2KP8A

Ligand bound to a model peptide that mimics the open fusogenic form
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
72
structure length
72
Chain Sequence
TSLIHSLIEESQNQQEKNEQELLELDGDGPQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Model peptide
publication title Non-peptide entry inhibitors of HIV-1 that target the gp41 coiled coil pocket.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 32
structure length 72
sequence length 72
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2kp8A00
5AW8B 2QM7A 3VTPC 2YO3A 2KP8A 2XV5A 4I2LC 5AVYB 1JUNA 1CZQA 1GZLA 4HYTB 2WTYA 1GU5A 2WT7B 1OXZA 1H89A 4RESB 1HBWA 1HUCA 1YYCA 5APSA 3LIEA 2QM8A 3NXSA 1GU4A 3VYIA 2Q3IA 2P7JA 2ZXEB 4LC1A 1FAVA 1H88A 3I5CA 3KQGA 3TK1A 2IPPA 2WPQA 5AVRB 5AVZB 3SWFA 2WT7A 5AVUB 3TYYA 1MUUA 5APQA 3V5BA 1MV8A 1NWQA 3T97A 1OWAA 2N9BA 3IR9A 5AVXB 1GTWA 3A2AA 3M0AA 3M0DA 3TNUB 3P32A 1CI6B 3V4QA 1SLQA 5AW5B 1A02J 4AUWA 1DH3A 3VMXA 3OAKA 3VN0A 3A3YB 2R32A 3TNUA 1CI6A 4C46A 3A5TA 2WPRA 3LIDA 3KDPB 3UIAA 5AVVB 2R3CA 3HE5B 2VRSA 2XU6A 3MGNA 5APTA 5APUA 1S9KE 3M91A 4JYBA 1T2KD 2XZRA 3VMYA 3L35A 5AW3B 3V4WA 4AQRD 5AW6B 1S9KD 1MFZA 3HE5A 2Z5IA 5APYA 4C7NB 1A02F 2BASA 5AVTB 2YNYA 3HE4B 4GT1A 1CSBA 2Z5HA 2W27A 5AW0B 3HTKA 2P67A 3M9BA 4XE5B 5AW7B 4C7NA 1GD2E 3NMDA 3A7OA 1KQLA 2YO2A 3L36A 3M06A 4M3LA 3HE4A 1GK4A 3VMZA 4B86A 5AVQB 3M9HA 5AW9B 5AVSB 5APWA 1T2KC 2R5DA 3O8ZA 1FOSF 2ZFCA 3NTNA 2WPSA 2C9NY 4GKGA 1X8YA 3B8EB 4KHXA 4JYCA 4DZOA 2E42A 5AVWB 4I6MC 5AW2B 3P8MC 1J2JB 3MD0A 2E43A 2Q7CA 5CMZA 1NAFA 2P2UA 2JJLA 1SP4A 2C9LY 3L37A 3NFQA 5APVA 1JNMA 2Q5UA 1G2CB 3P7KA 2W6AA 1H8AA 1HWTC 2H7HA 2R5BA 1HJBA 1FOSE 2WWWA 4AYCA 5APXA 4EOTA 1IO4A 5AW1B 5AW4B 1GK6A
chains in the Genus database with same CATH superfamily
2QM7A 4O9BA 1AJYA 3FX0A 2FXOA 1LT9A 1OVRA 5BU5A 4L75A 1DD3A 4U3FE 1FAVA 2ZT9D 3RBXA 1MUUA 4Z1MH 4IFDK 3L75D 1KZUB 4KT0J 1LP1B 2E74C 2IFMA 3M0DA 2ZXXA 4CPGA 1SFCC 1CI6B 4U7JA 3H1KD 1EZVE 3CCEP 3BCCG 5B66E 2KIKA 3OAKA 5CJ4A 3WU2E 3RK3E 3L73J 1RE4C 1KORA 1M1JC 3MGNA 1KYOH 1S9KE 3M91A 2HR3A 1URQD 4IL6H 1S5LX 2D2CD 3M9QA 3FGAD 5CBNA 3FWLA 2YIUC 1RY3A 3MUDC 1Q82Q 1QVGO 1ZRTE 3H1LE 5H2FE 4HH2A 4NPFX 1NGMB 3SSUA 1T2KC 3L4FA 2FXPA 2N1TA 3U59A 4WVZA 1X8YA 3L73D 4I7ZB 2NZ2A 1BSNA 2BCCG 1RF0C 1HGVA 1KILB 3Q5SA 3L37A 3R4YA 3H1LG 5CBOA 2R5BA 2E76D 1BCCJ 1FOSE 1ZXGA 1VQLP 1VQKP 3CX5D 3S4RA 1EC5A 1L0LE 1ZLLA 1YYCA 2KB7P 3RK2C 5B5EE 1AVOA 5KTBA 1NTKE 3SWKA 3CMEP 1SLQA 4H13C 2WSFJ 1LP1A 5KLIB 1LTGC 1QGKB 1PP9D 1IJDB 1CI6A 1BCCD 2IBZE 3RL0C 2Q3EA 1X0TA 1NTKG 2NPSD 1KQGB 2Z5IA 4C7NB 1P84D 2V7QH 3HE4B 3G9RA 2YMKA 2AXTH 2WVRA 1EDLA 1S2EA 2SPZA 3M9BA 3TGUE 2W6BA 2IBZI 1JCCA 3OW2O 4H0LB 1L2PA 4IL6X 4TT3H 2IBZG 2A06E 1NVOA 3B8EB 4PD4E 2D2CC 5E79H 1N2DC 3L71D 2CK3H 1SP4A 3B5NB 1QLED 1JNMA 1OW8A 2WWWA 1CW5A 1RF0A 1VPCA 2C0XA 3RL0g 1KILA 1LWUB 1VDFA 3TGUG 1SQVJ 3KXDA 4L76A 2WT7B 1NTKK 3CWBG 3SWYA 1L4AD 5TISE 1MFTA 1VF5D 2WSFH 2GM4A 3V4QA 4WY4B 2WSEJ 1LTBC 2LKMA 1SQBE 3G3ZA 1IFIA 1N73C 1EXJA 2BCCJ 1KN7A 2R3CA 3CI9A 5APUA 4ZMDA 4N6JA 1SQVD 1WMKA 5CCHD 4HKZH 5M1BA 1J1DC 2OTKE 2M0BA 1SQXE 2QG4A 2P67A 4C7NA 3IF4A 1YIJP 3HE4A 2LXCB 1K8AQ 1ZR2A 2Q9IA 5AVSB 2NPSC 4JYCA 4D6TG 2QEXP 1GL2B 2W6JH 1S72P 5K5GB 1J2JB 1X22A 1NAFA 2WQYC 2IFNA 1XTCC 1R8EA 1L0NE 1SQXG 1UIXA 1M1KQ 1KYOE 3CPWO 1IO4A 4ZNCA 3B5NA 3PHLA 2H43A 3AEEC 2HYNA 2I8DA 3L72E 2KXPB 1N7SB 1LWUA 2FYUD 2ZXEB 3L75E 3I5CA 2HLOA 3TK1A 2IPPA 1VL2A 2WT7A 5AVUB 3PRJA 2WSEH 3II6A 1SQBK 5KLVJ 4NPEA 1Q86Q 2ZVNB 4AUWA 3H1HD 2ZYAA 5H2FH 2B89A 2ZYGA 2OYHC 4WY4A 1G1IA 3CCUP 3KPEA 3HE5B 3L75G 2J59M 4AQRD 3BATA 1SQXK 3H1KG 1FBMA 3OJAB 1XTGB 3V2QA 1U57A 2E75B 3CWBJ 1GDTA 4W7YA 2Y0CA 2KLUA 5GTIH 2XKMA 4JBZA 5KLVD 1Z56A 3L73E 2C9NY 1S1CX 3LW5J 3CCQP 2JJLA 5B5EH 2WSCH 3NFQA 3D70A 3KZIE 1HWTC 3CX5E 1GL2A 3RK3B 1SQQJ 1JCDA 1JY2N 2XDJA 1HGZA 2YO3A 1DX7A 1E5WA 3TSIA 3P8CD 3L73G 1FS0E 2M8RA 2AXTE 4OGQB 2WMMA 1OMIA 5KAFE 2KS1B 3AEFC 1KFNA 1N7SA 1QL2A 1NOHA 3VMAA 2N9BA 3A0BE 1JMBA 1NTMJ 1KC8Q 1IFPA 3V2PA 3VMXA 1YITP 1BCCE 1JO5A 4D6TJ 2JWAA 1JY2O 2V4HA 4WB4A 1SQQD 4Y99C 4XFJA 3H25A 5CCGD 1SQXJ 1HJ0A 1GW4A 4R4LA 3HD7B 2DW3A 1VQ5P 3HE5A 3Q5PA 2KLVA 3JSVC 2QSIA 3CC2P 3R2PA 1PP9G 4OH8B 4GOFA 1BCCG 3HUSB 1WT6A 4OVNF 3N7NA 4YXDC 1P84I 1NTMD 1K05A 3FXDA 1FZBA 3SFEC 2E43A 2QJYC 3C8VA 3L70D 2H8PD 5TISH 3WMM0 1HJBA 1OIPA 2PFXA 1NHLA 1VQNP 5AW8B 4UB8H 2KSEA 2XV5A 1GZLA 1HBWA 3D71A 3H1KJ 1PFIA 1KILD 1J1EB 3L71G 3KQGA 2WPQA 1HF9A 3G71P 1IFDA 1N86A 2JKVA 1QEXA 1NU1J 1M8OB 2KS1A 1LTIC 3E1IA 1YJWP 1SQVE 2WPRA 3LIDA 4PV1C 2E74B 1SFCB 2Y0EA 1FDOA 3USSA 3HD7A 1FZCC 1CSBA 1FE6A 1ZP0C 5AW0B 5AW7B 1M1JB 1EDKA 2N9YB 1SQVG 1R5SA 4GODA 2O1JA 1NU1D 3HUSA 2YIUB 3L74G 2XNDH 2BCCE 1Q2NA 4KHXA 1R5LA 1Y8AA 1AA0A 3AE9C 1JB0J 2YKQA 1Y9BA 2HFED 2HPCB 4H0LD 3CC4P 1PV3A 3E7KA 2JP3A 5AW1B 3VTPC 5AVYB 2IDBA 2YKPA 1CZQA 2E5YA 3H1IG 1GU4A 1PGPA 1KV4A 4H44C 3V2NA 5KJ7D 1VQPP 4WWIA 1PP9J 5BU8B 2WZ7A 1MV8A 3KYQA 5GTIE 1IZNB 3C1LA 4DOJA 3G4SP 2G8YA 1YJ9P 2FBWC 1SQVK 1RE3C 4W80A 2FYUG 3RK2B 1K73Q 3A5TA 2QJPC 4OWFA 2XU6A 5GTHE 4N78E 4WY4D 1KB9D 3BRVB 4H13B 2KYVA 3Q2YA 1A02F 2O01J 1M7LA 3H1HG 2J58A 3CXHD 1SFCA 3ABVC 2P1JA 3MIWA 5KKZC 3L71J 3KZIH 2ZT9C 3AE3C 1FC2C 3RL0B 3CX5H 2GUVA 5KLVE 1GK4A 2FYNC 4ASVA 1RE4A 2BEQD 1M1JA 1LTJC 2K1AA 4A7PA 2B9BA 2P2UA 2W8ZA 1H8AA 3MUDA 5KAFH 1USDA 1IFJA 2FYUK 1QVFO 3A0BH 2Y9ZA 3P8CE 3GMAA 4KJMA 1DEBA 1FZAA 5KLVG 1URQC 2HPCA 2D2CB 1OXZA 1GL2D 1HUCA 3CWBE 1HH0A 3VYIA 1TU3F 2HG5D 5AVZB 1RF1C 1HTLC 1NWQA 2K9YA 2OYOA 3CMAP 3VP8A 1P84H 3TNUB 3BRTB 1RQVA 4JQ0D 3L74J 2FXMA 1SQQE 2KZIA 2K9JB 3IN6A 1PGJA 5KJ7C 1FJKA 3CCLP 1BE3J 2E76C 2YKOA 3I56P 1AFOA 3F89A 3HTKB 4UB8E 2KI7B 1YTZT 1KTMA 3AECC 3H1IJ 1SS1A 4GT1A 1N73B 5KLVK 1PPJG 2OTLP 1OVUA 1SQQG 3NMDA 1NTME 1OZHA 3CCRP 3FXEA 4XA4A 4D6TE 3U1AA 2IZ0A 3O8ZA 2ZFCA 4IFMA 3L74D 1J1DB 3MHVA 2E42A 5CJ0A 4I6MC 4NPDA 4K35A 1USEA 2E75D 2MKVA 2FYUJ 3P7KA 2H88C 1BE3D 3IAOA 3GHGC 3S9OA 2OTJP 3CCMP 1NTMG 2NPSB 4TLFA 3H1ID 1GU5A 2OQQA 2W90A 1W5CE 1KD1Q 1FJPA 1EZVD 4LC1A 1KQSO 3H1HJ 2W83C 5AVRB 3AEDC 3B4SA 3L70G 3RK3D 3VP9A 1YQ4C 1VQ8P 1YTZI 3GF3A 1SQQK 1IFMA 1PZQA 5KAIE 4L74A 3CLQA 3VN0A 2UWJE 2FFDC 3TNUA 3WUTA 3AE6C 3V2RA 4JYBA 2K9JA 2OYIC 3W68A 3H1KE 2ZJSE 3JC22 3CCVP 1JY3N 5CHXA 2YXQB 2WPVB 5AVTB 1NTMK 2W27A 2OYHB 1M90Q 3HTKA 4GOEA 4HJGH 1M57D 1KQLA 1VQMP 1L4AC 1NU1E 3HD7D 1VF5C 1N73A 3AEAC 3M9HA 3FWNA 1MZ9A 5DJUB 2QIWA 4DZOA 1K9MQ 1L0LD 4JF7A 3AE7C 2LR2A 3Q1MA 1NO4A 4AYCA 1JY3O 1W2BO 2QJKC 1U7JA 5AW4B 2ZVOB 4YXWH 2BEZF 3GHGA 1NU1G 5CCHC 4I1LA 1EQ7A 3GLMA 1NH4A 3E1RA 2Q3IA 4LLHA 5C39A 2NPSA 3QH9A 1G1JA 1JTHB 2N1TD 1T6AA 2FKWB 5GTHH 2AEJA 3M0AA 1PIXA 4RJTA 1A02J 1DD4A 3TF5A 1QX8A 1T8ZA 5EFWB 1LTAC 1JMMA 1W2EA 3EFGA 1Y47A 1PL5A 2QVAA 3L35A 5AW3B 3V4WA 2A45I 3K5BA 3CXHE 1PP9E 1AV1A 3N4XA 1LTSC 2A06D 2YNYA 4ASWA 4PD4D 2A45G 1NU1K 1PPJD 2JR8A 4Y99B 1EXIA 2E74D 3A7OA 1AQTA 3L70J 1KB9I 2OYHA 1LT9C 1MKMA 1P84E 4IFFA 3CXHI 4EIJA 3P8MC 1S3JA 1RHZB 2Q5UA 4YPCA 3M0DC 3D6YA 3AE2C 3KHUA 3LW5H 2R44A 2M3EA 4RKUJ 4C7RA 1H89A 3L71E 1HVVA 1NKZB 3B71A 3NXSA 2KUBA 2QJYB 1JM0A 1QL1A 1SQBD 2B87B 5BVZA 3I55P 5AVXB 2JDIH 1GTWA 1JTHA 1PGQA 2YMYA 3O6QA 1Q81Q 1Q90D 5AVVB 2N1TC 3EFFK 1U7MA 1NJIQ 2G3AA 1Q7YQ 4W7ZA 2LXBA 3RK2D 2Z5HA 3PLNA 1LTTC 5DJTB 4PV1B 3PJSK 1LGHB 3L36A 3M06A 4M3LA 4B86A 1L0ND 3L74E 1G2CA 4H13D 2MJZA 1KYOD 1FOSF 4L73A 2PGDA 1FZCB 3L72D 2B88A 1BGYJ 1JOCA 1BE3E 1SQPJ 3RL0D 3AE4C 4DCKA 2HODA 3H1IE 4ZKPA 4EOTA 5CCGC 4HYTB 4RESB 5KAIH 2I1JA 2WSSH 3T97B 2CPSA 3CCSP 1OW6A 1S4XA 2JWDA 3SWFA 4BWNA 1OX3A 4U3FG 1M56D 1BE3G 1OWAA 1YQ3C 1JY2P 2PAJA 1EZVI 2FYUE 1BDDA 2GUSA 2B87A 1BGYD 1OFCX 4H44B 1SQPD 1EZVG 3B5ND 2V7QJ 3UIAA 2L5GB 1YJNP 1SVFA 4R4MA 2KNCB 1IC2A 1NTZJ 1OVVA 5AW6B 4GDOA 2PRRA 3H1HE 1MFZA 1DEEG 5APYA 2C0WA 2RN0A 4I7ZC 1KILC 2QJPB 2YO2A 1FU1A 2R5DA 1VQ7P 2OARA 1ZR4A 2RKLA 4DJGA 5KKZB 2PP6A 1LNQA 1EDJA 5APVA 2ZT9B 4BXLA 2FYZA 2FYNB 1FZCA 2AEFA 1VQOP 1NTZD 2M5AB 2KP8A 3JCUE 2O01N 2A45H 1LTJB 1JEKA 3MZWB 5CCGA 4RO0A 5KLIC 3F5HA 1L0LG 2P7JA 4BRYB 4UB6H 5TJHA 3PH0A 1K04A 3H1JJ 3T97A 1KB9H 2P58A 3A2AA 3V6IA 1URQB 2H89C 3CXHH 4EYYQ 2IYPA 3CCJP 1RF1B 1DIPA 1T3UA 2M3BA 5L8RJ 1AQ5A 3D6ZA 1OW7A 2XZRA 4H0LC 3CD6P 1ZN5A 1S5LE 1FZEA 3AE8C 3CL3D 1PPJE 1N7SD 3BCCJ 2KNCA 2P10A 2Y9YA 1YI2P 3B5NC 4PJ0H 2L91A 4DT0A 3H1JD 2Y0DA 1RE3A 4U3FJ 1ZV8A 2E76B 1L0LK 1LT1A 1YHQP 2O01H 1N8RQ 1LWUC 4PD4I 2ITAA 3MTUE 4GKGA 1H0TB 3Q3DA 1IFNA 2A06G 5AVWB 2ZAEB 1ZOYC 3G6EP 2CPBA 3AE1C 3AEGC 2H7HA 1GW3A 3BCCD 1NAYA 4WY4C 5APSA 2QM8A 3ZDMA 1UIIA 3L70E 2M5AA 1H88A 3BVHA 4N3YB 1LTJA 4K3AA 4U3FD 2IYOA 3H1LJ 3GHGB 2GA1A 4BRYA 3H6PA 4ZKUA 3GG2A 1EDIA 1KILE 3IFMA 2R3SA 4IOIH 3A0HH 3A3YB 1URQA 1FDMA 3EWKA 1SQBG 2QE7H 3KDPB 5APTA 3ITKA 2JEEA 1RF1A 1KQFB 1S9KD 3U1CA 3VOPA 2KSJA 4GIFA 3RBZA 2K88A 1RQUA 1KFMA 1GL2C 2FFDB 2BCCD 1T3JA 4OGQD 1L0LJ 2AXCA 4EI2A 1ZRTD 3H1LD 2KZJA 1GD2E 3CC7P 1RH5B 2OYIB 3VMZA 2FY8A 2WSCJ 1BDCA 5APWA 1PGOA 5KJ7A 4IL6E 1ZW0A 2JO1A 1NTKJ 1BSHA 2WPSA 3W67A 5B66H 2KK7A 3WU2H 5AW2B 1N7SC 2KOGA 2C9LY 3GW6A 1H0TA 1L4AB 1FDIA 1VF5B 1KYOI 3MP7B 3AE5C 1L0NG 2Q1KA 1JUNA 1FZFA 2WTYA 3LIEA 1YBKA 3L72G 3H32B 5APQA 3V5BA 1VQ6P 2QJKB 2O1KA 3TDKA 3BASA 1NTKD 1BGYE 3TGUJ 3SFDC 3P32A 1VQ4P 2IZ1A 4N78D 3WUVA 1SQPE 5AW5B 2AEMA 1DH3A 2R32A 2IX7C 2E75C 4EDFA 2E5TA 3O6QB 2IBZD 2J5UA 1X9VA 1BGYG 1L0NK 1GMJA 1SQPG 4UB6E 4XE5B 3WUUA 3RK3C 1IK9A 2FFDA 1D7MA 1AVYA 1KB9E 3TGUD 5AW9B 2OGUA 2QA4P 3OA7A 3JCUH 2Z4EA 1KMIZ 2K37A 2OYIA 1IK7A 2K3RA 3GF7A 2QRXA 3MD0A 3HRNA 4PV1D 3CWBD 4LGDE 1G2CB 3CX5I 1NTZE 2XNXA 4OGQC 4WBAA 1SQBJ 1LT9B 1SFCD 1GK6A 1E79H 4I2LC 1L4AA 3Q5RA 1N7LA 5E79E 2O3JA 2ZYDA 2HODB 1WRGA 3TYYA 4PJ0E 2Q6QA 3H32A 3S1KA 1SQPK 3IR9A 1NTZG 3HD7C 3AEBC 1NKNA 1S5LH 4PD4H 3RGUA 3C9IA 1X79B 3PP5A 5CCHA 4C46A 2NRGA 3HUSC 3PTZA 2VRSA 3QWOC 1T2KD 2I1KA 3VMYA 4YTPC 1L0NJ 2RH0A 4H44D 4D6TD 2BASA 3H1JE 4MN4C 3L72J 4JPZB 4HB1A 1SQXD 2N1TB 2RMZA 1NYHA 2WITA 3L75J 5AVQB 2YXRB 3NTNA 1LJ2A 1NTZK 1ZMEC 1JY3P 1VQ9P 2Q7CA 5CMZA 3A0HE 1J1EC 3EQ2A 2W6AA 2POHA 4Y28J 1FZGA 5APXA 3H1JG 4QMAA 3BCCE
chains in the Genus database with same CATH topology
1HGZA 2QM7A 2YO3A 1DX7A 2KP8A 1E5WA 2NPSB 2A45H 1LTJB 4O9BA 3TSIA 1GU5A 3P8CD 5CCGA 1LT9A 5BU5A 1FJPA 2P7JA 4LC1A 1FAVA 2M8RA 5AVRB 3RK3D 3VP9A 1MUUA 4IFDK 1KZUB 1KFNA 1N7SA 3T97A 1QL2A 1NOHA 2N9BA 1YTZI 2IFMA 3A2AA 3M0DA 1URQB 1SFCC 1SQQK 1CI6B 1IFMA 3V2PA 3VMXA 3CLQA 1JO5A 3OAKA 3VN0A 5CJ4A 2FFDC 3TNUA 1JY2O 1RF1B 4WB4A 1T3UA 2M3BA 4Y99C 1RE4C 1AQ5A 1M1JC 3MGNA 3V2RA 5CCGD 1S9KE 3M91A 1GW4A 4JYBA 2OYIC 2XZRA 3HD7B 1URQD 1ZN5A 3M9QA 1FZEA 3CL3D 3HE5A 1RY3A 1JY3N 5CHXA 2KLVA 1N7SD 5AVTB 3R2PA 4HH2A 1NTMK 2W27A 2OYHB 3HTKA 4OH8B 3B5NC 3HUSB 1KQLA 1RE3A 1L4AC 1ZV8A 1WT6A 1L0LK 3HD7D 1N73A 3N7NA 3M9HA 1T2KC 2O01H 1LWUC 3L4FA 1MZ9A 2N1TA 3U59A 3MTUE 4GKGA 1X8YA 1FZBA 4DZOA 1IFNA 5AVWB 2E43A 1RF0C 1HGVA 1KILB 4JF7A 3L37A 2H8PD 2R5BA 3WMM0 1NO4A 1HJBA 1FOSE 4AYCA 1NHLA 2CPBA 1JY3O 5AW4B 2H7HA 5AW8B 2XV5A 3GHGA 5CCHC 4I1LA 1GZLA 1EQ7A 1GW3A 4WY4C 1HBWA 1ZLLA 1NH4A 1YYCA 5APSA 2QM8A 1PFIA 1KILD 2Q3IA 2KB7P 1H88A 1J1EB 4LLHA 3BVHA 3RK2C 3KQGA 2NPSA 4N3YB 1LTJA 1G1JA 2WPQA 5KTBA 1JTHB 2N1TD 1IFDA 3GHGB 2FKWB 3H6PA 1N86A 3M0AA 4ZKUA 1SLQA 1A02J 3IFMA 1LTIC 1LTGC 1T8ZA 3E1IA 3A3YB 1IJDB 1URQA 1CI6A 1FDMA 2WPRA 3LIDA 3KDPB 1LTAC 3RL0C 1JMMA 5APTA 1W2EA 3EFGA 2JEEA 3L35A 5AW3B 1RF1A 3V4WA 1SFCB 2NPSD 2A45I 1S9KD 3U1CA 3VOPA 2KSJA 2Z5IA 3N4XA 4C7NB 4GIFA 1LTSC 1KFMA 2YNYA 3HD7A 1GL2C 3HE4B 1CSBA 2FFDB 1FZCC 2A45G 5AW0B 1T3JA 1NU1K 4Y99B 3M9BA 5AW7B 1GD2E 2W6BA 3A7OA 1M1JB 1JCCA 2OYIB 3VMZA 2OYHA 1LT9C 5APWA 5KJ7A 2O1JA 4IFFA 3HUSA 2WPSA 4EIJA 3B8EB 4KHXA 5AW2B 3P8MC 1N7SC 1N2DC 2KOGA 2YKQA 1SP4A 2C9LY 3B5NB 2HFED 1JNMA 2Q5UA 3M0DC 1L4AB 2WWWA 2HPCB 1CW5A 1RF0A 1VPCA 2C0XA 3LW5H 1KILA 5AW1B 1LWUB 1VDFA 3VTPC 5AVYB 1JUNA 2YKPA 1CZQA 1FZFA 2WTYA 4C7RA 2WT7B 1H89A 1HVVA 1NKZB 3LIEA 1GU4A 3NXSA 3H32B 1NTKK 3V2NA 5KJ7D 1QL1A 3SWYA 1L4AD 5BU8B 2WZ7A 5APQA 3V5BA 1MV8A 3KYQA 5BVZA 2WSFH 2O1KA 5AVXB 1GTWA 3BASA 2GM4A 1JTHA 3P32A 4N78D 4DOJA 3V4QA 4WY4B 5AW5B 2YMYA 1DH3A 1SQVK 1LTBC 1RE3C 4W80A 2LKMA 3RK2B 3G3ZA 1IFIA 2R32A 1N73C 2IX7C 3A5TA 5AVVB 2N1TC 2R3CA 3CI9A 2XU6A 5APUA 4N6JA 4N78E 5CCHD 4W7ZA 4WY4D 3BRVB 1X9VA 1J1DC 2KYVA 1A02F 1L0NK 3RK2D 1M7LA 2J58A 2Z5HA 1SFCA 2P67A 1LTTC 2P1JA 3MIWA 4XE5B 4C7NA 3RL0B 1LGHB 2GUVA 3L36A 3M06A 4M3LA 3HE4A 1GK4A 1IK9A 3RK3C 2FFDA 4B86A 1ZR2A 2Q9IA 5AW9B 5AVSB 1G2CA 3OA7A 1RE4A 2MJZA 1FOSF 2Z4EA 1M1JA 2NPSC 1LTJC 2OYIA 4JYCA 1GL2B 1FZCB 1J2JB 3MD0A 3HRNA 1NAFA 1JOCA 2P2UA 2IFNA 1XTCC 4LGDE 3RL0D 1H8AA 1G2CB 2XNXA 3MUDA 4WBAA 1IFJA 2HODA 2FYUK 1LT9B 4ZKPA 4EOTA 1IO4A 3P8CE 1SFCD 3B5NA 5CCGC 1GK6A 2H43A 1DEBA 1FZAA 4I2LC 2HYNA 1URQC 1L4AA 4HYTB 2HPCA 1OXZA 1GL2D 4RESB 1N7LA 1HUCA 2I1JA 1HH0A 1N7SB 3VYIA 1LWUA 2ZXEB 2HODB 2CPSA 2HG5D 3I5CA 2HLOA 3TK1A 2IPPA 5AVZB 3SWFA 2WT7A 1RF1C 1WRGA 5AVUB 3TYYA 1HTLC 1NWQA 3H32A 1OWAA 2WSEH 1SQPK 3IR9A 3HD7C 1JY2P 3VP8A 2PAJA 3TNUB 1NKNA 3II6A 3BRTB 1SQBK 2GUSA 4AUWA 2FXMA 3C9IA 1X79B 3PP5A 5CCHA 3B5ND 2OYHC 4C46A 4WY4A 5KJ7C 1G1IA 3KPEA 3UIAA 3HUSC 1FJKA 3HE5B 2VRSA 2L5GB 1T2KD 2J59M 1SVFA 2I1KA 3VMYA 1IC2A 2YKOA 4AQRD 5AW6B 1AFOA 3BATA 3HTKB 1SQXK 1YTZT 1MFZA 5APYA 2C0WA 2BASA 4GT1A 1FBMA 1N73B 3OJAB 5KLVK 1XTGB 3V2QA 1KILC 2N1TB 1GDTA 4W7YA 3NMDA 2YO2A 2XKMA 2WITA 1FU1A 5AVQB 2R5DA 4XA4A 3U1AA 1Z56A 3O8ZA 2ZFCA 3NTNA 4IFMA 1J1DB 2C9NY 2OARA 2E42A 1NTZK 1ZR4A 1JY3P 5CJ0A 4I6MC 2Q7CA 5CMZA 2JJLA 1J1EC 2PP6A 2WSCH 3NFQA 5APVA 2FYZA 3EQ2A 3P7KA 2W6AA 2POHA 1HWTC 1FZGA 1GL2A 5APXA 1JCDA 3RK3B 1FZCA 3GHGC 1JY2N 2XDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AW8 B;  2QM7 A;  3VTP C;  2YO3 A;  2KP8 A;  2XV5 A;  4I2L C;  5AVY B;  1JUN A;  1CZQ A;  1GZL A;  4HYT B;  2WTY A;  1GU5 A;  2WT7 B;  1OXZ A;  1H89 A;  4RES B;  1HBW A;  1HUC A;  1YYC A;  5APS A;  3LIE A;  2QM8 A;  3NXS A;  1GU4 A;  3VYI A;  2Q3I A;  2P7J A;  2ZXE B;  4LC1 A;  1FAV A;  1H88 A;  3I5C A;  3KQG A;  3TK1 A;  2IPP A;  2WPQ A;  5AVR B;  5AVZ B;  3SWF A;  2WT7 A;  5AVU B;  3TYY A;  1MUU A;  5APQ A;  3V5B A;  1MV8 A;  1NWQ A;  3T97 A;  1OWA A;  2N9B A;  3IR9 A;  5AVX B;  1GTW A;  3A2A A;  3M0A A;  3M0D A;  3TNU B;  3P32 A;  1CI6 B;  3V4Q A;  1SLQ A;  5AW5 B;  1A02 J;  4AUW A;  1DH3 A;  3VMX A;  3OAK A;  3VN0 A;  3A3Y B;  2R32 A;  3TNU A;  1CI6 A;  4C46 A;  3A5T A;  2WPR A;  3LID A;  3KDP B;  3UIA A;  5AVV B;  2R3C A;  3HE5 B;  2VRS A;  2XU6 A;  3MGN A;  5APT A;  5APU A;  1S9K E;  3M91 A;  4JYB A;  1T2K D;  2XZR A;  3VMY A;  3L35 A;  5AW3 B;  3V4W A;  4AQR D;  5AW6 B;  1S9K D;  1MFZ A;  3HE5 A;  2Z5I A;  5APY A;  4C7N B;  1A02 F;  2BAS A;  5AVT B;  2YNY A;  3HE4 B;  4GT1 A;  1CSB A;  2Z5H A;  2W27 A;  5AW0 B;  3HTK A;  2P67 A;  3M9B A;  4XE5 B;  5AW7 B;  4C7N A;  1GD2 E;  3NMD A;  3A7O A;  1KQL A;  2YO2 A;  3L36 A;  3M06 A;  4M3L A;  3HE4 A;  1GK4 A;  3VMZ A;  4B86 A;  5AVQ B;  3M9H A;  5AW9 B;  5AVS B;  5APW A;  1T2K C;  2R5D A;  3O8Z A;  1FOS F;  2ZFC A;  3NTN A;  2WPS A;  2C9N Y;  4GKG A;  1X8Y A;  3B8E B;  4KHX A;  4JYC A;  4DZO A;  2E42 A;  5AVW B;  4I6M C;  5AW2 B;  3P8M C;  1J2J B;  3MD0 A;  2E43 A;  2Q7C A;  5CMZ A;  1NAF A;  2P2U A;  2JJL A;  1SP4 A;  2C9L Y;  3L37 A;  3NFQ A;  5APV A;  1JNM A;  2Q5U A;  1G2C B;  3P7K A;  2W6A A;  1H8A A;  1HWT C;  2H7H A;  2R5B A;  1HJB A;  1FOS E;  2WWW A;  4AYC A;  5APX A;  4EOT A;  1IO4 A;  5AW1 B;  5AW4 B;  1GK6 A; 
#chains in the Genus database with same CATH topology
 2QM7 A;  4O9B A;  1AJY A;  3FX0 A;  2FXO A;  1LT9 A;  1OVR A;  5BU5 A;  4L75 A;  1DD3 A;  4U3F E;  1FAV A;  2ZT9 D;  3RBX A;  1MUU A;  4Z1M H;  4IFD K;  3L75 D;  1KZU B;  4KT0 J;  1LP1 B;  2E74 C;  2IFM A;  3M0D A;  2ZXX A;  4CPG A;  1SFC C;  1CI6 B;  4U7J A;  3H1K D;  1EZV E;  3CCE P;  3BCC G;  5B66 E;  2KIK A;  3OAK A;  5CJ4 A;  3WU2 E;  3RK3 E;  3L73 J;  1RE4 C;  1KOR A;  1M1J C;  3MGN A;  1KYO H;  1S9K E;  3M91 A;  2HR3 A;  1URQ D;  4IL6 H;  1S5L X;  2D2C D;  3M9Q A;  3FGA D;  5CBN A;  3FWL A;  2YIU C;  1RY3 A;  3MUD C;  1Q82 Q;  1QVG O;  1ZRT E;  3H1L E;  5H2F E;  4HH2 A;  4NPF X;  1NGM B;  3SSU A;  1T2K C;  3L4F A;  2FXP A;  2N1T A;  3U59 A;  4WVZ A;  1X8Y A;  3L73 D;  4I7Z B;  2NZ2 A;  1BSN A;  2BCC G;  1RF0 C;  1HGV A;  1KIL B;  3Q5S A;  3L37 A;  3R4Y A;  3H1L G;  5CBO A;  2R5B A;  2E76 D;  1BCC J;  1FOS E;  1ZXG A;  1VQL P;  1VQK P;  3CX5 D;  3S4R A;  1EC5 A;  1L0L E;  1ZLL A;  1YYC A;  2KB7 P;  3RK2 C;  5B5E E;  1AVO A;  5KTB A;  1NTK E;  3SWK A;  3CME P;  1SLQ A;  4H13 C;  2WSF J;  1LP1 A;  5KLI B;  1LTG C;  1QGK B;  1PP9 D;  1IJD B;  1CI6 A;  1BCC D;  2IBZ E;  3RL0 C;  2Q3E A;  1X0T A;  1NTK G;  2NPS D;  1KQG B;  2Z5I A;  4C7N B;  1P84 D;  2V7Q H;  3HE4 B;  3G9R A;  2YMK A;  2AXT H;  2WVR A;  1EDL A;  1S2E A;  2SPZ A;  3M9B A;  3TGU E;  2W6B A;  2IBZ I;  1JCC A;  3OW2 O;  4H0L B;  1L2P A;  4IL6 X;  4TT3 H;  2IBZ G;  2A06 E;  1NVO A;  3B8E B;  4PD4 E;  2D2C C;  5E79 H;  1N2D C;  3L71 D;  2CK3 H;  1SP4 A;  3B5N B;  1QLE D;  1JNM A;  1OW8 A;  2WWW A;  1CW5 A;  1RF0 A;  1VPC A;  2C0X A;  3RL0 g;  1KIL A;  1LWU B;  1VDF A;  3TGU G;  1SQV J;  3KXD A;  4L76 A;  2WT7 B;  1NTK K;  3CWB G;  3SWY A;  1L4A D;  5TIS E;  1MFT A;  1VF5 D;  2WSF H;  2GM4 A;  3V4Q A;  4WY4 B;  2WSE J;  1LTB C;  2LKM A;  1SQB E;  3G3Z A;  1IFI A;  1N73 C;  1EXJ A;  2BCC J;  1KN7 A;  2R3C A;  3CI9 A;  5APU A;  4ZMD A;  4N6J A;  1SQV D;  1WMK A;  5CCH D;  4HKZ H;  5M1B A;  1J1D C;  2OTK E;  2M0B A;  1SQX E;  2QG4 A;  2P67 A;  4C7N A;  3IF4 A;  1YIJ P;  3HE4 A;  2LXC B;  1K8A Q;  1ZR2 A;  2Q9I A;  5AVS B;  2NPS C;  4JYC A;  4D6T G;  2QEX P;  1GL2 B;  2W6J H;  1S72 P;  5K5G B;  1J2J B;  1X22 A;  1NAF A;  2WQY C;  2IFN A;  1XTC C;  1R8E A;  1L0N E;  1SQX G;  1UIX A;  1M1K Q;  1KYO E;  3CPW O;  1IO4 A;  4ZNC A;  3B5N A;  3PHL A;  2H43 A;  3AEE C;  2HYN A;  2I8D A;  3L72 E;  2KXP B;  1N7S B;  1LWU A;  2FYU D;  2ZXE B;  3L75 E;  3I5C A;  2HLO A;  3TK1 A;  2IPP A;  1VL2 A;  2WT7 A;  5AVU B;  3PRJ A;  2WSE H;  3II6 A;  1SQB K;  5KLV J;  4NPE A;  1Q86 Q;  2ZVN B;  4AUW A;  3H1H D;  2ZYA A;  5H2F H;  2B89 A;  2ZYG A;  2OYH C;  4WY4 A;  1G1I A;  3CCU P;  3KPE A;  3HE5 B;  3L75 G;  2J59 M;  4AQR D;  3BAT A;  1SQX K;  3H1K G;  1FBM A;  3OJA B;  1XTG B;  3V2Q A;  1U57 A;  2E75 B;  3CWB J;  1GDT A;  4W7Y A;  2Y0C A;  2KLU A;  5GTI H;  2XKM A;  4JBZ A;  5KLV D;  1Z56 A;  3L73 E;  2C9N Y;  1S1C X;  3LW5 J;  3CCQ P;  2JJL A;  5B5E H;  2WSC H;  3NFQ A;  3D70 A;  3KZI E;  1HWT C;  3CX5 E;  1GL2 A;  3RK3 B;  1SQQ J;  1JCD A;  1JY2 N;  2XDJ A;  1HGZ A;  2YO3 A;  1DX7 A;  1E5W A;  3TSI A;  3P8C D;  3L73 G;  1FS0 E;  2M8R A;  2AXT E;  4OGQ B;  2WMM A;  1OMI A;  5KAF E;  2KS1 B;  3AEF C;  1KFN A;  1N7S A;  1QL2 A;  1NOH A;  3VMA A;  2N9B A;  3A0B E;  1JMB A;  1NTM J;  1KC8 Q;  1IFP A;  3V2P A;  3VMX A;  1YIT P;  1BCC E;  1JO5 A;  4D6T J;  2JWA A;  1JY2 O;  2V4H A;  4WB4 A;  1SQQ D;  4Y99 C;  4XFJ A;  3H25 A;  5CCG D;  1SQX J;  1HJ0 A;  1GW4 A;  4R4L A;  3HD7 B;  2DW3 A;  1VQ5 P;  3HE5 A;  3Q5P A;  2KLV A;  3JSV C;  2QSI A;  3CC2 P;  3R2P A;  1PP9 G;  4OH8 B;  4GOF A;  1BCC G;  3HUS B;  1WT6 A;  4OVN F;  3N7N A;  4YXD C;  1P84 I;  1NTM D;  1K05 A;  3FXD A;  1FZB A;  3SFE C;  2E43 A;  2QJY C;  3C8V A;  3L70 D;  2H8P D;  5TIS H;  3WMM 0;  1HJB A;  1OIP A;  2PFX A;  1NHL A;  1VQN P;  5AW8 B;  4UB8 H;  2KSE A;  2XV5 A;  1GZL A;  1HBW A;  3D71 A;  3H1K J;  1PFI A;  1KIL D;  1J1E B;  3L71 G;  3KQG A;  2WPQ A;  1HF9 A;  3G71 P;  1IFD A;  1N86 A;  2JKV A;  1QEX A;  1NU1 J;  1M8O B;  2KS1 A;  1LTI C;  3E1I A;  1YJW P;  1SQV E;  2WPR A;  3LID A;  4PV1 C;  2E74 B;  1SFC B;  2Y0E A;  1FDO A;  3USS A;  3HD7 A;  1FZC C;  1CSB A;  1FE6 A;  1ZP0 C;  5AW0 B;  5AW7 B;  1M1J B;  1EDK A;  2N9Y B;  1SQV G;  1R5S A;  4GOD A;  2O1J A;  1NU1 D;  3HUS A;  2YIU B;  3L74 G;  2XND H;  2BCC E;  1Q2N A;  4KHX A;  1R5L A;  1Y8A A;  1AA0 A;  3AE9 C;  1JB0 J;  2YKQ A;  1Y9B A;  2HFE D;  2HPC B;  4H0L D;  3CC4 P;  1PV3 A;  3E7K A;  2JP3 A;  5AW1 B;  3VTP C;  5AVY B;  2IDB A;  2YKP A;  1CZQ A;  2E5Y A;  3H1I G;  1GU4 A;  1PGP A;  1KV4 A;  4H44 C;  3V2N A;  5KJ7 D;  1VQP P;  4WWI A;  1PP9 J;  5BU8 B;  2WZ7 A;  1MV8 A;  3KYQ A;  5GTI E;  1IZN B;  3C1L A;  4DOJ A;  3G4S P;  2G8Y A;  1YJ9 P;  2FBW C;  1SQV K;  1RE3 C;  4W80 A;  2FYU G;  3RK2 B;  1K73 Q;  3A5T A;  2QJP C;  4OWF A;  2XU6 A;  5GTH E;  4N78 E;  4WY4 D;  1KB9 D;  3BRV B;  4H13 B;  2KYV A;  3Q2Y A;  1A02 F;  2O01 J;  1M7L A;  3H1H G;  2J58 A;  3CXH D;  1SFC A;  3ABV C;  2P1J A;  3MIW A;  5KKZ C;  3L71 J;  3KZI H;  2ZT9 C;  3AE3 C;  1FC2 C;  3RL0 B;  3CX5 H;  2GUV A;  5KLV E;  1GK4 A;  2FYN C;  4ASV A;  1RE4 A;  2BEQ D;  1M1J A;  1LTJ C;  2K1A A;  4A7P A;  2B9B A;  2P2U A;  2W8Z A;  1H8A A;  3MUD A;  5KAF H;  1USD A;  1IFJ A;  2FYU K;  1QVF O;  3A0B H;  2Y9Z A;  3P8C E;  3GMA A;  4KJM A;  1DEB A;  1FZA A;  5KLV G;  1URQ C;  2HPC A;  2D2C B;  1OXZ A;  1GL2 D;  1HUC A;  3CWB E;  1HH0 A;  3VYI A;  1TU3 F;  2HG5 D;  5AVZ B;  1RF1 C;  1HTL C;  1NWQ A;  2K9Y A;  2OYO A;  3CMA P;  3VP8 A;  1P84 H;  3TNU B;  3BRT B;  1RQV A;  4JQ0 D;  3L74 J;  2FXM A;  1SQQ E;  2KZI A;  2K9J B;  3IN6 A;  1PGJ A;  5KJ7 C;  1FJK A;  3CCL P;  1BE3 J;  2E76 C;  2YKO A;  3I56 P;  1AFO A;  3F89 A;  3HTK B;  4UB8 E;  2KI7 B;  1YTZ T;  1KTM A;  3AEC C;  3H1I J;  1SS1 A;  4GT1 A;  1N73 B;  5KLV K;  1PPJ G;  2OTL P;  1OVU A;  1SQQ G;  3NMD A;  1NTM E;  1OZH A;  3CCR P;  3FXE A;  4XA4 A;  4D6T E;  3U1A A;  2IZ0 A;  3O8Z A;  2ZFC A;  4IFM A;  3L74 D;  1J1D B;  3MHV A;  2E42 A;  5CJ0 A;  4I6M C;  4NPD A;  4K35 A;  1USE A;  2E75 D;  2MKV A;  2FYU J;  3P7K A;  2H88 C;  1BE3 D;  3IAO A;  3GHG C;  3S9O A;  2OTJ P;  3CCM P;  1NTM G;  2NPS B;  4TLF A;  3H1I D;  1GU5 A;  2OQQ A;  2W90 A;  1W5C E;  1KD1 Q;  1FJP A;  1EZV D;  4LC1 A;  1KQS O;  3H1H J;  2W83 C;  5AVR B;  3AED C;  3B4S A;  3L70 G;  3RK3 D;  3VP9 A;  1YQ4 C;  1VQ8 P;  1YTZ I;  3GF3 A;  1SQQ K;  1IFM A;  1PZQ A;  5KAI E;  4L74 A;  3CLQ A;  3VN0 A;  2UWJ E;  2FFD C;  3TNU A;  3WUT A;  3AE6 C;  3V2R A;  4JYB A;  2K9J A;  2OYI C;  3W68 A;  3H1K E;  2ZJS E;  3JC2 2;  3CCV P;  1JY3 N;  5CHX A;  2YXQ B;  2WPV B;  5AVT B;  1NTM K;  2W27 A;  2OYH B;  1M90 Q;  3HTK A;  4GOE A;  4HJG H;  1M57 D;  1KQL A;  1VQM P;  1L4A C;  1NU1 E;  3HD7 D;  1VF5 C;  1N73 A;  3AEA C;  3M9H A;  3FWN A;  1MZ9 A;  5DJU B;  2QIW A;  4DZO A;  1K9M Q;  1L0L D;  4JF7 A;  3AE7 C;  2LR2 A;  3Q1M A;  1NO4 A;  4AYC A;  1JY3 O;  1W2B O;  2QJK C;  1U7J A;  5AW4 B;  2ZVO B;  4YXW H;  2BEZ F;  3GHG A;  1NU1 G;  5CCH C;  4I1L A;  1EQ7 A;  3GLM A;  1NH4 A;  3E1R A;  2Q3I A;  4LLH A;  5C39 A;  2NPS A;  3QH9 A;  1G1J A;  1JTH B;  2N1T D;  1T6A A;  2FKW B;  5GTH H;  2AEJ A;  3M0A A;  1PIX A;  4RJT A;  1A02 J;  1DD4 A;  3TF5 A;  1QX8 A;  1T8Z A;  5EFW B;  1LTA C;  1JMM A;  1W2E A;  3EFG A;  1Y47 A;  1PL5 A;  2QVA A;  3L35 A;  5AW3 B;  3V4W A;  2A45 I;  3K5B A;  3CXH E;  1PP9 E;  1AV1 A;  3N4X A;  1LTS C;  2A06 D;  2YNY A;  4ASW A;  4PD4 D;  2A45 G;  1NU1 K;  1PPJ D;  2JR8 A;  4Y99 B;  1EXI A;  2E74 D;  3A7O A;  1AQT A;  3L70 J;  1KB9 I;  2OYH A;  1LT9 C;  1MKM A;  1P84 E;  4IFF A;  3CXH I;  4EIJ A;  3P8M C;  1S3J A;  1RHZ B;  2Q5U A;  4YPC A;  3M0D C;  3D6Y A;  3AE2 C;  3KHU A;  3LW5 H;  2R44 A;  2M3E A;  4RKU J;  4C7R A;  1H89 A;  3L71 E;  1HVV A;  1NKZ B;  3B71 A;  3NXS A;  2KUB A;  2QJY B;  1JM0 A;  1QL1 A;  1SQB D;  2B87 B;  5BVZ A;  3I55 P;  5AVX B;  2JDI H;  1GTW A;  1JTH A;  1PGQ A;  2YMY A;  3O6Q A;  1Q81 Q;  1Q90 D;  5AVV B;  2N1T C;  3EFF K;  1U7M A;  1NJI Q;  2G3A A;  1Q7Y Q;  4W7Z A;  2LXB A;  3RK2 D;  2Z5H A;  3PLN A;  1LTT C;  5DJT B;  4PV1 B;  3PJS K;  1LGH B;  3L36 A;  3M06 A;  4M3L A;  4B86 A;  1L0N D;  3L74 E;  1G2C A;  4H13 D;  2MJZ A;  1KYO D;  1FOS F;  4L73 A;  2PGD A;  1FZC B;  3L72 D;  2B88 A;  1BGY J;  1JOC A;  1BE3 E;  1SQP J;  3RL0 D;  3AE4 C;  4DCK A;  2HOD A;  3H1I E;  4ZKP A;  4EOT A;  5CCG C;  4HYT B;  4RES B;  5KAI H;  2I1J A;  2WSS H;  3T97 B;  2CPS A;  3CCS P;  1OW6 A;  1S4X A;  2JWD A;  3SWF A;  4BWN A;  1OX3 A;  4U3F G;  1M56 D;  1BE3 G;  1OWA A;  1YQ3 C;  1JY2 P;  2PAJ A;  1EZV I;  2FYU E;  1BDD A;  2GUS A;  2B87 A;  1BGY D;  1OFC X;  4H44 B;  1SQP D;  1EZV G;  3B5N D;  2V7Q J;  3UIA A;  2L5G B;  1YJN P;  1SVF A;  4R4M A;  2KNC B;  1IC2 A;  1NTZ J;  1OVV A;  5AW6 B;  4GDO A;  2PRR A;  3H1H E;  1MFZ A;  1DEE G;  5APY A;  2C0W A;  2RN0 A;  4I7Z C;  1KIL C;  2QJP B;  2YO2 A;  1FU1 A;  2R5D A;  1VQ7 P;  2OAR A;  1ZR4 A;  2RKL A;  4DJG A;  5KKZ B;  2PP6 A;  1LNQ A;  1EDJ A;  5APV A;  2ZT9 B;  4BXL A;  2FYZ A;  2FYN B;  1FZC A;  2AEF A;  1VQO P;  1NTZ D;  2M5A B;  2KP8 A;  3JCU E;  2O01 N;  2A45 H;  1LTJ B;  1JEK A;  3MZW B;  5CCG A;  4RO0 A;  5KLI C;  3F5H A;  1L0L G;  2P7J A;  4BRY B;  4UB6 H;  5TJH A;  3PH0 A;  1K04 A;  3H1J J;  3T97 A;  1KB9 H;  2P58 A;  3A2A A;  3V6I A;  1URQ B;  2H89 C;  3CXH H;  4EYY Q;  2IYP A;  3CCJ P;  1RF1 B;  1DIP A;  1T3U A;  2M3B A;  5L8R J;  1AQ5 A;  3D6Z A;  1OW7 A;  2XZR A;  4H0L C;  3CD6 P;  1ZN5 A;  1S5L E;  1FZE A;  3AE8 C;  3CL3 D;  1PPJ E;  1N7S D;  3BCC J;  2KNC A;  2P10 A;  2Y9Y A;  1YI2 P;  3B5N C;  4PJ0 H;  2L91 A;  4DT0 A;  3H1J D;  2Y0D A;  1RE3 A;  4U3F J;  1ZV8 A;  2E76 B;  1L0L K;  1LT1 A;  1YHQ P;  2O01 H;  1N8R Q;  1LWU C;  4PD4 I;  2ITA A;  3MTU E;  4GKG A;  1H0T B;  3Q3D A;  1IFN A;  2A06 G;  5AVW B;  2ZAE B;  1ZOY C;  3G6E P;  2CPB A;  3AE1 C;  3AEG C;  2H7H A;  1GW3 A;  3BCC D;  1NAY A;  4WY4 C;  5APS A;  2QM8 A;  3ZDM A;  1UII A;  3L70 E;  2M5A A;  1H88 A;  3BVH A;  4N3Y B;  1LTJ A;  4K3A A;  4U3F D;  2IYO A;  3H1L J;  3GHG B;  2GA1 A;  4BRY A;  3H6P A;  4ZKU A;  3GG2 A;  1EDI A;  1KIL E;  3IFM A;  2R3S A;  4IOI H;  3A0H H;  3A3Y B;  1URQ A;  1FDM A;  3EWK A;  1SQB G;  2QE7 H;  3KDP B;  5APT A;  3ITK A;  2JEE A;  1RF1 A;  1KQF B;  1S9K D;  3U1C A;  3VOP A;  2KSJ A;  4GIF A;  3RBZ A;  2K88 A;  1RQU A;  1KFM A;  1GL2 C;  2FFD B;  2BCC D;  1T3J A;  4OGQ D;  1L0L J;  2AXC A;  4EI2 A;  1ZRT D;  3H1L D;  2KZJ A;  1GD2 E;  3CC7 P;  1RH5 B;  2OYI B;  3VMZ A;  2FY8 A;  2WSC J;  1BDC A;  5APW A;  1PGO A;  5KJ7 A;  4IL6 E;  1ZW0 A;  2JO1 A;  1NTK J;  1BSH A;  2WPS A;  3W67 A;  5B66 H;  2KK7 A;  3WU2 H;  5AW2 B;  1N7S C;  2KOG A;  2C9L Y;  3GW6 A;  1H0T A;  1L4A B;  1FDI A;  1VF5 B;  1KYO I;  3MP7 B;  3AE5 C;  1L0N G;  2Q1K A;  1JUN A;  1FZF A;  2WTY A;  3LIE A;  1YBK A;  3L72 G;  3H32 B;  5APQ A;  3V5B A;  1VQ6 P;  2QJK B;  2O1K A;  3TDK A;  3BAS A;  1NTK D;  1BGY E;  3TGU J;  3SFD C;  3P32 A;  1VQ4 P;  2IZ1 A;  4N78 D;  3WUV A;  1SQP E;  5AW5 B;  2AEM A;  1DH3 A;  2R32 A;  2IX7 C;  2E75 C;  4EDF A;  2E5T A;  3O6Q B;  2IBZ D;  2J5U A;  1X9V A;  1BGY G;  1L0N K;  1GMJ A;  1SQP G;  4UB6 E;  4XE5 B;  3WUU A;  3RK3 C;  1IK9 A;  2FFD A;  1D7M A;  1AVY A;  1KB9 E;  3TGU D;  5AW9 B;  2OGU A;  2QA4 P;  3OA7 A;  3JCU H;  2Z4E A;  1KMI Z;  2K37 A;  2OYI A;  1IK7 A;  2K3R A;  3GF7 A;  2QRX A;  3MD0 A;  3HRN A;  4PV1 D;  3CWB D;  4LGD E;  1G2C B;  3CX5 I;  1NTZ E;  2XNX A;  4OGQ C;  4WBA A;  1SQB J;  1LT9 B;  1SFC D;  1GK6 A;  1E79 H;  4I2L C;  1L4A A;  3Q5R A;  1N7L A;  5E79 E;  2O3J A;  2ZYD A;  2HOD B;  1WRG A;  3TYY A;  4PJ0 E;  2Q6Q A;  3H32 A;  3S1K A;  1SQP K;  3IR9 A;  1NTZ G;  3HD7 C;  3AEB C;  1NKN A;  1S5L H;  4PD4 H;  3RGU A;  3C9I A;  1X79 B;  3PP5 A;  5CCH A;  4C46 A;  2NRG A;  3HUS C;  3PTZ A;  2VRS A;  3QWO C;  1T2K D;  2I1K A;  3VMY A;  4YTP C;  1L0N J;  2RH0 A;  4H44 D;  4D6T D;  2BAS A;  3H1J E;  4MN4 C;  3L72 J;  4JPZ B;  4HB1 A;  1SQX D;  2N1T B;  2RMZ A;  1NYH A;  2WIT A;  3L75 J;  5AVQ B;  2YXR B;  3NTN A;  1LJ2 A;  1NTZ K;  1ZME C;  1JY3 P;  1VQ9 P;  2Q7C A;  5CMZ A;  3A0H E;  1J1E C;  3EQ2 A;  2W6A A;  2POH A;  4Y28 J;  1FZG A;  5APX A;  3H1J G;  4QMA A;  3BCC E; 
#chains in the Genus database with same CATH homology
 1HGZ A;  2QM7 A;  2YO3 A;  1DX7 A;  2KP8 A;  1E5W A;  2NPS B;  2A45 H;  1LTJ B;  4O9B A;  3TSI A;  1GU5 A;  3P8C D;  5CCG A;  1LT9 A;  5BU5 A;  1FJP A;  2P7J A;  4LC1 A;  1FAV A;  2M8R A;  5AVR B;  3RK3 D;  3VP9 A;  1MUU A;  4IFD K;  1KZU B;  1KFN A;  1N7S A;  3T97 A;  1QL2 A;  1NOH A;  2N9B A;  1YTZ I;  2IFM A;  3A2A A;  3M0D A;  1URQ B;  1SFC C;  1SQQ K;  1CI6 B;  1IFM A;  3V2P A;  3VMX A;  3CLQ A;  1JO5 A;  3OAK A;  3VN0 A;  5CJ4 A;  2FFD C;  3TNU A;  1JY2 O;  1RF1 B;  4WB4 A;  1T3U A;  2M3B A;  4Y99 C;  1RE4 C;  1AQ5 A;  1M1J C;  3MGN A;  3V2R A;  5CCG D;  1S9K E;  3M91 A;  1GW4 A;  4JYB A;  2OYI C;  2XZR A;  3HD7 B;  1URQ D;  1ZN5 A;  3M9Q A;  1FZE A;  3CL3 D;  3HE5 A;  1RY3 A;  1JY3 N;  5CHX A;  2KLV A;  1N7S D;  5AVT B;  3R2P A;  4HH2 A;  1NTM K;  2W27 A;  2OYH B;  3HTK A;  4OH8 B;  3B5N C;  3HUS B;  1KQL A;  1RE3 A;  1L4A C;  1ZV8 A;  1WT6 A;  1L0L K;  3HD7 D;  1N73 A;  3N7N A;  3M9H A;  1T2K C;  2O01 H;  1LWU C;  3L4F A;  1MZ9 A;  2N1T A;  3U59 A;  3MTU E;  4GKG A;  1X8Y A;  1FZB A;  4DZO A;  1IFN A;  5AVW B;  2E43 A;  1RF0 C;  1HGV A;  1KIL B;  4JF7 A;  3L37 A;  2H8P D;  2R5B A;  3WMM 0;  1NO4 A;  1HJB A;  1FOS E;  4AYC A;  1NHL A;  2CPB A;  1JY3 O;  5AW4 B;  2H7H A;  5AW8 B;  2XV5 A;  3GHG A;  5CCH C;  4I1L A;  1GZL A;  1EQ7 A;  1GW3 A;  4WY4 C;  1HBW A;  1ZLL A;  1NH4 A;  1YYC A;  5APS A;  2QM8 A;  1PFI A;  1KIL D;  2Q3I A;  2KB7 P;  1H88 A;  1J1E B;  4LLH A;  3BVH A;  3RK2 C;  3KQG A;  2NPS A;  4N3Y B;  1LTJ A;  1G1J A;  2WPQ A;  5KTB A;  1JTH B;  2N1T D;  1IFD A;  3GHG B;  2FKW B;  3H6P A;  1N86 A;  3M0A A;  4ZKU A;  1SLQ A;  1A02 J;  3IFM A;  1LTI C;  1LTG C;  1T8Z A;  3E1I A;  3A3Y B;  1IJD B;  1URQ A;  1CI6 A;  1FDM A;  2WPR A;  3LID A;  3KDP B;  1LTA C;  3RL0 C;  1JMM A;  5APT A;  1W2E A;  3EFG A;  2JEE A;  3L35 A;  5AW3 B;  1RF1 A;  3V4W A;  1SFC B;  2NPS D;  2A45 I;  1S9K D;  3U1C A;  3VOP A;  2KSJ A;  2Z5I A;  3N4X A;  4C7N B;  4GIF A;  1LTS C;  1KFM A;  2YNY A;  3HD7 A;  1GL2 C;  3HE4 B;  1CSB A;  2FFD B;  1FZC C;  2A45 G;  5AW0 B;  1T3J A;  1NU1 K;  4Y99 B;  3M9B A;  5AW7 B;  1GD2 E;  2W6B A;  3A7O A;  1M1J B;  1JCC A;  2OYI B;  3VMZ A;  2OYH A;  1LT9 C;  5APW A;  5KJ7 A;  2O1J A;  4IFF A;  3HUS A;  2WPS A;  4EIJ A;  3B8E B;  4KHX A;  5AW2 B;  3P8M C;  1N7S C;  1N2D C;  2KOG A;  2YKQ A;  1SP4 A;  2C9L Y;  3B5N B;  2HFE D;  1JNM A;  2Q5U A;  3M0D C;  1L4A B;  2WWW A;  2HPC B;  1CW5 A;  1RF0 A;  1VPC A;  2C0X A;  3LW5 H;  1KIL A;  5AW1 B;  1LWU B;  1VDF A;  3VTP C;  5AVY B;  1JUN A;  2YKP A;  1CZQ A;  1FZF A;  2WTY A;  4C7R A;  2WT7 B;  1H89 A;  1HVV A;  1NKZ B;  3LIE A;  1GU4 A;  3NXS A;  3H32 B;  1NTK K;  3V2N A;  5KJ7 D;  1QL1 A;  3SWY A;  1L4A D;  5BU8 B;  2WZ7 A;  5APQ A;  3V5B A;  1MV8 A;  3KYQ A;  5BVZ A;  2WSF H;  2O1K A;  5AVX B;  1GTW A;  3BAS A;  2GM4 A;  1JTH A;  3P32 A;  4N78 D;  4DOJ A;  3V4Q A;  4WY4 B;  5AW5 B;  2YMY A;  1DH3 A;  1SQV K;  1LTB C;  1RE3 C;  4W80 A;  2LKM A;  3RK2 B;  3G3Z A;  1IFI A;  2R32 A;  1N73 C;  2IX7 C;  3A5T A;  5AVV B;  2N1T C;  2R3C A;  3CI9 A;  2XU6 A;  5APU A;  4N6J A;  4N78 E;  5CCH D;  4W7Z A;  4WY4 D;  3BRV B;  1X9V A;  1J1D C;  2KYV A;  1A02 F;  1L0N K;  3RK2 D;  1M7L A;  2J58 A;  2Z5H A;  1SFC A;  2P67 A;  1LTT C;  2P1J A;  3MIW A;  4XE5 B;  4C7N A;  3RL0 B;  1LGH B;  2GUV A;  3L36 A;  3M06 A;  4M3L A;  3HE4 A;  1GK4 A;  1IK9 A;  3RK3 C;  2FFD A;  4B86 A;  1ZR2 A;  2Q9I A;  5AW9 B;  5AVS B;  1G2C A;  3OA7 A;  1RE4 A;  2MJZ A;  1FOS F;  2Z4E A;  1M1J A;  2NPS C;  1LTJ C;  2OYI A;  4JYC A;  1GL2 B;  1FZC B;  1J2J B;  3MD0 A;  3HRN A;  1NAF A;  1JOC A;  2P2U A;  2IFN A;  1XTC C;  4LGD E;  3RL0 D;  1H8A A;  1G2C B;  2XNX A;  3MUD A;  4WBA A;  1IFJ A;  2HOD A;  2FYU K;  1LT9 B;  4ZKP A;  4EOT A;  1IO4 A;  3P8C E;  1SFC D;  3B5N A;  5CCG C;  1GK6 A;  2H43 A;  1DEB A;  1FZA A;  4I2L C;  2HYN A;  1URQ C;  1L4A A;  4HYT B;  2HPC A;  1OXZ A;  1GL2 D;  4RES B;  1N7L A;  1HUC A;  2I1J A;  1HH0 A;  1N7S B;  3VYI A;  1LWU A;  2ZXE B;  2HOD B;  2CPS A;  2HG5 D;  3I5C A;  2HLO A;  3TK1 A;  2IPP A;  5AVZ B;  3SWF A;  2WT7 A;  1RF1 C;  1WRG A;  5AVU B;  3TYY A;  1HTL C;  1NWQ A;  3H32 A;  1OWA A;  2WSE H;  1SQP K;  3IR9 A;  3HD7 C;  1JY2 P;  3VP8 A;  2PAJ A;  3TNU B;  1NKN A;  3II6 A;  3BRT B;  1SQB K;  2GUS A;  4AUW A;  2FXM A;  3C9I A;  1X79 B;  3PP5 A;  5CCH A;  3B5N D;  2OYH C;  4C46 A;  4WY4 A;  5KJ7 C;  1G1I A;  3KPE A;  3UIA A;  3HUS C;  1FJK A;  3HE5 B;  2VRS A;  2L5G B;  1T2K D;  2J59 M;  1SVF A;  2I1K A;  3VMY A;  1IC2 A;  2YKO A;  4AQR D;  5AW6 B;  1AFO A;  3BAT A;  3HTK B;  1SQX K;  1YTZ T;  1MFZ A;  5APY A;  2C0W A;  2BAS A;  4GT1 A;  1FBM A;  1N73 B;  3OJA B;  5KLV K;  1XTG B;  3V2Q A;  1KIL C;  2N1T B;  1GDT A;  4W7Y A;  3NMD A;  2YO2 A;  2XKM A;  2WIT A;  1FU1 A;  5AVQ B;  2R5D A;  4XA4 A;  3U1A A;  1Z56 A;  3O8Z A;  2ZFC A;  3NTN A;  4IFM A;  1J1D B;  2C9N Y;  2OAR A;  2E42 A;  1NTZ K;  1ZR4 A;  1JY3 P;  5CJ0 A;  4I6M C;  2Q7C A;  5CMZ A;  2JJL A;  1J1E C;  2PP6 A;  2WSC H;  3NFQ A;  5APV A;  2FYZ A;  3EQ2 A;  3P7K A;  2W6A A;  2POH A;  1HWT C;  1FZG A;  1GL2 A;  5APX A;  1JCD A;  3RK3 B;  1FZC A;  3GHG C;  1JY2 N;  2XDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...