2KP8A

Ligand bound to a model peptide that mimics the open fusogenic form
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
72
structure length
72
Chain Sequence
TSLIHSLIEESQNQQEKNEQELLELDGDGPQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Model peptide
publication title Non-peptide entry inhibitors of HIV-1 that target the gp41 coiled coil pocket.
pubmed doi rcsb
source organism Escherichia coli
total genus 32
structure length 72
sequence length 72
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2kp8A00
4I6MC 4KHXA 2W27A 1FOSE 2WTYA 5AVZB 3LIDA 3HE5A 4RESB 2C9LY 3M0DA 1HUCA 1T2KD 3TNUB 2WPQA 1SP4A 2E42A 3NMDA 4M3LA 3HE4A 4GT1A 1H8AA 2P7JA 3A5TA 2E43A 1CI6A 3MD0A 2KP8A 3LIEA 5AW9B 2H7HA 1H89A 1HBWA 2IPPA 2YNYA 1OXZA 4I2LC 1GU5A 2Z5HA 3A2AA 5APXA 5AVWB 3M06A 5AVSB 3HE5B 3TK1A 4LC1A 3VYIA 1T2KC 1GU4A 4AYCA 1OWAA 1HJBA 4HYTB 2R3CA 5AW6B 5APQA 3L35A 2YO2A 3L37A 5AW5B 5APTA 1FAVA 2P2UA 2QM7A 3HE4B 1A02F 3KDPB 3V4WA 2WT7A 3P32A 1NAFA 2R5DA 1MFZA 4AUWA 1CZQA 1GTWA 2QM8A 1GD2E 3M9BA 1S9KE 1SLQA 3HTKA 3VMZA 1JNMA 2Z5IA 3SWFA 2ZXEB 3I5CA 3V4QA 2Q7CA 4AQRD 2ZFCA 1G2CB 2XZRA 2WPRA 4C7NA 3IR9A 1KQLA 2WWWA 3T97A 4DZOA 3NFQA 1MV8A 3A3YB 3M0AA 3TYYA 3MGNA 3NXSA 4JYCA 4XE5B 5AW8B 3A7OA 1S9KD 1HWTC 2N9BA 5AVRB 4C46A 1GK6A 1CI6B 1CSBA 3VMYA 3M9HA 1JUNA 3TNUA 4GKGA 3V5BA 5AVVB 5AW3B 5AVYB 3B8EB 5APSA 3UIAA 2Q3IA 2YO3A 1J2JB 3P7KA 4EOTA 4C7NB 2WPSA 4JYBA 5AW4B 3KQGA 1A02J 1DH3A 3L36A 3M91A 5APVA 3P8MC 5AVUB 5CMZA 1GK4A 2WT7B 1FOSF 3VMXA 2XV5A 4B86A 2XU6A 5APYA 5AVXB 2R5BA 1NWQA 5AVQB 1X8YA 5AW0B 3NTNA 3VN0A 5AVTB 2C9NY 2BASA 3OAKA 1IO4A 5AW1B 2R32A 5AW7B 1MUUA 5AW2B 1GZLA 2VRSA 2P67A 2Q5UA 5APUA 1H88A 2JJLA 1YYCA 3O8ZA 3VTPC 5APWA 2W6AA
chains in the Genus database with same CATH superfamily
4H44B 3L75G 1NTKD 3IFMA 1UIIA 2WTYA 2Z4EA 3MZWB 3AE4C 1LP1B 4HJGH 1RF0A 1ZN5A 1EZVE 3A5TA 1H89A 4U3FD 5KAFH 3LW5J 1QEXA 2YMKA 1D7MA 3M9QA 2ZT9D 4W7YA 1NTZG 1VF5C 2QJYB 2Q6QA 3EWKA 1PFIA 2FYUG 3CC7P 3B5NC 1U7MA 3BCCG 1FDMA 1S9KE 2D2CD 1QL1A 3AEBC 3CWBE 1KC8Q 1L0NJ 4C7NA 3TGUD 4QMAA 3L73G 2A45I 4IL6E 3H1IE 1NTMG 1VF5B 1JMBA 3UIAA 1Y9BA 2YO3A 1J2JB 1PGQA 4C7NB 2OYIC 3B5NB 2LKMA 1QGKB 3P8MC 1GK4A 3H1LG 1PPJD 1P84D 1SQBD 2OYHC 1KYOH 5AVQB 1VL2A 1NTKE 1ZRTD 1SQVK 1EZVG 3V2PA 2JJLA 1K9MQ 3AE3C 2OYHA 2H43A 1L0LG 4U3FE 5KJ7D 5CBNA 1G1JA 4UB8E 3PP5A 2WSEJ 3MUDC 1RF1C 1T3JA 2HLOA 3LIEA 1EZVI 1DD4A 2OYHB 1KQFB 5EFWB 3G71P 1RE3A 1VQMP 3M06A 5AVSB 4L75A 1GL2D 5APTA 2P10A 3KHUA 2O01H 4JF7A 3CXHH 3V2QA 2AXCA 4A7PA 1YJWP 1RF1B 3HUSC 1SFCD 2M3BA 3NFQA 1MV8A 2UWJE 3TYYA 3L70E 1FZGA 3VMYA 3M9HA 2IZ1A 2QVAA 1PPJE 3B8EB 1P84E 1SQBE 3HUSA 1LTGC 1NTKG 4L74A 1L0ND 3R4YA 1LJ2A 1ZRTE 3L36A 5CMZA 4DT0A 4U3FG 4N6JA 5AVXB 4PV1C 3HUSB 3QWOC 3GF3A 3CCUP 3AE9C 2AXTE 3KZIE 3AEEC 5E79E 1VQPP 4I6MC 1M8OB 4NPEA 1G2CA 3JCUH 1QLED 1FE6A 2KZJA 1YJ9P 3S4RA 3NMDA 2SPZA 5CJ0A 3MP7B 2L91A 3TGUG 1FS0E 3Q5PA 4PV1B 4PD4H 3RL0C 1GU4A 4XFJA 4AYCA 2KSJA 1IFDA 4C7RA 1ZP0C 3V4WA 5KTBA 2YXRB 2E76D 2IBZD 3HRNA 5KKZC 2B88A 1PPJG 5CCGD 1SQBG 3WUUA 2ZFCA 2OYOA 3D70A 5AW8B 5GTHH 3H1KJ 3A7OA 3RL0B 2JWDA 1VQ8P 2H88C 1JUNA 2KUBA 2I8DA 2KNCA 1JMMA 1LTBC 4K3AA 2B9BA 1SQQJ 1P84I 1Y8AA 2PFXA 1UIXA 1NU1E 2O1JA 5KKZB 5AVUB 2WSCH 1SQPK 1VQ6P 2QJKB 3MHVA 2OGUA 2KNCB 3FXEA 3L71J 1U7JA 2BASA 2YXQB 5AW1B 3WU2H 4U7JA 3VTPC 2M8RA 2YIUC 5AVZB 3HE5A 2C9LY 4K35A 5H2FE 2P7JA 1VQ4P 1PGJA 3D6YA 2IBZE 3HE5B 1Q7YQ 3RL0g 1T2KC 3CXHI 1EXJA 1Q2NA 2ITAA 1L0NG 1CW5A 1OFCX 1JCDA 2YIUB 2K88A 1FJKA 5TISE 1GTWA 2QM8A 5GTHE 3FWNA 1ZR2A 1S3JA 2G8YA 2Z5IA 3A0BH 1M7LA 2V7QH 1AA0A 3D6ZA 1FBMA 2E74C 1M57D 2K3RA 1W2BO 3P7KA 1LTJC 3CPWO 2FYZA 1DH3A 1NKZB 1R8EA 3B4SA 1VQKP 2BCCJ 1NOHA 3H1IJ 3H1KD 3VMXA 1N73A 3KXDA 1YBKA 1SQXK 1XTGB 3Q3DA 1OMIA 3M0DC 1LTSC 1SQQD 1IFIA 2E74B 1N86A 2J5UA 1IK9A 5APWA 1SVFA 1RE4A 2IBZG 2FXMA 1LTJB 1BDDA 1E79H 3M0DA 4YXWH 1AVYA 1OIPA 3CI9A 4ZNCA 4PD4I 3AEGC 3L71D 2CPBA 5KLVK 4GT1A 2E43A 1HBWA 2RMZA 2IPPA 1NVOA 2GUVA 3S1KA 4BWNA 5AVWB 2HR3A 2H89C 3VYIA 2IBZI 1MZ9A 4PJ0H 1BE3E 1N7SC 5CCHC 1NAFA 2R5DA 1NTZK 2E5YA 1FJPA 2ZXEB 4EYYQ 2FKWB 2FYUK 4LGDE 2ZYGA 3GHGA 1PL5A 2HPCA 1HWTC 1CI6B 4XA4A 1K73Q 3H1KE 3RK2C 2A06E 4WY4D 1Z56A 3GHGB 4JYBA 3B71A 1SQQE 2HPCB 1KMIZ 3L70J 1X9VA 1X0TA 3PLNA 2WT7B 2I1KA 4D6TJ 3OJAB 4JBZA 1LT9C 3JC22 3K5BA 2RN0A 2QA4P 4OH8B 4IL6H 3L71E 1KILC 3VMAA 2E75C 2QRXA 2BCCD 3H1ID 2W27A 1FC2C 3RK2B 1LT9A 1ZXGA 2IDBA 1USEA 1KN7A 3BATA 2K37A 3A0HH 3G6EP 1KTMA 1M1JA 2R3SA 1KILA 4OGQB 1L0LK 1Y47A 3I56P 3P8CD 2Z5HA 1RF0C 1LT9B 3L74J 3TK1A 4LC1A 3CX5H 1HJBA 2Q3EA 3CX5D 3O6QA 4R4LA 5AW5B 2P2UA 1M1JB 3GMAA 1KILB 2LXCB 2E75B 3V2RA 3IN6A 2BEZF 3BRVB 3EFGA 3PJSK 3RK3C 2W90A 3H1KG 4UB8H 1IK7A 3O6QB 1H0TA 2XZRA 2WPRA 1NH4A 1FZCA 1ZW0A 1YTZI 1SQQG 3V2NA 4JYCA 1S72P 1X79B 1JY3P 2N9BA 3IF4A 2W6BA 5CHXA 2WMMA 4ASVA 1KORA 3L4FA 4IFMA 1FZCB 2AEMA 4CPGA 4W7ZA 2RKLA 2ZAEB 3L71G 3RK3B 1NTKK 1QVGO 4B86A 2BCCE 4YTPC 1SQVD 1LT1A 3VN0A 2C9NY 5AW7B 1NU1J 1YQ4C 1HTLC 3A0HE 1L4AC 2W6AA 4HKZH 3L70D 4KHXA 2IZ0A 1KFMA 4D6TD 3P8CE 1P84H 2LR2A 2WPQA 1Q82Q 2QEXP 3CX5E 1L4AA 3MD0A 4I1LA 5AW9B 3TDKA 1RY3A 3CMEP 1AQ5A 2E5TA 4YXDC 1RE3C 3KDPB 1L4AB 2AXTH 3KZIH 2ZXXA 5E79H 3W68A 1FZFA 1HH0A 3MIWA 3L74D 4EI2A 2JR8A 1JTHA 1LTTC 3CWBG 2ZVOB 4XE5B 1SQBK 1S2EA 2BCCG 3H1IG 5AVVB 2WPVB 3LW5H 1JTHB 2Q3IA 1R5SA 3CCRP 2LXBA 3BRTB 2IX7C 5AW4B 3Q5RA 1SQVE 2KXPB 1QL2A 4YPCA 2PP6A 1IFNA 4JPZB 3R2PA 2N1TD 1X8YA 5AW0B 1OW8A 4D6TE 1N7SD 1L2PA 2ZVNB 1GZLA 3QH9A 4I7ZC 5L8RJ 3AEFC 4H13D 3S9OA 1JY3O 1OVVA 3HD7D 5DJTB 3GW6A 1FOSE 3G4SP 3LIDA 1J1DC 2L5GB 2Q1KA 1T6AA 4M3LA 1DEEG 1NU1D 3CX5I 1BSNA 2YNYA 1N8RQ 1VQ7P 4ZKPA 1QX8A 1JB0J 1FU1A 2FY8A 1JEKA 5KAIH 3L74E 4I7ZB 2NZ2A 1A02F 3P32A 4H0LD 3H1JE 3U1CA 1J1DB 3HTKA 1KFNA 4H44D 1L0NK 4TT3H 1G2CB 5H2FH 1ZMEC 3A3YB 1BE3J 2WSEH 2NPSC 1SQXJ 2O1KA 1CSBA 2HODA 3V6IA 4KJMA 3HTKB 3TNUA 4GDOA 3L70G 2WSSH 1URQD 2WZ7A 2QJKC 1KQGB 1WRGA 4D6TG 4WVZA 1IC2A 1HGZA 4Z1MH 1SQPD 1A02J 3C1LA 2NPSA 3Q5SA 3PH0A 5TISH 3F5HA 4L73A 3N7NA 5KLVJ 5AVTB 2NPSB 2ZYAA 1AJYA 2VRSA 1DIPA 1Q90D 1H88A 2I1JA 3CCJP 3U1AA 5GTIE 2YKOA 2OARA 3L74G 2FXOA 1VF5D 2OTLP 3AE6C 4NPDA 3CCMP 1RQVA 5KAIE 2Y9ZA 1G1IA 5BU5A 3B5ND 2ZJSE 3RBXA 3BCCJ 3L37A 2WSFJ 1FAVA 1HVVA 4W80A 4EIJA 1IJDB 3M9BA 3CMAP 2ZT9C 3AECC 3SWFA 2AEFA 2NRGA 2Q7CA 3PTZA 1JO5A 1KV4A 2WWWA 3T97A 1BCCJ 3MGNA 3NXSA 1LWUC 1SQPE 4IFDK 1BGYJ 2JDIH 4UB6E 2CPSA 1HJ0A 2D2CC 2QE7H 1S5LE 5AW3B 3T97B 2PAJA 4KT0J 1LWUA 3W67A 1BE3D 2ZT9B 1NU1G 1SQXD 3L72J 3RK3E 3GF7A 5B66E 3H1HE 3VP8A 1N73C 1LWUB 1KQSO 4JQ0D 2R44A 3AE2C 3H1LE 2D2CB 3E1IA 3AE5C 3FWLA 1HUCA 2V4HA 2P58A 5KLVD 2A06D 1PP9J 1RE4C 3C8VA 4O9BA 5M1BA 1OXZA 5KJ7C 1M1KQ 1N73B 4BRYA 5KJ7A 4WWIA 1SLQA 2POHA 2M0BA 2M5AA 1GL2C 3BCCD 4L76A 4DZOA 2JWAA 4HB1A 2FYNC 2KLUA 5AVRB 1GK6A 2XNDH 3GHGC 1HF9A 2M5AB 2C0WA 1SQXE 4PV1D 1GL2A 3E7KA 1SFCC 1SQQK 3USSA 3H25A 1BCCD 4DOJA 3KPEA 1FOSF 1BGYD 1RHZB 3II6A 1NWQA 5APYA 1GL2B 1SFCA 2KB7P 3NTNA 3Q2YA 4WBAA 1SQVJ 5KLVE 2FYNB 1KZUB 3L75E 2Y0CA 2N1TA 5APUA 1T3UA 3BVHA 2YKQA 2MJZA 3L72D 3IAOA 1SFCB 1NTMK 3RL0D 4OGQC 1FDOA 3KYQA 1SP4A 2E42A 3CD6P 1ZV8A 3FGAD 1NTZE 1M1JC 3SSUA 4OWFA 4WB4A 3SWYA 1PP9D 2KS1A 3AE8C 3BCCE 3G3ZA 2KLVA 4AUWA 2QIWA 2Y9YA 1BE3G 1OW6A 2G3AA 3SFEC 3VMZA 1SQXG 5BVZA 5CJ4A 1GW4A 2KS1B 1YJNP 2E76C 1FZCC 1W5CE 1NO4A 1BCCE 3H1JJ 1GMJA 5CCGC 1EDKA 1BGYE 2CK3H 1SS1A 4BXLA 1Q81Q 1OZHA 3KQGA 3ITKA 2A06G 1URQA 2ZYDA 4ZKUA 1YI2P 2YMYA 4R4MA 5CCGA 3SWKA 3L72E 2O01J 2OTJP 1K05A 2E76B 1VQLP 3RGUA 1H0TB 2QSIA 1URQB 1L0LE 1PGOA 2Q5UA 1YYCA 4RO0A 4OVNF 2KIKA 2XDJA 2JEEA 1EQ7A 2QG4A 1LTAC 2A45G 5KLIC 1T2KD 2W83C 2AEJA 2HG5D 2P1JA 1LGHB 3ABVC 1JY2N 1PP9E 3BASA 1BDCA 1GU5A 1IFPA 1EDJA 1R5LA 4HYTB 1K04A 5APQA 3B5NA 1OX3A 3CCLP 2BEQD 1MFZA 2E74D 5KLIB 1BCCG 1CZQA 1GD2E 3AE1C 2WVRA 1BGYG 5CBOA 1W2EA 2GM4A 1GW3A 1VQOP 1KYOD 2OYIA 4MN4C 3L72G 3CCQP 4LLHA 1VQ9P 4GODA 2HFED 2IYPA 3JSVC 1JOCA 1SQPJ 5KAFE 2OYIB 3SFDC 3H1JD 2R5BA 2IFNA 3N4XA 2IFMA 2B89A 3Q1MA 1TU3F 3CCEP 2IYOA 1PP9G 1NHLA 3MUDA 2KOGA 1RF1A 3FX0A 3AE7C 2W8ZA 3H1HJ 3TGUE 3D71A 1VPCA 3CXHD 5CCHD 2C0XA 4I2LC 1VDFA 3A2AA 4TLFA 1J1EC 3L35A 2WSCJ 1S4XA 1JY2P 4DCKA 3CLQA 5GTIH 2B87A 1KYOE 1JNMA 1EC5A 1RH5B 3I5CA 3OA7A 3V4QA 3RK2D 2JP3A 2WQYC 3WMM0 3GG2A 1OVUA 1OW7A 3M0AA 4N3YB 4OGQD 4C46A 3CCSP 1ZLLA 1J1EB 2B87B 4GKGA 2J58A 3WUVA 4DJGA 1AV1A 2W6JH 1MKMA 1WMKA 3M91A 1PZQA 1KILD 1SQVG 2E75D 2N9YB 4GOFA 1PGPA 1DD3A 3I55P 1ZOYC 1IFMA 4WY4C 2R32A 1NU1K 1HGVA 1MUUA 5AW2B 2P67A 4PD4D 2KK7A 3CXHE 4UB6H 3EQ2A 3PHLA 1S5LH 1U57A 2V7QJ 1YHQP 4WY4A 2HODB 5K5GB 4IL6X 3TNUB 3MTUE 1LTIC 1H8AA 3L75J 1JCCA 4HH2A 2KP8A 2YKPA 3H6PA 5BU8B 1VQ5P 1IFJA 4WY4B 3RK3D 5B66H 1L0NE 3H1HD 2MKVA 3RBZA 3EFFK 1NTZJ 1M90Q 3WUTA 3CCVP 2PGDA 1KYOI 3H1JG 2FYUJ 1YTZT 1AQTA 1EDLA 1YQ3C 1EXIA 2HYNA 1NKNA 5B5EH 1Q86Q 2OQQA 1KILE 3V5BA 2KZIA 5AVYB 3AEDC 3L73J 3JCUE 1USDA 2GA1A 2FFDC 1DX7A 2KYVA 1AFOA 5C39A 1NTMJ 1JY2O 1L4AD 4PD4E 1T8ZA 2GUSA 1VQNP 4EDFA 2JKVA 1KB9H 2FFDA 1KB9D 1XTCC 3C9IA 3H1LJ 2K1AA 3O8ZA 3TF5A 1OVRA 2FFDB 4RESB 3G9RA 2K9JA 2OTKE 1IZNB 1L0LJ 2H7HA 1RQUA 2XKMA 3ZDMA 3U59A 1OWAA 2K9JB 5AW6B 1M56D 3VP9A 1MFTA 2FBWC 3L75D 1NYHA 3CWBJ 1FDIA 5B5EE 3IR9A 4IFFA 3WU2E 2JO1A 1S1CX 1PV3A 1LTJA 1NTZD 1E5WA 2A45H 1SQPG 3FXDA 5APSA 1NAYA 1NJIQ 2QJPC 2WPSA 4IOIH 4GIFA 2FYUD 1YIJP 2FXPA 3GLMA 2Q9IA 1KB9E 4BRYB 2WSFH 2Y0DA 2DW3A 1NTKJ 1K8AQ 2KI7B 2XV5A 2XU6A 4Y99C 4GOEA 3L73D 1AVOA 1LNQA 1X22A 3H1HG 4U3FJ 3VOPA 1NTMD 2RH0A 3E1RA 1PIXA 2QJPB 2N1TC 2KSEA 3CL3D 3A0BE 1KD1Q 1FZEA 4RKUJ 1JY3N 4N78D 4Y28J 3HE4A 3H1LD 1QVFO 1CI6A 4H13C 3HD7C 3TSIA 5APXA 4Y99B 2Y0EA 1N7SA 5CCHA 3F89A 2R3CA 1EZVD 3TGUJ 2YO2A 5TJHA 2QM7A 3HE4B 2O3JA 2WT7A 1DEBA 1L0LD 3HD7A 3H32A 1ZR4A 2NPSD 2N1TB 2K9YA 1N7SB 5DJUB 4RJTA 3AEAC 4NPFX 1KQLA 3PRJA 4H13B 3HD7B 2WITA 3H32B 1FZAA 2FYUE 2XNXA 2M3EA 4H0LC 1S9KD 1NGMB 1SQBJ 3CWBD 4ZMDA 4H44C 4ASWA 1YITP 4EOTA 1FZBA 1EDIA 3L73E 2J59M 1N2DC 5APVA 1JM0A 1KB9I 2O01N 1WT6A 1NTME 1URQC 2H8PD 1N7LA 3OW2O 1LP1A 1S5LX 3OAKA 4PJ0E 4H0LB 1IO4A 3CC4P 2QJYC 4N78E 3CC2P 1BSHA 5KLVG 1GDTA 2PRRA 4AQRD
chains in the Genus database with same CATH topology
3MUDA 2KOGA 1RF1A 1RE4A 3IFMA 2WTYA 2Z4EA 2FXMA 2YKOA 1LTJB 3M0DA 2OARA 3CI9A 2CPBA 1VPCA 5KLVK 1RF0A 1ZN5A 4GT1A 3A5TA 2E43A 1HBWA 1G1IA 1H89A 5CCHD 5BU5A 2IPPA 2C0XA 2GUVA 3B5ND 4I2LC 1VDFA 3A2AA 5AVWB 3M9QA 4W7YA 3VYIA 1J1EC 1MZ9A 3L35A 3L37A 1FAVA 1HVVA 1PFIA 4W80A 4EIJA 1IJDB 1N7SC 1JY2P 5CCHC 1NAFA 2R5DA 3B5NC 1NTZK 1FDMA 3CLQA 3M9BA 1S9KE 1QL1A 1JNMA 1FJPA 3SWFA 2ZXEB 3I5CA 3V4QA 3OA7A 2Q7CA 2FKWB 3RK2D 2FYUK 4LGDE 3WMM0 4C7NA 1JO5A 2WWWA 3GHGA 3T97A 2A45I 3M0AA 3MGNA 3NXSA 4N3YB 1LWUC 2HPCA 1HWTC 4IFDK 4C46A 1CI6B 1ZLLA 2CPSA 1J1EB 4GKGA 2J58A 4XA4A 5AW3B 3UIAA 3RK2C 2YO3A 1J2JB 4WY4D 4C7NB 1Z56A 3GHGB 4JYBA 2OYIC 2PAJA 1LWUA 3B5NB 3M91A 2HPCB 2LKMA 3P8MC 1GK4A 1KILD 1X9VA 2WT7B 2OYHC 2I1KA 3OJAB 5AVQB 1IFMA 1LT9C 4WY4C 3VP8A 1N73C 4OH8B 1SQVK 1LWUB 2R32A 1NU1K 1HGVA 1MUUA 5AW2B 2P67A 3V2PA 1KILC 2JJLA 2OYHA 2H43A 3EQ2A 2W27A 3E1IA 5KJ7D 3RK2B 1G1JA 1LT9A 4WY4A 2HODB 1HUCA 3PP5A 3BATA 3TNUB 3MTUE 1LTIC 1RF1C 1RE4C 1T3JA 1M1JA 2HLOA 1H8AA 1KILA 1L0LK 1JCCA 4HH2A 2KP8A 2YKPA 3LIEA 3H6PA 4O9BA 5BU8B 2OYHB 1OXZA 3P8CD 2Z5HA 5KJ7C 1RE3A 1RF0C 3M06A 1LT9B 1IFJA 5AVSB 4WY4B 3RK3D 3TK1A 4LC1A 1HJBA 1N73B 5AW5B 1GL2D 5APTA 2P2UA 1M1JB 1KILB 3V2RA 2O01H 4JF7A 5KJ7A 3V2QA 3BRVB 3EFGA 3RK3C 1SLQA 2POHA 1RF1B 1GL2C 2XZRA 1SFCD 1YTZT 2M3BA 1NH4A 2WPRA 3HUSC 1FZCA 4DZOA 1YTZI 3NFQA 1MV8A 2HYNA 3TYYA 3V2NA 1NKNA 4JYCA 1X79B 1JY3P 2N9BA 5AVRB 1GK6A 1FZGA 3VMYA 3GHGC 3M9HA 2W6BA 5CHXA 3V5BA 2C0WA 5AVYB 3B8EB 3L4FA 1GL2A 3HUSA 1LTGC 1SFCC 1SQQK 4IFMA 1FZCB 2FFDC 4W7ZA 1DX7A 2KYVA 3L36A 4DOJA 1AFOA 5CMZA 3RK3B 1JY2O 1L4AD 3KPEA 1NTKK 1FOSF 1T8ZA 2GUSA 4N6JA 4B86A 3II6A 5APYA 5AVXB 1GL2B 3HUSB 1SFCA 1NWQA 2FFDA 2KB7P 1XTCC 3NTNA 3VN0A 3C9IA 2C9NY 4WBAA 5AW7B 1KZUB 1HTLC 2N1TA 5APUA 3O8ZA 1T3UA 1L4AC 3BVHA 2YKQA 2W6AA 2MJZA 4I6MC 4KHXA 1KFMA 1SFCB 1NTMK 1G2CA 3RL0D 2FFDB 3P8CE 4RESB 3KYQA 2WPQA 1SP4A 2E42A 3NMDA 1ZV8A 5CJ0A 1L4AA 3MD0A 4I1LA 5AW9B 2H7HA 1RY3A 1AQ5A 1M1JC 3RL0C 2XKMA 1GU4A 3U59A 4AYCA 1OWAA 2KSJA 5AW6B 1IFDA 1RE3C 4WB4A 4C7RA 3VP9A 3KDPB 3SWYA 3V4WA 1L4AB 5KTBA 3G3ZA 3HRNA 2KLVA 4AUWA 1FZFA 1HH0A 3MIWA 3VMZA 5BVZA 5CCGD 1JTHA 1LTTC 5CJ4A 2ZFCA 3IR9A 1GW4A 4IFFA 4XE5B 5AW8B 3A7OA 3RL0B 1SQBK 1FZCC 1LTJA 1NO4A 1JUNA 5CCGC 1E5WA 2A45H 5AVVB 1JMMA 5APSA 3LW5H 1JTHB 1LTBC 2Q3IA 2WPSA 3BRTB 4GIFA 2IX7C 5AW4B 3KQGA 2Q9IA 2O1JA 1URQA 5AVUB 2WSFH 1QL2A 2WSCH 1SQPK 4ZKUA 2YMYA 5CCGA 2PP6A 2XV5A 2XU6A 1IFNA 3R2PA 4Y99C 2N1TD 1X8YA 5AW0B 1N7SD 2BASA 5AW1B 1GZLA 1URQB 2Q5UA 1YYCA 3VTPC 2XDJA 3VOPA 2JEEA 1JY3O 3HD7D 2M8RA 1EQ7A 1FOSE 1LTAC 2A45G 2N1TC 3LIDA 3HE5A 5AVZB 2C9LY 3CL3D 1T2KD 1J1DC 1FZEA 2L5GB 2HG5D 1JY3N 2P1JA 4N78D 1LGHB 4M3LA 3HE4A 2P7JA 1CI6A 1JY2N 3BASA 2YNYA 3HD7C 3TSIA 1GU5A 5APXA 4Y99B 4ZKPA 1FU1A 3HE5B 1T2KC 1N7SA 5CCHA 4HYTB 2R3CA 5APQA 3B5NA 2YO2A 2QM7A 3HE4B 1A02F 2WT7A 1CW5A 1DEBA 3P32A 3HD7A 3H32A 1JCDA 1ZR4A 1MFZA 2NPSD 1FJKA 2N1TB 1CZQA 1GTWA 2QM8A 1GD2E 3U1CA 1J1DB 3HTKA 1N7SB 1KFNA 1ZR2A 2Z5IA 1L0NK 1M7LA 1G2CB 1KQLA 1W2EA 2GM4A 3A3YB 3HD7B 2WITA 2WSEH 1FZAA 2XNXA 3H32B 2NPSC 1S9KD 1FBMA 1GW3A 2O1KA 1CSBA 2HODA 2OYIA 3HTKB 3TNUA 1URQD 2WZ7A 4LLHA 3P7KA 4EOTA 1FZBA 2HFED 1WRGA 1LTJC 1IC2A 1HGZA 2FYZA 1A02J 2J59M 1DH3A 2NPSA 1JOCA 1N2DC 1NKZB 5APVA 1NOHA 1WT6A 2OYIB 3VMXA 1N73A 2R5BA 1SQXK 1URQC 1XTGB 2IFNA 2H8PD 3N7NA 1N7LA 3N4XA 3M0DC 5AVTB 1LTSC 2IFMA 3OAKA 1IO4A 1IFIA 2NPSB 2VRSA 1N86A 1H88A 4N78E 1IK9A 2I1JA 5APWA 1SVFA 1GDTA 1NHLA 4AQRD 3U1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6M C;  4KHX A;  2W27 A;  1FOS E;  2WTY A;  5AVZ B;  3LID A;  3HE5 A;  4RES B;  2C9L Y;  3M0D A;  1HUC A;  1T2K D;  3TNU B;  2WPQ A;  1SP4 A;  2E42 A;  3NMD A;  4M3L A;  3HE4 A;  4GT1 A;  1H8A A;  2P7J A;  3A5T A;  2E43 A;  1CI6 A;  3MD0 A;  2KP8 A;  3LIE A;  5AW9 B;  2H7H A;  1H89 A;  1HBW A;  2IPP A;  2YNY A;  1OXZ A;  4I2L C;  1GU5 A;  2Z5H A;  3A2A A;  5APX A;  5AVW B;  3M06 A;  5AVS B;  3HE5 B;  3TK1 A;  4LC1 A;  3VYI A;  1T2K C;  1GU4 A;  4AYC A;  1OWA A;  1HJB A;  4HYT B;  2R3C A;  5AW6 B;  5APQ A;  3L35 A;  2YO2 A;  3L37 A;  5AW5 B;  5APT A;  1FAV A;  2P2U A;  2QM7 A;  3HE4 B;  1A02 F;  3KDP B;  3V4W A;  2WT7 A;  3P32 A;  1NAF A;  2R5D A;  1MFZ A;  4AUW A;  1CZQ A;  1GTW A;  2QM8 A;  1GD2 E;  3M9B A;  1S9K E;  1SLQ A;  3HTK A;  3VMZ A;  1JNM A;  2Z5I A;  3SWF A;  2ZXE B;  3I5C A;  3V4Q A;  2Q7C A;  4AQR D;  2ZFC A;  1G2C B;  2XZR A;  2WPR A;  4C7N A;  3IR9 A;  1KQL A;  2WWW A;  3T97 A;  4DZO A;  3NFQ A;  1MV8 A;  3A3Y B;  3M0A A;  3TYY A;  3MGN A;  3NXS A;  4JYC A;  4XE5 B;  5AW8 B;  3A7O A;  1S9K D;  1HWT C;  2N9B A;  5AVR B;  4C46 A;  1GK6 A;  1CI6 B;  1CSB A;  3VMY A;  3M9H A;  1JUN A;  3TNU A;  4GKG A;  3V5B A;  5AVV B;  5AW3 B;  5AVY B;  3B8E B;  5APS A;  3UIA A;  2Q3I A;  2YO3 A;  1J2J B;  3P7K A;  4EOT A;  4C7N B;  2WPS A;  4JYB A;  5AW4 B;  3KQG A;  1A02 J;  1DH3 A;  3L36 A;  3M91 A;  5APV A;  3P8M C;  5AVU B;  5CMZ A;  1GK4 A;  2WT7 B;  1FOS F;  3VMX A;  2XV5 A;  4B86 A;  2XU6 A;  5APY A;  5AVX B;  2R5B A;  1NWQ A;  5AVQ B;  1X8Y A;  5AW0 B;  3NTN A;  3VN0 A;  5AVT B;  2C9N Y;  2BAS A;  3OAK A;  1IO4 A;  5AW1 B;  2R32 A;  5AW7 B;  1MUU A;  5AW2 B;  1GZL A;  2VRS A;  2P67 A;  2Q5U A;  5APU A;  1H88 A;  2JJL A;  1YYC A;  3O8Z A;  3VTP C;  5APW A;  2W6A A; 
#chains in the Genus database with same CATH topology
 4H44 B;  3L75 G;  1NTK D;  3IFM A;  1UII A;  2WTY A;  2Z4E A;  3MZW B;  3AE4 C;  1LP1 B;  4HJG H;  1RF0 A;  1ZN5 A;  1EZV E;  3A5T A;  1H89 A;  4U3F D;  5KAF H;  3LW5 J;  1QEX A;  2YMK A;  1D7M A;  3M9Q A;  2ZT9 D;  4W7Y A;  1NTZ G;  1VF5 C;  2QJY B;  2Q6Q A;  3EWK A;  1PFI A;  2FYU G;  3CC7 P;  3B5N C;  1U7M A;  3BCC G;  1FDM A;  1S9K E;  2D2C D;  1QL1 A;  3AEB C;  3CWB E;  1KC8 Q;  1L0N J;  4C7N A;  3TGU D;  4QMA A;  3L73 G;  2A45 I;  4IL6 E;  3H1I E;  1NTM G;  1VF5 B;  1JMB A;  3UIA A;  1Y9B A;  2YO3 A;  1J2J B;  1PGQ A;  4C7N B;  2OYI C;  3B5N B;  2LKM A;  1QGK B;  3P8M C;  1GK4 A;  3H1L G;  1PPJ D;  1P84 D;  1SQB D;  2OYH C;  1KYO H;  5AVQ B;  1VL2 A;  1NTK E;  1ZRT D;  1SQV K;  1EZV G;  3V2P A;  2JJL A;  1K9M Q;  3AE3 C;  2OYH A;  2H43 A;  1L0L G;  4U3F E;  5KJ7 D;  5CBN A;  1G1J A;  4UB8 E;  3PP5 A;  2WSE J;  3MUD C;  1RF1 C;  1T3J A;  2HLO A;  3LIE A;  1EZV I;  1DD4 A;  2OYH B;  1KQF B;  5EFW B;  3G71 P;  1RE3 A;  1VQM P;  3M06 A;  5AVS B;  4L75 A;  1GL2 D;  5APT A;  2P10 A;  3KHU A;  2O01 H;  4JF7 A;  3CXH H;  3V2Q A;  2AXC A;  4A7P A;  1YJW P;  1RF1 B;  3HUS C;  1SFC D;  2M3B A;  3NFQ A;  1MV8 A;  2UWJ E;  3TYY A;  3L70 E;  1FZG A;  3VMY A;  3M9H A;  2IZ1 A;  2QVA A;  1PPJ E;  3B8E B;  1P84 E;  1SQB E;  3HUS A;  1LTG C;  1NTK G;  4L74 A;  1L0N D;  3R4Y A;  1LJ2 A;  1ZRT E;  3L36 A;  5CMZ A;  4DT0 A;  4U3F G;  4N6J A;  5AVX B;  4PV1 C;  3HUS B;  3QWO C;  3GF3 A;  3CCU P;  3AE9 C;  2AXT E;  3KZI E;  3AEE C;  5E79 E;  1VQP P;  4I6M C;  1M8O B;  4NPE A;  1G2C A;  3JCU H;  1QLE D;  1FE6 A;  2KZJ A;  1YJ9 P;  3S4R A;  3NMD A;  2SPZ A;  5CJ0 A;  3MP7 B;  2L91 A;  3TGU G;  1FS0 E;  3Q5P A;  4PV1 B;  4PD4 H;  3RL0 C;  1GU4 A;  4XFJ A;  4AYC A;  2KSJ A;  1IFD A;  4C7R A;  1ZP0 C;  3V4W A;  5KTB A;  2YXR B;  2E76 D;  2IBZ D;  3HRN A;  5KKZ C;  2B88 A;  1PPJ G;  5CCG D;  1SQB G;  3WUU A;  2ZFC A;  2OYO A;  3D70 A;  5AW8 B;  5GTH H;  3H1K J;  3A7O A;  3RL0 B;  2JWD A;  1VQ8 P;  2H88 C;  1JUN A;  2KUB A;  2I8D A;  2KNC A;  1JMM A;  1LTB C;  4K3A A;  2B9B A;  1SQQ J;  1P84 I;  1Y8A A;  2PFX A;  1UIX A;  1NU1 E;  2O1J A;  5KKZ B;  5AVU B;  2WSC H;  1SQP K;  1VQ6 P;  2QJK B;  3MHV A;  2OGU A;  2KNC B;  3FXE A;  3L71 J;  1U7J A;  2BAS A;  2YXQ B;  5AW1 B;  3WU2 H;  4U7J A;  3VTP C;  2M8R A;  2YIU C;  5AVZ B;  3HE5 A;  2C9L Y;  4K35 A;  5H2F E;  2P7J A;  1VQ4 P;  1PGJ A;  3D6Y A;  2IBZ E;  3HE5 B;  1Q7Y Q;  3RL0 g;  1T2K C;  3CXH I;  1EXJ A;  1Q2N A;  2ITA A;  1L0N G;  1CW5 A;  1OFC X;  1JCD A;  2YIU B;  2K88 A;  1FJK A;  5TIS E;  1GTW A;  2QM8 A;  5GTH E;  3FWN A;  1ZR2 A;  1S3J A;  2G8Y A;  2Z5I A;  3A0B H;  1M7L A;  2V7Q H;  1AA0 A;  3D6Z A;  1FBM A;  2E74 C;  1M57 D;  2K3R A;  1W2B O;  3P7K A;  1LTJ C;  3CPW O;  2FYZ A;  1DH3 A;  1NKZ B;  1R8E A;  3B4S A;  1VQK P;  2BCC J;  1NOH A;  3H1I J;  3H1K D;  3VMX A;  1N73 A;  3KXD A;  1YBK A;  1SQX K;  1XTG B;  3Q3D A;  1OMI A;  3M0D C;  1LTS C;  1SQQ D;  1IFI A;  2E74 B;  1N86 A;  2J5U A;  1IK9 A;  5APW A;  1SVF A;  1RE4 A;  2IBZ G;  2FXM A;  1LTJ B;  1BDD A;  1E79 H;  3M0D A;  4YXW H;  1AVY A;  1OIP A;  3CI9 A;  4ZNC A;  4PD4 I;  3AEG C;  3L71 D;  2CPB A;  5KLV K;  4GT1 A;  2E43 A;  1HBW A;  2RMZ A;  2IPP A;  1NVO A;  2GUV A;  3S1K A;  4BWN A;  5AVW B;  2HR3 A;  2H89 C;  3VYI A;  2IBZ I;  1MZ9 A;  4PJ0 H;  1BE3 E;  1N7S C;  5CCH C;  1NAF A;  2R5D A;  1NTZ K;  2E5Y A;  1FJP A;  2ZXE B;  4EYY Q;  2FKW B;  2FYU K;  4LGD E;  2ZYG A;  3GHG A;  1PL5 A;  2HPC A;  1HWT C;  1CI6 B;  4XA4 A;  1K73 Q;  3H1K E;  3RK2 C;  2A06 E;  4WY4 D;  1Z56 A;  3GHG B;  4JYB A;  3B71 A;  1SQQ E;  2HPC B;  1KMI Z;  3L70 J;  1X9V A;  1X0T A;  3PLN A;  2WT7 B;  2I1K A;  4D6T J;  3OJA B;  4JBZ A;  1LT9 C;  3JC2 2;  3K5B A;  2RN0 A;  2QA4 P;  4OH8 B;  4IL6 H;  3L71 E;  1KIL C;  3VMA A;  2E75 C;  2QRX A;  2BCC D;  3H1I D;  2W27 A;  1FC2 C;  3RK2 B;  1LT9 A;  1ZXG A;  2IDB A;  1USE A;  1KN7 A;  3BAT A;  2K37 A;  3A0H H;  3G6E P;  1KTM A;  1M1J A;  2R3S A;  1KIL A;  4OGQ B;  1L0L K;  1Y47 A;  3I56 P;  3P8C D;  2Z5H A;  1RF0 C;  1LT9 B;  3L74 J;  3TK1 A;  4LC1 A;  3CX5 H;  1HJB A;  2Q3E A;  3CX5 D;  3O6Q A;  4R4L A;  5AW5 B;  2P2U A;  1M1J B;  3GMA A;  1KIL B;  2LXC B;  2E75 B;  3V2R A;  3IN6 A;  2BEZ F;  3BRV B;  3EFG A;  3PJS K;  3RK3 C;  2W90 A;  3H1K G;  4UB8 H;  1IK7 A;  3O6Q B;  1H0T A;  2XZR A;  2WPR A;  1NH4 A;  1FZC A;  1ZW0 A;  1YTZ I;  1SQQ G;  3V2N A;  4JYC A;  1S72 P;  1X79 B;  1JY3 P;  2N9B A;  3IF4 A;  2W6B A;  5CHX A;  2WMM A;  4ASV A;  1KOR A;  3L4F A;  4IFM A;  1FZC B;  2AEM A;  4CPG A;  4W7Z A;  2RKL A;  2ZAE B;  3L71 G;  3RK3 B;  1NTK K;  1QVG O;  4B86 A;  2BCC E;  4YTP C;  1SQV D;  1LT1 A;  3VN0 A;  2C9N Y;  5AW7 B;  1NU1 J;  1YQ4 C;  1HTL C;  3A0H E;  1L4A C;  2W6A A;  4HKZ H;  3L70 D;  4KHX A;  2IZ0 A;  1KFM A;  4D6T D;  3P8C E;  1P84 H;  2LR2 A;  2WPQ A;  1Q82 Q;  2QEX P;  3CX5 E;  1L4A A;  3MD0 A;  4I1L A;  5AW9 B;  3TDK A;  1RY3 A;  3CME P;  1AQ5 A;  2E5T A;  4YXD C;  1RE3 C;  3KDP B;  1L4A B;  2AXT H;  3KZI H;  2ZXX A;  5E79 H;  3W68 A;  1FZF A;  1HH0 A;  3MIW A;  3L74 D;  4EI2 A;  2JR8 A;  1JTH A;  1LTT C;  3CWB G;  2ZVO B;  4XE5 B;  1SQB K;  1S2E A;  2BCC G;  3H1I G;  5AVV B;  2WPV B;  3LW5 H;  1JTH B;  2Q3I A;  1R5S A;  3CCR P;  2LXB A;  3BRT B;  2IX7 C;  5AW4 B;  3Q5R A;  1SQV E;  2KXP B;  1QL2 A;  4YPC A;  2PP6 A;  1IFN A;  4JPZ B;  3R2P A;  2N1T D;  1X8Y A;  5AW0 B;  1OW8 A;  4D6T E;  1N7S D;  1L2P A;  2ZVN B;  1GZL A;  3QH9 A;  4I7Z C;  5L8R J;  3AEF C;  4H13 D;  3S9O A;  1JY3 O;  1OVV A;  3HD7 D;  5DJT B;  3GW6 A;  1FOS E;  3G4S P;  3LID A;  1J1D C;  2L5G B;  2Q1K A;  1T6A A;  4M3L A;  1DEE G;  1NU1 D;  3CX5 I;  1BSN A;  2YNY A;  1N8R Q;  1VQ7 P;  4ZKP A;  1QX8 A;  1JB0 J;  1FU1 A;  2FY8 A;  1JEK A;  5KAI H;  3L74 E;  4I7Z B;  2NZ2 A;  1A02 F;  3P32 A;  4H0L D;  3H1J E;  3U1C A;  1J1D B;  3HTK A;  1KFN A;  4H44 D;  1L0N K;  4TT3 H;  1G2C B;  5H2F H;  1ZME C;  3A3Y B;  1BE3 J;  2WSE H;  2NPS C;  1SQX J;  2O1K A;  1CSB A;  2HOD A;  3V6I A;  4KJM A;  3HTK B;  3TNU A;  4GDO A;  3L70 G;  2WSS H;  1URQ D;  2WZ7 A;  2QJK C;  1KQG B;  1WRG A;  4D6T G;  4WVZ A;  1IC2 A;  1HGZ A;  4Z1M H;  1SQP D;  1A02 J;  3C1L A;  2NPS A;  3Q5S A;  3PH0 A;  5TIS H;  3F5H A;  4L73 A;  3N7N A;  5KLV J;  5AVT B;  2NPS B;  2ZYA A;  1AJY A;  2VRS A;  1DIP A;  1Q90 D;  1H88 A;  2I1J A;  3CCJ P;  3U1A A;  5GTI E;  2YKO A;  2OAR A;  3L74 G;  2FXO A;  1VF5 D;  2OTL P;  3AE6 C;  4NPD A;  3CCM P;  1RQV A;  5KAI E;  2Y9Z A;  1G1I A;  5BU5 A;  3B5N D;  2ZJS E;  3RBX A;  3BCC J;  3L37 A;  2WSF J;  1FAV A;  1HVV A;  4W80 A;  4EIJ A;  1IJD B;  3M9B A;  3CMA P;  2ZT9 C;  3AEC C;  3SWF A;  2AEF A;  2NRG A;  2Q7C A;  3PTZ A;  1JO5 A;  1KV4 A;  2WWW A;  3T97 A;  1BCC J;  3MGN A;  3NXS A;  1LWU C;  1SQP E;  4IFD K;  1BGY J;  2JDI H;  4UB6 E;  2CPS A;  1HJ0 A;  2D2C C;  2QE7 H;  1S5L E;  5AW3 B;  3T97 B;  2PAJ A;  4KT0 J;  1LWU A;  3W67 A;  1BE3 D;  2ZT9 B;  1NU1 G;  1SQX D;  3L72 J;  3RK3 E;  3GF7 A;  5B66 E;  3H1H E;  3VP8 A;  1N73 C;  1LWU B;  1KQS O;  4JQ0 D;  2R44 A;  3AE2 C;  3H1L E;  2D2C B;  3E1I A;  3AE5 C;  3FWL A;  1HUC A;  2V4H A;  2P58 A;  5KLV D;  2A06 D;  1PP9 J;  1RE4 C;  3C8V A;  4O9B A;  5M1B A;  1OXZ A;  5KJ7 C;  1M1K Q;  1N73 B;  4BRY A;  5KJ7 A;  4WWI A;  1SLQ A;  2POH A;  2M0B A;  2M5A A;  1GL2 C;  3BCC D;  4L76 A;  4DZO A;  2JWA A;  4HB1 A;  2FYN C;  2KLU A;  5AVR B;  1GK6 A;  2XND H;  3GHG C;  1HF9 A;  2M5A B;  2C0W A;  1SQX E;  4PV1 D;  1GL2 A;  3E7K A;  1SFC C;  1SQQ K;  3USS A;  3H25 A;  1BCC D;  4DOJ A;  3KPE A;  1FOS F;  1BGY D;  1RHZ B;  3II6 A;  1NWQ A;  5APY A;  1GL2 B;  1SFC A;  2KB7 P;  3NTN A;  3Q2Y A;  4WBA A;  1SQV J;  5KLV E;  2FYN B;  1KZU B;  3L75 E;  2Y0C A;  2N1T A;  5APU A;  1T3U A;  3BVH A;  2YKQ A;  2MJZ A;  3L72 D;  3IAO A;  1SFC B;  1NTM K;  3RL0 D;  4OGQ C;  1FDO A;  3KYQ A;  1SP4 A;  2E42 A;  3CD6 P;  1ZV8 A;  3FGA D;  1NTZ E;  1M1J C;  3SSU A;  4OWF A;  4WB4 A;  3SWY A;  1PP9 D;  2KS1 A;  3AE8 C;  3BCC E;  3G3Z A;  2KLV A;  4AUW A;  2QIW A;  2Y9Y A;  1BE3 G;  1OW6 A;  2G3A A;  3SFE C;  3VMZ A;  1SQX G;  5BVZ A;  5CJ4 A;  1GW4 A;  2KS1 B;  1YJN P;  2E76 C;  1FZC C;  1W5C E;  1NO4 A;  1BCC E;  3H1J J;  1GMJ A;  5CCG C;  1EDK A;  1BGY E;  2CK3 H;  1SS1 A;  4BXL A;  1Q81 Q;  1OZH A;  3KQG A;  3ITK A;  2A06 G;  1URQ A;  2ZYD A;  4ZKU A;  1YI2 P;  2YMY A;  4R4M A;  5CCG A;  3SWK A;  3L72 E;  2O01 J;  2OTJ P;  1K05 A;  2E76 B;  1VQL P;  3RGU A;  1H0T B;  2QSI A;  1URQ B;  1L0L E;  1PGO A;  2Q5U A;  1YYC A;  4RO0 A;  4OVN F;  2KIK A;  2XDJ A;  2JEE A;  1EQ7 A;  2QG4 A;  1LTA C;  2A45 G;  5KLI C;  1T2K D;  2W83 C;  2AEJ A;  2HG5 D;  2P1J A;  1LGH B;  3ABV C;  1JY2 N;  1PP9 E;  3BAS A;  1BDC A;  1GU5 A;  1IFP A;  1EDJ A;  1R5L A;  4HYT B;  1K04 A;  5APQ A;  3B5N A;  1OX3 A;  3CCL P;  2BEQ D;  1MFZ A;  2E74 D;  5KLI B;  1BCC G;  1CZQ A;  1GD2 E;  3AE1 C;  2WVR A;  1BGY G;  5CBO A;  1W2E A;  2GM4 A;  1GW3 A;  1VQO P;  1KYO D;  2OYI A;  4MN4 C;  3L72 G;  3CCQ P;  4LLH A;  1VQ9 P;  4GOD A;  2HFE D;  2IYP A;  3JSV C;  1JOC A;  1SQP J;  5KAF E;  2OYI B;  3SFD C;  3H1J D;  2R5B A;  2IFN A;  3N4X A;  2IFM A;  2B89 A;  3Q1M A;  1TU3 F;  3CCE P;  2IYO A;  1PP9 G;  1NHL A;  3MUD A;  2KOG A;  1RF1 A;  3FX0 A;  3AE7 C;  2W8Z A;  3H1H J;  3TGU E;  3D71 A;  1VPC A;  3CXH D;  5CCH D;  2C0X A;  4I2L C;  1VDF A;  3A2A A;  4TLF A;  1J1E C;  3L35 A;  2WSC J;  1S4X A;  1JY2 P;  4DCK A;  3CLQ A;  5GTI H;  2B87 A;  1KYO E;  1JNM A;  1EC5 A;  1RH5 B;  3I5C A;  3OA7 A;  3V4Q A;  3RK2 D;  2JP3 A;  2WQY C;  3WMM 0;  3GG2 A;  1OVU A;  1OW7 A;  3M0A A;  4N3Y B;  4OGQ D;  4C46 A;  3CCS P;  1ZLL A;  1J1E B;  2B87 B;  4GKG A;  2J58 A;  3WUV A;  4DJG A;  1AV1 A;  2W6J H;  1MKM A;  1WMK A;  3M91 A;  1PZQ A;  1KIL D;  1SQV G;  2E75 D;  2N9Y B;  4GOF A;  1PGP A;  1DD3 A;  3I55 P;  1ZOY C;  1IFM A;  4WY4 C;  2R32 A;  1NU1 K;  1HGV A;  1MUU A;  5AW2 B;  2P67 A;  4PD4 D;  2KK7 A;  3CXH E;  4UB6 H;  3EQ2 A;  3PHL A;  1S5L H;  1U57 A;  2V7Q J;  1YHQ P;  4WY4 A;  2HOD B;  5K5G B;  4IL6 X;  3TNU B;  3MTU E;  1LTI C;  1H8A A;  3L75 J;  1JCC A;  4HH2 A;  2KP8 A;  2YKP A;  3H6P A;  5BU8 B;  1VQ5 P;  1IFJ A;  4WY4 B;  3RK3 D;  5B66 H;  1L0N E;  3H1H D;  2MKV A;  3RBZ A;  3EFF K;  1NTZ J;  1M90 Q;  3WUT A;  3CCV P;  2PGD A;  1KYO I;  3H1J G;  2FYU J;  1YTZ T;  1AQT A;  1EDL A;  1YQ3 C;  1EXI A;  2HYN A;  1NKN A;  5B5E H;  1Q86 Q;  2OQQ A;  1KIL E;  3V5B A;  2KZI A;  5AVY B;  3AED C;  3L73 J;  3JCU E;  1USD A;  2GA1 A;  2FFD C;  1DX7 A;  2KYV A;  1AFO A;  5C39 A;  1NTM J;  1JY2 O;  1L4A D;  4PD4 E;  1T8Z A;  2GUS A;  1VQN P;  4EDF A;  2JKV A;  1KB9 H;  2FFD A;  1KB9 D;  1XTC C;  3C9I A;  3H1L J;  2K1A A;  3O8Z A;  3TF5 A;  1OVR A;  2FFD B;  4RES B;  3G9R A;  2K9J A;  2OTK E;  1IZN B;  1L0L J;  2H7H A;  1RQU A;  2XKM A;  3ZDM A;  3U59 A;  1OWA A;  2K9J B;  5AW6 B;  1M56 D;  3VP9 A;  1MFT A;  2FBW C;  3L75 D;  1NYH A;  3CWB J;  1FDI A;  5B5E E;  3IR9 A;  4IFF A;  3WU2 E;  2JO1 A;  1S1C X;  1PV3 A;  1LTJ A;  1NTZ D;  1E5W A;  2A45 H;  1SQP G;  3FXD A;  5APS A;  1NAY A;  1NJI Q;  2QJP C;  2WPS A;  4IOI H;  4GIF A;  2FYU D;  1YIJ P;  2FXP A;  3GLM A;  2Q9I A;  1KB9 E;  4BRY B;  2WSF H;  2Y0D A;  2DW3 A;  1NTK J;  1K8A Q;  2KI7 B;  2XV5 A;  2XU6 A;  4Y99 C;  4GOE A;  3L73 D;  1AVO A;  1LNQ A;  1X22 A;  3H1H G;  4U3F J;  3VOP A;  1NTM D;  2RH0 A;  3E1R A;  1PIX A;  2QJP B;  2N1T C;  2KSE A;  3CL3 D;  3A0B E;  1KD1 Q;  1FZE A;  4RKU J;  1JY3 N;  4N78 D;  4Y28 J;  3HE4 A;  3H1L D;  1QVF O;  1CI6 A;  4H13 C;  3HD7 C;  3TSI A;  5APX A;  4Y99 B;  2Y0E A;  1N7S A;  5CCH A;  3F89 A;  2R3C A;  1EZV D;  3TGU J;  2YO2 A;  5TJH A;  2QM7 A;  3HE4 B;  2O3J A;  2WT7 A;  1DEB A;  1L0L D;  3HD7 A;  3H32 A;  1ZR4 A;  2NPS D;  2N1T B;  2K9Y A;  1N7S B;  5DJU B;  4RJT A;  3AEA C;  4NPF X;  1KQL A;  3PRJ A;  4H13 B;  3HD7 B;  2WIT A;  3H32 B;  1FZA A;  2FYU E;  2XNX A;  2M3E A;  4H0L C;  1S9K D;  1NGM B;  1SQB J;  3CWB D;  4ZMD A;  4H44 C;  4ASW A;  1YIT P;  4EOT A;  1FZB A;  1EDI A;  3L73 E;  2J59 M;  1N2D C;  5APV A;  1JM0 A;  1KB9 I;  2O01 N;  1WT6 A;  1NTM E;  1URQ C;  2H8P D;  1N7L A;  3OW2 O;  1LP1 A;  1S5L X;  3OAK A;  4PJ0 E;  4H0L B;  1IO4 A;  3CC4 P;  2QJY C;  4N78 E;  3CC2 P;  1BSH A;  5KLV G;  1GDT A;  2PRR A;  4AQR D; 
#chains in the Genus database with same CATH homology
 3MUD A;  2KOG A;  1RF1 A;  1RE4 A;  3IFM A;  2WTY A;  2Z4E A;  2FXM A;  2YKO A;  1LTJ B;  3M0D A;  2OAR A;  3CI9 A;  2CPB A;  1VPC A;  5KLV K;  1RF0 A;  1ZN5 A;  4GT1 A;  3A5T A;  2E43 A;  1HBW A;  1G1I A;  1H89 A;  5CCH D;  5BU5 A;  2IPP A;  2C0X A;  2GUV A;  3B5N D;  4I2L C;  1VDF A;  3A2A A;  5AVW B;  3M9Q A;  4W7Y A;  3VYI A;  1J1E C;  1MZ9 A;  3L35 A;  3L37 A;  1FAV A;  1HVV A;  1PFI A;  4W80 A;  4EIJ A;  1IJD B;  1N7S C;  1JY2 P;  5CCH C;  1NAF A;  2R5D A;  3B5N C;  1NTZ K;  1FDM A;  3CLQ A;  3M9B A;  1S9K E;  1QL1 A;  1JNM A;  1FJP A;  3SWF A;  2ZXE B;  3I5C A;  3V4Q A;  3OA7 A;  2Q7C A;  2FKW B;  3RK2 D;  2FYU K;  4LGD E;  3WMM 0;  4C7N A;  1JO5 A;  2WWW A;  3GHG A;  3T97 A;  2A45 I;  3M0A A;  3MGN A;  3NXS A;  4N3Y B;  1LWU C;  2HPC A;  1HWT C;  4IFD K;  4C46 A;  1CI6 B;  1ZLL A;  2CPS A;  1J1E B;  4GKG A;  2J58 A;  4XA4 A;  5AW3 B;  3UIA A;  3RK2 C;  2YO3 A;  1J2J B;  4WY4 D;  4C7N B;  1Z56 A;  3GHG B;  4JYB A;  2OYI C;  2PAJ A;  1LWU A;  3B5N B;  3M91 A;  2HPC B;  2LKM A;  3P8M C;  1GK4 A;  1KIL D;  1X9V A;  2WT7 B;  2OYH C;  2I1K A;  3OJA B;  5AVQ B;  1IFM A;  1LT9 C;  4WY4 C;  3VP8 A;  1N73 C;  4OH8 B;  1SQV K;  1LWU B;  2R32 A;  1NU1 K;  1HGV A;  1MUU A;  5AW2 B;  2P67 A;  3V2P A;  1KIL C;  2JJL A;  2OYH A;  2H43 A;  3EQ2 A;  2W27 A;  3E1I A;  5KJ7 D;  3RK2 B;  1G1J A;  1LT9 A;  4WY4 A;  2HOD B;  1HUC A;  3PP5 A;  3BAT A;  3TNU B;  3MTU E;  1LTI C;  1RF1 C;  1RE4 C;  1T3J A;  1M1J A;  2HLO A;  1H8A A;  1KIL A;  1L0L K;  1JCC A;  4HH2 A;  2KP8 A;  2YKP A;  3LIE A;  3H6P A;  4O9B A;  5BU8 B;  2OYH B;  1OXZ A;  3P8C D;  2Z5H A;  5KJ7 C;  1RE3 A;  1RF0 C;  3M06 A;  1LT9 B;  1IFJ A;  5AVS B;  4WY4 B;  3RK3 D;  3TK1 A;  4LC1 A;  1HJB A;  1N73 B;  5AW5 B;  1GL2 D;  5APT A;  2P2U A;  1M1J B;  1KIL B;  3V2R A;  2O01 H;  4JF7 A;  5KJ7 A;  3V2Q A;  3BRV B;  3EFG A;  3RK3 C;  1SLQ A;  2POH A;  1RF1 B;  1GL2 C;  2XZR A;  1SFC D;  1YTZ T;  2M3B A;  1NH4 A;  2WPR A;  3HUS C;  1FZC A;  4DZO A;  1YTZ I;  3NFQ A;  1MV8 A;  2HYN A;  3TYY A;  3V2N A;  1NKN A;  4JYC A;  1X79 B;  1JY3 P;  2N9B A;  5AVR B;  1GK6 A;  1FZG A;  3VMY A;  3GHG C;  3M9H A;  2W6B A;  5CHX A;  3V5B A;  2C0W A;  5AVY B;  3B8E B;  3L4F A;  1GL2 A;  3HUS A;  1LTG C;  1SFC C;  1SQQ K;  4IFM A;  1FZC B;  2FFD C;  4W7Z A;  1DX7 A;  2KYV A;  3L36 A;  4DOJ A;  1AFO A;  5CMZ A;  3RK3 B;  1JY2 O;  1L4A D;  3KPE A;  1NTK K;  1FOS F;  1T8Z A;  2GUS A;  4N6J A;  4B86 A;  3II6 A;  5APY A;  5AVX B;  1GL2 B;  3HUS B;  1SFC A;  1NWQ A;  2FFD A;  2KB7 P;  1XTC C;  3NTN A;  3VN0 A;  3C9I A;  2C9N Y;  4WBA A;  5AW7 B;  1KZU B;  1HTL C;  2N1T A;  5APU A;  3O8Z A;  1T3U A;  1L4A C;  3BVH A;  2YKQ A;  2W6A A;  2MJZ A;  4I6M C;  4KHX A;  1KFM A;  1SFC B;  1NTM K;  1G2C A;  3RL0 D;  2FFD B;  3P8C E;  4RES B;  3KYQ A;  2WPQ A;  1SP4 A;  2E42 A;  3NMD A;  1ZV8 A;  5CJ0 A;  1L4A A;  3MD0 A;  4I1L A;  5AW9 B;  2H7H A;  1RY3 A;  1AQ5 A;  1M1J C;  3RL0 C;  2XKM A;  1GU4 A;  3U59 A;  4AYC A;  1OWA A;  2KSJ A;  5AW6 B;  1IFD A;  1RE3 C;  4WB4 A;  4C7R A;  3VP9 A;  3KDP B;  3SWY A;  3V4W A;  1L4A B;  5KTB A;  3G3Z A;  3HRN A;  2KLV A;  4AUW A;  1FZF A;  1HH0 A;  3MIW A;  3VMZ A;  5BVZ A;  5CCG D;  1JTH A;  1LTT C;  5CJ4 A;  2ZFC A;  3IR9 A;  1GW4 A;  4IFF A;  4XE5 B;  5AW8 B;  3A7O A;  3RL0 B;  1SQB K;  1FZC C;  1LTJ A;  1NO4 A;  1JUN A;  5CCG C;  1E5W A;  2A45 H;  5AVV B;  1JMM A;  5APS A;  3LW5 H;  1JTH B;  1LTB C;  2Q3I A;  2WPS A;  3BRT B;  4GIF A;  2IX7 C;  5AW4 B;  3KQG A;  2Q9I A;  2O1J A;  1URQ A;  5AVU B;  2WSF H;  1QL2 A;  2WSC H;  1SQP K;  4ZKU A;  2YMY A;  5CCG A;  2PP6 A;  2XV5 A;  2XU6 A;  1IFN A;  3R2P A;  4Y99 C;  2N1T D;  1X8Y A;  5AW0 B;  1N7S D;  2BAS A;  5AW1 B;  1GZL A;  1URQ B;  2Q5U A;  1YYC A;  3VTP C;  2XDJ A;  3VOP A;  2JEE A;  1JY3 O;  3HD7 D;  2M8R A;  1EQ7 A;  1FOS E;  1LTA C;  2A45 G;  2N1T C;  3LID A;  3HE5 A;  5AVZ B;  2C9L Y;  3CL3 D;  1T2K D;  1J1D C;  1FZE A;  2L5G B;  2HG5 D;  1JY3 N;  2P1J A;  4N78 D;  1LGH B;  4M3L A;  3HE4 A;  2P7J A;  1CI6 A;  1JY2 N;  3BAS A;  2YNY A;  3HD7 C;  3TSI A;  1GU5 A;  5APX A;  4Y99 B;  4ZKP A;  1FU1 A;  3HE5 B;  1T2K C;  1N7S A;  5CCH A;  4HYT B;  2R3C A;  5APQ A;  3B5N A;  2YO2 A;  2QM7 A;  3HE4 B;  1A02 F;  2WT7 A;  1CW5 A;  1DEB A;  3P32 A;  3HD7 A;  3H32 A;  1JCD A;  1ZR4 A;  1MFZ A;  2NPS D;  1FJK A;  2N1T B;  1CZQ A;  1GTW A;  2QM8 A;  1GD2 E;  3U1C A;  1J1D B;  3HTK A;  1N7S B;  1KFN A;  1ZR2 A;  2Z5I A;  1L0N K;  1M7L A;  1G2C B;  1KQL A;  1W2E A;  2GM4 A;  3A3Y B;  3HD7 B;  2WIT A;  2WSE H;  1FZA A;  2XNX A;  3H32 B;  2NPS C;  1S9K D;  1FBM A;  1GW3 A;  2O1K A;  1CSB A;  2HOD A;  2OYI A;  3HTK B;  3TNU A;  1URQ D;  2WZ7 A;  4LLH A;  3P7K A;  4EOT A;  1FZB A;  2HFE D;  1WRG A;  1LTJ C;  1IC2 A;  1HGZ A;  2FYZ A;  1A02 J;  2J59 M;  1DH3 A;  2NPS A;  1JOC A;  1N2D C;  1NKZ B;  5APV A;  1NOH A;  1WT6 A;  2OYI B;  3VMX A;  1N73 A;  2R5B A;  1SQX K;  1URQ C;  1XTG B;  2IFN A;  2H8P D;  3N7N A;  1N7L A;  3N4X A;  3M0D C;  5AVT B;  1LTS C;  2IFM A;  3OAK A;  1IO4 A;  1IFI A;  2NPS B;  2VRS A;  1N86 A;  1H88 A;  4N78 E;  1IK9 A;  2I1J A;  5APW A;  1SVF A;  1GDT A;  1NHL A;  4AQR D;  3U1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...