2KP8A

Ligand bound to a model peptide that mimics the open fusogenic form
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
72
structure length
72
Chain Sequence
TSLIHSLIEESQNQQEKNEQELLELDGDGPQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Non-peptide entry inhibitors of HIV-1 that target the gp41 coiled coil pocket.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords Model peptide
total genus 32
structure length 72
sequence length 72
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2kp8A00
2H7HA 2VRSA 3V4WA 3L37A 1FAVA 2XU6A 1H89A 3V5BA 4HYTB 1GU5A 1G2CB 1OWAA 1HBWA 4JYCA 2XZRA 2WPSA 3VMZA 3A5TA 2P7JA 4GKGA 5APSA 4I2LC 2QM7A 4I6MC 3M06A 1MFZA 3NMDA 5APUA 5APXA 2WT7B 3I5CA 1J2JB 1GK4A 3VMXA 3B8EB 4KHXA 3NTNA 2YO2A 1MV8A 3VTPC 2R32A 4C7NB 5AVXB 2P67A 3HE5A 5CMZA 2C9LY 3P7KA 3O8ZA 5AVSB 5AW9B 3KQGA 2C9NY 1HJBA 5AVZB 1HWTC 4AUWA 1FOSE 3IR9A 1A02J 1S9KE 4JYBA 3L35A 2ZFCA 3A3YB 1OXZA 4RESB 5AW3B 3P8MC 2Q7CA 4C7NA 1GTWA 2KP8A 5AVUB 1KQLA 2P2UA 1JUNA 1NAFA 1T2KD 3L36A 1GD2E 4C46A 2QM8A 2E43A 4AYCA 2WPQA 1S9KD 3UIAA 2JJLA 2BASA 5AW0B 2E42A 5AW7B 2W27A 5AVQB 5APVA 5AVWB 1JNMA 1GZLA 2XV5A 1CI6A 2Z5IA 5APWA 3M9BA 1DH3A 4LC1A 3MD0A 3M91A 2ZXEB 5AVTB 1A02F 1FOSF 2R3CA 3OAKA 1CZQA 3P32A 1GU4A 2YNYA 1YYCA 3HE4A 5AW2B 5AW1B 1SLQA 4AQRD 3HTKA 5AVYB 1HUCA 1T2KC 2Z5HA 4EOTA 4B86A 1CI6B 5APYA 2R5BA 5AW6B 4DZOA 1X8YA 2YO3A 2N9BA 3KDPB 2WWWA 3TNUA 2W6AA 2Q3IA 3T97A 4XE5B 2Q5UA 3LIEA 1IO4A 5AVRB 3A7OA 5APTA 3M0AA 2R5DA 1NWQA 1H8AA 3TYYA 1GK6A 3VYIA 3M9HA 3LIDA 3NXSA 3TNUB 3VN0A 1SP4A 1CSBA 5AW5B 3NFQA 2WT7A 3VMYA 4M3LA 2IPPA 1MUUA 5APQA 5AW4B 1H88A 3TK1A 2WPRA 3SWFA 3A2AA 5AVVB 5AW8B 3HE5B 3M0DA 3HE4B 3V4QA 4GT1A 2WTYA 3MGNA
chains in the Genus database with same CATH superfamily
2K3RA 3Q5SA 1DIPA 2B88A 1KILD 2WSCJ 1H0TB 3RK3E 1IJDB 5KTBA 3V4WA 2OYIB 1PP9E 1SQPE 2CPSA 1KYOI 1SVFA 1YTZT 2N1TA 2H88C 3LW5J 4IOIH 2XU6A 2FFDA 1WT6A 2V4HA 2C0WA 4H0LD 3CCUP 3U1CA 1G2CB 1Y9BA 2O01H 2C0XA 4D6TE 3B4SA 1J1EB 2M0BA 2FYNB 2WPSA 1T6AA 3A5TA 3P8CD 3HUSA 1VL2A 2FBWC 2ZT9D 3AE8C 1SQVG 1NTME 1LTIC 1NTKE 3L4FA 4L75A 2KIKA 1LWUC 3B5NC 2HR3A 2HODA 3AE5C 3L74G 1L4AB 3BRTB 1U7JA 1KQFB 1L2PA 2QJKC 2XKMA 3Q2YA 1S5LX 1L0LK 1BE3J 3I5CA 1N7SB 4WY4C 4C7RA 1VQPP 1JOCA 1SS1A 2QRXA 3B8EB 4H44D 4Y99B 1MFTA 4OH8B 1VQNP 1KB9D 2QIWA 5KLIC 3L70G 2YO2A 4WY4B 1NAYA 2IX7C 3VTPC 1K73Q 2J5UA 2P67A 1BGYE 1LTAC 2IFNA 3IN6A 3P7KA 5CCGC 3KQGA 4LLHA 3SWYA 3I56P 1N8RQ 4ZNCA 2NPSA 1IC2A 2AXTH 3KYQA 4TT3H 1LTGC 5CHXA 4RO0A 3IR9A 1FOSE 3W68A 1JTHB 2GM4A 1M7LA 3L75D 1OIPA 3L70E 2B87B 4GOFA 1LT9C 3CXHE 2ZYDA 4YTPC 3VMAA 2OTJP 2XNDH 1NKNA 3A3YB 1OXZA 4RESB 3H1LJ 3P8MC 1OZHA 3CXHI 2KP8A 3A0HH 4BRYB 3B5ND 1FZCB 1JCCA 3AECC 1USDA 1IFIA 2ZXXA 3AE4C 2KZJA 2M5AA 3VYIA 3WUTA 1NAFA 1NTKG 2IBZI 3AE6C 3L36A 3I55P 1ZR4A 5B66H 1T2KD 2WSEJ 3PP5A 1JO5A 3CD6P 1ZMEC 2NPSC 3A0BE 1FZBA 2E74C 3CCRP 4H13B 2K9JB 5AW0B 2QJPC 1JY3N 1AJYA 3AEEC 5APVA 5AVWB 1J1DB 1NTZD 2KS1A 1NTZK 1AVOA 1NTZG 2V7QJ 4YXWH 1LJ2A 1SQPG 1CI6A 1S2EA 2D2CC 3GHGB 4LC1A 3MD0A 1OX3A 2A06D 1N7SD 2NRGA 1S3JA 1EDIA 3FWLA 3H1KD 1A02F 2R3CA 3OAKA 4IFDK 3V2QA 3P32A 4BRYA 2O01J 4Y99C 2M3BA 2Q3EA 1W2EA 2KSJA 3L72D 3HTKA 1PL5A 1HUCA 2AXTE 5AVYB 2QJKB 2KNCA 4B86A 3AE7C 1U57A 3MHVA 3OA7A 3G9RA 4H0LC 4PD4D 5APYA 1KN7A 4W7YA 1RE3A 3H1LD 5H2FE 1L0LD 2N9BA 3E1RA 1EDLA 2OTLP 2Q3IA 2Q5UA 2K88A 1NU1G 2JR8A 1L0NE 1IFPA 1AVYA 1T3UA 1SQQE 3A7OA 5K5GB 4O9BA 3M0AA 5APTA 1PZQA 4BWNA 2KB7P 2WMMA 3CWBE 5KAFH 3QH9A 3G6EP 2OYIC 1LT1A 3M9HA 2Y0CA 3LIDA 3TNUB 1ZP0C 5M1BA 4BXLA 2BCCG 2GUVA 4KJMA 1L0LE 2WT7A 4DJGA 1N73A 1JEKA 2K1AA 1N7SA 1MUUA 2YXQB 3L72J 4IL6X 3V2NA 1SFCB 3TK1A 5CCHC 1VQ5P 1VQ9P 4R4LA 4H13D 1EDJA 1KQSO 2W90A 3OW2O 1VQ6P 2UWJE 1LTBC 1X0TA 1YTZI 2JEEA 5AVVB 1GD2E 1UIXA 3V4QA 3Q3DA 3HD7D 2E74B 5KJ7C 4GT1A 4I7ZC 3VOPA 2IYPA 1OVRA 4UB6H 2Y9YA 1YIJP 3PLNA 3TGUJ 1H88A 3CXHH 1KILB 2CK3H 3L37A 1RF1C 5KKZC 1FAVA 1L4AA 1EZVE 2WSSH 3M0DC 3RK3C 3TGUD 1EDKA 1H89A 4HYTB 1NTKD 4W80A 1VF5C 3H1LG 1PPJD 3BASA 2CPBA 2I1KA 4ASWA 1FZCA 1NHLA 4JQ0D 1URQC 3USSA 1NU1K 1KFNA 1KMIZ 2O1KA 2XZRA 3G3ZA 1YHQP 2H43A 2ITAA 3CX5H 1K8AQ 2QE7H 1BCCD 1VF5D 1U7MA 3BVHA 2AEMA 3MP7B 2QM7A 4I6MC 2ZYGA 3H1HG 2Y9ZA 2OYIA 1BSHA 2AEJA 2OQQA 4QMAA 1KYOD 1AA0A 2OGUA 4JF7A 5APXA 1JM0A 1LTSC 1J2JB 1M56D 1NTZJ 1Z56A 2E5YA 2I8DA 3VMXA 4GOEA 2IZ1A 3C9IA 1OW6A 1PV3A 2R32A 3L70D 3L75E 3L71G 5AVXB 2KSEA 2E5TA 3TDKA 1R8EA 5AVSB 5KLVG 2G3AA 3O6QA 3PJSK 3CCSP 1SQBG 3CWBG 2IBZE 1FOSF 2LR2A 2HODB 3F89A 4ZMDA 3Q5PA 1IFNA 1HWTC 2PAJA 3V2RA 3B71A 4WWIA 3CCLP 2OYHC 4UB8H 1NGMB 1L4AD 2HG5D 3H6PA 3OJAB 1URQD 2WSEH 2ZFCA 2KK7A 1E79H 1PGPA 1RQVA 4WVZA 1FE6A 1LTJB 1TU3F 1NH4A 1NVOA 2K9YA 2W8ZA 3MUDC 3RBZA 2P10A 3KHUA 3V2PA 1JUNA 4HH2A 1SQQD 3WUUA 3AEGC 1LT9A 1KFMA 2H89C 3HD7A 3RL0g 3RBXA 5KLVE 1GW3A 2WSCH 4AYCA 2B87A 3L74J 1FJKA 2OYOA 2E42A 1Q81Q 1JY2P 2W27A 1PPJE 2YIUC 1LWUB 3B5NB 3H1LE 4NPDA 5AVQB 5KAIE 2XV5A 5KAFE 5BU5A 1JNMA 3L74D 1EXIA 1DX7A 1KYOE 1Y8AA 3GF3A 3TF5A 2M5AB 2Z5IA 3L70J 4R4MA 3F5HA 4EDFA 2A45H 2GUSA 1FDMA 5BU8B 4XA4A 3FWNA 1SFCA 1VQOP 3D71A 1BCCE 2WVRA 4GDOA 5AVTB 5KKZB 4N6JA 2M3EA 5DJUB 1CZQA 4ZKPA 4UB8E 1PFIA 1GL2B 4RJTA 4JBZA 1RF1B 1JY2N 1M90Q 1RE4C 1X22A 4I7ZB 1FS0E 1URQA 2FXMA 4L76A 1CI6B 2LXCB 3E7KA 2R5BA 5AW6B 4DZOA 2Q1KA 1KILA 4EIJA 2MKVA 2YO3A 2ZVOB 3D70A 2A45G 3II6A 1IFDA 2G8YA 3D6YA 2N1TC 1NTKJ 3CX5I 1P84E 3T97A 2JO1A 2MJZA 1KZUB 2L5GB 1LP1A 5AVRB 2LKMA 4I1LA 2QG4A 3HTKB 3SSUA 2P1JA 3AEDC 4OWFA 2HFED 2R5DA 1ZN5A 2E74D 4IFMA 4Y28J 3TYYA 3KPEA 1NTMK 1BCCJ 1SQPJ 1BGYD 1PP9J 1FU1A 2IFMA 3FGAD 3H32A 1JY3P 3KZIE 4K3AA 1FJPA 1SP4A 1CSBA 1KB9E 3VMYA 4M3LA 4XFJA 5AW4B 2YMKA 5B66E 2DW3A 2IBZD 3AEAC 1VQ7P 1S72P 1JMMA 4EOTA 4PV1C 1ZW0A 2AEFA 3G71P 2RN0A 4ASVA 1SQPK 3L74E 1QX8A 1VPCA 1L0NG 2SPZA 5KLVJ 5CBOA 1NTMD 3MGNA 4DOJA 1NTMG 4H44C 1P84I 1AV1A 5GTHE 3PTZA 5B5EE 1EC5A 1HJ0A 2H7HA 2VRSA 4PJ0H 3S1KA 3BCCG 1R5LA 4OGQC 4WB4A 1EQ7A 3GW6A 3CCVP 4PD4E 4IL6H 3V5BA 1LTJA 2XNXA 1IZNB 2JWDA 3CCMP 4PV1D 4L74A 1GDTA 3JCUH 1DD3A 1HBWA 1XTCC 3KZIH 1JCDA 3GHGC 2BEQD 4JYCA 3RK2B 3G4SP 2W83C 2YIUB 3ITKA 1XTGB 1N73C 5APSA 4CPGA 1EZVG 1OMIA 5CJ0A 1EZVD 4I2LC 2A06E 2PRRA 3M06A 2A45I 1MFZA 3L75J 2QJPB 5E79H 1Q2NA 2O1JA 4H13C 5APUA 2WT7B 3L72G 2OYHA 1NTZE 1FBMA 1QVFO 3CC7P 1ZXGA 4KHXA 3H1JE 3NTNA 1FZCC 2NZ2A 2I1JA 1VQ8P 1JB0J 1PIXA 1BDCA 3E1IA 5CMZA 5KLVD 3O8ZA 3RL0B 5CCGA 2FFDC 3AEFC 3L73J 1M1JA 4TLFA 1KD1Q 1LT9B 1HJBA 2WQYC 3FX0A 5AVZB 2FXPA 1ZLLA 1L0ND 3AE2C 1YBKA 4W7ZA 2RH0A 2Y0DA 3C8VA 1X9VA 4WBAA 3H1JG 4JYBA 1A02J 1NJIQ 1P84D 3L35A 1AQTA 4NPFX 5AW3B 1LGHB 1ZV8A 2Q7CA 4C7NA 1GTWA 2KUBA 3KXDA 5AVUB 5KLIB 2P2UA 2AXCA 2QVAA 4N3YB 3RGUA 1OFCX 1M57D 1NTKK 1W5CE 3TGUE 1SQXG 2E76D 2XDJA 3TSIA 2FXOA 3Q5RA 3QWOC 3CCJP 1FZAA 1SQPD 2QM8A 2WSFH 1QEXA 2KZIA 3CC2P 3H1HJ 1YQ4C 2WPQA 1KC8Q 1KB9I 1S9KD 1LTJC 3AE9C 1M1JC 3C1LA 2JP3A 1EXJA 1L4AC 2KOGA 1Y47A 1OW8A 3LW5H 3L73D 3CPWO 2FYNC 1ZR2A 1GZLA 4Z1MH 1SQQK 1SQBK 1URQB 3BCCE 3L72E 2Q6QA 3PH0A 5APWA 1L0LJ 3M9BA 3W67A 1RHZB 3HD7B 1J1EC 2FYUK 3L71J 5BVZA 4EYYQ 1K04A 1BE3D 3O6QB 3CWBJ 1P84H 1PGJA 3SFEC 3T97B 1G1IA 1OVUA 1PPJG 1QL2A 2FYUJ 2WZ7A 2GA1A 3H1IG 4D6TG 1SQQJ 1YYCA 5H2FH 1SLQA 4WY4D 1YJNP 1L0NJ 5CCHA 3CWBD 1T2KC 1WMKA 3AEBC 3CI9A 1EZVI 5EFWB 3D6ZA 2Q9IA 2QSIA 3KDPB 1L0NK 1S4XA 2N1TB 1FZFA 2YKQA 2NPSD 3ZDMA 2FY8A 2E75B 2JDIH 1S5LH 5GTIE 1N7LA 3RK2C 3LIEA 1G2CA 3CXHD 4N78D 1T8ZA 3HRNA 4U3FE 5CJ4A 3CL3D 3V6IA 3N7NA 2KLUA 2ZYAA 3S4RA 3FXEA 5KLVK 3H1HD 1IO4A 1DEBA 1MZ9A 3RK2D 3VP9A 1W2BO 1NWQA 1KILE 1H8AA 2HYNA 5KAIH 1GK6A 1RF0A 1LWUA 1SQVJ 3B5NA 1ZRTD 1NU1D 2BEZF 4NPEA 1DEEG 3SFDC 1HTLC 3A0BH 5CBNA 2WPVB 3L75G 1FZGA 5AW5B 1DD4A 1RH5B 2KXPB 3NFQA 4L73A 2IPPA 3HD7C 2QA4P 1M1KQ 2HPCB 3H1KE 2ZVNB 1LP1B 2PGDA 2KI7B 3EFFK 4IL6E 1WRGA 4PD4H 1AFOA 1VQLP 3VP8A 1AQ5A 2E75C 2FYUD 4PV1B 1NYHA 1YITP 3EQ2A 1GL2A 2BCCD 2K37A 3HE4B 1KORA 3MTUE 4H0LB 1M1JB 1KQGB 1RF1A 3PRJA 2E76B 5GTHH 3H32B 3L73G 2WTYA 3H1KJ 5TISH 3HUSB 4D6TD 1NOHA 1Q86Q 2YKPA 1LTTC 2KLVA 2A06G 4GODA 1OVVA 5KJ7D 1SQVE 1SQXK 3U59A 2POHA 1BDDA 3P8CE 1GU5A 2QJYB 3BATA 1M8OB 1VQ4P 1OWAA 1OW7A 1KB9H 2J59M 3ABVC 1JY2O 4U3FJ 1FZEA 4WY4A 3R4YA 3VMZA 2P7JA 5CCHD 3FXDA 3RL0D 4GKGA 1MKMA 1VQMP 3CMEP 2N9YB 3GMAA 1BCCG 1KTMA 1PP9G 1T3JA 1BGYJ 1PP9D 2NPSB 2E75D 3AE3C 3EFGA 3L71D 1N86A 3RL0C 2W6JH 2Z4EA 2FFDB 1HF9A 3NMDA 2KS1B 1VDFA 2IZ0A 2D2CD 1Q90D 1GK4A 4LGDE 1USEA 3CX5E 1BE3E 1N2DC 1NO4A 2HLOA 1R5SA 3GLMA 3H25A 1L0LG 1MV8A 2RMZA 3IFMA 4IFFA 4U7JA 4C7NB 4EI2A 2C9LY 2FYUE 3HE5A 4OGQD 1K05A 5AW9B 2IYOA 2C9NY 1SQBD 3Q1MA 1K9MQ 1NTMJ 1FC2C 2O01N 1E5WA 3BRVB 3IF4A 4AUWA 2D2CB 1HGZA 1RQUA 2PP6A 3L71E 4PJ0E 1GMJA 1HVVA 1SQQG 3PHLA 3WMM0 4D6TJ 1H0TA 1FDIA 3BCCJ 1J1DC 1RE4A 5B5EH 5KJ7A 1S9KE 1QVGO 3H1JD 1CW5A 3CX5D 5TJHA 2JWAA 3MUDA 1VF5B 1VQKP 5L8RJ 1GL2D 5DJTB 4JPZB 3CLQA 3WU2H 1KQLA 2P58A 1D7MA 3H1HE 1KYOH 1N7SC 2OARA 1KV4A 1IK7A 2OTKE 4ZKUA 4DCKA 1SQBE 1IK9A 4C46A 1JY3O 1NU1J 2FYZA 1LNQA 5C39A 1X79B 1QLED 4HB1A 1PGQA 4MN4C 2E43A 3UIAA 3GG2A 2J58A 2JJLA 4A7PA 5CCGD 2BASA 3H1IE 1QL1A 1BE3G 1IFJA 2L91A 3AE1C 5AW7B 3CCQP 1HGVA 3MZWB 1Q82Q 2OYHB 4KT0J 4PD4I 1QGKB 1FDOA 2KNCB 2WSFJ 2YMYA 3SWKA 1YJ9P 1N73B 2BCCJ 2O3JA 1DH3A 2N1TD 2H8PD 2HPCA 3A0HE 3M91A 2ZXEB 5GTIH 3L73E 1S5LE 2JKVA 2QJYC 2R3SA 2V7QH 2Y0EA 4HJGH 1RE3C 3H1ID 1PGOA 1GU4A 2K9JA 2ZAEB 2LXBA 2YNYA 4OGQB 3HE4A 1IFMA 3HUSC 5AW2B 1JTHA 1UIIA 5AW1B 4AQRD 1JMBA 3H1JJ 4YPCA 2E76C 2M8RA 3BCCD 2Z5HA 4RKUJ 3H1KG 1SQVD 4DT0A 3CMAP 1SQVK 1SQXE 2R44A 4H44B 3TGUG 1X8YA 3U1AA 3WUVA 3RK3D 2WWWA 4U3FD 4YXDC 3TNUA 4GIFA 2W6AA 1ZRTE 1SQXJ 4XE5B 3CCEP 4K35A 2ZT9B 2KYVA 3JSVC 2YKOA 1YJWP 3N4XA 3JC22 5E79E 1S1CX 2FKWB 2YXRB 4U3FG 1SQXD 1YI2P 3RK3B 1GL2C 4N78E 3K5BA 1Q7YQ 2ZJSE 1KILC 3NXSA 3IAOA 3GF7A 1BGYG 1BSNA 2B89A 3M9QA 3MIWA 3CC4P 2BCCE 2ZT9C 3JCUE 3VN0A 3GHGA 5APQA 1SFCD 3EWKA 2IBZG 2RKLA 3S9OA 2QEXP 2W6BA 1ZOYC 2WPRA 1GW4A 3SWFA 2FYUG 3R2PA 3A2AA 3H1IJ 1NKZB 1RF0C 5AW8B 1G1JA 2PFXA 3HE5B 3M0DA 4HKZH 3WU2E 1HH0A 1YQ3C 2IDBA 2WITA 4OVNF 1SFCC 1NU1E 1RY3A 1SQBJ 5TISE 4UB6E 2B9BA
chains in the Genus database with same CATH topology
1KILD 1IJDB 5KTBA 3V4WA 2OYIB 2N1TA 2CPSA 1SVFA 1YTZT 2FFDA 2XU6A 1WT6A 2C0WA 3U1CA 1G2CB 2O01H 2C0XA 1J1EB 2WPSA 3A5TA 3P8CD 3HUSA 3L4FA 1LTIC 1LWUC 3B5NC 2HODA 1L4AB 3BRTB 2XKMA 4WY4C 1L0LK 3I5CA 1N7SB 4C7RA 1JOCA 3B8EB 4Y99B 4OH8B 2YO2A 4WY4B 2IX7C 3VTPC 2P67A 1LTAC 5CCGC 2IFNA 3P7KA 3SWYA 3KQGA 4LLHA 2NPSA 1IC2A 3KYQA 1LTGC 5CHXA 1FOSE 3IR9A 1JTHB 2GM4A 1M7LA 1LT9C 1NKNA 3A3YB 1OXZA 4RESB 3P8MC 2KP8A 3B5ND 1FZCB 1JCCA 1IFIA 1NAFA 1T2KD 3L36A 1ZR4A 1JO5A 3PP5A 2NPSC 1FZBA 5AW0B 1JY3N 5APVA 5AVWB 1J1DB 1NTZK 1CI6A 3GHGB 4LC1A 3MD0A 1N7SD 1A02F 2R3CA 3OAKA 4IFDK 3V2QA 3P32A 4Y99C 2M3BA 1W2EA 2KSJA 3HTKA 5AVYB 1HUCA 4EOTA 4B86A 5APYA 3OA7A 4W7YA 1RE3A 2N9BA 2Q3IA 2Q5UA 1T3UA 3A7OA 4O9BA 3M0AA 5APTA 2KB7P 2OYIC 3M9HA 3LIDA 3TNUB 2GUVA 2WT7A 1N73A 5CCHC 1N7SA 1MUUA 3V2NA 1H88A 1SFCB 3TK1A 5AVVB 1LTBC 1YTZI 2JEEA 3V4QA 3HD7D 5KJ7C 4GT1A 3VOPA 1KILB 3L37A 1RF1C 1FAVA 1L4AA 3RK3C 3M0DC 1H89A 4HYTB 4W80A 3BASA 2CPBA 2I1KA 1FZCA 1NHLA 1URQC 1NU1K 1KFNA 2O1KA 3G3ZA 2XZRA 2H43A 3BVHA 2QM7A 4I6MC 2OYIA 4JF7A 5APXA 1LTSC 1J2JB 3VMXA 1Z56A 3C9IA 2R32A 5AVXB 5AVSB 2HODB 1IFNA 1HWTC 2PAJA 3V2RA 2OYHC 1L4AD 2HG5D 3H6PA 3OJAB 1URQD 2WSEH 2ZFCA 1LTJB 1NH4A 3V2PA 1JUNA 4HH2A 1LT9A 1KFMA 3HD7A 1GW3A 2WSCH 4AYCA 1FJKA 2E42A 1JY2P 2W27A 5AVQB 1LWUB 3B5NB 1JNMA 5BU5A 2XV5A 1DX7A 2Z5IA 2A45H 2GUSA 1FDMA 5BU8B 4XA4A 1SFCA 5AVTB 4N6JA 1CZQA 4ZKPA 1PFIA 1GL2B 1RF1B 1JY2N 1RE4C 1URQA 2FXMA 1CI6B 2R5BA 5AW6B 4DZOA 1KILA 4EIJA 2YO3A 2A45G 3II6A 1IFDA 2N1TC 3T97A 2MJZA 1KZUB 2L5GB 5AVRB 2LKMA 4I1LA 3HTKB 2P1JA 2HFED 2R5DA 1ZN5A 4IFMA 3TYYA 3KPEA 1NTMK 3H32A 3VYIA 1FU1A 2IFMA 1JY3P 1FJPA 1SP4A 1CSBA 3VMYA 4M3LA 5AW4B 1JMMA 1SQPK 1VPCA 3MGNA 4DOJA 2H7HA 2VRSA 4WB4A 1EQ7A 3V5BA 1LTJA 2XNXA 1GDTA 1HBWA 1XTCC 4JYCA 1JCDA 3GHGC 3RK2B 1N73C 1XTGB 5APSA 5CJ0A 4I2LC 3M06A 2A45I 1MFZA 2O1JA 5APUA 2WT7B 2OYHA 1FBMA 4KHXA 3NTNA 1FZCC 2I1JA 3E1IA 5CMZA 3O8ZA 3RL0B 5CCGA 2FFDC 1M1JA 1HJBA 1LT9B 5AVZB 1ZLLA 4W7ZA 4WBAA 1A02J 1X9VA 4JYBA 3L35A 5AW3B 1LGHB 1ZV8A 2Q7CA 4C7NA 1GTWA 5AVUB 2P2UA 4N3YB 1NTKK 2XDJA 1GD2E 3TSIA 1FZAA 2QM8A 2WSFH 2WPQA 1S9KD 1LTJC 1M1JC 1L4AC 2KOGA 3LW5H 1ZR2A 1GZLA 1SQQK 1SQBK 1URQB 5APWA 3M9BA 3HD7B 1J1EC 2FYUK 5BVZA 1G1IA 2WZ7A 1QL2A 1YYCA 1SLQA 4WY4D 5CCHA 1T2KC 3CI9A 2Q9IA 3KDPB 1L0NK 2N1TB 1FZFA 2YKQA 2NPSD 1N7LA 3RK2C 3LIEA 1G2CA 4N78D 1T8ZA 3HRNA 5CJ4A 5KLVK 3CL3D 1IO4A 3N7NA 1DEBA 1MZ9A 3RK2D 3VP9A 1NWQA 1H8AA 2HYNA 1GK6A 1RF0A 1LWUA 3B5NA 1FZGA 1HTLC 5AW5B 3NFQA 2IPPA 3HD7C 2HPCB 1WRGA 1AFOA 3VP8A 3EQ2A 1GL2A 3MTUE 3HE4B 1AQ5A 1RF1A 1M1JB 2WTYA 3H32B 3HUSB 1NOHA 2YKPA 1LTTC 2KLVA 5KJ7D 1SQXK 3U59A 2POHA 3P8CE 1GU5A 3BATA 1OWAA 2J59M 1JY2O 1FZEA 4WY4A 3VMZA 2P7JA 5CCHD 3RL0D 4GKGA 1T3JA 2NPSB 3EFGA 2Z4EA 1N86A 3RL0C 2FFDB 3NMDA 1VDFA 1GK4A 4LGDE 1N2DC 1NO4A 2HLOA 4C7NB 1MV8A 3IFMA 4IFFA 2C9LY 3HE5A 2C9NY 5AW9B 1E5WA 3BRVB 4AUWA 2PP6A 1HGZA 3WMM0 1HVVA 1J1DC 1RE4A 1S9KE 5KJ7A 1CW5A 3MUDA 1GL2D 3CLQA 1KQLA 2OARA 1N7SC 4ZKUA 1IK9A 4C46A 1JY3O 2FYZA 1X79B 2E43A 3UIAA 2J58A 2JJLA 5CCGD 2BASA 1QL1A 5AW7B 1IFJA 1HGVA 2OYHB 2YMYA 1N73B 1DH3A 2N1TD 2H8PD 2HPCA 3M91A 2ZXEB 1FOSF 1RE3C 1GU4A 2YNYA 3HE4A 1IFMA 3HUSC 5AW2B 1JTHA 5AW1B 4AQRD 2M8RA 2Z5HA 1SQVK 1X8YA 3U1AA 3RK3D 2WWWA 3TNUA 4GIFA 2W6AA 4XE5B 2KYVA 2YKOA 3N4XA 2FKWB 3RK3B 1GL2C 4N78E 1KILC 3NXSA 3MIWA 3M9QA 3VN0A 3GHGA 5APQA 1SFCD 2W6BA 2WPRA 1GW4A 3SWFA 3R2PA 3A2AA 1NKZB 1RF0C 5AW8B 1G1JA 3HE5B 3M0DA 1HH0A 2WITA 1SFCC 1RY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H7H A;  2VRS A;  3V4W A;  3L37 A;  1FAV A;  2XU6 A;  1H89 A;  3V5B A;  4HYT B;  1GU5 A;  1G2C B;  1OWA A;  1HBW A;  4JYC A;  2XZR A;  2WPS A;  3VMZ A;  3A5T A;  2P7J A;  4GKG A;  5APS A;  4I2L C;  2QM7 A;  4I6M C;  3M06 A;  1MFZ A;  3NMD A;  5APU A;  5APX A;  2WT7 B;  3I5C A;  1J2J B;  1GK4 A;  3VMX A;  3B8E B;  4KHX A;  3NTN A;  2YO2 A;  1MV8 A;  3VTP C;  2R32 A;  4C7N B;  5AVX B;  2P67 A;  3HE5 A;  5CMZ A;  2C9L Y;  3P7K A;  3O8Z A;  5AVS B;  5AW9 B;  3KQG A;  2C9N Y;  1HJB A;  5AVZ B;  1HWT C;  4AUW A;  1FOS E;  3IR9 A;  1A02 J;  1S9K E;  4JYB A;  3L35 A;  2ZFC A;  3A3Y B;  1OXZ A;  4RES B;  5AW3 B;  3P8M C;  2Q7C A;  4C7N A;  1GTW A;  2KP8 A;  5AVU B;  1KQL A;  2P2U A;  1JUN A;  1NAF A;  1T2K D;  3L36 A;  1GD2 E;  4C46 A;  2QM8 A;  2E43 A;  4AYC A;  2WPQ A;  1S9K D;  3UIA A;  2JJL A;  2BAS A;  5AW0 B;  2E42 A;  5AW7 B;  2W27 A;  5AVQ B;  5APV A;  5AVW B;  1JNM A;  1GZL A;  2XV5 A;  1CI6 A;  2Z5I A;  5APW A;  3M9B A;  1DH3 A;  4LC1 A;  3MD0 A;  3M91 A;  2ZXE B;  5AVT B;  1A02 F;  1FOS F;  2R3C A;  3OAK A;  1CZQ A;  3P32 A;  1GU4 A;  2YNY A;  1YYC A;  3HE4 A;  5AW2 B;  5AW1 B;  1SLQ A;  4AQR D;  3HTK A;  5AVY B;  1HUC A;  1T2K C;  2Z5H A;  4EOT A;  4B86 A;  1CI6 B;  5APY A;  2R5B A;  5AW6 B;  4DZO A;  1X8Y A;  2YO3 A;  2N9B A;  3KDP B;  2WWW A;  3TNU A;  2W6A A;  2Q3I A;  3T97 A;  4XE5 B;  2Q5U A;  3LIE A;  1IO4 A;  5AVR B;  3A7O A;  5APT A;  3M0A A;  2R5D A;  1NWQ A;  1H8A A;  3TYY A;  1GK6 A;  3VYI A;  3M9H A;  3LID A;  3NXS A;  3TNU B;  3VN0 A;  1SP4 A;  1CSB A;  5AW5 B;  3NFQ A;  2WT7 A;  3VMY A;  4M3L A;  2IPP A;  1MUU A;  5APQ A;  5AW4 B;  1H88 A;  3TK1 A;  2WPR A;  3SWF A;  3A2A A;  5AVV B;  5AW8 B;  3HE5 B;  3M0D A;  3HE4 B;  3V4Q A;  4GT1 A;  2WTY A;  3MGN A; 
#chains in the Genus database with same CATH topology
 2K3R A;  3Q5S A;  1DIP A;  2B88 A;  1KIL D;  2WSC J;  1H0T B;  3RK3 E;  1IJD B;  5KTB A;  3V4W A;  2OYI B;  1PP9 E;  1SQP E;  2CPS A;  1KYO I;  1SVF A;  1YTZ T;  2N1T A;  2H88 C;  3LW5 J;  4IOI H;  2XU6 A;  2FFD A;  1WT6 A;  2V4H A;  2C0W A;  4H0L D;  3CCU P;  3U1C A;  1G2C B;  1Y9B A;  2O01 H;  2C0X A;  4D6T E;  3B4S A;  1J1E B;  2M0B A;  2FYN B;  2WPS A;  1T6A A;  3A5T A;  3P8C D;  3HUS A;  1VL2 A;  2FBW C;  2ZT9 D;  3AE8 C;  1SQV G;  1NTM E;  1LTI C;  1NTK E;  3L4F A;  4L75 A;  2KIK A;  1LWU C;  3B5N C;  2HR3 A;  2HOD A;  3AE5 C;  3L74 G;  1L4A B;  3BRT B;  1U7J A;  1KQF B;  1L2P A;  2QJK C;  2XKM A;  3Q2Y A;  1S5L X;  1L0L K;  1BE3 J;  3I5C A;  1N7S B;  4WY4 C;  4C7R A;  1VQP P;  1JOC A;  1SS1 A;  2QRX A;  3B8E B;  4H44 D;  4Y99 B;  1MFT A;  4OH8 B;  1VQN P;  1KB9 D;  2QIW A;  5KLI C;  3L70 G;  2YO2 A;  4WY4 B;  1NAY A;  2IX7 C;  3VTP C;  1K73 Q;  2J5U A;  2P67 A;  1BGY E;  1LTA C;  2IFN A;  3IN6 A;  3P7K A;  5CCG C;  3KQG A;  4LLH A;  3SWY A;  3I56 P;  1N8R Q;  4ZNC A;  2NPS A;  1IC2 A;  2AXT H;  3KYQ A;  4TT3 H;  1LTG C;  5CHX A;  4RO0 A;  3IR9 A;  1FOS E;  3W68 A;  1JTH B;  2GM4 A;  1M7L A;  3L75 D;  1OIP A;  3L70 E;  2B87 B;  4GOF A;  1LT9 C;  3CXH E;  2ZYD A;  4YTP C;  3VMA A;  2OTJ P;  2XND H;  1NKN A;  3A3Y B;  1OXZ A;  4RES B;  3H1L J;  3P8M C;  1OZH A;  3CXH I;  2KP8 A;  3A0H H;  4BRY B;  3B5N D;  1FZC B;  1JCC A;  3AEC C;  1USD A;  1IFI A;  2ZXX A;  3AE4 C;  2KZJ A;  2M5A A;  3VYI A;  3WUT A;  1NAF A;  1NTK G;  2IBZ I;  3AE6 C;  3L36 A;  3I55 P;  1ZR4 A;  5B66 H;  1T2K D;  2WSE J;  3PP5 A;  1JO5 A;  3CD6 P;  1ZME C;  2NPS C;  3A0B E;  1FZB A;  2E74 C;  3CCR P;  4H13 B;  2K9J B;  5AW0 B;  2QJP C;  1JY3 N;  1AJY A;  3AEE C;  5APV A;  5AVW B;  1J1D B;  1NTZ D;  2KS1 A;  1NTZ K;  1AVO A;  1NTZ G;  2V7Q J;  4YXW H;  1LJ2 A;  1SQP G;  1CI6 A;  1S2E A;  2D2C C;  3GHG B;  4LC1 A;  3MD0 A;  1OX3 A;  2A06 D;  1N7S D;  2NRG A;  1S3J A;  1EDI A;  3FWL A;  3H1K D;  1A02 F;  2R3C A;  3OAK A;  4IFD K;  3V2Q A;  3P32 A;  4BRY A;  2O01 J;  4Y99 C;  2M3B A;  2Q3E A;  1W2E A;  2KSJ A;  3L72 D;  3HTK A;  1PL5 A;  1HUC A;  2AXT E;  5AVY B;  2QJK B;  2KNC A;  4B86 A;  3AE7 C;  1U57 A;  3MHV A;  3OA7 A;  3G9R A;  4H0L C;  4PD4 D;  5APY A;  1KN7 A;  4W7Y A;  1RE3 A;  3H1L D;  5H2F E;  1L0L D;  2N9B A;  3E1R A;  1EDL A;  2OTL P;  2Q3I A;  2Q5U A;  2K88 A;  1NU1 G;  2JR8 A;  1L0N E;  1IFP A;  1AVY A;  1T3U A;  1SQQ E;  3A7O A;  5K5G B;  4O9B A;  3M0A A;  5APT A;  1PZQ A;  4BWN A;  2KB7 P;  2WMM A;  3CWB E;  5KAF H;  3QH9 A;  3G6E P;  2OYI C;  1LT1 A;  3M9H A;  2Y0C A;  3LID A;  3TNU B;  1ZP0 C;  5M1B A;  4BXL A;  2BCC G;  2GUV A;  4KJM A;  1L0L E;  2WT7 A;  4DJG A;  1N73 A;  1JEK A;  2K1A A;  1N7S A;  1MUU A;  2YXQ B;  3L72 J;  4IL6 X;  3V2N A;  1SFC B;  3TK1 A;  5CCH C;  1VQ5 P;  1VQ9 P;  4R4L A;  4H13 D;  1EDJ A;  1KQS O;  2W90 A;  3OW2 O;  1VQ6 P;  2UWJ E;  1LTB C;  1X0T A;  1YTZ I;  2JEE A;  5AVV B;  1GD2 E;  1UIX A;  3V4Q A;  3Q3D A;  3HD7 D;  2E74 B;  5KJ7 C;  4GT1 A;  4I7Z C;  3VOP A;  2IYP A;  1OVR A;  4UB6 H;  2Y9Y A;  1YIJ P;  3PLN A;  3TGU J;  1H88 A;  3CXH H;  1KIL B;  2CK3 H;  3L37 A;  1RF1 C;  5KKZ C;  1FAV A;  1L4A A;  1EZV E;  2WSS H;  3M0D C;  3RK3 C;  3TGU D;  1EDK A;  1H89 A;  4HYT B;  1NTK D;  4W80 A;  1VF5 C;  3H1L G;  1PPJ D;  3BAS A;  2CPB A;  2I1K A;  4ASW A;  1FZC A;  1NHL A;  4JQ0 D;  1URQ C;  3USS A;  1NU1 K;  1KFN A;  1KMI Z;  2O1K A;  2XZR A;  3G3Z A;  1YHQ P;  2H43 A;  2ITA A;  3CX5 H;  1K8A Q;  2QE7 H;  1BCC D;  1VF5 D;  1U7M A;  3BVH A;  2AEM A;  3MP7 B;  2QM7 A;  4I6M C;  2ZYG A;  3H1H G;  2Y9Z A;  2OYI A;  1BSH A;  2AEJ A;  2OQQ A;  4QMA A;  1KYO D;  1AA0 A;  2OGU A;  4JF7 A;  5APX A;  1JM0 A;  1LTS C;  1J2J B;  1M56 D;  1NTZ J;  1Z56 A;  2E5Y A;  2I8D A;  3VMX A;  4GOE A;  2IZ1 A;  3C9I A;  1OW6 A;  1PV3 A;  2R32 A;  3L70 D;  3L75 E;  3L71 G;  5AVX B;  2KSE A;  2E5T A;  3TDK A;  1R8E A;  5AVS B;  5KLV G;  2G3A A;  3O6Q A;  3PJS K;  3CCS P;  1SQB G;  3CWB G;  2IBZ E;  1FOS F;  2LR2 A;  2HOD B;  3F89 A;  4ZMD A;  3Q5P A;  1IFN A;  1HWT C;  2PAJ A;  3V2R A;  3B71 A;  4WWI A;  3CCL P;  2OYH C;  4UB8 H;  1NGM B;  1L4A D;  2HG5 D;  3H6P A;  3OJA B;  1URQ D;  2WSE H;  2ZFC A;  2KK7 A;  1E79 H;  1PGP A;  1RQV A;  4WVZ A;  1FE6 A;  1LTJ B;  1TU3 F;  1NH4 A;  1NVO A;  2K9Y A;  2W8Z A;  3MUD C;  3RBZ A;  2P10 A;  3KHU A;  3V2P A;  1JUN A;  4HH2 A;  1SQQ D;  3WUU A;  3AEG C;  1LT9 A;  1KFM A;  2H89 C;  3HD7 A;  3RL0 g;  3RBX A;  5KLV E;  1GW3 A;  2WSC H;  4AYC A;  2B87 A;  3L74 J;  1FJK A;  2OYO A;  2E42 A;  1Q81 Q;  1JY2 P;  2W27 A;  1PPJ E;  2YIU C;  1LWU B;  3B5N B;  3H1L E;  4NPD A;  5AVQ B;  5KAI E;  2XV5 A;  5KAF E;  5BU5 A;  1JNM A;  3L74 D;  1EXI A;  1DX7 A;  1KYO E;  1Y8A A;  3GF3 A;  3TF5 A;  2M5A B;  2Z5I A;  3L70 J;  4R4M A;  3F5H A;  4EDF A;  2A45 H;  2GUS A;  1FDM A;  5BU8 B;  4XA4 A;  3FWN A;  1SFC A;  1VQO P;  3D71 A;  1BCC E;  2WVR A;  4GDO A;  5AVT B;  5KKZ B;  4N6J A;  2M3E A;  5DJU B;  1CZQ A;  4ZKP A;  4UB8 E;  1PFI A;  1GL2 B;  4RJT A;  4JBZ A;  1RF1 B;  1JY2 N;  1M90 Q;  1RE4 C;  1X22 A;  4I7Z B;  1FS0 E;  1URQ A;  2FXM A;  4L76 A;  1CI6 B;  2LXC B;  3E7K A;  2R5B A;  5AW6 B;  4DZO A;  2Q1K A;  1KIL A;  4EIJ A;  2MKV A;  2YO3 A;  2ZVO B;  3D70 A;  2A45 G;  3II6 A;  1IFD A;  2G8Y A;  3D6Y A;  2N1T C;  1NTK J;  3CX5 I;  1P84 E;  3T97 A;  2JO1 A;  2MJZ A;  1KZU B;  2L5G B;  1LP1 A;  5AVR B;  2LKM A;  4I1L A;  2QG4 A;  3HTK B;  3SSU A;  2P1J A;  3AED C;  4OWF A;  2HFE D;  2R5D A;  1ZN5 A;  2E74 D;  4IFM A;  4Y28 J;  3TYY A;  3KPE A;  1NTM K;  1BCC J;  1SQP J;  1BGY D;  1PP9 J;  1FU1 A;  2IFM A;  3FGA D;  3H32 A;  1JY3 P;  3KZI E;  4K3A A;  1FJP A;  1SP4 A;  1CSB A;  1KB9 E;  3VMY A;  4M3L A;  4XFJ A;  5AW4 B;  2YMK A;  5B66 E;  2DW3 A;  2IBZ D;  3AEA C;  1VQ7 P;  1S72 P;  1JMM A;  4EOT A;  4PV1 C;  1ZW0 A;  2AEF A;  3G71 P;  2RN0 A;  4ASV A;  1SQP K;  3L74 E;  1QX8 A;  1VPC A;  1L0N G;  2SPZ A;  5KLV J;  5CBO A;  1NTM D;  3MGN A;  4DOJ A;  1NTM G;  4H44 C;  1P84 I;  1AV1 A;  5GTH E;  3PTZ A;  5B5E E;  1EC5 A;  1HJ0 A;  2H7H A;  2VRS A;  4PJ0 H;  3S1K A;  3BCC G;  1R5L A;  4OGQ C;  4WB4 A;  1EQ7 A;  3GW6 A;  3CCV P;  4PD4 E;  4IL6 H;  3V5B A;  1LTJ A;  2XNX A;  1IZN B;  2JWD A;  3CCM P;  4PV1 D;  4L74 A;  1GDT A;  3JCU H;  1DD3 A;  1HBW A;  1XTC C;  3KZI H;  1JCD A;  3GHG C;  2BEQ D;  4JYC A;  3RK2 B;  3G4S P;  2W83 C;  2YIU B;  3ITK A;  1XTG B;  1N73 C;  5APS A;  4CPG A;  1EZV G;  1OMI A;  5CJ0 A;  1EZV D;  4I2L C;  2A06 E;  2PRR A;  3M06 A;  2A45 I;  1MFZ A;  3L75 J;  2QJP B;  5E79 H;  1Q2N A;  2O1J A;  4H13 C;  5APU A;  2WT7 B;  3L72 G;  2OYH A;  1NTZ E;  1FBM A;  1QVF O;  3CC7 P;  1ZXG A;  4KHX A;  3H1J E;  3NTN A;  1FZC C;  2NZ2 A;  2I1J A;  1VQ8 P;  1JB0 J;  1PIX A;  1BDC A;  3E1I A;  5CMZ A;  5KLV D;  3O8Z A;  3RL0 B;  5CCG A;  2FFD C;  3AEF C;  3L73 J;  1M1J A;  4TLF A;  1KD1 Q;  1LT9 B;  1HJB A;  2WQY C;  3FX0 A;  5AVZ B;  2FXP A;  1ZLL A;  1L0N D;  3AE2 C;  1YBK A;  4W7Z A;  2RH0 A;  2Y0D A;  3C8V A;  1X9V A;  4WBA A;  3H1J G;  4JYB A;  1A02 J;  1NJI Q;  1P84 D;  3L35 A;  1AQT A;  4NPF X;  5AW3 B;  1LGH B;  1ZV8 A;  2Q7C A;  4C7N A;  1GTW A;  2KUB A;  3KXD A;  5AVU B;  5KLI B;  2P2U A;  2AXC A;  2QVA A;  4N3Y B;  3RGU A;  1OFC X;  1M57 D;  1NTK K;  1W5C E;  3TGU E;  1SQX G;  2E76 D;  2XDJ A;  3TSI A;  2FXO A;  3Q5R A;  3QWO C;  3CCJ P;  1FZA A;  1SQP D;  2QM8 A;  2WSF H;  1QEX A;  2KZI A;  3CC2 P;  3H1H J;  1YQ4 C;  2WPQ A;  1KC8 Q;  1KB9 I;  1S9K D;  1LTJ C;  3AE9 C;  1M1J C;  3C1L A;  2JP3 A;  1EXJ A;  1L4A C;  2KOG A;  1Y47 A;  1OW8 A;  3LW5 H;  3L73 D;  3CPW O;  2FYN C;  1ZR2 A;  1GZL A;  4Z1M H;  1SQQ K;  1SQB K;  1URQ B;  3BCC E;  3L72 E;  2Q6Q A;  3PH0 A;  5APW A;  1L0L J;  3M9B A;  3W67 A;  1RHZ B;  3HD7 B;  1J1E C;  2FYU K;  3L71 J;  5BVZ A;  4EYY Q;  1K04 A;  1BE3 D;  3O6Q B;  3CWB J;  1P84 H;  1PGJ A;  3SFE C;  3T97 B;  1G1I A;  1OVU A;  1PPJ G;  1QL2 A;  2FYU J;  2WZ7 A;  2GA1 A;  3H1I G;  4D6T G;  1SQQ J;  1YYC A;  5H2F H;  1SLQ A;  4WY4 D;  1YJN P;  1L0N J;  5CCH A;  3CWB D;  1T2K C;  1WMK A;  3AEB C;  3CI9 A;  1EZV I;  5EFW B;  3D6Z A;  2Q9I A;  2QSI A;  3KDP B;  1L0N K;  1S4X A;  2N1T B;  1FZF A;  2YKQ A;  2NPS D;  3ZDM A;  2FY8 A;  2E75 B;  2JDI H;  1S5L H;  5GTI E;  1N7L A;  3RK2 C;  3LIE A;  1G2C A;  3CXH D;  4N78 D;  1T8Z A;  3HRN A;  4U3F E;  5CJ4 A;  3CL3 D;  3V6I A;  3N7N A;  2KLU A;  2ZYA A;  3S4R A;  3FXE A;  5KLV K;  3H1H D;  1IO4 A;  1DEB A;  1MZ9 A;  3RK2 D;  3VP9 A;  1W2B O;  1NWQ A;  1KIL E;  1H8A A;  2HYN A;  5KAI H;  1GK6 A;  1RF0 A;  1LWU A;  1SQV J;  3B5N A;  1ZRT D;  1NU1 D;  2BEZ F;  4NPE A;  1DEE G;  3SFD C;  1HTL C;  3A0B H;  5CBN A;  2WPV B;  3L75 G;  1FZG A;  5AW5 B;  1DD4 A;  1RH5 B;  2KXP B;  3NFQ A;  4L73 A;  2IPP A;  3HD7 C;  2QA4 P;  1M1K Q;  2HPC B;  3H1K E;  2ZVN B;  1LP1 B;  2PGD A;  2KI7 B;  3EFF K;  4IL6 E;  1WRG A;  4PD4 H;  1AFO A;  1VQL P;  3VP8 A;  1AQ5 A;  2E75 C;  2FYU D;  4PV1 B;  1NYH A;  1YIT P;  3EQ2 A;  1GL2 A;  2BCC D;  2K37 A;  3HE4 B;  1KOR A;  3MTU E;  4H0L B;  1M1J B;  1KQG B;  1RF1 A;  3PRJ A;  2E76 B;  5GTH H;  3H32 B;  3L73 G;  2WTY A;  3H1K J;  5TIS H;  3HUS B;  4D6T D;  1NOH A;  1Q86 Q;  2YKP A;  1LTT C;  2KLV A;  2A06 G;  4GOD A;  1OVV A;  5KJ7 D;  1SQV E;  1SQX K;  3U59 A;  2POH A;  1BDD A;  3P8C E;  1GU5 A;  2QJY B;  3BAT A;  1M8O B;  1VQ4 P;  1OWA A;  1OW7 A;  1KB9 H;  2J59 M;  3ABV C;  1JY2 O;  4U3F J;  1FZE A;  4WY4 A;  3R4Y A;  3VMZ A;  2P7J A;  5CCH D;  3FXD A;  3RL0 D;  4GKG A;  1MKM A;  1VQM P;  3CME P;  2N9Y B;  3GMA A;  1BCC G;  1KTM A;  1PP9 G;  1T3J A;  1BGY J;  1PP9 D;  2NPS B;  2E75 D;  3AE3 C;  3EFG A;  3L71 D;  1N86 A;  3RL0 C;  2W6J H;  2Z4E A;  2FFD B;  1HF9 A;  3NMD A;  2KS1 B;  1VDF A;  2IZ0 A;  2D2C D;  1Q90 D;  1GK4 A;  4LGD E;  1USE A;  3CX5 E;  1BE3 E;  1N2D C;  1NO4 A;  2HLO A;  1R5S A;  3GLM A;  3H25 A;  1L0L G;  1MV8 A;  2RMZ A;  3IFM A;  4IFF A;  4U7J A;  4C7N B;  4EI2 A;  2C9L Y;  2FYU E;  3HE5 A;  4OGQ D;  1K05 A;  5AW9 B;  2IYO A;  2C9N Y;  1SQB D;  3Q1M A;  1K9M Q;  1NTM J;  1FC2 C;  2O01 N;  1E5W A;  3BRV B;  3IF4 A;  4AUW A;  2D2C B;  1HGZ A;  1RQU A;  2PP6 A;  3L71 E;  4PJ0 E;  1GMJ A;  1HVV A;  1SQQ G;  3PHL A;  3WMM 0;  4D6T J;  1H0T A;  1FDI A;  3BCC J;  1J1D C;  1RE4 A;  5B5E H;  5KJ7 A;  1S9K E;  1QVG O;  3H1J D;  1CW5 A;  3CX5 D;  5TJH A;  2JWA A;  3MUD A;  1VF5 B;  1VQK P;  5L8R J;  1GL2 D;  5DJT B;  4JPZ B;  3CLQ A;  3WU2 H;  1KQL A;  2P58 A;  1D7M A;  3H1H E;  1KYO H;  1N7S C;  2OAR A;  1KV4 A;  1IK7 A;  2OTK E;  4ZKU A;  4DCK A;  1SQB E;  1IK9 A;  4C46 A;  1JY3 O;  1NU1 J;  2FYZ A;  1LNQ A;  5C39 A;  1X79 B;  1QLE D;  4HB1 A;  1PGQ A;  4MN4 C;  2E43 A;  3UIA A;  3GG2 A;  2J58 A;  2JJL A;  4A7P A;  5CCG D;  2BAS A;  3H1I E;  1QL1 A;  1BE3 G;  1IFJ A;  2L91 A;  3AE1 C;  5AW7 B;  3CCQ P;  1HGV A;  3MZW B;  1Q82 Q;  2OYH B;  4KT0 J;  4PD4 I;  1QGK B;  1FDO A;  2KNC B;  2WSF J;  2YMY A;  3SWK A;  1YJ9 P;  1N73 B;  2BCC J;  2O3J A;  1DH3 A;  2N1T D;  2H8P D;  2HPC A;  3A0H E;  3M91 A;  2ZXE B;  5GTI H;  3L73 E;  1S5L E;  2JKV A;  2QJY C;  2R3S A;  2V7Q H;  2Y0E A;  4HJG H;  1RE3 C;  3H1I D;  1PGO A;  1GU4 A;  2K9J A;  2ZAE B;  2LXB A;  2YNY A;  4OGQ B;  3HE4 A;  1IFM A;  3HUS C;  5AW2 B;  1JTH A;  1UII A;  5AW1 B;  4AQR D;  1JMB A;  3H1J J;  4YPC A;  2E76 C;  2M8R A;  3BCC D;  2Z5H A;  4RKU J;  3H1K G;  1SQV D;  4DT0 A;  3CMA P;  1SQV K;  1SQX E;  2R44 A;  4H44 B;  3TGU G;  1X8Y A;  3U1A A;  3WUV A;  3RK3 D;  2WWW A;  4U3F D;  4YXD C;  3TNU A;  4GIF A;  2W6A A;  1ZRT E;  1SQX J;  4XE5 B;  3CCE P;  4K35 A;  2ZT9 B;  2KYV A;  3JSV C;  2YKO A;  1YJW P;  3N4X A;  3JC2 2;  5E79 E;  1S1C X;  2FKW B;  2YXR B;  4U3F G;  1SQX D;  1YI2 P;  3RK3 B;  1GL2 C;  4N78 E;  3K5B A;  1Q7Y Q;  2ZJS E;  1KIL C;  3NXS A;  3IAO A;  3GF7 A;  1BGY G;  1BSN A;  2B89 A;  3M9Q A;  3MIW A;  3CC4 P;  2BCC E;  2ZT9 C;  3JCU E;  3VN0 A;  3GHG A;  5APQ A;  1SFC D;  3EWK A;  2IBZ G;  2RKL A;  3S9O A;  2QEX P;  2W6B A;  1ZOY C;  2WPR A;  1GW4 A;  3SWF A;  2FYU G;  3R2P A;  3A2A A;  3H1I J;  1NKZ B;  1RF0 C;  5AW8 B;  1G1J A;  2PFX A;  3HE5 B;  3M0D A;  4HKZ H;  3WU2 E;  1HH0 A;  1YQ3 C;  2IDB A;  2WIT A;  4OVN F;  1SFC C;  1NU1 E;  1RY3 A;  1SQB J;  5TIS E;  4UB6 E;  2B9B A; 
#chains in the Genus database with same CATH homology
 1KIL D;  1IJD B;  5KTB A;  3V4W A;  2OYI B;  2N1T A;  2CPS A;  1SVF A;  1YTZ T;  2FFD A;  2XU6 A;  1WT6 A;  2C0W A;  3U1C A;  1G2C B;  2O01 H;  2C0X A;  1J1E B;  2WPS A;  3A5T A;  3P8C D;  3HUS A;  3L4F A;  1LTI C;  1LWU C;  3B5N C;  2HOD A;  1L4A B;  3BRT B;  2XKM A;  4WY4 C;  1L0L K;  3I5C A;  1N7S B;  4C7R A;  1JOC A;  3B8E B;  4Y99 B;  4OH8 B;  2YO2 A;  4WY4 B;  2IX7 C;  3VTP C;  2P67 A;  1LTA C;  5CCG C;  2IFN A;  3P7K A;  3SWY A;  3KQG A;  4LLH A;  2NPS A;  1IC2 A;  3KYQ A;  1LTG C;  5CHX A;  1FOS E;  3IR9 A;  1JTH B;  2GM4 A;  1M7L A;  1LT9 C;  1NKN A;  3A3Y B;  1OXZ A;  4RES B;  3P8M C;  2KP8 A;  3B5N D;  1FZC B;  1JCC A;  1IFI A;  1NAF A;  1T2K D;  3L36 A;  1ZR4 A;  1JO5 A;  3PP5 A;  2NPS C;  1FZB A;  5AW0 B;  1JY3 N;  5APV A;  5AVW B;  1J1D B;  1NTZ K;  1CI6 A;  3GHG B;  4LC1 A;  3MD0 A;  1N7S D;  1A02 F;  2R3C A;  3OAK A;  4IFD K;  3V2Q A;  3P32 A;  4Y99 C;  2M3B A;  1W2E A;  2KSJ A;  3HTK A;  5AVY B;  1HUC A;  4EOT A;  4B86 A;  5APY A;  3OA7 A;  4W7Y A;  1RE3 A;  2N9B A;  2Q3I A;  2Q5U A;  1T3U A;  3A7O A;  4O9B A;  3M0A A;  5APT A;  2KB7 P;  2OYI C;  3M9H A;  3LID A;  3TNU B;  2GUV A;  2WT7 A;  1N73 A;  5CCH C;  1N7S A;  1MUU A;  3V2N A;  1H88 A;  1SFC B;  3TK1 A;  5AVV B;  1LTB C;  1YTZ I;  2JEE A;  3V4Q A;  3HD7 D;  5KJ7 C;  4GT1 A;  3VOP A;  1KIL B;  3L37 A;  1RF1 C;  1FAV A;  1L4A A;  3RK3 C;  3M0D C;  1H89 A;  4HYT B;  4W80 A;  3BAS A;  2CPB A;  2I1K A;  1FZC A;  1NHL A;  1URQ C;  1NU1 K;  1KFN A;  2O1K A;  3G3Z A;  2XZR A;  2H43 A;  3BVH A;  2QM7 A;  4I6M C;  2OYI A;  4JF7 A;  5APX A;  1LTS C;  1J2J B;  3VMX A;  1Z56 A;  3C9I A;  2R32 A;  5AVX B;  5AVS B;  2HOD B;  1IFN A;  1HWT C;  2PAJ A;  3V2R A;  2OYH C;  1L4A D;  2HG5 D;  3H6P A;  3OJA B;  1URQ D;  2WSE H;  2ZFC A;  1LTJ B;  1NH4 A;  3V2P A;  1JUN A;  4HH2 A;  1LT9 A;  1KFM A;  3HD7 A;  1GW3 A;  2WSC H;  4AYC A;  1FJK A;  2E42 A;  1JY2 P;  2W27 A;  5AVQ B;  1LWU B;  3B5N B;  1JNM A;  5BU5 A;  2XV5 A;  1DX7 A;  2Z5I A;  2A45 H;  2GUS A;  1FDM A;  5BU8 B;  4XA4 A;  1SFC A;  5AVT B;  4N6J A;  1CZQ A;  4ZKP A;  1PFI A;  1GL2 B;  1RF1 B;  1JY2 N;  1RE4 C;  1URQ A;  2FXM A;  1CI6 B;  2R5B A;  5AW6 B;  4DZO A;  1KIL A;  4EIJ A;  2YO3 A;  2A45 G;  3II6 A;  1IFD A;  2N1T C;  3T97 A;  2MJZ A;  1KZU B;  2L5G B;  5AVR B;  2LKM A;  4I1L A;  3HTK B;  2P1J A;  2HFE D;  2R5D A;  1ZN5 A;  4IFM A;  3TYY A;  3KPE A;  1NTM K;  3H32 A;  3VYI A;  1FU1 A;  2IFM A;  1JY3 P;  1FJP A;  1SP4 A;  1CSB A;  3VMY A;  4M3L A;  5AW4 B;  1JMM A;  1SQP K;  1VPC A;  3MGN A;  4DOJ A;  2H7H A;  2VRS A;  4WB4 A;  1EQ7 A;  3V5B A;  1LTJ A;  2XNX A;  1GDT A;  1HBW A;  1XTC C;  4JYC A;  1JCD A;  3GHG C;  3RK2 B;  1N73 C;  1XTG B;  5APS A;  5CJ0 A;  4I2L C;  3M06 A;  2A45 I;  1MFZ A;  2O1J A;  5APU A;  2WT7 B;  2OYH A;  1FBM A;  4KHX A;  3NTN A;  1FZC C;  2I1J A;  3E1I A;  5CMZ A;  3O8Z A;  3RL0 B;  5CCG A;  2FFD C;  1M1J A;  1HJB A;  1LT9 B;  5AVZ B;  1ZLL A;  4W7Z A;  4WBA A;  1A02 J;  1X9V A;  4JYB A;  3L35 A;  5AW3 B;  1LGH B;  1ZV8 A;  2Q7C A;  4C7N A;  1GTW A;  5AVU B;  2P2U A;  4N3Y B;  1NTK K;  2XDJ A;  1GD2 E;  3TSI A;  1FZA A;  2QM8 A;  2WSF H;  2WPQ A;  1S9K D;  1LTJ C;  1M1J C;  1L4A C;  2KOG A;  3LW5 H;  1ZR2 A;  1GZL A;  1SQQ K;  1SQB K;  1URQ B;  5APW A;  3M9B A;  3HD7 B;  1J1E C;  2FYU K;  5BVZ A;  1G1I A;  2WZ7 A;  1QL2 A;  1YYC A;  1SLQ A;  4WY4 D;  5CCH A;  1T2K C;  3CI9 A;  2Q9I A;  3KDP B;  1L0N K;  2N1T B;  1FZF A;  2YKQ A;  2NPS D;  1N7L A;  3RK2 C;  3LIE A;  1G2C A;  4N78 D;  1T8Z A;  3HRN A;  5CJ4 A;  5KLV K;  3CL3 D;  1IO4 A;  3N7N A;  1DEB A;  1MZ9 A;  3RK2 D;  3VP9 A;  1NWQ A;  1H8A A;  2HYN A;  1GK6 A;  1RF0 A;  1LWU A;  3B5N A;  1FZG A;  1HTL C;  5AW5 B;  3NFQ A;  2IPP A;  3HD7 C;  2HPC B;  1WRG A;  1AFO A;  3VP8 A;  3EQ2 A;  1GL2 A;  3MTU E;  3HE4 B;  1AQ5 A;  1RF1 A;  1M1J B;  2WTY A;  3H32 B;  3HUS B;  1NOH A;  2YKP A;  1LTT C;  2KLV A;  5KJ7 D;  1SQX K;  3U59 A;  2POH A;  3P8C E;  1GU5 A;  3BAT A;  1OWA A;  2J59 M;  1JY2 O;  1FZE A;  4WY4 A;  3VMZ A;  2P7J A;  5CCH D;  3RL0 D;  4GKG A;  1T3J A;  2NPS B;  3EFG A;  2Z4E A;  1N86 A;  3RL0 C;  2FFD B;  3NMD A;  1VDF A;  1GK4 A;  4LGD E;  1N2D C;  1NO4 A;  2HLO A;  4C7N B;  1MV8 A;  3IFM A;  4IFF A;  2C9L Y;  3HE5 A;  2C9N Y;  5AW9 B;  1E5W A;  3BRV B;  4AUW A;  2PP6 A;  1HGZ A;  3WMM 0;  1HVV A;  1J1D C;  1RE4 A;  1S9K E;  5KJ7 A;  1CW5 A;  3MUD A;  1GL2 D;  3CLQ A;  1KQL A;  2OAR A;  1N7S C;  4ZKU A;  1IK9 A;  4C46 A;  1JY3 O;  2FYZ A;  1X79 B;  2E43 A;  3UIA A;  2J58 A;  2JJL A;  5CCG D;  2BAS A;  1QL1 A;  5AW7 B;  1IFJ A;  1HGV A;  2OYH B;  2YMY A;  1N73 B;  1DH3 A;  2N1T D;  2H8P D;  2HPC A;  3M91 A;  2ZXE B;  1FOS F;  1RE3 C;  1GU4 A;  2YNY A;  3HE4 A;  1IFM A;  3HUS C;  5AW2 B;  1JTH A;  5AW1 B;  4AQR D;  2M8R A;  2Z5H A;  1SQV K;  1X8Y A;  3U1A A;  3RK3 D;  2WWW A;  3TNU A;  4GIF A;  2W6A A;  4XE5 B;  2KYV A;  2YKO A;  3N4X A;  2FKW B;  3RK3 B;  1GL2 C;  4N78 E;  1KIL C;  3NXS A;  3MIW A;  3M9Q A;  3VN0 A;  3GHG A;  5APQ A;  1SFC D;  2W6B A;  2WPR A;  1GW4 A;  3SWF A;  3R2P A;  3A2A A;  1NKZ B;  1RF0 C;  5AW8 B;  1G1J A;  3HE5 B;  3M0D A;  1HH0 A;  2WIT A;  1SFC C;  1RY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...