2KP8A

Ligand bound to a model peptide that mimics the open fusogenic form
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
72
structure length
72
Chain Sequence
TSLIHSLIEESQNQQEKNEQELLELDGDGPQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Non-peptide entry inhibitors of HIV-1 that target the gp41 coiled coil pocket.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords Model peptide
total genus 32
structure length 72
sequence length 72
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2kp8A00
4LC1A 1A02J 1YYCA 5AVTB 2WTYA 2R5BA 3NFQA 3M91A 1X8YA 1FAVA 5AW3B 2QM7A 2WPSA 4I6MC 4C7NA 3V5BA 2YO3A 4C7NB 1MUUA 3VMYA 1G2CB 5APTA 1HJBA 1GU4A 4AYCA 5APSA 3MGNA 5APYA 3P32A 3V4QA 4AUWA 3SWFA 1GZLA 3TK1A 2E43A 5AVRB 1SLQA 3I5CA 5AW1B 2WPQA 5CMZA 2ZXEB 1T2KC 5AVZB 3NTNA 2Z5IA 5AW2B 1A02F 3A3YB 2XU6A 2IPPA 5AVQB 2VRSA 3L37A 1OWAA 1SP4A 3A7OA 3KQGA 4DZOA 1OXZA 1HWTC 3TNUA 4GT1A 3VYIA 5APXA 2WPRA 3M0DA 5AW0B 5AW8B 1FOSF 2ZFCA 1S9KE 1T2KD 1CSBA 2W6AA 5AVYB 3KDPB 3A5TA 1GTWA 1J2JB 2C9LY 3A2AA 3IR9A 3HE4A 2WT7B 2N9BA 5AVXB 2Q7CA 5APQA 5APUA 4AQRD 3VMZA 1H88A 2R32A 1JNMA 1HUCA 3NXSA 2Q3IA 2H7HA 2P7JA 3VN0A 5AVWB 5AW7B 1JUNA 4EOTA 3UIAA 2C9NY 1CI6B 3O8ZA 4RESB 2KP8A 3P8MC 4KHXA 3HE5A 3LIDA 5APVA 2Q5UA 2W27A 1H8AA 3HE5B 1CI6A 2R3CA 3M9HA 3M06A 3M9BA 2E42A 4I2LC 1GK6A 2XZRA 2P67A 4JYBA 3TYYA 1NWQA 3P7KA 5AW4B 3VMXA 1DH3A 2R5DA 1GK4A 3OAKA 2BASA 2YO2A 5AW5B 3HE4B 2WT7A 2YNYA 5APWA 4C46A 3NMDA 4HYTB 1CZQA 5AVVB 2XV5A 3VTPC 3M0AA 1FOSE 5AVUB 3V4WA 3LIEA 2P2UA 1KQLA 5AVSB 1H89A 3B8EB 2Z5HA 2QM8A 1GU5A 4B86A 3TNUB 3L36A 3HTKA 1IO4A 1MV8A 4JYCA 4M3LA 1HBWA 2WWWA 3L35A 5AW9B 1NAFA 5AW6B 2JJLA 1GD2E 1S9KD 3MD0A 4GKGA 4XE5B 1MFZA 3T97A
chains in the Genus database with same CATH superfamily
3CC7P 4LC1A 1GL2B 1P84D 1YYCA 2K88A 3F89A 1PP9E 2DW3A 2L91A 1L4AD 2YKOA 3NFQA 3WU2E 3OW2O 5CJ4A 1G2CA 1P84H 2E75D 1NOHA 3JCUH 1HGZA 1PP9G 2HODA 2KLUA 1USEA 2QM7A 1ZLLA 3V5BA 1GW3A 1NTMK 3K5BA 4H13C 3CCLP 4LLHA 3AE1C 2W6JH 5KLIC 1FBMA 2G3AA 1PGQA 3H1KD 2AXTE 3GW6A 3M0DC 4EDFA 3Q2YA 4AYCA 3QH9A 4U3FJ 2Y9YA 1L0NJ 3MGNA 4AUWA 1GZLA 1GL2A 1Q2NA 2QJKB 2XDJA 3RBXA 2E43A 4QMAA 2YXQB 1KYOH 1SLQA 3I5CA 3CL3D 1VQLP 1LTAC 1FZGA 1SQBJ 2J5UA 3CX5E 3WU2H 3CMEP 5CMZA 1VQ6P 1LTIC 2ZXEB 1NTZE 1E5WA 1KILE 2M0BA 3CLQA 5AW2B 2QJPB 3AE3C 1VQ4P 2IZ1A 1BGYD 3A3YB 1L2PA 1IFDA 3IN6A 1HJ0A 3L37A 2OARA 5CCGA 1K9MQ 1LJ2A 3A7OA 3CXHD 3U59A 1KD1Q 4N6JA 4DZOA 1OXZA 2BCCG 1G1JA 1Y47A 1L0NG 2V7QH 1FE6A 3HTKB 1KB9I 5CCHC 1KILA 2Z4EA 3EWKA 4YXDC 2Q1KA 1LTJA 4GIFA 1BGYG 1FOSF 2PFXA 1BCCG 3RK3E 1S4XA 2FYUE 5CBNA 3WMM0 4HH2A 1PPJG 3CXHH 1OX3A 2J59M 1SQXD 1EC5A 3KDPB 2WITA 1KZUB 1RE3C 1SQPG 3KPEA 2FXOA 5TJHA 2N9BA 3ITKA 2GUSA 3M9QA 5AVXB 1FDOA 5APQA 2O01J 1ZP0C 3LW5J 3MUDC 1KV4A 1M1JA 3PLNA 2JEEA 2J58A 2OTLP 5CJ0A 5KLIB 3KXDA 1SQQD 1QVGO 1SVFA 2IX7C 2Q3EA 4PV1C 1L4AA 2AXCA 2B88A 3PP5A 1SQVG 1IZNB 1NTMJ 4N78D 1SQPE 5AVWB 2FFDB 2IBZI 1EDIA 2YKQA 2YMKA 3UIAA 3L73E 3BCCD 3L72G 2PAJA 1CI6B 3MIWA 4A7PA 1QL2A 2KIKA 2C9NY 4IFDK 2OYIA 3CWBD 3AE2C 1IK9A 1WRGA 1RQVA 3P8MC 4MN4C 1N73A 4N78E 4ASVA 1SQPK 2OYIB 3R2PA 1CI6A 3M9HA 2FYUK 1X0TA 3M06A 3M9BA 1EZVD 4I2LC 1SQXK 4IOIH 4JYBA 5GTHE 1HF9A 2E75B 4UB8H 2A45G 5AW4B 1SFCC 3HUSC 3L75J 1NTZJ 1EZVE 5GTIE 1SQXE 1NTZG 1LT9B 4Z1MH 5KAIH 5KKZC 1IK7A 3U1CA 3N7NA 1NTZK 3V2RA 5AW5B 1XTGB 1JY2O 2YNYA 4C46A 2JDIH 4HJGH 4HYTB 4ASWA 4ZMDA 3AEFC 1KTMA 5AVVB 1K05A 4EI2A 1KILD 1W5CE 1URQA 1EXIA 1M7LA 1NTKK 2QJKC 1NTKD 1UIXA 5AVUB 5AW7B 3V4WA 3VTPC 1VL2A 2KZIA 2ZYDA 1WMKA 2KB7P 1KQLA 4IFFA 5AVSB 1H89A 3GF3A 1IFIA 2Z5HA 1GMJA 3AEAC 4I7ZB 1BCCD 1SS1A 3H1LD 1YTZI 2KSEA 3L74D 2BCCJ 3RK3D 1EZVI 2ITAA 3E1IA 4D6TG 1RE4C 4W7YA 2CPSA 1JY3N 1N7SA 1VF5C 2I8DA 3CX5I 5AW9B 4L75A 1JEKA 3RL0C 1NU1D 2A06E 2FYZA 3H1LG 1L4AC 2FXMA 2RH0A 1GD2E 1S9KD 3CCEP 1ZR4A 5B66H 1PFIA 2RKLA 1RF1C 2KNCB 1AJYA 1N7SD 2QJYB 3AECC 1MKMA 3MP7B 4H44D 1KYOE 4XA4A 2WSEH 5AVTB 3SSUA 1FZBA 1T3UA 1AVYA 2H8PD 2WTYA 3HD7D 1RQUA 2JP3A 2A45I 3GF7A 4OGQB 3SWYA 5KJ7A 3M91A 1X8YA 2P10A 4L73A 3H1HE 1KORA 2KSJA 2M3EA 2WPSA 2FBWC 2ZJSE 4W80A 5M1BA 1KILC 2E76C 2OTJP 1MUUA 1S5LE 3L70G 2QA4P 3B71A 1NTZD 2AEMA 3CCJP 1HJBA 5KAFH 3CCUP 1N8RQ 1FDMA 5KJ7D 2ZXXA 1R5SA 5CCHA 1DIPA 1HVVA 3G3ZA 3Q5PA 2IYPA 3E1RA 3WUTA 3B5NA 3CCSP 2P1JA 4R4LA 1T8ZA 4YXWH 1KYOI 1SQXG 2Y0EA 2HFED 4N3YB 5E79H 2NPSA 2Z5IA 1OW6A 1A02F 3PTZA 1ZMEC 1Q82Q 1PIXA 3H32B 2IPPA 1PPJE 1BE3G 1N7SB 3H1HD 5BU8B 3WUUA 5GTIH 3BVHA 3L74G 3A0HE 3CCQP 3D6YA 1PGJA 1LGHB 1HWTC 1BDCA 1NTKE 1P84E 2O1JA 4L76A 3RK2B 4PV1B 3RK2D 2WPRA 4WY4C 3M0DA 5AW0B 3B4SA 5B5EH 2ZFCA 4U3FG 3FWLA 1NU1J 3GG2A 1T2KD 2Y9ZA 3VOPA 1URQB 2A06D 4PV1D 2FY8A 3TF5A 3AE5C 1RF1A 1QVFO 3A5TA 1GTWA 2C9LY 3TGUE 3A2AA 1BE3J 2HG5D 3P8CD 1YI2P 2GA1A 2FXPA 2Q7CA 4ZNCA 4IFMA 1IJDB 2LKMA 5H2FE 3V2QA 1JCCA 1JOCA 3IAOA 3L73D 4U3FD 5K5GB 5KLVK 2QJPC 1EXJA 2OYHB 1RE4A 1JNMA 1RY3A 1W2BO 2BEZF 3HD7A 2SPZA 3TGUJ 4DJGA 1NYHA 2KS1B 2E74D 3VN0A 1LP1B 2D2CD 2QVAA 1SQBD 1HTLC 1OVVA 1YBKA 2JKVA 3LW5H 3C9IA 3O6QB 4HB1A 4NPDA 1NU1K 2R44A 2QEXP 1URQC 2OYIC 2WSEJ 4RESB 2KP8A 2CPBA 2R3SA 1DD4A 4UB6E 4KHXA 2ZYAA 3CWBG 3FXEA 1LNQA 3HE5A 1Q7YQ 1MZ9A 5TISH 3CMAP 1YJNP 1NAYA 4GODA 1OFCX 1LTSC 1SQBG 4H0LC 2R3CA 1J1EB 3BASA 4H44B 2O1KA 5H2FH 1VQNP 1SQPJ 1RE3A 1VF5B 2K3RA 2QIWA 1LP1A 1VDFA 2XZRA 3B5ND 1J1DB 4JQ0D 1SQQJ 2KS1A 4OGQD 1S5LH 5KLVJ 1KQSO 1PGPA 1FZCB 3VMXA 3H1IG 2RMZA 1LTBC 2KOGA 2YIUC 2ZT9C 1M1JB 2R5DA 3A0BH 3HUSA 1YIJP 1DH3A 4EIJA 2Q9IA 3RL0g 3CWBJ 2YO2A 3CXHI 3HE4B 1SQQE 5APWA 1LTGC 2NPSC 2QJYC 4U3FE 5DJUB 1RF1B 2KK7A 1DX7A 4H13D 2XV5A 2WSCJ 3L70D 3M0AA 2OYOA 1XTCC 1HH0A 4OWFA 1P84I 3C8VA 3II6A 1L0LE 1SQVK 2P2UA 2YIUB 2WSFJ 2ZT9B 3CXHE 2K1AA 3RK3B 2IBZE 1NTMD 1KILB 1JY3P 1ZRTE 1BGYE 2B89A 2JO1A 2W6BA 1FC2C 4RKUJ 1J1DC 4NPFX 1GU5A 2FYUG 2JWAA 3AEEC 3GHGC 1OVRA 2BEQD 1L0LK 3L73J 4JBZA 4JYCA 4W7ZA 1J1EC 4M3LA 1HBWA 2KUBA 3PJSK 2POHA 2QE7H 1M1JC 2K9JB 3H32A 3OJAB 3TGUD 1SQVD 1ZV8A 5KTBA 3H1HG 2W90A 1NU1G 1E79H 1NAFA 5AW6B 1FZCC 3MHVA 1D7MA 2H88C 1AQTA 4GKGA 1RF0C 3H1KE 3V2PA 1SQQK 2ZVNB 1A02J 5BVZA 4OH8B 3BRTB 2KLVA 3H1KG 1DEEG 2LR2A 3L74J 4WBAA 1LWUC 3GHGA 1LT9C 3L73G 4IL6X 3Q5RA 2HPCB 1FAVA 2QSIA 1NU1E 2ZVOB 4I7ZC 1L0NK 2YO3A 4JPZB 3F5HA 1NTKG 1Q90D 3SWKA 2CK3H 2YKPA 2IYOA 1G2CB 2W8ZA 3GHGB 1NTKJ 2IFMA 3N4XA 4LGDE 3PH0A 3L74E 2N9YB 1NHLA 1QLED 2KYVA 3OA7A 3TDKA 3TK1A 2QRXA 1NTME 2OYHC 1X22A 5AVRB 3H6PA 3T97B 2IBZG 1GL2C 1DEBA 2I1KA 2G8YA 2A06G 1NVOA 3H1KJ 2B87A 4KJMA 2JR8A 2WVRA 4PD4I 1AFOA 2WPQA 1FU1A 1L0ND 1JMBA 1NKNA 1ZN5A 1K73Q 5AVZB 3NTNA 5TISE 1K8AQ 1BCCE 2N1TD 2LXCB 2FKWB 4OVNF 1FDIA 3CI9A 5AVQB 2FFDC 1SP4A 1USDA 1U7JA 3H1IJ 3KQGA 4JF7A 5BU5A 1YITP 1JM0A 1M57D 3S1KA 4UB6H 1N2DC 3L70E 1R8EA 4BRYA 1KYOD 1KN7A 1YTZT 1BGYJ 2AEFA 3L71G 1S2EA 5APXA 1N7LA 2YMYA 4YTPC 1N7SC 4WVZA 1FZEA 4TT3H 2C0XA 3I56P 2W83C 2IDBA 1QL1A 1GDTA 4DOJA 3HRNA 1PL5A 3USSA 3HE4A 2QG4A 1LT1A 4K35A 2C0WA 3CCRP 1VQ7P 2H89C 2IFNA 3Q3DA 2FFDA 3CWBE 1VQ8P 1LT9A 1VQKP 1IFNA 5APUA 2HYNA 2K37A 4C7RA 3HUSB 2N1TB 4H13B 3VMZA 1NO4A 1ZRTD 1YJWP 1SQBE 2E5YA 3L71J 2OTKE 1BE3E 1HUCA 2Q3IA 2XNXA 3NXSA 1L0LD 2P7JA 1OW7A 2OGUA 1JO5A 1JUNA 4O9BA 3A0BE 4GDOA 4WY4A 1H0TB 1R5LA 3BCCE 3G71P 3Q5SA 3LIDA 5APVA 2W27A 3FGAD 2UWJE 1H8AA 3CCVP 3H25A 3PRJA 4TLFA 1L0LG 4B86A 1H0TA 3KZIE 1FZAA 1JB0J 3O6QA 4R4MA 1QGKB 2L5GB 1GK6A 2E5TA 3EFFK 3TYYA 4ZKUA 1PP9J 1BSNA 3L72E 4KT0J 1NWQA 2KI7B 1L4AB 3P7KA 4XFJA 3W67A 2NPSD 3H1ID 2OYHA 3GMAA 2N1TA 5CCGC 1ZW0A 1GK4A 1JCDA 1GW4A 2FYNB 3AE4C 3B5NC 4WB4A 2BASA 1KMIZ 1EZVG 1JMMA 1BE3D 2WSFH 3W68A 2WT7A 2E76D 2V7QJ 1K04A 5KLVE 1X9VA 1FZFA 1HGVA 1UIIA 1L0NE 1BDDA 4YPCA 2GUVA 3ZDMA 1FOSE 5GTHH 1VQMP 1VQ5P 1M8OB 1EDLA 3RL0D 5L8RJ 3V6IA 4UB8E 1LTJB 1JY2N 1JY3O 1N86A 2Y0DA 2KZJA 3KHUA 3B8EB 3L75G 1G1IA 4D6TE 4BRYB 1PZQA 3FX0A 1WT6A 2FYUD 3L36A 3TNUB 3HTKA 5KLVG 1IO4A 1SQQG 2MKVA 2PRRA 3SFEC 1ZXGA 2HR3A 1BSHA 1KQFB 5KKZB 3CC2P 3CX5D 1FS0E 1OW8A 2WWWA 3L35A 4U7JA 3U1AA 4BWNA 2HLOA 3CD6P 1JY2P 4PD4H 1BCCJ 1SFCB 4PD4D 2AXTH 1IC2A 2JJLA 2JWDA 4NPEA 2AEJA 2O01N 2B87B 1TU3F 4XE5B 1Y8AA 3TSIA 3B5NB 3G4SP 1W2EA 1EQ7A 2M5AB 3ABVC 3T97A 5B5EE 2H43A 1NKZB 4WY4D 5DJTB 3BRVB 3WUVA 3G6EP 3G9RA 2R5BA 1KQGB 4D6TJ 4ZKPA 1ZR2A 5AW3B 1VF5D 4I6MC 1GL2D 1PP9D 3V2NA 4C7NA 3AE7C 3Q1MA 4Y99C 4C7NB 1S5LX 2FYNC 4IL6E 3AE6C 2HODB 1SQVJ 3VMYA 2RN0A 3R4YA 2E74B 1YJ9P 1EDKA 5APTA 1OIPA 3L70J 4RO0A 1GU4A 2HPCA 1S1CX 2PP6A 5APSA 3EFGA 3AEGC 3KYQA 3P32A 4PJ0H 5APYA 3V4QA 3SWFA 2Y0CA 1AV1A 1KB9H 2IBZD 2KNCA 2M5AA 3FWNA 2A45H 1JTHA 3H1HJ 2D2CB 3VP9A 5AW1B 3PHLA 3L71E 1Z56A 2KXPB 3H1JG 1YQ3C 3C1LA 1S72P 2XKMA 2K9YA 1T2KC 1SFCA 2V4HA 1VQPP 2K9JA 2XU6A 2VRSA 1OWAA 3MTUE 2ZT9D 1RH5B 4HKZH 3AE9C 4DT0A 2FYUJ 3D70A 3TNUA 1SQVE 1NGMB 1SFCD 1KC8Q 4GT1A 3VYIA 4DCKA 1KB9D 4OGQC 5EFWB 2ZYGA 4H44C 2N1TC 3BCCG 2OQQA 3L72D 3L75D 1KFNA 4H0LB 1QEXA 2O01H 5AW8B 1S9KE 1CSBA 1NH4A 3H1JJ 3BCCJ 2W6AA 3H1LE 1IFJA 3JSVC 5AVYB 4PD4E 3S9OA 4EYYQ 1T6AA 2B9BA 2O3JA 1NJIQ 1LWUA 1J2JB 1AQ5A 1MFTA 3IR9A 2WT7B 1VQ9P 4L74A 3MUDA 3RK2C 1RF0A 1QX8A 5KJ7C 4AQRD 3E7KA 2NRGA 4D6TD 1H88A 1OVUA 2R32A 1T3JA 1FZCA 2PGDA 2ZAEB 2NZ2A 2P58A 3AEDC 3RK3C 1M90Q 2H7HA 1M56D 3TGUG 1PGOA 1Y9BA 2BCCE 3CPWO 4EOTA 1VPCA 3H1JE 3H1LJ 4IL6H 1RHZB 3RBZA 3O8ZA 1AVOA 1LTJC 1U7MA 5KLVD 3RGUA 4CPGA 3CCMP 2Q5UA 3IF4A 3HE5B 4PJ0E 1N73B 2Q6QA 3SFDC 3AE8C 1IFMA 1Q81Q 4WY4B 1X79B 2E42A 3H1IE 1AA0A 4GOEA 2P67A 3EQ2A 2WPVB 1ZOYC 2MJZA 3HD7B 3CC4P 3QWOC 5CCHD 1URQD 2IZ0A 2BCCD 1SQPD 5C39A 3OAKA 3VP8A 3A0HH 2WMMA 3I55P 5B66E 4H0LD 3S4RA 1NTMG 4I1LA 2YXRB 3NMDA 1CZQA 1DD3A 1LWUB 3L72J 4WWIA 1SQBK 2I1JA 3D71A 5CCGD 1OMIA 3H1JD 1KFMA 3BATA 4GOFA 3VMAA 3IFMA 3JCUE 4RJTA 4Y28J 1LTTC 1U57A 2M3BA 3L71D 3LIEA 1IFPA 2XNDH 5CHXA 2E74C 3RL0B 1M1KQ 1L0LJ 1YQ4C 2WZ7A 4K3AA 4Y99B 2QM8A 1Q86Q 1S3JA 3JC22 1FJKA 2E76B 2WQYC 5E79E 2WSCH 1VQOP 1YHQP 1MV8A 5KAIE 3GLMA 1KB9E 3FXDA 3P8CE 1FJPA 1OZHA 1PV3A 1N73C 2E75C 4BXLA 2M8RA 2NPSB 2LXBA 3CX5H 5CBOA 3AEBC 3MZWB 3HD7C 5KAFE 2D2CC 2WSSH 3MD0A 1SQXJ 3KZIH 3L75E 1CW5A 1MFZA 3D6ZA 1PPJD 1EDJA 1JTHB 2GM4A 3L4FA
chains in the Genus database with same CATH topology
4LC1A 1GL2B 1YYCA 1L4AD 2YKOA 3NFQA 5CJ4A 1G2CA 1NOHA 1HGZA 2HODA 2QM7A 1ZLLA 3V5BA 1GW3A 1NTMK 4LLHA 1FBMA 3M0DC 4AYCA 3MGNA 4AUWA 1GZLA 1GL2A 2XDJA 2E43A 1SLQA 3I5CA 3CL3D 1LTAC 1FZGA 5CMZA 1LTIC 2ZXEB 1E5WA 3CLQA 5AW2B 3A3YB 5CCGA 1IFDA 3L37A 2OARA 3A7OA 3U59A 4N6JA 4DZOA 1OXZA 1G1JA 3HTKB 5CCHC 1KILA 2Z4EA 1LTJA 4GIFA 1FOSF 3WMM0 4HH2A 2J59M 3KDPB 2WITA 1KZUB 1RE3C 3KPEA 2N9BA 2GUSA 3M9QA 5AVXB 5APQA 1M1JA 2JEEA 2J58A 5CJ0A 1SVFA 2IX7C 1L4AA 3PP5A 4N78D 2FFDB 5AVWB 3UIAA 2YKQA 3MIWA 2PAJA 1CI6B 2C9NY 4IFDK 1QL2A 2OYIA 1IK9A 1WRGA 3P8MC 1N73A 4N78E 1SQPK 2OYIB 3R2PA 1CI6A 3M9HA 2FYUK 3M06A 3M9BA 4I2LC 1SQXK 4JYBA 2A45G 5AW4B 1SFCC 3HUSC 1LT9B 3U1CA 3N7NA 1NTZK 3V2RA 5AW5B 1XTGB 1JY2O 2YNYA 4C46A 4HYTB 5AVVB 1KILD 1URQA 1M7LA 1NTKK 3VTPC 5AVUB 3V4WA 2KB7P 1KQLA 4IFFA 5AVSB 1H89A 1IFIA 2Z5HA 4B86A 1YTZI 3RK3D 3E1IA 1RE4C 4W7YA 2CPSA 1JY3N 1N7SA 5AW9B 3RL0C 2FYZA 1L4AC 2FXMA 1GD2E 1S9KD 1ZR4A 1PFIA 1RF1C 1N7SD 4XA4A 2WSEH 5AVTB 1FZBA 1T3UA 2H8PD 2WTYA 3HD7D 2A45I 3SWYA 5KJ7A 3M91A 1X8YA 2WPSA 2KSJA 4W80A 1KILC 1MUUA 1HJBA 1FDMA 5KJ7D 5CCHA 1HVVA 3G3ZA 3B5NA 2P1JA 1T8ZA 2HFED 4N3YB 2NPSA 2Z5IA 1A02F 3H32B 2IPPA 5BU8B 1N7SB 1LGHB 1HWTC 2O1JA 3RK2B 3RK2D 2WPRA 4WY4C 3M0DA 5AW0B 2ZFCA 1T2KD 3VOPA 1URQB 1RF1A 3A5TA 1GTWA 2C9LY 3A2AA 2HG5D 3P8CD 2Q7CA 4IFMA 1IJDB 2LKMA 3V2QA 1JCCA 1JOCA 5KLVK 2OYHB 1RE4A 1JNMA 1RY3A 3HD7A 3VN0A 5AW7B 3U1AA 1HTLC 3LW5H 3C9IA 2OYIC 1NU1K 1URQC 4RESB 2KP8A 2CPBA 4KHXA 3HE5A 1MZ9A 1LTSC 2R3CA 1J1EB 3BASA 2O1KA 1RE3A 3B5ND 2XZRA 1VDFA 2FFDA 1J1DB 1FZCB 3VMXA 1LTBC 2KOGA 1DH3A 3HUSA 1M1JB 2R5DA 4EIJA 2Q9IA 2YO2A 3HE4B 5APWA 1LTGC 2NPSC 1DX7A 1RF1B 2XV5A 3M0AA 1XTCC 1HH0A 3II6A 2P2UA 1SQVK 3RK3B 1KILB 1JY3P 1GU5A 2W6BA 1J1DC 3GHGC 4JYCA 1L0LK 4W7ZA 1J1EC 4M3LA 1HBWA 2POHA 3OJAB 1M1JC 3H32A 1ZV8A 5KTBA 1FZCC 1NAFA 5AW6B 4GKGA 1RF0C 3V2PA 1SQQK 1A02J 5BVZA 4OH8B 3BRTB 2KLVA 4WBAA 2HPCB 1LWUC 3GHGA 1LT9C 1FAVA 1L0NK 2YO3A 2YKPA 1G2CB 3GHGB 4LGDE 2IFMA 3N4XA 1NHLA 2KYVA 3OA7A 2OYHC 3TK1A 5AVRB 3H6PA 1GL2C 1DEBA 2I1KA 1AFOA 2WPQA 1FU1A 1NKNA 1ZN5A 5AVZB 3NTNA 2N1TD 2FKWB 5AVQB 3CI9A 2FFDC 1SP4A 4JF7A 3KQGA 5BU5A 1N2DC 1YTZT 5APXA 1N7LA 2YMYA 1N7SC 1FZEA 2C0XA 1QL1A 1GDTA 4DOJA 3HRNA 3HE4A 2C0WA 2IFNA 1LT9A 1IFNA 5APUA 2HYNA 4C7RA 3HUSB 2N1TB 3VMZA 1NO4A 1HUCA 2Q3IA 2XNXA 3NXSA 2P7JA 1JUNA 1JO5A 4O9BA 4WY4A 3LIDA 5APVA 2W27A 1H8AA 1FZAA 2L5GB 1GK6A 3TYYA 4ZKUA 1NWQA 3P7KA 1L4AB 2NPSD 2OYHA 2N1TA 5CCGC 1GK4A 1JCDA 1GW4A 3B5NC 4WB4A 2BASA 1JMMA 2WSFH 2WT7A 1X9VA 1FZFA 1HGVA 1FOSE 2GUVA 3RL0D 1LTJB 1JY2N 1JY3O 1N86A 3B8EB 1G1IA 1WT6A 3TNUB 3L36A 3HTKA 1IO4A 2WWWA 3L35A 2HLOA 1JY2P 1SFCB 1IC2A 2JJLA 4XE5B 3TSIA 3B5NB 2H43A 1W2EA 1EQ7A 3T97A 1NKZB 4WY4D 3BRVB 2R5BA 4ZKPA 1ZR2A 5AW3B 4I6MC 1GL2D 3V2NA 4C7NA 4Y99C 4C7NB 2HODB 3VMYA 5APTA 2HPCA 1GU4A 2PP6A 5APSA 3EFGA 3KYQA 5APYA 3P32A 3V4QA 3SWFA 2A45H 1JTHA 3VP9A 5AW1B 1Z56A 2XKMA 1T2KC 1SFCA 2XU6A 2VRSA 1OWAA 3MTUE 3TNUA 1SFCD 4GT1A 3VYIA 2N1TC 5AW8B 3BVHA 1KFNA 2O01H 1S9KE 1CSBA 1NH4A 2W6AA 1IFJA 5AVYB 1LWUA 1J2JB 1AQ5A 3IR9A 2WT7B 3MUDA 3RK2C 1RF0A 5KJ7C 4AQRD 1H88A 2R32A 1T3JA 1FZCA 3RK3C 2H7HA 4EOTA 1VPCA 3O8ZA 1LTJC 2Q5UA 3HE5B 1N73B 1IFMA 4WY4B 1X79B 2E42A 2P67A 3EQ2A 2MJZA 3HD7B 5CCHD 1URQD 3OAKA 3VP8A 4I1LA 3NMDA 1CZQA 1LWUB 1SQBK 2I1JA 5CCGD 1KFMA 3BATA 3IFMA 1LTTC 2M3BA 3RL0B 3LIEA 5CHXA 2WZ7A 4Y99B 2QM8A 1FJKA 2WSCH 1MV8A 3P8CE 1FJPA 1N73C 2M8RA 2NPSB 3HD7C 3MD0A 1CW5A 1MFZA 1JTHB 2GM4A 3L4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LC1 A;  1A02 J;  1YYC A;  5AVT B;  2WTY A;  2R5B A;  3NFQ A;  3M91 A;  1X8Y A;  1FAV A;  5AW3 B;  2QM7 A;  2WPS A;  4I6M C;  4C7N A;  3V5B A;  2YO3 A;  4C7N B;  1MUU A;  3VMY A;  1G2C B;  5APT A;  1HJB A;  1GU4 A;  4AYC A;  5APS A;  3MGN A;  5APY A;  3P32 A;  3V4Q A;  4AUW A;  3SWF A;  1GZL A;  3TK1 A;  2E43 A;  5AVR B;  1SLQ A;  3I5C A;  5AW1 B;  2WPQ A;  5CMZ A;  2ZXE B;  1T2K C;  5AVZ B;  3NTN A;  2Z5I A;  5AW2 B;  1A02 F;  3A3Y B;  2XU6 A;  2IPP A;  5AVQ B;  2VRS A;  3L37 A;  1OWA A;  1SP4 A;  3A7O A;  3KQG A;  4DZO A;  1OXZ A;  1HWT C;  3TNU A;  4GT1 A;  3VYI A;  5APX A;  2WPR A;  3M0D A;  5AW0 B;  5AW8 B;  1FOS F;  2ZFC A;  1S9K E;  1T2K D;  1CSB A;  2W6A A;  5AVY B;  3KDP B;  3A5T A;  1GTW A;  1J2J B;  2C9L Y;  3A2A A;  3IR9 A;  3HE4 A;  2WT7 B;  2N9B A;  5AVX B;  2Q7C A;  5APQ A;  5APU A;  4AQR D;  3VMZ A;  1H88 A;  2R32 A;  1JNM A;  1HUC A;  3NXS A;  2Q3I A;  2H7H A;  2P7J A;  3VN0 A;  5AVW B;  5AW7 B;  1JUN A;  4EOT A;  3UIA A;  2C9N Y;  1CI6 B;  3O8Z A;  4RES B;  2KP8 A;  3P8M C;  4KHX A;  3HE5 A;  3LID A;  5APV A;  2Q5U A;  2W27 A;  1H8A A;  3HE5 B;  1CI6 A;  2R3C A;  3M9H A;  3M06 A;  3M9B A;  2E42 A;  4I2L C;  1GK6 A;  2XZR A;  2P67 A;  4JYB A;  3TYY A;  1NWQ A;  3P7K A;  5AW4 B;  3VMX A;  1DH3 A;  2R5D A;  1GK4 A;  3OAK A;  2BAS A;  2YO2 A;  5AW5 B;  3HE4 B;  2WT7 A;  2YNY A;  5APW A;  4C46 A;  3NMD A;  4HYT B;  1CZQ A;  5AVV B;  2XV5 A;  3VTP C;  3M0A A;  1FOS E;  5AVU B;  3V4W A;  3LIE A;  2P2U A;  1KQL A;  5AVS B;  1H89 A;  3B8E B;  2Z5H A;  2QM8 A;  1GU5 A;  4B86 A;  3TNU B;  3L36 A;  3HTK A;  1IO4 A;  1MV8 A;  4JYC A;  4M3L A;  1HBW A;  2WWW A;  3L35 A;  5AW9 B;  1NAF A;  5AW6 B;  2JJL A;  1GD2 E;  1S9K D;  3MD0 A;  4GKG A;  4XE5 B;  1MFZ A;  3T97 A; 
#chains in the Genus database with same CATH topology
 3CC7 P;  4LC1 A;  1GL2 B;  1P84 D;  1YYC A;  2K88 A;  3F89 A;  1PP9 E;  2DW3 A;  2L91 A;  1L4A D;  2YKO A;  3NFQ A;  3WU2 E;  3OW2 O;  5CJ4 A;  1G2C A;  1P84 H;  2E75 D;  1NOH A;  3JCU H;  1HGZ A;  1PP9 G;  2HOD A;  2KLU A;  1USE A;  2QM7 A;  1ZLL A;  3V5B A;  1GW3 A;  1NTM K;  3K5B A;  4H13 C;  3CCL P;  4LLH A;  3AE1 C;  2W6J H;  5KLI C;  1FBM A;  2G3A A;  1PGQ A;  3H1K D;  2AXT E;  3GW6 A;  3M0D C;  4EDF A;  3Q2Y A;  4AYC A;  3QH9 A;  4U3F J;  2Y9Y A;  1L0N J;  3MGN A;  4AUW A;  1GZL A;  1GL2 A;  1Q2N A;  2QJK B;  2XDJ A;  3RBX A;  2E43 A;  4QMA A;  2YXQ B;  1KYO H;  1SLQ A;  3I5C A;  3CL3 D;  1VQL P;  1LTA C;  1FZG A;  1SQB J;  2J5U A;  3CX5 E;  3WU2 H;  3CME P;  5CMZ A;  1VQ6 P;  1LTI C;  2ZXE B;  1NTZ E;  1E5W A;  1KIL E;  2M0B A;  3CLQ A;  5AW2 B;  2QJP B;  3AE3 C;  1VQ4 P;  2IZ1 A;  1BGY D;  3A3Y B;  1L2P A;  1IFD A;  3IN6 A;  1HJ0 A;  3L37 A;  2OAR A;  5CCG A;  1K9M Q;  1LJ2 A;  3A7O A;  3CXH D;  3U59 A;  1KD1 Q;  4N6J A;  4DZO A;  1OXZ A;  2BCC G;  1G1J A;  1Y47 A;  1L0N G;  2V7Q H;  1FE6 A;  3HTK B;  1KB9 I;  5CCH C;  1KIL A;  2Z4E A;  3EWK A;  4YXD C;  2Q1K A;  1LTJ A;  4GIF A;  1BGY G;  1FOS F;  2PFX A;  1BCC G;  3RK3 E;  1S4X A;  2FYU E;  5CBN A;  3WMM 0;  4HH2 A;  1PPJ G;  3CXH H;  1OX3 A;  2J59 M;  1SQX D;  1EC5 A;  3KDP B;  2WIT A;  1KZU B;  1RE3 C;  1SQP G;  3KPE A;  2FXO A;  5TJH A;  2N9B A;  3ITK A;  2GUS A;  3M9Q A;  5AVX B;  1FDO A;  5APQ A;  2O01 J;  1ZP0 C;  3LW5 J;  3MUD C;  1KV4 A;  1M1J A;  3PLN A;  2JEE A;  2J58 A;  2OTL P;  5CJ0 A;  5KLI B;  3KXD A;  1SQQ D;  1QVG O;  1SVF A;  2IX7 C;  2Q3E A;  4PV1 C;  1L4A A;  2AXC A;  2B88 A;  3PP5 A;  1SQV G;  1IZN B;  1NTM J;  4N78 D;  1SQP E;  5AVW B;  2FFD B;  2IBZ I;  1EDI A;  2YKQ A;  2YMK A;  3UIA A;  3L73 E;  3BCC D;  3L72 G;  2PAJ A;  1CI6 B;  3MIW A;  4A7P A;  1QL2 A;  2KIK A;  2C9N Y;  4IFD K;  2OYI A;  3CWB D;  3AE2 C;  1IK9 A;  1WRG A;  1RQV A;  3P8M C;  4MN4 C;  1N73 A;  4N78 E;  4ASV A;  1SQP K;  2OYI B;  3R2P A;  1CI6 A;  3M9H A;  2FYU K;  1X0T A;  3M06 A;  3M9B A;  1EZV D;  4I2L C;  1SQX K;  4IOI H;  4JYB A;  5GTH E;  1HF9 A;  2E75 B;  4UB8 H;  2A45 G;  5AW4 B;  1SFC C;  3HUS C;  3L75 J;  1NTZ J;  1EZV E;  5GTI E;  1SQX E;  1NTZ G;  1LT9 B;  4Z1M H;  5KAI H;  5KKZ C;  1IK7 A;  3U1C A;  3N7N A;  1NTZ K;  3V2R A;  5AW5 B;  1XTG B;  1JY2 O;  2YNY A;  4C46 A;  2JDI H;  4HJG H;  4HYT B;  4ASW A;  4ZMD A;  3AEF C;  1KTM A;  5AVV B;  1K05 A;  4EI2 A;  1KIL D;  1W5C E;  1URQ A;  1EXI A;  1M7L A;  1NTK K;  2QJK C;  1NTK D;  1UIX A;  5AVU B;  5AW7 B;  3V4W A;  3VTP C;  1VL2 A;  2KZI A;  2ZYD A;  1WMK A;  2KB7 P;  1KQL A;  4IFF A;  5AVS B;  1H89 A;  3GF3 A;  1IFI A;  2Z5H A;  1GMJ A;  3AEA C;  4I7Z B;  1BCC D;  1SS1 A;  3H1L D;  1YTZ I;  2KSE A;  3L74 D;  2BCC J;  3RK3 D;  1EZV I;  2ITA A;  3E1I A;  4D6T G;  1RE4 C;  4W7Y A;  2CPS A;  1JY3 N;  1N7S A;  1VF5 C;  2I8D A;  3CX5 I;  5AW9 B;  4L75 A;  1JEK A;  3RL0 C;  1NU1 D;  2A06 E;  2FYZ A;  3H1L G;  1L4A C;  2FXM A;  2RH0 A;  1GD2 E;  1S9K D;  3CCE P;  1ZR4 A;  5B66 H;  1PFI A;  2RKL A;  1RF1 C;  2KNC B;  1AJY A;  1N7S D;  2QJY B;  3AEC C;  1MKM A;  3MP7 B;  4H44 D;  1KYO E;  4XA4 A;  2WSE H;  5AVT B;  3SSU A;  1FZB A;  1T3U A;  1AVY A;  2H8P D;  2WTY A;  3HD7 D;  1RQU A;  2JP3 A;  2A45 I;  3GF7 A;  4OGQ B;  3SWY A;  5KJ7 A;  3M91 A;  1X8Y A;  2P10 A;  4L73 A;  3H1H E;  1KOR A;  2KSJ A;  2M3E A;  2WPS A;  2FBW C;  2ZJS E;  4W80 A;  5M1B A;  1KIL C;  2E76 C;  2OTJ P;  1MUU A;  1S5L E;  3L70 G;  2QA4 P;  3B71 A;  1NTZ D;  2AEM A;  3CCJ P;  1HJB A;  5KAF H;  3CCU P;  1N8R Q;  1FDM A;  5KJ7 D;  2ZXX A;  1R5S A;  5CCH A;  1DIP A;  1HVV A;  3G3Z A;  3Q5P A;  2IYP A;  3E1R A;  3WUT A;  3B5N A;  3CCS P;  2P1J A;  4R4L A;  1T8Z A;  4YXW H;  1KYO I;  1SQX G;  2Y0E A;  2HFE D;  4N3Y B;  5E79 H;  2NPS A;  2Z5I A;  1OW6 A;  1A02 F;  3PTZ A;  1ZME C;  1Q82 Q;  1PIX A;  3H32 B;  2IPP A;  1PPJ E;  1BE3 G;  1N7S B;  3H1H D;  5BU8 B;  3WUU A;  5GTI H;  3BVH A;  3L74 G;  3A0H E;  3CCQ P;  3D6Y A;  1PGJ A;  1LGH B;  1HWT C;  1BDC A;  1NTK E;  1P84 E;  2O1J A;  4L76 A;  3RK2 B;  4PV1 B;  3RK2 D;  2WPR A;  4WY4 C;  3M0D A;  5AW0 B;  3B4S A;  5B5E H;  2ZFC A;  4U3F G;  3FWL A;  1NU1 J;  3GG2 A;  1T2K D;  2Y9Z A;  3VOP A;  1URQ B;  2A06 D;  4PV1 D;  2FY8 A;  3TF5 A;  3AE5 C;  1RF1 A;  1QVF O;  3A5T A;  1GTW A;  2C9L Y;  3TGU E;  3A2A A;  1BE3 J;  2HG5 D;  3P8C D;  1YI2 P;  2GA1 A;  2FXP A;  2Q7C A;  4ZNC A;  4IFM A;  1IJD B;  2LKM A;  5H2F E;  3V2Q A;  1JCC A;  1JOC A;  3IAO A;  3L73 D;  4U3F D;  5K5G B;  5KLV K;  2QJP C;  1EXJ A;  2OYH B;  1RE4 A;  1JNM A;  1RY3 A;  1W2B O;  2BEZ F;  3HD7 A;  2SPZ A;  3TGU J;  4DJG A;  1NYH A;  2KS1 B;  2E74 D;  3VN0 A;  1LP1 B;  2D2C D;  2QVA A;  1SQB D;  1HTL C;  1OVV A;  1YBK A;  2JKV A;  3LW5 H;  3C9I A;  3O6Q B;  4HB1 A;  4NPD A;  1NU1 K;  2R44 A;  2QEX P;  1URQ C;  2OYI C;  2WSE J;  4RES B;  2KP8 A;  2CPB A;  2R3S A;  1DD4 A;  4UB6 E;  4KHX A;  2ZYA A;  3CWB G;  3FXE A;  1LNQ A;  3HE5 A;  1Q7Y Q;  1MZ9 A;  5TIS H;  3CMA P;  1YJN P;  1NAY A;  4GOD A;  1OFC X;  1LTS C;  1SQB G;  4H0L C;  2R3C A;  1J1E B;  3BAS A;  4H44 B;  2O1K A;  5H2F H;  1VQN P;  1SQP J;  1RE3 A;  1VF5 B;  2K3R A;  2QIW A;  1LP1 A;  1VDF A;  2XZR A;  3B5N D;  1J1D B;  4JQ0 D;  1SQQ J;  2KS1 A;  4OGQ D;  1S5L H;  5KLV J;  1KQS O;  1PGP A;  1FZC B;  3VMX A;  3H1I G;  2RMZ A;  1LTB C;  2KOG A;  2YIU C;  2ZT9 C;  1M1J B;  2R5D A;  3A0B H;  3HUS A;  1YIJ P;  1DH3 A;  4EIJ A;  2Q9I A;  3RL0 g;  3CWB J;  2YO2 A;  3CXH I;  3HE4 B;  1SQQ E;  5APW A;  1LTG C;  2NPS C;  2QJY C;  4U3F E;  5DJU B;  1RF1 B;  2KK7 A;  1DX7 A;  4H13 D;  2XV5 A;  2WSC J;  3L70 D;  3M0A A;  2OYO A;  1XTC C;  1HH0 A;  4OWF A;  1P84 I;  3C8V A;  3II6 A;  1L0L E;  1SQV K;  2P2U A;  2YIU B;  2WSF J;  2ZT9 B;  3CXH E;  2K1A A;  3RK3 B;  2IBZ E;  1NTM D;  1KIL B;  1JY3 P;  1ZRT E;  1BGY E;  2B89 A;  2JO1 A;  2W6B A;  1FC2 C;  4RKU J;  1J1D C;  4NPF X;  1GU5 A;  2FYU G;  2JWA A;  3AEE C;  3GHG C;  1OVR A;  2BEQ D;  1L0L K;  3L73 J;  4JBZ A;  4JYC A;  4W7Z A;  1J1E C;  4M3L A;  1HBW A;  2KUB A;  3PJS K;  2POH A;  2QE7 H;  1M1J C;  2K9J B;  3H32 A;  3OJA B;  3TGU D;  1SQV D;  1ZV8 A;  5KTB A;  3H1H G;  2W90 A;  1NU1 G;  1E79 H;  1NAF A;  5AW6 B;  1FZC C;  3MHV A;  1D7M A;  2H88 C;  1AQT A;  4GKG A;  1RF0 C;  3H1K E;  3V2P A;  1SQQ K;  2ZVN B;  1A02 J;  5BVZ A;  4OH8 B;  3BRT B;  2KLV A;  3H1K G;  1DEE G;  2LR2 A;  3L74 J;  4WBA A;  1LWU C;  3GHG A;  1LT9 C;  3L73 G;  4IL6 X;  3Q5R A;  2HPC B;  1FAV A;  2QSI A;  1NU1 E;  2ZVO B;  4I7Z C;  1L0N K;  2YO3 A;  4JPZ B;  3F5H A;  1NTK G;  1Q90 D;  3SWK A;  2CK3 H;  2YKP A;  2IYO A;  1G2C B;  2W8Z A;  3GHG B;  1NTK J;  2IFM A;  3N4X A;  4LGD E;  3PH0 A;  3L74 E;  2N9Y B;  1NHL A;  1QLE D;  2KYV A;  3OA7 A;  3TDK A;  3TK1 A;  2QRX A;  1NTM E;  2OYH C;  1X22 A;  5AVR B;  3H6P A;  3T97 B;  2IBZ G;  1GL2 C;  1DEB A;  2I1K A;  2G8Y A;  2A06 G;  1NVO A;  3H1K J;  2B87 A;  4KJM A;  2JR8 A;  2WVR A;  4PD4 I;  1AFO A;  2WPQ A;  1FU1 A;  1L0N D;  1JMB A;  1NKN A;  1ZN5 A;  1K73 Q;  5AVZ B;  3NTN A;  5TIS E;  1K8A Q;  1BCC E;  2N1T D;  2LXC B;  2FKW B;  4OVN F;  1FDI A;  3CI9 A;  5AVQ B;  2FFD C;  1SP4 A;  1USD A;  1U7J A;  3H1I J;  3KQG A;  4JF7 A;  5BU5 A;  1YIT P;  1JM0 A;  1M57 D;  3S1K A;  4UB6 H;  1N2D C;  3L70 E;  1R8E A;  4BRY A;  1KYO D;  1KN7 A;  1YTZ T;  1BGY J;  2AEF A;  3L71 G;  1S2E A;  5APX A;  1N7L A;  2YMY A;  4YTP C;  1N7S C;  4WVZ A;  1FZE A;  4TT3 H;  2C0X A;  3I56 P;  2W83 C;  2IDB A;  1QL1 A;  1GDT A;  4DOJ A;  3HRN A;  1PL5 A;  3USS A;  3HE4 A;  2QG4 A;  1LT1 A;  4K35 A;  2C0W A;  3CCR P;  1VQ7 P;  2H89 C;  2IFN A;  3Q3D A;  2FFD A;  3CWB E;  1VQ8 P;  1LT9 A;  1VQK P;  1IFN A;  5APU A;  2HYN A;  2K37 A;  4C7R A;  3HUS B;  2N1T B;  4H13 B;  3VMZ A;  1NO4 A;  1ZRT D;  1YJW P;  1SQB E;  2E5Y A;  3L71 J;  2OTK E;  1BE3 E;  1HUC A;  2Q3I A;  2XNX A;  3NXS A;  1L0L D;  2P7J A;  1OW7 A;  2OGU A;  1JO5 A;  1JUN A;  4O9B A;  3A0B E;  4GDO A;  4WY4 A;  1H0T B;  1R5L A;  3BCC E;  3G71 P;  3Q5S A;  3LID A;  5APV A;  2W27 A;  3FGA D;  2UWJ E;  1H8A A;  3CCV P;  3H25 A;  3PRJ A;  4TLF A;  1L0L G;  4B86 A;  1H0T A;  3KZI E;  1FZA A;  1JB0 J;  3O6Q A;  4R4M A;  1QGK B;  2L5G B;  1GK6 A;  2E5T A;  3EFF K;  3TYY A;  4ZKU A;  1PP9 J;  1BSN A;  3L72 E;  4KT0 J;  1NWQ A;  2KI7 B;  1L4A B;  3P7K A;  4XFJ A;  3W67 A;  2NPS D;  3H1I D;  2OYH A;  3GMA A;  2N1T A;  5CCG C;  1ZW0 A;  1GK4 A;  1JCD A;  1GW4 A;  2FYN B;  3AE4 C;  3B5N C;  4WB4 A;  2BAS A;  1KMI Z;  1EZV G;  1JMM A;  1BE3 D;  2WSF H;  3W68 A;  2WT7 A;  2E76 D;  2V7Q J;  1K04 A;  5KLV E;  1X9V A;  1FZF A;  1HGV A;  1UII A;  1L0N E;  1BDD A;  4YPC A;  2GUV A;  3ZDM A;  1FOS E;  5GTH H;  1VQM P;  1VQ5 P;  1M8O B;  1EDL A;  3RL0 D;  5L8R J;  3V6I A;  4UB8 E;  1LTJ B;  1JY2 N;  1JY3 O;  1N86 A;  2Y0D A;  2KZJ A;  3KHU A;  3B8E B;  3L75 G;  1G1I A;  4D6T E;  4BRY B;  1PZQ A;  3FX0 A;  1WT6 A;  2FYU D;  3L36 A;  3TNU B;  3HTK A;  5KLV G;  1IO4 A;  1SQQ G;  2MKV A;  2PRR A;  3SFE C;  1ZXG A;  2HR3 A;  1BSH A;  1KQF B;  5KKZ B;  3CC2 P;  3CX5 D;  1FS0 E;  1OW8 A;  2WWW A;  3L35 A;  4U7J A;  3U1A A;  4BWN A;  2HLO A;  3CD6 P;  1JY2 P;  4PD4 H;  1BCC J;  1SFC B;  4PD4 D;  2AXT H;  1IC2 A;  2JJL A;  2JWD A;  4NPE A;  2AEJ A;  2O01 N;  2B87 B;  1TU3 F;  4XE5 B;  1Y8A A;  3TSI A;  3B5N B;  3G4S P;  1W2E A;  1EQ7 A;  2M5A B;  3ABV C;  3T97 A;  5B5E E;  2H43 A;  1NKZ B;  4WY4 D;  5DJT B;  3BRV B;  3WUV A;  3G6E P;  3G9R A;  2R5B A;  1KQG B;  4D6T J;  4ZKP A;  1ZR2 A;  5AW3 B;  1VF5 D;  4I6M C;  1GL2 D;  1PP9 D;  3V2N A;  4C7N A;  3AE7 C;  3Q1M A;  4Y99 C;  4C7N B;  1S5L X;  2FYN C;  4IL6 E;  3AE6 C;  2HOD B;  1SQV J;  3VMY A;  2RN0 A;  3R4Y A;  2E74 B;  1YJ9 P;  1EDK A;  5APT A;  1OIP A;  3L70 J;  4RO0 A;  1GU4 A;  2HPC A;  1S1C X;  2PP6 A;  5APS A;  3EFG A;  3AEG C;  3KYQ A;  3P32 A;  4PJ0 H;  5APY A;  3V4Q A;  3SWF A;  2Y0C A;  1AV1 A;  1KB9 H;  2IBZ D;  2KNC A;  2M5A A;  3FWN A;  2A45 H;  1JTH A;  3H1H J;  2D2C B;  3VP9 A;  5AW1 B;  3PHL A;  3L71 E;  1Z56 A;  2KXP B;  3H1J G;  1YQ3 C;  3C1L A;  1S72 P;  2XKM A;  2K9Y A;  1T2K C;  1SFC A;  2V4H A;  1VQP P;  2K9J A;  2XU6 A;  2VRS A;  1OWA A;  3MTU E;  2ZT9 D;  1RH5 B;  4HKZ H;  3AE9 C;  4DT0 A;  2FYU J;  3D70 A;  3TNU A;  1SQV E;  1NGM B;  1SFC D;  1KC8 Q;  4GT1 A;  3VYI A;  4DCK A;  1KB9 D;  4OGQ C;  5EFW B;  2ZYG A;  4H44 C;  2N1T C;  3BCC G;  2OQQ A;  3L72 D;  3L75 D;  1KFN A;  4H0L B;  1QEX A;  2O01 H;  5AW8 B;  1S9K E;  1CSB A;  1NH4 A;  3H1J J;  3BCC J;  2W6A A;  3H1L E;  1IFJ A;  3JSV C;  5AVY B;  4PD4 E;  3S9O A;  4EYY Q;  1T6A A;  2B9B A;  2O3J A;  1NJI Q;  1LWU A;  1J2J B;  1AQ5 A;  1MFT A;  3IR9 A;  2WT7 B;  1VQ9 P;  4L74 A;  3MUD A;  3RK2 C;  1RF0 A;  1QX8 A;  5KJ7 C;  4AQR D;  3E7K A;  2NRG A;  4D6T D;  1H88 A;  1OVU A;  2R32 A;  1T3J A;  1FZC A;  2PGD A;  2ZAE B;  2NZ2 A;  2P58 A;  3AED C;  3RK3 C;  1M90 Q;  2H7H A;  1M56 D;  3TGU G;  1PGO A;  1Y9B A;  2BCC E;  3CPW O;  4EOT A;  1VPC A;  3H1J E;  3H1L J;  4IL6 H;  1RHZ B;  3RBZ A;  3O8Z A;  1AVO A;  1LTJ C;  1U7M A;  5KLV D;  3RGU A;  4CPG A;  3CCM P;  2Q5U A;  3IF4 A;  3HE5 B;  4PJ0 E;  1N73 B;  2Q6Q A;  3SFD C;  3AE8 C;  1IFM A;  1Q81 Q;  4WY4 B;  1X79 B;  2E42 A;  3H1I E;  1AA0 A;  4GOE A;  2P67 A;  3EQ2 A;  2WPV B;  1ZOY C;  2MJZ A;  3HD7 B;  3CC4 P;  3QWO C;  5CCH D;  1URQ D;  2IZ0 A;  2BCC D;  1SQP D;  5C39 A;  3OAK A;  3VP8 A;  3A0H H;  2WMM A;  3I55 P;  5B66 E;  4H0L D;  3S4R A;  1NTM G;  4I1L A;  2YXR B;  3NMD A;  1CZQ A;  1DD3 A;  1LWU B;  3L72 J;  4WWI A;  1SQB K;  2I1J A;  3D71 A;  5CCG D;  1OMI A;  3H1J D;  1KFM A;  3BAT A;  4GOF A;  3VMA A;  3IFM A;  3JCU E;  4RJT A;  4Y28 J;  1LTT C;  1U57 A;  2M3B A;  3L71 D;  3LIE A;  1IFP A;  2XND H;  5CHX A;  2E74 C;  3RL0 B;  1M1K Q;  1L0L J;  1YQ4 C;  2WZ7 A;  4K3A A;  4Y99 B;  2QM8 A;  1Q86 Q;  1S3J A;  3JC2 2;  1FJK A;  2E76 B;  2WQY C;  5E79 E;  2WSC H;  1VQO P;  1YHQ P;  1MV8 A;  5KAI E;  3GLM A;  1KB9 E;  3FXD A;  3P8C E;  1FJP A;  1OZH A;  1PV3 A;  1N73 C;  2E75 C;  4BXL A;  2M8R A;  2NPS B;  2LXB A;  3CX5 H;  5CBO A;  3AEB C;  3MZW B;  3HD7 C;  5KAF E;  2D2C C;  2WSS H;  3MD0 A;  1SQX J;  3KZI H;  3L75 E;  1CW5 A;  1MFZ A;  3D6Z A;  1PPJ D;  1EDJ A;  1JTH B;  2GM4 A;  3L4F A; 
#chains in the Genus database with same CATH homology
 4LC1 A;  1GL2 B;  1YYC A;  1L4A D;  2YKO A;  3NFQ A;  5CJ4 A;  1G2C A;  1NOH A;  1HGZ A;  2HOD A;  2QM7 A;  1ZLL A;  3V5B A;  1GW3 A;  1NTM K;  4LLH A;  1FBM A;  3M0D C;  4AYC A;  3MGN A;  4AUW A;  1GZL A;  1GL2 A;  2XDJ A;  2E43 A;  1SLQ A;  3I5C A;  3CL3 D;  1LTA C;  1FZG A;  5CMZ A;  1LTI C;  2ZXE B;  1E5W A;  3CLQ A;  5AW2 B;  3A3Y B;  5CCG A;  1IFD A;  3L37 A;  2OAR A;  3A7O A;  3U59 A;  4N6J A;  4DZO A;  1OXZ A;  1G1J A;  3HTK B;  5CCH C;  1KIL A;  2Z4E A;  1LTJ A;  4GIF A;  1FOS F;  3WMM 0;  4HH2 A;  2J59 M;  3KDP B;  2WIT A;  1KZU B;  1RE3 C;  3KPE A;  2N9B A;  2GUS A;  3M9Q A;  5AVX B;  5APQ A;  1M1J A;  2JEE A;  2J58 A;  5CJ0 A;  1SVF A;  2IX7 C;  1L4A A;  3PP5 A;  4N78 D;  2FFD B;  5AVW B;  3UIA A;  2YKQ A;  3MIW A;  2PAJ A;  1CI6 B;  2C9N Y;  4IFD K;  1QL2 A;  2OYI A;  1IK9 A;  1WRG A;  3P8M C;  1N73 A;  4N78 E;  1SQP K;  2OYI B;  3R2P A;  1CI6 A;  3M9H A;  2FYU K;  3M06 A;  3M9B A;  4I2L C;  1SQX K;  4JYB A;  2A45 G;  5AW4 B;  1SFC C;  3HUS C;  1LT9 B;  3U1C A;  3N7N A;  1NTZ K;  3V2R A;  5AW5 B;  1XTG B;  1JY2 O;  2YNY A;  4C46 A;  4HYT B;  5AVV B;  1KIL D;  1URQ A;  1M7L A;  1NTK K;  3VTP C;  5AVU B;  3V4W A;  2KB7 P;  1KQL A;  4IFF A;  5AVS B;  1H89 A;  1IFI A;  2Z5H A;  4B86 A;  1YTZ I;  3RK3 D;  3E1I A;  1RE4 C;  4W7Y A;  2CPS A;  1JY3 N;  1N7S A;  5AW9 B;  3RL0 C;  2FYZ A;  1L4A C;  2FXM A;  1GD2 E;  1S9K D;  1ZR4 A;  1PFI A;  1RF1 C;  1N7S D;  4XA4 A;  2WSE H;  5AVT B;  1FZB A;  1T3U A;  2H8P D;  2WTY A;  3HD7 D;  2A45 I;  3SWY A;  5KJ7 A;  3M91 A;  1X8Y A;  2WPS A;  2KSJ A;  4W80 A;  1KIL C;  1MUU A;  1HJB A;  1FDM A;  5KJ7 D;  5CCH A;  1HVV A;  3G3Z A;  3B5N A;  2P1J A;  1T8Z A;  2HFE D;  4N3Y B;  2NPS A;  2Z5I A;  1A02 F;  3H32 B;  2IPP A;  5BU8 B;  1N7S B;  1LGH B;  1HWT C;  2O1J A;  3RK2 B;  3RK2 D;  2WPR A;  4WY4 C;  3M0D A;  5AW0 B;  2ZFC A;  1T2K D;  3VOP A;  1URQ B;  1RF1 A;  3A5T A;  1GTW A;  2C9L Y;  3A2A A;  2HG5 D;  3P8C D;  2Q7C A;  4IFM A;  1IJD B;  2LKM A;  3V2Q A;  1JCC A;  1JOC A;  5KLV K;  2OYH B;  1RE4 A;  1JNM A;  1RY3 A;  3HD7 A;  3VN0 A;  5AW7 B;  3U1A A;  1HTL C;  3LW5 H;  3C9I A;  2OYI C;  1NU1 K;  1URQ C;  4RES B;  2KP8 A;  2CPB A;  4KHX A;  3HE5 A;  1MZ9 A;  1LTS C;  2R3C A;  1J1E B;  3BAS A;  2O1K A;  1RE3 A;  3B5N D;  2XZR A;  1VDF A;  2FFD A;  1J1D B;  1FZC B;  3VMX A;  1LTB C;  2KOG A;  1DH3 A;  3HUS A;  1M1J B;  2R5D A;  4EIJ A;  2Q9I A;  2YO2 A;  3HE4 B;  5APW A;  1LTG C;  2NPS C;  1DX7 A;  1RF1 B;  2XV5 A;  3M0A A;  1XTC C;  1HH0 A;  3II6 A;  2P2U A;  1SQV K;  3RK3 B;  1KIL B;  1JY3 P;  1GU5 A;  2W6B A;  1J1D C;  3GHG C;  4JYC A;  1L0L K;  4W7Z A;  1J1E C;  4M3L A;  1HBW A;  2POH A;  3OJA B;  1M1J C;  3H32 A;  1ZV8 A;  5KTB A;  1FZC C;  1NAF A;  5AW6 B;  4GKG A;  1RF0 C;  3V2P A;  1SQQ K;  1A02 J;  5BVZ A;  4OH8 B;  3BRT B;  2KLV A;  4WBA A;  2HPC B;  1LWU C;  3GHG A;  1LT9 C;  1FAV A;  1L0N K;  2YO3 A;  2YKP A;  1G2C B;  3GHG B;  4LGD E;  2IFM A;  3N4X A;  1NHL A;  2KYV A;  3OA7 A;  2OYH C;  3TK1 A;  5AVR B;  3H6P A;  1GL2 C;  1DEB A;  2I1K A;  1AFO A;  2WPQ A;  1FU1 A;  1NKN A;  1ZN5 A;  5AVZ B;  3NTN A;  2N1T D;  2FKW B;  5AVQ B;  3CI9 A;  2FFD C;  1SP4 A;  4JF7 A;  3KQG A;  5BU5 A;  1N2D C;  1YTZ T;  5APX A;  1N7L A;  2YMY A;  1N7S C;  1FZE A;  2C0X A;  1QL1 A;  1GDT A;  4DOJ A;  3HRN A;  3HE4 A;  2C0W A;  2IFN A;  1LT9 A;  1IFN A;  5APU A;  2HYN A;  4C7R A;  3HUS B;  2N1T B;  3VMZ A;  1NO4 A;  1HUC A;  2Q3I A;  2XNX A;  3NXS A;  2P7J A;  1JUN A;  1JO5 A;  4O9B A;  4WY4 A;  3LID A;  5APV A;  2W27 A;  1H8A A;  1FZA A;  2L5G B;  1GK6 A;  3TYY A;  4ZKU A;  1NWQ A;  3P7K A;  1L4A B;  2NPS D;  2OYH A;  2N1T A;  5CCG C;  1GK4 A;  1JCD A;  1GW4 A;  3B5N C;  4WB4 A;  2BAS A;  1JMM A;  2WSF H;  2WT7 A;  1X9V A;  1FZF A;  1HGV A;  1FOS E;  2GUV A;  3RL0 D;  1LTJ B;  1JY2 N;  1JY3 O;  1N86 A;  3B8E B;  1G1I A;  1WT6 A;  3TNU B;  3L36 A;  3HTK A;  1IO4 A;  2WWW A;  3L35 A;  2HLO A;  1JY2 P;  1SFC B;  1IC2 A;  2JJL A;  4XE5 B;  3TSI A;  3B5N B;  2H43 A;  1W2E A;  1EQ7 A;  3T97 A;  1NKZ B;  4WY4 D;  3BRV B;  2R5B A;  4ZKP A;  1ZR2 A;  5AW3 B;  4I6M C;  1GL2 D;  3V2N A;  4C7N A;  4Y99 C;  4C7N B;  2HOD B;  3VMY A;  5APT A;  2HPC A;  1GU4 A;  2PP6 A;  5APS A;  3EFG A;  3KYQ A;  5APY A;  3P32 A;  3V4Q A;  3SWF A;  2A45 H;  1JTH A;  3VP9 A;  5AW1 B;  1Z56 A;  2XKM A;  1T2K C;  1SFC A;  2XU6 A;  2VRS A;  1OWA A;  3MTU E;  3TNU A;  1SFC D;  4GT1 A;  3VYI A;  2N1T C;  5AW8 B;  3BVH A;  1KFN A;  2O01 H;  1S9K E;  1CSB A;  1NH4 A;  2W6A A;  1IFJ A;  5AVY B;  1LWU A;  1J2J B;  1AQ5 A;  3IR9 A;  2WT7 B;  3MUD A;  3RK2 C;  1RF0 A;  5KJ7 C;  4AQR D;  1H88 A;  2R32 A;  1T3J A;  1FZC A;  3RK3 C;  2H7H A;  4EOT A;  1VPC A;  3O8Z A;  1LTJ C;  2Q5U A;  3HE5 B;  1N73 B;  1IFM A;  4WY4 B;  1X79 B;  2E42 A;  2P67 A;  3EQ2 A;  2MJZ A;  3HD7 B;  5CCH D;  1URQ D;  3OAK A;  3VP8 A;  4I1L A;  3NMD A;  1CZQ A;  1LWU B;  1SQB K;  2I1J A;  5CCG D;  1KFM A;  3BAT A;  3IFM A;  1LTT C;  2M3B A;  3RL0 B;  3LIE A;  5CHX A;  2WZ7 A;  4Y99 B;  2QM8 A;  1FJK A;  2WSC H;  1MV8 A;  3P8C E;  1FJP A;  1N73 C;  2M8R A;  2NPS B;  3HD7 C;  3MD0 A;  1CW5 A;  1MFZ A;  1JTH B;  2GM4 A;  3L4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...