3SD4 A;  2DIG A;  2RJE A;  2OAR A;  3DB4 A;  2GFA A;  3H6Z A;  2P0K A;  4QQD A;  2XDP A;  4Z02 A;  3L42 A;  5FRM A;  2EQJ A;  2QQR A;  1WJS A;  2R5M A;  1SQP K;  3QBY A;  5J39 A;  3OYK A;  2L3R A;  2LKM A;  4L59 A;  2WSC H;  5KE3 A;  5C6S A;  4Q5W A;  4E7H A;  1L0L K;  2YRV A;  3MP1 A;  3OY9 A;  2RJD A;  3PNW C;  1OYX A;  2B8A A;  1OZ2 A;  3CEY A;  5FRN A;  2EKO A;  4N4G A;  2X35 A;  3OYJ A;  3FC3 A;  4CRI A;  4BE2 A;  3S3O A;  2K3Y A;  3E9G A;  4FU6 A;  1WGS A;  1OZ3 A;  4PLL A;  3OYE A;  3L2U A;  2WAC A;  3L2W A;  2EQK A;  2LCC A;  1H3Z A;  2E5Q A;  2XK0 A;  4A4E A;  3OQ5 A;  1KHC A;  3QII A;  1N27 A;  3PMI A;  4N4I A;  4IUU A;  4HCZ A;  2RO0 A;  5CIU A;  2EFI A;  4LD6 A;  3C4S A;  2LTO A; 
#chains in the Genus database with same CATH topology
 2NYS A;  2K57 A;  3HSB A;  4M75 C;  3A98 A;  3VUZ A;  4NPD A;  1BCO A;  5DJT B;  4QW2 A;  1HXD A;  1L0L E;  1URQ C;  1ZA2 B;  2RHY A;  3V8K A;  1Q81 C;  1PP9 G;  3GLM A;  3WUU A;  2K79 A;  3LH5 A;  4ZKP A;  2LJ3 A;  1FBM A;  1ZR2 A;  2I8D A;  1KMI Z;  1HJD A;  4QVZ A;  4C7N B;  2A36 A;  1DD3 A;  3PE0 A;  5AVU B;  3LLR A;  1BSN A;  5LJ3 j;  2E76 C;  2GM4 A;  1WYX A;  1GW4 A;  1V29 B;  5K5G B;  1W70 A;  4M75 A;  4C0Z A;  1X2Q A;  1KIL C;  1U7J A;  1N7L A;  3SFM A;  1M1K R;  2RJF A;  3M4G A;  3H9N A;  1KQS S;  1YN8 A;  1H88 A;  2V8J A;  1YJN P;  1KC8 C;  2A45 G;  1VDF A;  3PFS A;  1JBM A;  3I56 Q;  3CCU A;  4DOJ A;  1NYH A;  2YO2 A;  4FW2 A;  2QEX Q;  4H0L C;  5D6Y A;  1C1A A;  1VQ6 Q;  5KAF E;  1PD0 A;  3L70 G;  1Q81 U;  1UHC A;  1S72 P;  5L23 A;  3M54 A;  4U3F G;  2V26 A;  3AEB C;  3HPW A;  3FWN A;  4BY6 C;  2C0X A;  3PHL A;  1TSF A;  1VYU A;  3TF5 A;  1VQ8 P;  4E7H A;  1J1E B;  2RNA A;  3NTI A;  1M8V A;  3CCM P;  3CC7 Q;  4IOI H;  1H0T B;  4ELY C;  5KLV D;  3NPF A;  1Q7Y C;  3CXH H;  4PJ0 E;  2OTJ T;  3I56 P;  3OW2 P;  1BSH A;  4R55 A;  4DA4 A;  3H25 A;  3QWO C;  3K5B A;  1TUG B;  4D8K A;  1SS1 A;  2PP6 A;  4RTZ A;  4M7A A;  2K7A A;  3DLL A;  1YJ9 A;  1W2B O;  4M78 G;  3JCM h;  1NEG A;  1JEK A;  3M59 A;  3CL3 D;  1PP9 D;  2JOY A;  2HAX A;  1SVF A;  3MUD C;  4BI4 A;  2HMA A;  1G3Y A;  1RAE B;  3GBQ A;  4M7A B;  1W2E A;  2KK7 A;  2CS7 A;  1SQX D;  1JU5 C;  2XID A;  3GLX A;  5EC7 A;  1Q82 U;  4PJ0 H;  1BIB A;  4RTT A;  1YJN A;  4L59 A;  1QLE D;  2EYZ A;  5C39 A;  4EMG A;  4D6T J;  3EG3 A;  1UJ0 A;  3CEY A;  3QZ5 B;  1YJ9 T;  1RAD B;  3GHG B;  4J5Y A;  5CCH D;  4M7D D;  1UG1 A;  3MGN A;  2POH A;  3HRU A;  2HL5 C;  1VF5 D;  2FYU E;  3MJX A;  1KG1 A;  2WAC A;  4PJO E;  3A8M B;  2C0T A;  3UF4 A;  3QII A;  4ATO A;  1NAF A;  2KYM A;  1GBR A;  2DTO A;  3RR6 A;  2JS2 A;  3HUS C;  4LUE A;  2YXQ B;  3HP9 A;  1NJI U;  3L72 D;  2KZJ A;  2F1L A;  2KYB A;  4M7A F;  2FYN B;  1GL2 B;  1W2B P;  1SQX K;  2N9B A;  1PNJ A;  2VV5 A;  1LWU C;  1SFC C;  4OGC A;  3G71 T;  3A8G B;  3QPH A;  2CH4 W;  3CD6 A;  3AEG C;  3H1K D;  1VQ4 P;  3EWK A;  3VRY A;  2N1T B;  4OWF A;  3E19 A;  2PRR A;  4F14 A;  1HSQ A;  2KNB B;  1YCY A;  1JY2 O;  1VYV A;  4MDW A;  3I9Q A;  4CC7 A;  4J9E A;  2O9V A;  4EMK A;  1OPL A;  2CUB A;  2OI3 A;  1VQO P;  1LTS C;  3UDC A;  1D7M A;  4C8Q E;  4KH1 B;  3CWB G;  3NFQ A;  3EHQ A;  1D1A A;  1M56 D;  1Y57 A;  1D0Y A;  3TSW A;  2JR8 A;  3MP8 A;  2ZAE B;  4RCB A;  2DXT A;  3RIR A;  2FL7 A;  1VA7 A;  1K73 C;  3DKM A;  4MZM A;  2QAS A;  1YJ9 P;  3SSU A;  4A4G A;  3CCL Q;  3MKD A;  5AVQ B;  4CPG A;  2DX1 A;  2P4R A;  3C12 A;  3CCE P;  2KAF A;  4FSX A;  4M77 G;  2OAU A;  1YJW Q;  4M7D B;  2IVW A;  2OYI C;  1M2V B;  4RTV A;  2J6K A;  2AKL A;  4M7D G;  3BCC E;  1Q86 C;  4RTY A;  4BE0 A;  5GMK j;  2FYN C;  2G3R A;  1X01 A;  3JB9 D;  2LR2 A;  2P4T A;  5GJV B;  2JO1 A;  1N2D C;  3CD6 T;  2Z0W A;  4C0G A;  2ECZ A;  2K88 A;  4NOY A;  2BEZ F;  1U5S A;  1BCC D;  1Y47 A;  4AFU C;  2IYP A;  3QUI A;  1OOT A;  4IIO A;  3LW5 J;  4HB1 A;  1SQB D;  2F5T X;  3L2R A;  3TGU G;  2JS0 A;  3G6E Q;  2B87 A;  3BAS A;  2OTJ P;  1I4K 1;  1ZLM A;  2QM7 A;  1N5Z A;  4HYT B;  1MNE A;  1KYO I;  1SQV J;  1VQL T;  4UB8 H;  4QQD A;  4Z02 A;  3PIP A;  5BU5 A;  1YFN A;  4IL6 E;  3C95 A;  2YDL A;  3OYK A;  2HLO A;  3M0Q A;  1VQ6 T;  2YUO A;  2QQB A;  2JEE A;  3OY9 A;  2WIT A;  4AMC A;  1K9M U;  3AEA C;  3OAK A;  4QMA A;  4EDF A;  4XTZ A;  2G6F X;  2JW4 A;  1KFZ A;  4OGQ D;  2VWF A;  3JCM d;  3EG9 B;  4C8Q A;  4J9C A;  1BGY J;  4WBA A;  1YJN T;  1L4A B;  5GAO p;  4X9C A;  1VQ4 T;  2L0A A;  1VQ5 A;  3CCR P;  1JTH B;  3VYI A;  2RQW A;  3EGX B;  5KCH A;  3KDP B;  3H41 A;  2NUP A;  2QVA A;  3EG9 A;  1G1J A;  4C8Q B;  3BAT A;  3H1J J;  4JPB W;  1N9S A;  3CCQ Q;  1NLP C;  4IKF A;  3A8L B;  2BTT A;  1YIT T;  2KR3 A;  4UB6 E;  2YXY A;  2BCC D;  2O4X A;  3VYG A;  1D1B A;  1A0N B;  2NUP B;  2WPR A;  2HPC A;  1TS9 A;  2HBP A;  1AHJ B;  1HWT C;  2QTV A;  2KNC B;  1FC2 C;  3HRN A;  5GMK e;  1ZME C;  1R0C B;  2E64 A;  3L2Z A;  2A45 H;  4N78 D;  3LGL A;  3UA7 A;  3CXH E;  2HPC B;  3VKI A;  1T3J A;  2MMP A;  3CCU T;  1BCC J;  4PJO F;  2K37 A;  3I55 Q;  1LP1 A;  4LDX A;  1SQV K;  4BXL A;  1OUL A;  2QDL A;  3DB3 A;  4ZGD B;  1L0L G;  2NPS A;  1MMA A;  2HNI A;  3HUS A;  4C5G A;  2OX7 A;  1VL2 A;  1W2B A;  5TIS H;  3MHX A;  1VQ9 Q;  5TIS E;  1MV3 A;  5CCH C;  4M7D C;  1JY2 P;  2WPS A;  2DK3 A;  1L2P A;  1WNL A;  1KFM A;  3CBM A;  2W6A A;  1UGP B;  2JJL A;  1PV3 A;  2KXD A;  4PD4 E;  2H8H A;  4PJO C;  2RQR A;  1AEY A;  1VQP T;  4ZN1 A;  1GL2 C;  3D7S B;  4OGQ B;  4M77 E;  3CME A;  1DX7 A;  1VQ5 P;  4ORZ A;  3RNJ A;  3AE9 C;  3H1J E;  2BIV A;  2FYZ A;  5DJU B;  2FZK B;  1IGU A;  2JZ2 A;  2HZY A;  2Q7C A;  4M75 F;  4BDZ A;  1AZE A;  2K1A A;  2R5A A;  2SEM A;  2M16 A;  5CCH A;  4M7D A;  3PT9 A;  5KAI H;  1T3L A;  4PD4 H;  1M27 C;  4JS4 A;  4DCK A;  3CCS A;  1SQB G;  5CKH A;  1VQ7 P;  2EQU A;  1NYF A;  3P32 A;  3QYG B;  1R0B G;  1IHV A;  1OVU A;  1WQW A;  1BU1 A;  4F16 A;  1WX6 A;  1CSB A;  2YO3 A;  2KBT A;  3NMZ C;  5KLI B;  3U59 A;  1UEC A;  2JTE A;  1I07 A;  3EG1 A;  4OMM A;  5GAN f;  3GF7 A;  1UFF A;  3TQ7 P;  1W4S A;  2HKN A;  2LXB A;  4D6W A;  5CAI A;  4XK8 E;  2CP3 A;  5CO7 A;  4HCB A;  1MV8 A;  1SQP J;  2M0Y A;  5FWC A;  3N5B B;  1UIX A;  3OYJ A;  1JCD A;  3L74 D;  1VQL A;  3LW5 E;  3CC7 T;  4BE2 A;  1FYN A;  4QT7 A;  1H64 1;  2EJF A;  1DJ7 B;  4FU6 A;  4F04 B;  4F7U G;  2YIU B;  4RKU J;  2EQI A;  1U3O A;  4HCC A;  1GRI A;  3VS7 A;  5AW5 B;  3TRE A;  5LJ3 e;  1W2B S;  3KFV A;  3P7K A;  3D6Z A;  3T97 B;  4AUW A;  5CMZ A;  5H2F E;  2W0Z A;  5IT9 E;  3MIW A;  3H0I A;  2X3W D;  1KIL A;  3P8D A;  3HD7 A;  3HTK B;  3TEE A;  1MUU A;  2WSE J;  1VQM Q;  3VV0 A;  1YJ9 Q;  1S5L X;  1DEE G;  1JM0 A;  4IFF A;  2FZC B;  5KJ7 C;  1IJD B;  3L1A A;  1FZF A;  1O9S A;  2M0O A;  3T97 A;  3USS A;  4EI2 A;  3SFE C;  4FM4 B;  4OMO A;  4WY4 B;  4KUL A;  2KOG A;  2DJQ A;  5H2F H;  3A2A A;  1NKN A;  3IAO A;  1PCX A;  1PD1 A;  2L3P A;  4C7R A;  2K9G A;  5HKC A;  1A02 F;  2CK3 H;  1BCC G;  3RK2 B;  2CZ6 B;  1NO4 A;  4IFD K;  4PV1 C;  3CC2 Q;  3L71 D;  2FFD A;  3MEU A;  1OMI A;  1HJB A;  5HK3 A;  1PIX A;  3BE3 A;  2ZPF B;  2OTL A;  1Z9Q A;  1N8R U;  2XKM A;  3GPL A;  4WY4 C;  3OS1 A;  2BKD N;  4C92 D;  2BCC J;  5CHX A;  1T2K D;  1PKS A;  3AE4 C;  2WPQ A;  5CK9 A;  2I1K A;  1RUW A;  1LP1 B;  2WTY A;  4XTW A;  1ZSZ C;  2P7J A;  1MMN A;  1D3B B;  1OX9 A;  1SQQ G;  1ZQ1 A;  3RES A;  2CZ1 B;  3B4S A;  3RK3 D;  3CPW A;  1KV4 A;  2I1J A;  3CPF A;  3X26 B;  3V6I A;  3RKY A;  5A0L A;  1CW5 A;  1N8R Q;  4M4Z A;  3G71 Q;  1RAC B;  3CCR Q;  5LJ3 f;  3O6Q A;  5GAM j;  3URG A;  3CCJ T;  1EC5 A;  2E12 A;  1WI7 A;  4OB2 B;  3LX7 A;  4GBQ A;  3LH0 A;  3RDV A;  2B9B A;  4IIM A;  4OMN A;  1BE3 G;  2WSF H;  2QIW A;  2FZG B;  4CC3 A;  2A08 A;  1DD4 A;  5AW9 B;  5CBO A;  1WHH A;  1LTB C;  1Q86 R;  4O5V A;  2Y4Y A;  2DTI A;  3I56 A;  1Q82 C;  2GTO A;  4B86 A;  2YWW A;  1TH7 A;  1ZW0 A;  1OZH A;  2XHC A;  3H6Z A;  4NPF X;  1VIF A;  1ZHI A;  5AVX B;  3JCM e;  1YYC A;  5ECA A;  4PJN A;  5IHK A;  3L37 A;  1JNM A;  3M5A A;  4DEX A;  4K11 A;  2D8H A;  3CD6 Q;  2QDY B;  2YUP A;  2K3B A;  1LJ2 A;  1SFC D;  1Y96 B;  4C0D B;  3L71 G;  1SKU B;  1ZV8 A;  4W7Z A;  2WSF J;  1RF0 C;  1NHL A;  4L6V 5;  2DER A;  2IBZ G;  2D1X A;  3CCS P;  4HT8 A;  3L73 E;  3X20 B;  3LWI A;  3CC2 A;  3JV3 A;  2COW A;  1DEB A;  2LCL A;  2QQA A;  2E6Z A;  4PLL A;  4M77 C;  3LWH A;  2EQK A;  1YWO A;  3FIF A;  1YTZ I;  4HCZ A;  2RKL A;  1CI6 B;  3OBY A;  4Z1M H;  2DEU A;  1Q7Y Q;  2NUT B;  2D0N A;  1QP3 A;  1OU8 A;  1WHL A;  1VQ6 A;  3KPE A;  2A06 E;  1HH0 A;  2WSE H;  4LDU A;  1K04 A;  2XDB A;  1VQ6 P;  1L0N K;  3A8H B;  1Q95 G;  1BIA A;  2WZ7 A;  1AA0 A;  3HFO A;  3SWN A;  1YJW A;  2HOD B;  1OWA A;  1JO8 A;  1JJ2 S;  1VPC A;  5B5E E;  1SF9 A;  1X75 C;  3B5N C;  3OMC A;  1OQK A;  2O4X B;  1GL2 D;  1IC2 A;  1M90 Q;  2O31 A;  1YJN Q;  4JDS A;  2QJK C;  3OYH A;  3P8C E;  1EFN A;  2FYU D;  3W68 A;  3OJA B;  2C9L Y;  2XU6 A;  1AFO A;  1M9S A;  5KLV K;  3TGU J;  3M0T A;  3CCV A;  4FSS A;  3CPW O;  2ZYA A;  1RHZ B;  3SDZ A;  2P84 A;  1BK2 A;  1VQO Q;  2VGM A;  1GK6 A;  2J59 M;  4AG1 C;  4C92 B;  1MND A;  5DLO A;  1MFT A;  1MKM A;  4J9G A;  4L76 A;  2RMO A;  4QQ6 A;  2AXT H;  3EGD B;  3AE8 C;  3EGU A;  3V7S A;  6AT1 B;  1Y07 A;  5AT1 B;  2ED0 A;  3GHG A;  4RTW A;  1QCO A;  2EYX A;  4HCK A;  2E74 D;  4FYY B;  3VS3 A;  2OYH B;  3L70 D;  1FAV A;  4M78 F;  3OMG A;  3OSS C;  1R77 A;  1NJI R;  2KS1 A;  3QG1 A;  3CCQ T;  3L2W A;  2CKK A;  2X4W A;  4Z89 A;  4C5E A;  2VUB A;  2GNC A;  1XNI A;  4XE5 B;  5B5E H;  1WA7 A;  2E70 A;  3PMT A;  4DT0 A;  4BI3 A;  1OXZ A;  2QI2 A;  3OS2 A;  3GF5 A;  1P84 E;  1M1K U;  1UE9 A;  4KBM B;  1VQ5 Q;  3EFF K;  2KLV A;  2R58 A;  4OVA A;  5LJ5 g;  2DKG A;  8AT1 B;  3CCJ P;  1PPJ E;  2AZV A;  1K0S A;  2IBZ E;  1AVO A;  2DIG A;  3FX0 A;  1IGQ A;  4E2F B;  4JF7 A;  1VQ9 P;  2A37 A;  5LJ5 d;  1KJW A;  2P0K A;  3UAT A;  4XU0 A;  1VQ9 A;  5KLV J;  1HJ0 A;  1U8R A;  1XTD A;  2KYV A;  1JO5 A;  5KYX A;  1AWO A;  1OYX A;  4O6J A;  1OZ2 A;  3ULR B;  5GAM e;  2HFE D;  5GAN h;  1H92 A;  3BCC G;  1O75 A;  2IZ0 A;  3HFN A;  2PVD B;  1FZG A;  4JJB A;  2HKQ B;  2YXR B;  3L35 A;  3RK3 C;  3RL0 g;  1QVG O;  2I0N A;  2QA4 T;  2D2C C;  2DL3 A;  1OW8 A;  5AW1 B;  1JJ2 P;  2ZZD A;  2GCX A;  3C0C A;  3G7Z A;  1EIF A;  1L4A D;  3CXH D;  1T3U A;  1WHK A;  3CCM Q;  3RKX A;  1ZR4 A;  4LLH A;  1AJY A;  2BZX A;  1LTJ C;  3D71 A;  3OYD A;  3EG0 A;  1ZN5 A;  1S72 Q;  4C8Q G;  4PJO B;  2LDM A;  5KLI C;  4D6T E;  4E7Z A;  3Q5S A;  2P58 A;  4I1L A;  3VU3 C;  2ZT9 B;  2FYU K;  1NTK K;  2J6F A;  2CZ0 B;  4F7U A;  2BE7 D;  5D6X A;  2O01 N;  1WXU A;  2RD1 A;  4DOW A;  1FDM A;  3JB9 J;  4PJO A;  4RTX A;  2E75 B;  2RJC A;  2OYI B;  2XDJ A;  2YKO A;  1RE4 C;  4U7J A;  2A28 A;  3L72 J;  4N0A A;  1MGQ A;  1KFN A;  2FKW B;  3SHW A;  4BRY B;  3OS0 A;  4M7A G;  4RJT A;  4UB6 H;  4N3Y B;  2GQV A;  3IQL A;  5LL6 S;  5GTI H;  1K8A R;  1PHT A;  2YUQ A;  3FWL A;  4U3F J;  1BCC E;  2ZGW A;  1H8A A;  3HD7 B;  3HTK A;  3OYG A;  1NZ9 A;  2LJ0 A;  3ASK A;  3N7N A;  1SSF A;  1QVG S;  3H6P A;  4JUV A;  5CKF A;  2E42 A;  2C0W A;  4CC4 B;  3ABV C;  4EYY Q;  2BUD A;  4J8O A;  2GF7 A;  2KSJ A;  3LW5 H;  1RE4 A;  2CSI A;  1NTK D;  2R3S A;  3MET A;  1VF5 B;  1RH5 B;  1S4X A;  4KJM A;  4LC1 A;  5DLQ E;  5IHI A;  1UTI A;  3LYI A;  1VQL Q;  1FJK A;  2K3R A;  1SFC A;  3H1L D;  3HHT B;  2RI5 A;  1YBY A;  3T9N A;  1YI2 Q;  3M0R A;  2W8Z A;  4LDV A;  5EFW B;  1TUD A;  2KRS A;  3M0A A;  4FYX B;  1Q2N A;  1PRM C;  5AVY B;  1IRX A;  1TWB A;  1QCN A;  1QCF A;  1WFW A;  2M1H A;  1K05 A;  4BDY A;  4AT1 B;  4C92 A;  2LQW A;  3CC2 T;  1VQK P;  3CCE Q;  1X8Y A;  3TYY A;  2Y9Z A;  1M4Z A;  3V4W A;  1SQP G;  1UHF A;  4JLG A;  4PJO D;  1B34 A;  2PU9 B;  4E47 A;  2A7Y A;  2RJE A;  4L5G A;  1M1J B;  4MDX A;  1IK7 A;  4H13 C;  2VB6 A;  4M7D F;  1NYG A;  3RL0 D;  3VS4 A;  2JTM A;  5GAN e;  5GAM h;  3NFC A;  1M30 A;  2IPP A;  4GDO A;  3EH1 A;  3QSU A;  1RAH B;  2QA4 A;  2R5D A;  1P84 I;  3J7A F;  2WPV B;  4E7S A;  9ATC B;  4YXW H;  3PNW C;  1QWE A;  2AEJ A;  2D0Q B;  3KXD A;  1MMG A;  3L74 G;  2M9U A;  4TVR A;  4B6M A;  1HTL C;  1D1C A;  2IBZ I;  4HXJ A;  1KQS P;  5KYX B;  1MZ9 A;  3HD7 D;  3JCM g;  1VQ4 Q;  4WB4 A;  1IRE B;  1KHC A;  1K9M Q;  4M75 G;  2DVJ A;  1K73 R;  5GTH H;  4KHX A;  5FLX E;  2X51 A;  1TTH B;  5CQY A;  1PSE A;  4R0K A;  1BBZ A;  2OJ2 A;  3VTP C;  5CKE A;  2JTF A;  2C06 A;  3LID A;  3NTH A;  3PLN A;  3J80 E;  1KYO E;  1NTM K;  4KH0 B;  4M77 B;  2CH4 A;  3M53 A;  5I22 A;  4R56 A;  1VQ8 A;  4OF1 A;  4LGD E;  4C7N A;  3P8B B;  1Y96 A;  3IF4 A;  3HL8 A;  4JYB A;  1L0N J;  3V2R A;  3R2P A;  3M0U A;  1NLO C;  3P8H A;  2PQW A;  3NTN A;  3D70 A;  1WJQ A;  5I2S A;  3ZL7 C;  3CPW S;  2W6B A;  3L75 E;  4RMO A;  4E7K A;  3CX5 E;  1J2J B;  1AVY A;  2L5G B;  1I8F A;  3L71 E;  3A3Y B;  3RL0 C;  3TK1 A;  1T0H A;  3VP8 A;  5E79 E;  4EIK A;  2KIK A;  2H88 C;  1PP9 J;  3JCM W;  1RQU A;  3JSC A;  2DIL A;  4DBQ A;  2XG8 D;  3H1J D;  3OB9 A;  4LE9 A;  3ZDM A;  1VQP A;  1EZV E;  2HQH A;  2ZYG A;  3HE4 A;  2HG5 D;  3LGF A;  2QQ9 A;  2Y0C A;  2D8J A;  5KH6 A;  2E5K A;  2DE0 X;  2CUD A;  2OGU A;  3NXS A;  4PJM A;  2A45 I;  5APX A;  1PC0 A;  2ZPG B;  3CCV T;  5L8R E;  2KVQ G;  4HVU A;  3RMS A;  2JUF A;  1D0X A;  3HE4 B;  3CMA A;  4N6J A;  1H0T A;  3OYF A;  1G5V A;  2KQW A;  5E79 H;  5KE2 A;  2KXC A;  1RF1 B;  5D7U A;  3OYN A;  3OYL A;  1YQ3 C;  2P1J A;  3UT1 A;  5GAN g;  1U7M A;  4J7F A;  1KYO D;  2JT4 A;  5HK0 A;  3H1L G;  2KT1 A;  1NPP A;  1KHI A;  1UUE A;  2V8I A;  4RTU A;  4V2S A;  1TU0 B;  2KZI A;  2DFU A;  2FRY A;  2X4Y A;  3CC4 A;  1B3Q A;  2YRD A;  3CXC P;  2EYQ A;  1YBK A;  4U3F D;  1R8E A;  4N0A C;  3G3Z A;  1K76 A;  1SQB K;  4PKC C;  1ZP0 C;  3H1I E;  5LJ5 e;  4MML A;  2CP2 A;  1NTM J;  2OTL Q;  2Q5U A;  3L2V A;  2Z5I A;  3JCM V;  2AXC A;  2R32 A;  2QGG A;  3RL0 B;  2OAR A;  1NTK J;  2QEX P;  2ABL A;  3PJS K;  3A5Z B;  3EFO A;  2XDP A;  1GL2 A;  1SG5 A;  1ZOY C;  5AVW B;  2ZPH B;  2Y0E A;  1VQ4 A;  2EPD A;  1SRL A;  3JCM f;  1JUN A;  2A3L A;  3PTA A;  4JQ0 D;  1QEX A;  2NUZ A;  3H1I G;  1A02 J;  1XTC C;  3M55 A;  1AV1 A;  5A2Q E;  5FRN A;  2RN8 A;  3L74 E;  4AQR D;  2DEQ A;  1SFC B;  1USD A;  2IYO A;  3E9G A;  5GAO n;  1QKX A;  3WXM B;  3KBG A;  3B5N A;  3QH9 A;  1VF5 C;  2MF2 A;  2DL4 A;  1L4A C;  1YTZ T;  2LTO A;  2R44 A;  2O88 A;  4JJD A;  1T0J A;  1NE8 A;  1S5L E;  3JAM E;  3CQT A;  3Q5R A;  1SHG A;  1YIJ T;  1YHQ A;  1EQ7 A;  4XTY A;  1J1E C;  3HRS A;  4ZGE B;  4KT0 E;  2DZ9 A;  4M7D E;  1BYM A;  4ASW A;  2AHJ B;  3JCM b;  3LIE A;  4A54 A;  1B07 A;  3VMA A;  1YCS B;  2E41 A;  1SQB J;  4WWI A;  1JY2 N;  1NTZ D;  4Y28 E;  2K2V A;  1UB4 A;  4M78 E;  1Y0M A;  1KD1 Q;  2NZ2 A;  2FYK A;  3M0P A;  2VGN A;  1H89 A;  2DJZ A;  2D6F A;  1TXQ A;  1WXT A;  1JB0 J;  3BY7 A;  1BI2 A;  1RAA B;  2M0B A;  3G4S A;  3CWB E;  3FB9 A;  1I1J A;  1RAB B;  3E1R A;  1ZA1 B;  2DVE A;  4VUB A;  1LCK A;  1JJ2 A;  1YWP A;  1U1T A;  2KRO A;  3IFM A;  4C5H A;  2BCC E;  3AE2 C;  1FZE A;  2XND H;  1JQQ A;  2EKH A;  3TCJ A;  3C9I A;  1ABO A;  1YIT P;  3FLG A;  5KYU A;  1FZA A;  4GLK A;  2K2M A;  2IX7 C;  4BE1 A;  1PGO A;  3IR9 A;  4E6R A;  2DRM A;  2F2X A;  4M7A E;  1N73 C;  1WZO A;  1WMK A;  3I35 A;  2B86 A;  4DEY A;  4F7U B;  1URQ A;  2OTK E;  2PVO B;  1G2C A;  1KQ1 A;  3FEO A;  3H1L E;  4RO0 A;  3TSZ A;  4IL6 H;  5AW6 B;  2DL7 A;  2FFD C;  4EDU A;  4ANJ A;  2Y9Y A;  1WHG A;  1IFM A;  1DH3 A;  1EDI A;  3JSV C;  2DL5 A;  4M78 A;  3EQ2 A;  1OU9 A;  2B89 A;  3V5B A;  1BI0 A;  5CQX A;  3V8L A;  1PWT A;  3OYC A;  4WY4 A;  1G8X A;  3H32 A;  2OTL P;  5HY6 A;  4BRY A;  5DY9 A;  2L91 A;  1NTK G;  5IXB A;  4MN4 C;  1VQN P;  3A0B E;  2MIO A;  2O1K A;  4C5I A;  4GIF A;  2OYH A;  5AVT B;  3E2U A;  2RI2 A;  2DM1 A;  4X34 A;  2Q3E A;  4RG8 A;  2KEA A;  2V7Q J;  1N9R A;  3VYH B;  4CI0 C;  2ZYD A;  2XMF A;  2FBW C;  3L42 A;  1GBQ A;  1G3W A;  1Q82 Q;  4J9I A;  3ZBD A;  3BVH A;  4OML A;  1OFC X;  2WSC H;  3TDK A;  3S1K A;  3MP1 A;  3L72 G;  4OMQ A;  1Q90 D;  2YSQ A;  2WT7 A;  3TGU D;  1G1I A;  4FIB A;  2LJ1 A;  3CD6 P;  5GAM f;  3MHV A;  4J9D A;  3RBX A;  2ROL A;  3L2U A;  2ZPB B;  2XK0 A;  5GAO r;  4W7Y A;  2XI9 A;  2ESW A;  1YI2 A;  1Y9B A;  2J06 A;  2WSS H;  4A53 A;  3KYQ A;  1NU1 D;  2E3I A;  1GCQ C;  3CCS T;  2ATC B;  1K8A Q;  4ESR A;  2AK5 A;  5J26 A;  2NPS B;  3JCU H;  2W10 A;  3CCE T;  4PL6 A;  2EQM A;  4H0L B;  3X28 B;  1UII A;  1M3A A;  3OA6 A;  1NG2 A;  1GK4 A;  2K5I A;  3CXH I;  1IFI A;  4A4H A;  4HT9 A;  4IUR A;  2M3B A;  1N7S D;  3JCM X;  4PFZ A;  1NTZ K;  1FJP A;  3CCQ A;  3L70 E;  3MTU E;  1BE3 J;  2J6O A;  2XV5 A;  1M1K Q;  2GA1 A;  2QA4 P;  1WDX A;  4Y92 A;  3L75 D;  1GZL A;  1M8M A;  1W1F A;  3OW2 S;  1Q86 U;  1ZLL A;  2MWP A;  3PP5 A;  2ROT A;  4II1 A;  2RPN A;  5DM7 R;  3AEF C;  3HRT A;  3II6 A;  2YT6 A;  3MEV A;  3CCL P;  1SHF A;  1LTJ B;  2XD0 A;  1QX8 A;  3H1H D;  3C94 A;  2MPX C;  3V2P A;  3WUV A;  2EGE A;  3AE1 C;  5CR2 A;  4ZTJ A;  2E75 D;  1FZC C;  1AWW A;  1JOC A;  1EZZ B;  2YLB A;  2V8K A;  3L73 J;  1FOS F;  2K4Y A;  1PG5 B;  1JMM A;  4M77 A;  5M1B A;  2KK4 A;  4JZ4 A;  2KXP B;  3CX5 I;  1KC8 Q;  1YP5 A;  3BDL A;  4LXC A;  2AXT E;  3FXD A;  2E5T A;  1OEB A;  4J6W A;  1RF1 C;  3EG2 A;  3L74 J;  3V4Q A;  2ZFC A;  1G83 A;  2LRQ A;  1S72 A;  1VQP Q;  1CI6 A;  2KDS A;  4OMF B;  1OVR A;  4QVC A;  4E7L A;  5GAN 3;  3E7K A;  3WUT A;  1V1C A;  2AEF A;  3SWN C;  2CZ7 B;  2KRM A;  4C92 E;  2RK1 A;  3X24 B;  3M0D A;  2E75 C;  4I7Z B;  3VP9 A;  2NPS D;  4OB1 B;  5AYF A;  3H1K E;  4AYC A;  1OW6 A;  2XU8 A;  2CT3 A;  1X27 A;  2OQQ A;  4RES B;  2QQS A;  2O01 J;  1LVK A;  3KXT A;  1MHN A;  1NU1 J;  1L0N D;  4JYC A;  5GAN 7;  3A0B H;  5AW4 B;  5CCG A;  5AW3 B;  1S9K E;  1D0Z A;  1PM3 A;  2V4H A;  3NHN A;  2QM8 A;  2MI6 A;  3O8Z A;  1LPL A;  2NWM A;  4HA8 A;  4Y99 C;  3Q5P A;  1WJS A;  2R3C A;  1AVZ C;  3AEE C;  4YTL A;  1X0T A;  3L75 G;  1E6G A;  3CCV Q;  5KE3 A;  4FYW B;  1FU1 A;  2QJP B;  3SWN B;  3VRZ A;  2WSC E;  2EYW A;  2FY8 A;  1URQ B;  1MV0 B;  2FRW A;  4MZP A;  4PNO A;  2H89 C;  2BZY A;  2Q3I A;  4J6Y A;  4C92 G;  1IK9 A;  1OPK A;  1EXI A;  1EDJ A;  2K5L A;  1N8R C;  1SQV E;  1SQX E;  1BB9 A;  2M3E A;  3C4S A;  1HUC A;  2FPD A;  1XJW B;  3E9F A;  4KUI A;  2DD5 A;  3V2N A;  1NJI C;  4PK4 A;  4TT3 H;  2PVG B;  3RBB B;  1PFI A;  2DZC A;  3MEW A;  4IUQ A;  1WJR A;  3JB9 I;  3TU4 K;  1ZBJ A;  5APU A;  5BVZ A;  4JRI A;  3QO3 A;  3KUF A;  1IHW A;  4IFM A;  1FXX A;  2JM9 A;  3WVE B;  1ZUY A;  2Y90 A;  1UGV A;  1EDL A;  3O6Q B;  1LTI C;  3B5N B;  1KB9 I;  1XTG B;  1VQ7 T;  3H1H G;  3EAE A;  4IUP A;  2EW3 A;  1X69 A;  1NKZ B;  4ZN3 A;  1OVV A;  2MYS A;  1K73 Q;  3M9B A;  5IN1 A;  1AQ5 A;  4NPE A;  1SQP E;  1QL2 A;  1VYT A;  2DTH A;  1FMW A;  2L8D A;  4J9F A;  3AE6 C;  3JB9 F;  3GG2 A;  2FB7 A;  5D6W A;  2QJY C;  2WVR A;  3V2Q A;  2PTK A;  1NGM B;  2PAJ A;  5APQ A;  2IZ1 A;  3M9Q A;  3INZ A;  2PFX A;  1BE3 D;  3AE3 C;  2C9N Y;  4H44 B;  3RGU A;  5AVZ B;  1M57 D;  3RBZ A;  2NRG A;  5APS A;  2O01 H;  3O8V A;  2B88 A;  3CBP A;  3G4S T;  7AT1 B;  3NGP A;  4JS5 A;  4AG2 C;  3FGA D;  1GD2 E;  1FZC B;  2LQK A;  4PJJ A;  3UPU A;  3TNU A;  4XFJ A;  4GLM A;  4J9B A;  5C0M A;  1ZSG A;  2KRN A;  1QQJ A;  1IZN B;  2GQI A;  1Q7Y U;  2ENM A;  1Q86 Q;  2A0F B;  4BB7 A;  3CCJ Q;  4BAC A;  1WXB A;  1SQQ J;  2XDD A;  1LTT C;  1OW7 A;  3VMX A;  3GNF B;  3VOP A;  3RK3 E;  2J5U A;  2RMZ A;  3G4S P;  5FW9 A;  1WQ7 A;  1ZXG A;  2IG0 A;  1NPR A;  5LJ5 f;  2RB6 A;  3QDR B;  1GFC A;  4Y99 B;  1PPJ D;  3RK2 C;  3MPU B;  3SD4 A;  2ZT9 D;  2FYU J;  4F7U F;  3H1H E;  3OSV A;  2DRK A;  1IZ6 A;  2GFA A;  5KYU B;  1CKB A;  2H3E B;  2FEI A;  1M3C A;  1URQ D;  2VVK A;  3FRN A;  1AWX A;  5GMK m;  3CI9 A;  5KKZ B;  5FU7 B;  2LT4 A;  5KYW B;  2RJD A;  1TU3 F;  2RA2 A;  4ELZ C;  2KGT A;  3BW1 A;  1JTH A;  2PGD A;  2EKO A;  3FC3 A;  3H1I D;  1HVV A;  3G9R A;  4L75 A;  1QP2 A;  2E43 A;  3HE5 A;  1K8A C;  2NUT A;  3A1P A;  2KUB A;  2M02 A;  5HCK A;  1JXO A;  1SQX G;  1WLP B;  4I2L C;  4XAX B;  1FX7 A;  2EGC A;  2OYO A;  4FT4 A;  1OV3 A;  3C1L A;  3PVL A;  1K9M C;  4UC4 A;  1H8K A;  4I7Z C;  1N73 B;  3OS5 A;  2EJ9 A;  3QXE B;  2KNC A;  3QZ9 B;  1D3B A;  1OI1 A;  2QG4 A;  3SFD C;  1G2B A;  4J7I A;  3M58 A;  3QDF A;  4JJN K;  2I2L A;  5APW A;  2O2O A;  4PLI A;  3B5N D;  1Z56 A;  4PD4 D;  1U06 A;  1GW3 A;  2DAQ A;  2CGH A;  3MEA A;  2EWN A;  1LTA C;  4PFP A;  3GIB A;  4J6X A;  2E76 D;  2Z4E A;  1AWJ A;  3OBW A;  3S3N A;  3F70 A;  1WPY A;  3EFO B;  1UDL A;  4Y28 J;  2OAW A;  1KB9 H;  3AEC C;  2HCK A;  2KY9 A;  1PPJ G;  1W5C E;  5LJ5 h;  1EX4 A;  3H0H A;  1IFN A;  2Q6Q A;  3D6Y A;  2RF0 A;  1RQV A;  3FXE A;  2PNI A;  3Q1J A;  5AW0 B;  3H1K G;  1BCM A;  5GAN 8;  2JM8 A;  2ZVO B;  5KAF H;  4JRP A;  1KQ2 A;  3I55 A;  2LP5 A;  2E6N A;  1KB9 E;  4MMK A;  2M51 A;  5GAN 6;  2RI3 A;  4DOV A;  1KQF B;  1ZSZ A;  1YIJ A;  1BGY D;  1SEM A;  2VAS A;  2X3X D;  2FXM A;  3PGG A;  1YIT A;  4ZTF A;  1RLP C;  3A0H H;  3L2Q A;  2V1Q A;  2HEQ A;  1R5L A;  2FO0 A;  4HVW A;  2FVU A;  1VQ5 T;  4GY5 A;  2FG0 A;  4M77 D;  1S1N A;  5GTH E;  2CP7 A;  3L71 J;  1KD1 C;  3M91 A;  3QYH B;  2AKK A;  1KB9 D;  1HBW A;  1PSF A;  3BCC J;  1SLQ A;  2VKN A;  4KGV B;  2JJ9 A;  2QSI A;  1LNX A;  3CXC S;  1NTK E;  3G71 P;  1OIP A;  2HOD A;  3F5H A;  4YPC A;  1VQ9 T;  1J1D C;  3SWF A;  2RQV A;  4XTX A;  5GAN 4;  1FE6 A;  3JC2 2;  1M7L A;  5GMK i;  2DXB A;  3H1H J;  4MZT A;  3AT1 B;  5C6S A;  4F17 A;  1YIJ Q;  1X6B A;  2O3J A;  2B8A A;  3CME Q;  4C8Q F;  3L73 D;  4X9D A;  4JJC A;  3EH2 A;  4HJG H;  2NPS C;  1TOV A;  3R6O A;  3KZI H;  1RL2 A;  1OZ3 A;  2P67 A;  5EG2 A;  1UGS B;  3M4Y A;  4C92 F;  2CDT A;  1I5L A;  5J3B A;  2EFI A;  5GAM d;  3QWX X;  2IFN A;  4Z8A A;  2H8P D;  2YRV A;  1QVF S;  3DLM A;  5LJ5 j;  2COZ A;  3EFG A;  4YXD C;  1SRM A;  4ZNX A;  4WCI A;  1X9V A;  5GTI E;  5KLV E;  3CWB D;  1BGY G;  1NU1 K;  3THK A;  3RER A;  3ER0 A;  4GOF A;  1MUZ A;  3TGU E;  3CX5 H;  3CCR T;  2HSE B;  2E76 B;  1S1C X;  2HQE A;  1LWU A;  4HKZ H;  2K9J A;  2MKV A;  1KN7 A;  3VMY A;  1L0N E;  2YMK A;  5FU6 B;  1VQ8 Q;  2NLU A;  2LX9 A;  4R4M A;  1JXM A;  3OYI A;  2HDA A;  1VQK A;  2RHX A;  2XNX A;  3O5Z A;  3R6N A;  5KLV G;  1FS0 E;  3M0S A;  8ATC B;  2BE9 B;  2DPP B;  2GGR A;  3G6E A;  3M56 A;  4B9W A;  4J83 A;  4W80 A;  2FFD B;  2MOX A;  4XU3 A;  2W83 C;  4OGQ C;  1VQL P;  5GAO l;  1JY3 N;  3U23 A;  1GMJ A;  1G3S A;  3A7O A;  5KTB A;  1YJW T;  1NVO A;  1X79 B;  3HUS B;  1M1J A;  1G3T A;  2FHD A;  1VQM T;  1VQN T;  1M3B A;  3V7R A;  1Q81 R;  1PZQ A;  1E5W A;  2J05 A;  1GU5 A;  2IBZ D;  1KTM A;  1KIL E;  1ZRT D;  2N1T A;  5CJ0 A;  4M75 E;  5CKB A;  3VS1 A;  4EMK B;  5CKD A;  2CP6 A;  1V76 A;  2WSF E;  1K8A U;  4PFO A;  4JZ3 A;  5I21 A;  1JCC A;  4XTV A;  4DZO A;  3FJP A;  4NS5 A;  1P84 D;  3GP8 A;  4LN2 A;  3QKJ A;  1M1J C;  1FMV A;  4RG2 A;  3A0H E;  2IIM A;  4PD4 I;  1VQ7 Q;  3U1C A;  1QWF A;  5A0G A;  2HL3 A;  4B9X A;  2DD4 A;  2CPS A;  2VC8 A;  1VOM A;  4PV1 B;  1KC8 R;  2FPF A;  3E1I A;  4JPZ B;  2G3A A;  2RK2 A;  1KQG B;  3JCU E;  2CT4 A;  5AVS B;  2VXF A;  3CWB J;  3SB2 A;  3JB9 G;  1S5L H;  1GU4 A;  2RQU A;  4M75 D;  1BI1 A;  1QW1 A;  1GFD A;  2HR3 A;  2M5A A;  4OGE A;  1M1F A;  1EDK A;  3VUB A;  4PJO G;  3L70 J;  4JRQ A;  1J3T A;  1VQO T;  2QAZ A;  4N4G A;  2SPZ A;  3G4S Q;  1BDC A;  2VXE A;  2QG9 B;  2MCN A;  2KI7 A;  1Q7Y R;  2F2V A;  4M78 C;  4JRK A;  2LCC A;  4A4E A;  1KQS O;  4DBH A;  2GUV A;  3HD7 C;  4JBZ A;  3CCS Q;  2EJG A;  5L8R J;  4C8Q C;  2YIU C;  2VRS A;  4IUT A;  1P84 H;  3CC4 T;  1SQQ K;  4A4F A;  3KQG A;  2CP0 A;  3L72 E;  1EZV D;  2KMT A;  3RKW A;  1EZV G;  3B8E B;  2HBW A;  4NL2 A;  3RMQ A;  5LJ3 d;  1M90 R;  3Q1M A;  2DW3 A;  2J58 A;  2XZR A;  4M78 B;  2QE7 H;  2EYY A;  4E7I A;  2JDI H;  2X4J A;  3I5R A;  3S6W A;  1EZV I;  4HVV A;  2DBK A;  1YHQ Q;  1WT6 A;  1CKA A;  1PGQ A;  2L2P A;  1SQV D;  2HSP A;  1KQL A;  4M7A C;  3QHS A;  3WMM 0;  1NTM D;  5IXF A;  2N9Y B;  4ZGJ B;  3OYM A;  2DBM A;  2K5F A;  1ZUU A;  3CLQ A;  4YTP C;  2GUS A;  1R8O B;  5FWB A;  3REA B;  4D8D A;  2M8R A;  2YMY A;  2LZ6 B;  1UGR B;  3WU2 H;  1AZG B;  3NTK A;  1OX8 A;  2UWJ E;  2QEX T;  4ZKU A;  1LOJ A;  4KGX B;  1M90 U;  2JP3 A;  4M77 F;  3GW6 A;  1QMC A;  1YQ4 C;  3RUX A;  4H13 D;  1S9K D;  4EIJ A;  2D9T A;  2P10 A;  2IFM A;  2YKQ A;  1E6H A;  5KYN A;  2L5Q A;  4RKU E;  2F69 A;  2ZPI B;  2KLU A;  4H44 D;  1KYO H;  3H1J G;  3GOX A;  2DNU A;  1IFP A;  1L0L D;  1HD3 A;  2BCC G;  1NJI Q;  4QQG A;  5IH2 A;  4HKE A;  1SQX J;  2C0I A;  4N4H A;  5KCO A;  2FYU G;  3CCE A;  4FW1 A;  3OA7 A;  2H3J A;  3JCM P;  4D6T D;  3G6E P;  5AVR B;  1RI0 A;  3A5T A;  3CC2 P;  3TVT A;  3OW2 O;  1XQH A;  4H0L D;  4OVN F;  2AIR B;  3CCM T;  1M5Q 1;  1I0C A;  2AT1 B;  2FPE A;  3JCM J;  1VQ8 T;  4M78 D;  1M8O B;  1L0N G;  4C46 A;  3AE5 C;  5TJH A;  1GL5 A;  1X6O A;  1N7S B;  1PP9 E;  4M75 B;  3CCV P;  1NTZ J;  1RY3 A;  3F89 A;  2ZPE B;  1SSH A;  2Q9I A;  1K9A A;  1U1S A;  4CC2 A;  3AED C;  2R5M A;  1JY3 P;  1SQP K;  4HH2 A;  1VQM P;  2ED1 A;  4K35 A;  2L3R A;  3G1J A;  3MCA B;  2KT8 A;  3TNU B;  4Q5W A;  1YJW P;  5GMK l;  1NM7 A;  2MK5 A;  2N1T C;  2ZAE A;  5KAI E;  2CPB A;  4BUG A;  3HKS A;  3P8M C;  3GNG A;  3CCM A;  1H3H A;  2M5A B;  3H1K J;  3HTR A;  2K3Y A;  2GTJ A;  3EFR A;  4EMK C;  4ASV A;  4A63 B;  5LJ3 g;  1GDT A;  2DET A;  3GHG C;  3S9O A;  1M2V A;  1RAF B;  1HGZ A;  2P0P A;  1CZQ A;  1KSW A;  4H13 B;  3S3M A;  3UA6 A;  1USE A;  4U3F E;  1J1D B;  4IUV A;  1VQP P;  1NWQ A;  4C92 C;  3CME T;  2KP8 A;  4R4L A;  1K1Z A;  2QXF A;  2YHT A;  1RE3 C;  2YKP A;  4I6M C;  3JCM Q;  1AQT A;  2WQY C;  2P0Q A;  3NMD A;  3JRZ A;  3QJ6 A;  1S3J A;  1U57 A;  2OYI A;  4X1V A;  4KUD K;  5KJ7 A;  4XTU A;  2X9H A;  1NTM G;  3CCJ A;  1KC8 U;  3WU2 E;  1B7T A;  1X43 A;  4AFZ C;  3CCU P;  2K9J B;  3MZW B;  3BRV B;  1RAG B;  3UWN A;  1PL5 A;  2ZVN B;  3BCC D;  1LTG C;  3E1S A;  2QYZ A;  1RE3 A;  1ZBX A;  1ZX6 A;  1VQN A;  4AFS C;  5GAO q;  2W27 A;  1Y7X A;  2OTJ A;  4BI8 B;  5A0D A;  4ME7 A;  1SQP D;  1KIL B;  4P5N A;  2DA9 A;  2Z5H A;  3CXC A;  1E79 H;  5KYW A;  1VUB A;  3PH0 A;  3Q2Y A;  1BI3 A;  5IHN A;  4NL3 A;  2DYI A;  1HGV A;  2EIF A;  2XKO C;  3R4Y A;  5GAN j;  4KT0 J;  2BAS A;  3OYA A;  2KE9 A;  3CMA T;  1YNZ A;  4BD3 A;  2DYB A;  3U1A A;  4OB3 B;  1ABQ A;  2A06 G;  3KZI E;  2LVM A;  4C8Q D;  4IL6 X;  4E7J A;  1VQK T;  1BGY E;  1G2C B;  2RM4 A;  1WHJ A;  1HK9 A;  3AE7 C;  3EGX A;  5FU6 C;  5FRO A;  1LWU B;  5AW2 B;  4RCC A;  4Y91 A;  4FL6 A;  4OB0 B;  2GBQ A;  2QGF B;  2ITA A;  2KS1 B;  3I55 P;  1IO6 A;  2ZXE B;  1YHQ T;  2L89 A;  3S4R A;  1FZB A;  1KD1 U;  1N8R R;  1NU1 G;  3X25 B;  2JXB A;  2KSS A;  3CBO A;  3CCL T;  5GMK h;  1T8Z A;  4LD9 K;  5APY A;  1VQO A;  3UIA A;  2BEQ D;  4UB8 E;  4M7A D;  2D2C B;  5LJ3 h;  2SRC A;  1NEB A;  2E74 C;  1IFJ A;  2F2W A;  2E5Y A;  3L75 J;  3B71 A;  4QKU A;  4GOE A;  5FRM A;  1L0L J;  2QQR A;  3PRJ A;  3CCQ P;  1QLY A;  3BDU A;  2E65 A;  1SPK A;  3VS0 A;  1SQQ D;  1BE3 E;  1S2E A;  3TSI A;  2HYN A;  4TLF A;  3MUD A;  4BWN A;  3S3O A;  1E7O A;  4JLI A;  4DBF A;  3W67 A;  1RF0 A;  1NTZ E;  1MMD A;  2JNG A;  2MJZ A;  3OYE A;  2CRE A;  2E5Q A;  2Y4X A;  4N4I A;  3REB B;  3PMI A;  1NH4 A;  1QL1 A;  2EBP A;  1GCP A;  5CIU A;  4XU1 A;  4C0D C;  3BRT B;  2LX7 A;  1LJO A;  4ZMD A;  2JKV A;  2K3X A;  1M1G A;  4WTO B;  2DO3 A;  3JB9 H;  1SQQ E;  1UJY A;  3VN0 A;  1NOH A;  3KHU A;  5KYY B;  3ME9 A;  4LUD A;  1ZUK A;  2MWO A;  3QWY A;  1M1K C;  2N1T D;  2RHZ A;  4O9B A;  1FWZ A;  1RLQ C;  2LT1 A;  2LCS A;  3OYB A;  2OTJ Q;  1Q81 Q;  1BKB A;  1EXJ A;  3P8C D;  2KI7 B;  1TUC A;  2O1J A;  2RH2 A;  2WWW A;  2IPO B;  2QEX A;  3MP6 A;  2OTL T;  2D2C D;  1M90 C;  1FZC A;  4N78 E;  3VS6 A;  2K6D A;  1KIL D;  1ZRT E;  4OMP A;  3MD0 A;  4A4K A;  2LNH B;  3Q3D A;  2V7Q H;  5AW7 B;  3A8O B;  3H32 B;  1VQ7 A;  2JWA A;  5GJW B;  3I5C A;  1LT9 C;  3I55 T;  1I81 A;  4KGZ B;  1HF9 A;  2GFU A;  2HQX A;  2QTX A;  3EFS A;  3L4F A;  2EVR A;  4WF2 A;  2QRX A;  3GF3 A;  1RF1 A;  2RQT A;  5CCG D;  2V1R A;  4FT2 A;  3CCR A;  1I5O B;  3BFM A;  2JMC A;  3PVQ A;  1HYO A;  2B87 B;  2K9Y A;  2J7I A;  1FDI A;  1WHM A;  3CC4 Q;  3VMZ A;  4DBR A;  1LT1 A;  3MO8 A;  5I2M A;  3ZEH A;  4L74 A;  3CMA P;  5B66 E;  4BY6 B;  3CCU Q;  1LT9 A;  2ZJS E;  3V7C A;  1K4U S;  1UEB A;  3L73 G;  2L3Q A;  2MAM A;  1N86 A;  2AZS A;  1IXD A;  1QVG P;  3FJ5 A;  1N73 A;  1SP4 A;  4F7U E;  4WY4 D;  3I5S A;  2W6J H;  4EMH A;  3FDR A;  1IB8 A;  1LT9 B;  2H43 A;  1P92 A;  3GMA A;  5CCG C;  2DLP A;  4LDW A;  3CC7 A;  1FDO A;  1QVF A;  1N7S C;  1AT1 B;  3CX5 D;  1R5S A;  1K9M R;  2QJY B;  1K0X A;  3RK2 D;  1DIP A;  2VYT A;  2ZT9 C;  2E1H A;  4AFQ C;  1X2K A;  4L73 A;  4DQ2 A;  3PTZ A;  3DB4 A;  2PZ1 A;  4QVD A;  2QJK B;  4PV1 D;  4D6T G;  1T3S A;  3VS2 A;  1QGK B;  4LDY A;  1WRG A;  2FXO A;  1JB0 E;  3QBY A;  3V8J A;  5BU8 B;  2CYZ B;  2LMJ A;  1JY3 O;  2LKM A;  3CME P;  2WSC J;  2JVV A;  5KJ7 D;  1YIJ P;  1KIK A;  2H7H A;  1CSK A;  1SQB E;  4FYV B;  1C6V X;  2QK0 A;  2X35 A;  2XIC A;  2EGA A;  4CRI A;  3RK3 B;  1K73 U;  1XOV A;  1PGJ A;  2QA4 Q;  5KKZ C;  4KRT A;  5FU7 C;  3I56 T;  1Y8A A;  1H3Z A;  3SEM A;  2JMA A;  1JMB A;  3OQ5 A;  1M2O A;  2KB7 P;  3M9H A;  1N27 A;  3WVD B;  1NU1 E;  4XU2 A;  3M06 A;  3CCL A;  5IAY A;  2LNV A;  1AD5 A;  1UGQ B;  2DF6 A;  1KZU B;  3C8V A;  3H0F A;  5GAM g;  3J81 E;  2W90 A;  3CPW P;  3M57 A;  3MP7 B;  4WVZ A;  4FCY A;  1GCQ A;  1W6X A;  1F1B B;  1NAY A;  1S72 T;  3N4X A;  1Q82 R;  1JEG A;  4K3A A;  5AVV B;  4DJG A;  2JN0 A;  5CJ4 A;  2OYH C;  1QVP A;  1KOR A;  1RI9 A;  1LTJ A;  2DL8 A;  4LNP A;  1VQM A;  1N6A A;  2DIQ A;  1KQS A;  1LNQ A;  4J9H A;  4A7P A;  1Z9Z A;  4H44 C;  2EAY A;  2YRC A;  1ZSZ B;  2R57 A;  5APV A;  2LXC B;  1KK7 A;  4C0F A;  3PIO A;  1PKT A;  1QVG A;  2AEM A;  2CSQ A;  2COY A;  3G6E T;  2RH0 A;  1PRL C;  1KD1 R;  2YNY A;  4EPC A;  2WMM A;  2CP5 A;  3CC7 P;  1QVF P;  4M3L A;  2RHI A;  3OYY A;  1NBE B;  4GOD A;  2F5K A;  1NTM E;  5M9O A;  1ARK A;  4RUG A;  2E4H A;  3H1I J;  1QVF O;  5KYY A;  1VQN Q;  2RHU A;  3ITK A;  2DXC A;  1VIE A;  1IFD A;  1PGP A;  2X4X A;  4XQ3 A;  2C0O A;  5CCA A;  1T6A A;  5GAN 2;  1QKW A;  3H8Z A;  4ZNC A;  2HD0 A;  5I11 A;  1BDD A;  1NTZ G;  3QJY A;  1YI2 T;  1YHQ P;  1D09 B;  3SWK A;  2PUK B;  2Q1K A;  3HE5 B;  2BZ8 A;  2Y0D A;  5CVI A;  2A06 D;  4GKG A;  2R5B A;  5GAO m;  1T2K C;  2QJP C;  3G71 A;  5GAN d;  2LQN A;  3IN6 A;  3L36 A;  2G8Y A;  2O9S A;  2PUO B;  5AW8 B;  5APT A;  1AOJ A;  1YIT Q;  1IO4 A;  2ZCF B;  5GAN 5;  2RN0 A;  2ZXX A;  1GTW A;  3VS5 A;  1OX3 A;  5B66 H;  2JWD A;  1MFZ A;  1JRI A;  2IDB A;  1B34 B;  2WT7 B;  1FOS E;  3VJP A;  1X22 A;  4PJL A;  4Z88 A;  2EQJ A;  1WIE A;  4OH8 B;  1RAI B;  4OP0 A;  1TG0 A;  2E3H A;  5J39 A;  3CMA Q;  1ACM B;  1Y71 A;  2L3S A;  2DXU A;  1SQV G;  5CBN A;  1L0L K;  2YUN A;  3CC4 P;  3EGD A;  2E74 B;  3OW2 A;  1X6G A;  2E10 A;  4XA4 A;  2KSE A;  3ZFJ A;  1VQK Q;  2O01 E;  3JCM c;  4EOT A;  2LC4 A;  2DMO A;  2LQ8 A;  1L4A A;  1GXI E;  2P2U A;  3EHR A;  3AHU A;  3SWY A;  1WGS A;  1YI2 P;  2YLC A;  1C0M A;  4GT1 A;  1N7S A;  2FXP A;  1LGH B;  4IUU A;  2WSE E;  2RO0 A;  1FMK A;  3H1L J;  4LD6 A;  3M0D C; 
#chains in the Genus database with same CATH homology
 2K57 A;  3HSB A;  4M75 C;  3VUZ A;  4QW2 A;  1HXD A;  1URQ C;  2RHY A;  3V8K A;  1Q81 C;  4ZKP A;  1FBM A;  1ZR2 A;  4QVZ A;  4C7N B;  5AVU B;  3LLR A;  5LJ3 j;  2GM4 A;  1GW4 A;  1V29 B;  4C0Z A;  4M75 A;  1KIL C;  1N7L A;  3SFM A;  2RJF A;  3M4G A;  1KQS S;  2V8J A;  1H88 A;  1KC8 C;  2A45 G;  1VDF A;  3PFS A;  1JBM A;  3CCU A;  4DOJ A;  2YO2 A;  5D6Y A;  1Q81 U;  3M54 A;  3HPW A;  4BY6 C;  2C0X A;  4E7H A;  1J1E B;  3NTI A;  1M8V A;  4ELY C;  1Q7Y C;  2OTJ T;  4R55 A;  4DA4 A;  2PP6 A;  4M7A A;  3DLL A;  1YJ9 A;  4M78 G;  3JCM h;  3M59 A;  3CL3 D;  2JOY A;  2HAX A;  1SVF A;  4BI4 A;  1G3Y A;  4M7A B;  1W2E A;  2CS7 A;  2XID A;  3GLX A;  1Q82 U;  1BIB A;  1YJN A;  4L59 A;  4EMG A;  3CEY A;  3QZ5 B;  1YJ9 T;  3GHG B;  4J5Y A;  5CCH D;  4M7D D;  3MGN A;  2POH A;  3HRU A;  1KG1 A;  2WAC A;  4PJO E;  3A8M B;  3QII A;  4ATO A;  1NAF A;  2DTO A;  3HUS C;  3HP9 A;  1NJI U;  4M7A F;  1GL2 B;  1SQX K;  2N9B A;  2VV5 A;  1LWU C;  1SFC C;  4OGC A;  3G71 T;  3A8G B;  3QPH A;  3CD6 A;  2N1T B;  3E19 A;  1YCY A;  1JY2 O;  4MDW A;  4EMK A;  1LTS C;  3UDC A;  4C8Q E;  3NFQ A;  3MP8 A;  4RCB A;  2DXT A;  3RIR A;  2FL7 A;  1K73 C;  3DKM A;  4MZM A;  4A4G A;  5AVQ B;  3C12 A;  2KAF A;  4FSX A;  4M77 G;  2OAU A;  4M7D B;  2IVW A;  2OYI C;  4M7D G;  1Q86 C;  4BE0 A;  5GMK j;  2G3R A;  1X01 A;  3JB9 D;  2P4T A;  1N2D C;  3CD6 T;  4C0G A;  4NOY A;  3QUI A;  2F5T X;  3L2R A;  3BAS A;  1I4K 1;  2QM7 A;  4HYT B;  1VQL T;  4QQD A;  4Z02 A;  3PIP A;  5BU5 A;  3C95 A;  3OYK A;  2HLO A;  1VQ6 T;  2QQB A;  2JEE A;  3OY9 A;  2WIT A;  1K9M U;  3OAK A;  4XTZ A;  3JCM d;  4C8Q A;  4WBA A;  1YJN T;  1L4A B;  5GAO p;  4X9C A;  1VQ4 T;  1VQ5 A;  1JTH B;  3VYI A;  5KCH A;  3KDP B;  4C8Q B;  1G1J A;  3BAT A;  1N9S A;  4IKF A;  3A8L B;  1YIT T;  3VYG A;  2O4X A;  2WPR A;  2HPC A;  2HBP A;  1AHJ B;  1HWT C;  3HRN A;  5GMK e;  2E64 A;  3L2Z A;  2A45 H;  4N78 D;  3LGL A;  2HPC B;  3VKI A;  1T3J A;  2MMP A;  3CCU T;  4PJO F;  4LDX A;  1SQV K;  3DB3 A;  4ZGD B;  2NPS A;  2HNI A;  3HUS A;  4C5G A;  1W2B A;  3MHX A;  5CCH C;  4M7D C;  1JY2 P;  2WPS A;  2DK3 A;  1WNL A;  1KFM A;  3CBM A;  2W6A A;  1UGP B;  2JJL A;  4PJO C;  1VQP T;  4ZN1 A;  1GL2 C;  4M77 E;  3CME A;  1DX7 A;  2BIV A;  2FYZ A;  2JZ2 A;  2Q7C A;  4M75 F;  4BDZ A;  2R5A A;  2M16 A;  5CCH A;  4M7D A;  3PT9 A;  4JS4 A;  3CCS A;  5CKH A;  2EQU A;  3QYG B;  3P32 A;  1WQW A;  1CSB A;  2YO3 A;  3U59 A;  5GAN f;  1W4S A;  4D6W A;  5CAI A;  4XK8 E;  4HCB A;  5CO7 A;  1MV8 A;  3N5B B;  3OYJ A;  1JCD A;  1VQL A;  3LW5 E;  3CC7 T;  4BE2 A;  1H64 1;  2EJF A;  1DJ7 B;  4FU6 A;  4F7U G;  4HCC A;  5AW5 B;  3TRE A;  5LJ3 e;  1W2B S;  3P7K A;  4AUW A;  5CMZ A;  5IT9 E;  3MIW A;  1KIL A;  3P8D A;  3HD7 A;  3HTK B;  3TEE A;  1MUU A;  3VV0 A;  4IFF A;  5KJ7 C;  1IJD B;  3L1A A;  1FZF A;  1O9S A;  2M0O A;  3T97 A;  4FM4 B;  4WY4 B;  4KUL A;  2KOG A;  3A2A A;  1NKN A;  4C7R A;  5HKC A;  1A02 F;  3RK2 B;  2CZ6 B;  1NO4 A;  4IFD K;  2FFD A;  3MEU A;  1HJB A;  5HK3 A;  2ZPF B;  2OTL A;  1N8R U;  2XKM A;  3GPL A;  4WY4 C;  3OS1 A;  2BKD N;  4C92 D;  5CHX A;  1T2K D;  2WPQ A;  5CK9 A;  2I1K A;  2WTY A;  4XTW A;  2P7J A;  1D3B B;  1ZQ1 A;  3RES A;  2CZ1 B;  3RK3 D;  3CPW A;  2I1J A;  3CPF A;  3X26 B;  5A0L A;  3RKY A;  1CW5 A;  5LJ3 f;  5GAM j;  3URG A;  3CCJ T;  2E12 A;  4OB2 B;  3LX7 A;  3LH0 A;  2WSF H;  5AW9 B;  1LTB C;  4O5V A;  2Y4Y A;  2DTI A;  3I56 A;  1Q82 C;  4B86 A;  1TH7 A;  2XHC A;  3H6Z A;  1VIF A;  1ZHI A;  5AVX B;  3JCM e;  1YYC A;  3L37 A;  1JNM A;  3M5A A;  2QDY B;  1SFC D;  1Y96 B;  4C0D B;  1ZV8 A;  4W7Z A;  4L6V 5;  1RF0 C;  1NHL A;  4HT8 A;  3X20 B;  3LWI A;  3CC2 A;  1DEB A;  2LCL A;  2QQA A;  2E6Z A;  4PLL A;  4M77 C;  3LWH A;  2EQK A;  3FIF A;  1YTZ I;  4HCZ A;  1CI6 B;  3OBY A;  1QP3 A;  1VQ6 A;  3KPE A;  1HH0 A;  2WSE H;  4LDU A;  2XDB A;  1L0N K;  3A8H B;  1BIA A;  2WZ7 A;  3HFO A;  3SWN A;  1YJW A;  2HOD B;  1OWA A;  1JJ2 S;  1VPC A;  1X75 C;  3B5N C;  3OMC A;  2O4X B;  1GL2 D;  1IC2 A;  4JDS A;  3OYH A;  3P8C E;  3OJA B;  2C9L Y;  2XU6 A;  1AFO A;  1M9S A;  5KLV K;  3CCV A;  3SDZ A;  2VGM A;  1GK6 A;  2J59 M;  5DLO A;  4C92 B;  4QQ6 A;  3V7S A;  1Y07 A;  3GHG A;  2OYH B;  1FAV A;  4M78 F;  3OMG A;  3OSS C;  3QG1 A;  3CCQ T;  3L2W A;  2CKK A;  2X4W A;  4C5E A;  2VUB A;  1XNI A;  4XE5 B;  2E70 A;  3PMT A;  4BI3 A;  1OXZ A;  2QI2 A;  3OS2 A;  3GF5 A;  1M1K U;  4KBM B;  2KLV A;  2R58 A;  4OVA A;  5LJ5 g;  2DKG A;  2DIG A;  4JF7 A;  5LJ5 d;  2P0K A;  4XU0 A;  1VQ9 A;  1U8R A;  1XTD A;  2KYV A;  1JO5 A;  1OYX A;  4O6J A;  1OZ2 A;  5GAM e;  2HFE D;  5GAN h;  1O75 A;  3HFN A;  2PVD B;  1FZG A;  3L35 A;  2QA4 T;  3RK3 C;  5AW1 B;  2ZZD A;  2GCX A;  3G7Z A;  1EIF A;  1L4A D;  1T3U A;  3RKX A;  1ZR4 A;  4LLH A;  1LTJ C;  3OYD A;  1ZN5 A;  4C8Q G;  4PJO B;  2LDM A;  4I1L A;  3VU3 C;  2FYU K;  1NTK K;  2CZ0 B;  4F7U A;  5D6X A;  2RD1 A;  4DOW A;  1FDM A;  3JB9 J;  4PJO A;  2RJC A;  2OYI B;  2XDJ A;  2YKO A;  1RE4 C;  4N0A A;  1MGQ A;  1KFN A;  2FKW B;  3OS0 A;  4M7A G;  4N3Y B;  2GQV A;  5LL6 S;  2ZGW A;  1H8A A;  3HD7 B;  3HTK A;  3OYG A;  1NZ9 A;  3ASK A;  3N7N A;  1SSF A;  1QVG S;  3H6P A;  4JUV A;  5CKF A;  2E42 A;  2C0W A;  2BUD A;  4J8O A;  2GF7 A;  2KSJ A;  3LW5 H;  1RE4 A;  3MET A;  4LC1 A;  5DLQ E;  3LYI A;  1FJK A;  1SFC A;  3HHT B;  2RI5 A;  1YBY A;  3T9N A;  4LDV A;  3M0A A;  5AVY B;  2M1H A;  4BDY A;  4C92 A;  3CC2 T;  1X8Y A;  3TYY A;  1M4Z A;  3V4W A;  4JLG A;  4PJO D;  1B34 A;  2PU9 B;  4E47 A;  2A7Y A;  2RJE A;  4L5G A;  1M1J B;  4MDX A;  4M7D F;  3RL0 D;  2JTM A;  5GAN e;  5GAM h;  3NFC A;  2IPP A;  3QSU A;  2QA4 A;  2R5D A;  3J7A F;  3PNW C;  2D0Q B;  2M9U A;  4TVR A;  1HTL C;  1MZ9 A;  3HD7 D;  3JCM g;  4WB4 A;  1IRE B;  1KHC A;  4M75 G;  4KHX A;  5FLX E;  5CQY A;  1PSE A;  5CKE A;  3VTP C;  2C06 A;  2JTF A;  3LID A;  3NTH A;  3J80 E;  1NTM K;  4M77 B;  3M53 A;  4R56 A;  1VQ8 A;  4OF1 A;  4LGD E;  4C7N A;  3P8B B;  1Y96 A;  3HL8 A;  4JYB A;  3V2R A;  3R2P A;  3P8H A;  2PQW A;  3NTN A;  1WJQ A;  5I2S A;  3CPW S;  2W6B A;  4RMO A;  4E7K A;  1J2J B;  2L5G B;  1I8F A;  3A3Y B;  3RL0 C;  3TK1 A;  3VP8 A;  3JCM W;  3JSC A;  2XG8 D;  3OB9 A;  1VQP A;  3HE4 A;  2HG5 D;  3LGF A;  2QQ9 A;  5KH6 A;  3NXS A;  2A45 I;  5APX A;  2ZPG B;  3CCV T;  5L8R E;  2KVQ G;  3RMS A;  2JUF A;  3HE4 B;  3CMA A;  4N6J A;  3OYF A;  1G5V A;  2KQW A;  5KE2 A;  1RF1 B;  3OYN A;  3OYL A;  2P1J A;  3UT1 A;  5GAN g;  4J7F A;  5HK0 A;  1NPP A;  1KHI A;  2V8I A;  4V2S A;  2X4Y A;  3CC4 A;  2EYQ A;  4N0A C;  3G3Z A;  1SQB K;  4PKC C;  5LJ5 e;  4MML A;  2Q5U A;  3L2V A;  2Z5I A;  3JCM V;  2R32 A;  3RL0 B;  2OAR A;  3A5Z B;  2XDP A;  1GL2 A;  5AVW B;  2ZPH B;  1VQ4 A;  3JCM f;  1JUN A;  2A3L A;  3PTA A;  1A02 J;  1XTC C;  3M55 A;  5A2Q E;  5FRN A;  4AQR D;  2DEQ A;  1SFC B;  3E9G A;  5GAO n;  3WXM B;  3KBG A;  3B5N A;  2MF2 A;  1L4A C;  1YTZ T;  2LTO A;  1NE8 A;  3JAM E;  1YIJ T;  1YHQ A;  1EQ7 A;  4XTY A;  1J1E C;  3HRS A;  4ZGE B;  4KT0 E;  2DZ9 A;  4M7D E;  1BYM A;  2AHJ B;  3JCM b;  3LIE A;  4A54 A;  2E41 A;  1JY2 N;  4Y28 E;  2K2V A;  1UB4 A;  4M78 E;  2FYK A;  2D6F A;  2VGN A;  1H89 A;  2DJZ A;  3BY7 A;  1BI2 A;  3G4S A;  3FB9 A;  2DVE A;  4VUB A;  1JJ2 A;  1U1T A;  3IFM A;  4C5H A;  1FZE A;  3TCJ A;  3C9I A;  3FLG A;  1FZA A;  4GLK A;  2IX7 C;  4BE1 A;  3IR9 A;  4M7A E;  1N73 C;  4F7U B;  1URQ A;  2PVO B;  1G2C A;  1KQ1 A;  3FEO A;  5AW6 B;  4EDU A;  2FFD C;  1IFM A;  1DH3 A;  4M78 A;  3EQ2 A;  5CQX A;  3V5B A;  3OYC A;  1BI0 A;  3V8L A;  4WY4 A;  3H32 A;  5HY6 A;  5DY9 A;  2O1K A;  4C5I A;  4GIF A;  2OYH A;  5AVT B;  2RI2 A;  4X34 A;  4RG8 A;  1N9R A;  3VYH B;  4CI0 C;  3L42 A;  1G3W A;  3ZBD A;  3BVH A;  2WSC H;  3MP1 A;  2WT7 A;  1G1I A;  4FIB A;  5GAM f;  3L2U A;  2ZPB B;  2XK0 A;  5GAO r;  4W7Y A;  2XI9 A;  1YI2 A;  4A53 A;  3KYQ A;  3CCS T;  5J26 A;  2NPS B;  3CCE T;  4PL6 A;  2EQM A;  3X28 B;  3OA6 A;  1GK4 A;  2K5I A;  1IFI A;  4A4H A;  4HT9 A;  4IUR A;  2M3B A;  1N7S D;  3JCM X;  1NTZ K;  1FJP A;  3CCQ A;  3MTU E;  2XV5 A;  1GZL A;  3OW2 S;  1Q86 U;  1ZLL A;  2MWP A;  3PP5 A;  4II1 A;  5DM7 R;  3MEV A;  3HRT A;  3II6 A;  1LTJ B;  2XD0 A;  3C94 A;  3V2P A;  5CR2 A;  4ZTJ A;  1FZC C;  1JOC A;  2YLB A;  2V8K A;  1FOS F;  2K4Y A;  1JMM A;  4M77 A;  2KK4 A;  3BDL A;  4J6W A;  1RF1 C;  3V4Q A;  2ZFC A;  1S72 A;  2LRQ A;  1CI6 A;  2KDS A;  4OMF B;  4QVC A;  4E7L A;  5GAN 3;  3SWN C;  2CZ7 B;  4C92 E;  2RK1 A;  3X24 B;  3M0D A;  3VP9 A;  2NPS D;  4OB1 B;  5AYF A;  2XU8 A;  4AYC A;  2QQS A;  4RES B;  3KXT A;  1MHN A;  4JYC A;  5GAN 7;  5AW4 B;  5CCG A;  5AW3 B;  1S9K E;  2QM8 A;  2MI6 A;  3O8Z A;  4HA8 A;  4Y99 C;  1WJS A;  2R3C A;  4YTL A;  5KE3 A;  1FU1 A;  3SWN B;  2WSC E;  1URQ B;  4MZP A;  4PNO A;  2Q3I A;  4J6Y A;  4C92 G;  1IK9 A;  2K5L A;  1N8R C;  3C4S A;  1HUC A;  3E9F A;  4KUI A;  2DD5 A;  3V2N A;  1NJI C;  2PVG B;  1PFI A;  2DZC A;  3MEW A;  4IUQ A;  1WJR A;  3JB9 I;  3TU4 K;  5APU A;  5BVZ A;  4JRI A;  3QO3 A;  3KUF A;  4IFM A;  1FXX A;  3WVE B;  2Y90 A;  1LTI C;  3B5N B;  1XTG B;  1VQ7 T;  3EAE A;  4IUP A;  1NKZ B;  4ZN3 A;  3M9B A;  5IN1 A;  1AQ5 A;  2DTH A;  1QL2 A;  2L8D A;  3JB9 F;  2FB7 A;  5D6W A;  3V2Q A;  2PAJ A;  5APQ A;  3M9Q A;  3INZ A;  2C9N Y;  5AVZ B;  5APS A;  2O01 H;  3O8V A;  3CBP A;  3G4S T;  4JS5 A;  1GD2 E;  1FZC B;  2LQK A;  3UPU A;  3TNU A;  5C0M A;  1Q7Y U;  4BB7 A;  4BAC A;  2XDD A;  1LTT C;  3VMX A;  3GNF B;  3VOP A;  1WQ7 A;  5LJ5 f;  2IG0 A;  1NPR A;  2RB6 A;  3QDR B;  4Y99 B;  3RK2 C;  3SD4 A;  4F7U F;  3OSV A;  1IZ6 A;  2GFA A;  1URQ D;  3FRN A;  5GMK m;  3CI9 A;  5FU7 B;  2LT4 A;  2RJD A;  2RA2 A;  4ELZ C;  3BW1 A;  1JTH A;  2EKO A;  3FC3 A;  1HVV A;  1QP2 A;  2E43 A;  3HE5 A;  1K8A C;  4XAX B;  4I2L C;  1FX7 A;  4FT4 A;  1K9M C;  4UC4 A;  1N73 B;  3OS5 A;  2EJ9 A;  3QXE B;  3QZ9 B;  1D3B A;  1OI1 A;  4J7I A;  3M58 A;  4JJN K;  2I2L A;  5APW A;  4PLI A;  3B5N D;  1Z56 A;  1GW3 A;  2DAQ A;  2CGH A;  3MEA A;  2EWN A;  1LTA C;  3GIB A;  4J6X A;  2Z4E A;  3OBW A;  3S3N A;  3F70 A;  1WPY A;  2KY9 A;  5LJ5 h;  1IFN A;  3Q1J A;  5AW0 B;  5GAN 8;  4JRP A;  1KQ2 A;  3I55 A;  2E6N A;  4MMK A;  5GAN 6;  2RI3 A;  4DOV A;  1YIJ A;  2FXM A;  3PGG A;  1YIT A;  4ZTF A;  3L2Q A;  2FVU A;  1VQ5 T;  4GY5 A;  4M77 D;  1KD1 C;  3M91 A;  3QYH B;  1HBW A;  1PSF A;  1SLQ A;  3CXC S;  1LNX A;  2HOD A;  1VQ9 T;  1J1D C;  3SWF A;  4XTX A;  5GAN 4;  1M7L A;  5GMK i;  2DXB A;  4MZT A;  5C6S A;  2B8A A;  4C8Q F;  4X9D A;  2NPS C;  3R6O A;  1RL2 A;  1OZ3 A;  2P67 A;  5EG2 A;  1UGS B;  3M4Y A;  4C92 F;  1I5L A;  5J3B A;  2EFI A;  5GAM d;  1QVF S;  2IFN A;  2H8P D;  2YRV A;  3DLM A;  5LJ5 j;  3EFG A;  1X9V A;  1NU1 K;  3RER A;  3ER0 A;  3CCR T;  2HQE A;  1LWU A;  3VMY A;  5FU6 B;  2NLU A;  2LX9 A;  3OYI A;  1VQK A;  2RHX A;  2XNX A;  2DPP B;  3G6E A;  3M56 A;  4B9W A;  4J83 A;  4W80 A;  2FFD B;  4XU3 A;  5GAO l;  1JY3 N;  1G3S A;  3A7O A;  5KTB A;  1YJW T;  1X79 B;  3HUS B;  1M1J A;  1G3T A;  2FHD A;  1VQM T;  1VQN T;  3V7R A;  1E5W A;  1GU5 A;  5CKB A;  4M75 E;  1K73 U;  5CJ0 A;  2N1T A;  4EMK B;  5CKD A;  2WSF E;  1K8A U;  5I21 A;  1JCC A;  4XTV A;  4DZO A;  3FJP A;  4NS5 A;  3GP8 A;  3QKJ A;  1M1J C;  4RG2 A;  3U1C A;  5A0G A;  4B9X A;  2DD4 A;  2CPS A;  2VC8 A;  3E1I A;  2RK2 A;  2VXF A;  5AVS B;  3SB2 A;  3JB9 G;  4M75 D;  1GU4 A;  1BI1 A;  1QW1 A;  4OGE A;  1M1F A;  3VUB A;  4PJO G;  4JRQ A;  1VQO T;  4N4G A;  2VXE A;  4M78 C;  4JRK A;  2LCC A;  4A4E A;  2GUV A;  3HD7 C;  2EJG A;  4C8Q C;  2VRS A;  4IUT A;  3CC4 T;  1SQQ K;  4A4F A;  3KQG A;  3RKW A;  2KMT A;  3B8E B;  4NL2 A;  3RMQ A;  5LJ3 d;  2J58 A;  2XZR A;  4M78 B;  4E7I A;  2X4J A;  3S6W A;  1WT6 A;  1KQL A;  4M7A C;  3QHS A;  3WMM 0;  4ZGJ B;  3OYM A;  2K5F A;  3CLQ A;  2GUS A;  1R8O B;  2M8R A;  2YMY A;  1UGR B;  3NTK A;  2QEX T;  4ZKU A;  1LOJ A;  1M90 U;  4M77 F;  3RUX A;  1S9K D;  4EIJ A;  2D9T A;  2IFM A;  2YKQ A;  2L5Q A;  4RKU E;  2F69 A;  2ZPI B;  3GOX A;  4QQG A;  4HKE A;  5KCO A;  4N4H A;  3CCE A;  3OA7 A;  2H3J A;  3JCM P;  5AVR B;  1RI0 A;  3A5T A;  1XQH A;  3CCM T;  1M5Q 1;  3JCM J;  1VQ8 T;  4M78 D;  4C46 A;  1X6O A;  1N7S B;  4M75 B;  1RY3 A;  2ZPE B;  2Q9I A;  1U1S A;  2R5M A;  1JY3 P;  1SQP K;  4HH2 A;  2L3R A;  3MCA B;  3TNU B;  4Q5W A;  5GMK l;  2N1T C;  2CPB A;  4BUG A;  3HKS A;  3P8M C;  3GNG A;  3CCM A;  2K3Y A;  3EFR A;  4EMK C;  5LJ3 g;  1GDT A;  3GHG C;  1HGZ A;  2P0P A;  1CZQ A;  3S3M A;  1J1D B;  4IUV A;  1NWQ A;  4C92 C;  3CME T;  2KP8 A;  2YHT A;  2QXF A;  3JCM Q;  1RE3 C;  2YKP A;  4I6M C;  2P0Q A;  3NMD A;  3JRZ A;  3QJ6 A;  4KUD K;  2OYI A;  5KJ7 A;  4XTU A;  3CCJ A;  1KC8 U;  3BRV B;  3UWN A;  1LTG C;  3E1S A;  1RE3 A;  1ZBX A;  1VQN A;  5GAO q;  2W27 A;  1Y7X A;  2OTJ A;  5A0D A;  4BI8 B;  4ME7 A;  1KIL B;  4P5N A;  2Z5H A;  3CXC A;  1VUB A;  1BI3 A;  4NL3 A;  2EIF A;  1HGV A;  2XKO C;  5GAN j;  2BAS A;  3OYA A;  3CMA T;  4BD3 A;  3U1A A;  4OB3 B;  2LVM A;  4C8Q D;  4E7J A;  1VQK T;  1G2C B;  2RM4 A;  1HK9 A;  5FU6 C;  5FRO A;  1LWU B;  5AW2 B;  4RCC A;  4Y91 A;  4FL6 A;  4OB0 B;  2ZXE B;  1YHQ T;  2L89 A;  1FZB A;  1KD1 U;  3X25 B;  2KSS A;  3CBO A;  3CCL T;  5GMK h;  1T8Z A;  4LD9 K;  5APY A;  1VQO A;  3UIA A;  4M7A D;  5LJ3 h;  1IFJ A;  5FRM A;  2QQR A;  3BDU A;  2E65 A;  3TSI A;  2HYN A;  3MUD A;  3S3O A;  4JLI A;  1RF0 A;  2JNG A;  3OYE A;  2MJZ A;  2E5Q A;  2Y4X A;  4N4I A;  3PMI A;  1NH4 A;  1QL1 A;  5CIU A;  4XU1 A;  4C0D C;  3BRT B;  1LJO A;  2K3X A;  1M1G A;  2DO3 A;  3JB9 H;  3VN0 A;  1NOH A;  3ME9 A;  2MWO A;  1M1K C;  2N1T D;  2RHZ A;  4O9B A;  1FWZ A;  2LT1 A;  3OYB A;  1BKB A;  3P8C D;  2O1J A;  2RH2 A;  2WWW A;  2QEX A;  3MP6 A;  2OTL T;  1M90 C;  1FZC A;  4N78 E;  1KIL D;  3MD0 A;  4A4K A;  5AW7 B;  3A8O B;  3H32 B;  1VQ7 A;  3I5C A;  1LT9 C;  3I55 T;  1I81 A;  2GFU A;  2HQX A;  2QTX A;  3EFS A;  3L4F A;  4WF2 A;  1RF1 A;  5CCG D;  4FT2 A;  3CCR A;  3BFM A;  3VMZ A;  3MO8 A;  5I2M A;  3ZEH A;  4BY6 B;  1LT9 A;  3V7C A;  1UEB A;  2MAM A;  1N86 A;  1N73 A;  1SP4 A;  4F7U E;  4WY4 D;  4EMH A;  3FDR A;  1LT9 B;  2H43 A;  1P92 A;  5CCG C;  3CC7 A;  1QVF A;  4LDW A;  1N7S C;  3RK2 D;  2VYT A;  2E1H A;  4DQ2 A;  3DB4 A;  4QVD A;  4LDY A;  1WRG A;  1JB0 E;  3QBY A;  3V8J A;  5BU8 B;  2CYZ B;  1JY3 O;  2LKM A;  2JVV A;  5KJ7 D;  2H7H A;  2X35 A;  2XIC A;  4CRI A;  3RK3 B;  1XOV A;  5FU7 C;  3I56 T;  1H3Z A;  3OQ5 A;  1N27 A;  3M9H A;  2KB7 P;  3WVD B;  4XU2 A;  3M06 A;  3CCL A;  5IAY A;  2LNV A;  1UGQ B;  1KZU B;  5GAM g;  3J81 E;  3M57 A;  1S72 T;  3N4X A;  5AVV B;  2JN0 A;  5CJ4 A;  2OYH C;  1QVP A;  1LTJ A;  1VQM A;  1N6A A;  2DIQ A;  1KQS A;  2EAY A;  2R57 A;  5APV A;  4C0F A;  3PIO A;  1QVG A;  3G6E T;  2YNY A;  4EPC A;  4M3L A;  2RHI A;  3OYY A;  2F5K A;  5M9O A;  2RHU A;  2DXC A;  1VIE A;  1IFD A;  2X4X A;  4XQ3 A;  5CCA A;  5GAN 2;  3H8Z A;  2HD0 A;  1YI2 T;  3QJY A;  2PUK B;  3HE5 B;  5CVI A;  4GKG A;  2R5B A;  5GAO m;  1T2K C;  3G71 A;  5GAN d;  3L36 A;  2PUO B;  5AW8 B;  5APT A;  1IO4 A;  2ZCF B;  5GAN 5;  1GTW A;  1MFZ A;  1JRI A;  1B34 B;  2WT7 B;  1FOS E;  3VJP A;  2EQJ A;  4OH8 B;  4OP0 A;  5J39 A;  1Y71 A;  2DXU A;  1L0L K;  3OW2 A;  2E10 A;  4XA4 A;  3ZFJ A;  2O01 E;  3JCM c;  4EOT A;  2LC4 A;  2LQ8 A;  1L4A A;  1GXI E;  2P2U A;  3AHU A;  3SWY A;  1WGS A;  2YLC A;  4GT1 A;  4IUU A;  1N7S A;  1LGH B;  2WSE E;  2RO0 A;  4LD6 A;  3M0D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...