2D2CB

Crystal structure of cytochrome b6f complex with dbmib from m. laminosus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
137
structure length
137
Chain Sequence
LAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGAALPLDKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Intraprotein transfer of the quinone analogue inhibitor 2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone in the cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 19
structure length 137
sequence length 137
chains with identical sequence O
ec nomenclature
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2d2cB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2d2cB01
1VF5B 2ZT9B 2D2CB 2E74B 4IL6X 4Y28J 2E76B 1JB0J 4H0LB 4I7ZB 2WPVB 4PV1B 3LW5J 5L8RJ 2WSCJ 2K9YA 3C8VA 2E75B 2WSFJ 2QJKC 4OGQB 4H44B 4KT0J 2QJYC 4RKUJ 5KKZC 1ZRTE 1Q90D 1S5LX 2QIWA 2QJPC 2YIUC 4H13B 2O01J 2FYNC 2QSIA 5KLIC 2WSEJ
chains in the Genus database with same CATH superfamily
4X20A 3L75D 1RSOA 2Z4EA 3K5LA 1Y74A 5KLVK 4BWNA 1L0LK 5DECA 3IAOA 2WPSA 1G1IA 1WT6A 3CRRA 4A5UB 4JF3A 2FYUH 1YIJP 2KG7B 2W6IG 4NVPA 1JQ0A 2EIKB 3VQYA 1VQMV 2K37A 1K4DC 3GF7A 1LP1A 3OAAG 3T1HB 1FZBA 4FLWA 1SQVG 4I4TB 5L3DA 3CCRP 3FB7C 2RCVA 4K8XA 2AGAA 2RKLA 3NMDA 1HR0O 4W7ZA 5AG2A 1IJDB 1OWAA 3RL0D 5IY5B 2OTLP 2ZNIA 3KXDA 1FXKB 1PP9H 2CH7A 5CBFA 3W7UA 2JS3A 2LXBA 3GLMA 3GWKC 1JY3N 3LW5H 4WFFA 2MW2B 1VDFA 3IFXA 2K88A 2V7QG 1N36B 1Y76B 1LUVA 4IIJA 1GL2D 1JY2N 5AVWB 5B66Z 3U11A 4OGQD 4YIPA 4B3TB 3WUTA 4FM1A 1AJNA 1YJ9V 5H2FZ 2X0LA 4RUEA 4F6RA 2QKAA 3CWBD 3L74E 2ZKOA 3W67A 2WLIA 2YEVA 1O9GA 1R8EA 4CPGA 3CEIA 1U7MA 1IX9A 4ZBMA 4K3AA 1PPJD 1KB9F 2FY8A 2QKSA 2P58A 2KS1A 3L74H 1EZVH 1QGKB 1OVUA 4K0KO 2O1KA 1A02F 2R9AA 2BCCD 2WAMA 1WB8A 2W6JG 1YXBA 1W2BU 1KZUB 3HTKA 3MHSC 2W83C 3K79A 4BIOA 3W7TA 1QQCA 2OGUA 2FXOA 4O2BA 4O4IB 3ZMVA 3ZEDA 1FE6A 1XI1A 1FFTB 1I08A 5D5QA 5FPRA 1BE3D 5FL7G 4H44C 2R72A 3IN6A 3KKYA 2DYRC 1CSBA 4CS3A 1MOFA 3L75H 2Q9IA 5JCOA 2PZSA 2OCCB 3M06A 2XKMA 3E89A 2VRZA 3M8AA 1NKZB 1FD9A 1QVFU 4TOIA 3JATA 1TVKB 2EILC 2UXBB 1P84D 1FZFA 5IWAO 2RNBA 3AG3C 4HJGH 1J95A 3OTFA 1KD1W 1HNWO 2VQEO 1SFCC 1VQ6V 1M1JA 2IW5A 3MIWA 3RN4A 2B9BA 3OUSA 3VQXA 2E74B 3AG4C 1E79H 2G3AA 1ORQC 3VBBA 4YY3O 4MTFA 3WUUA 4IL6Z 1NTKK 4AYCA 3SPGA 1KORA 1M57D 2POHA 1NBMG 4ASUG 1YEWA 4HB1A 5KHGA 4HNAA 2HVJC 1T2KC 1TVKA 3DSQA 3ZCCA 1JTHA 3NFQA 1L4AB 4I7ZC 3CCRV 3IFMA 1UPGA 3M7MX 2LFRA 2B88A 1EFRG 3JASB 4IFMA 3M0DC 4PD4F 1SLQA 1MZFA 2EJRA 2OTLV 1KP2A 5JJEB 3LNNA 2O3JA 2EBOA 1VQ7P 4Z1MH 1W59A 3AECC 1VF6A 4UVAA 5DJUB 3AE9C 2BTQA 1P49A 3RVYA 2WSSG 2FB5A 1DX7A 3EFFK 1Q7YW 5C93A 2QJPB 1NTMJ 4OVNF 5DJTB 4EI2A 4KT0J 3BCCG 5KLVE 1L0LE 3H6PA 4DV0O 3AE4C 2BCCH 3IGAC 1M4UA 1PGQA 2JJ2G 2XU6A 4B3MB 1RF1B 4FVMA 2CK3G 1BDDA 2Q4PA 1SA0A 3NR7A 5KLVH 1KILA 3PP5A 1L0LH 2FL4A 1QLEB 1HP8A 2CGNA 3QO8A 1AR1B 3A2AA 4UCRA 1VQPP 1K9MW 3CD6P 2HKOA 3LUTB 1NAYA 1NZ6A 4IHJB 4FFBA 4TV8B 3V2NA 3CCQP 2XNDG 4I50B 1TA8A 1RY3A 1DF4A 3BRCA 4L74A 5APYA 1P84H 1E1RG 1JMBA 4JI3B 3ZX6A 2DQ3A 2RDCA 1S9KE 3H1LJ 5KHHA 4WFEA 1E1QG 4EKWA 3SYAA 3LDCA 1BZKA 4JZ2A 3RBXA 2DE0X 1MZEA 2IU0A 4JBZA 1S1CX 2EZOA 3GHGA 3G4SV 2OTJP 4TSFG 3MZWB 4I50A 2FYNB 4KHXA 2QJYC 4EYYQ 3AK1A 1NTZE 3CXHD 2H8PD 5APQA 1RM1C 3G6EV 1KV4A 1MNGA 3ABVC 5E79Z 5APVA 5CA0A 2OYOA 1RE4A 5EC1C 1PIXA 4TQFA 1R3KC 3RK3C 1NTZH 2I8DA 4C46A 2QWRB 1HGVA 5B3SB 4DOJA 1K4CC 1HW7A 1ZXGA 3AG2C 3ABMC 4PA9A 2QG4A 2N9YB 2OYQA 3P7KA 2P7JA 3CMEP 4UCSA 4PV1C 4LR3A 2LXCB 3KYQA 2P67A 1XDCA 2JGDB 4PA7A 1BL8A 4ASVA 3OTOB 1USEA 4L8JA 4XA4A 4DR7B 3IC7A 1OCCB 4CC6A 1P84F 1EZJA 2F95B 1TGOA 1VF5B 1VQ7V 1OJHA 1B6QA 3BHPA 2JO1A 2YICA 3CMAV 1R1BA 4YHHO 1MUUA 3CX5D 4JQ0D 1AJQA 2HEPA 2YO2A 1GRJA 1Q81W 1S5LH 2YNYA 4JAUA 3D36C 1LTBC 1NTKE 1N8RQ 1M1KQ 3F89A 1EXIA 1L4AD 3F7VC 1DEBA 4WY4D 3E8GA 4FIPC 1N7SA 1SC5B 5L3EA 1K92A 1N33B 1I5XA 1G1XB 1VQ6P 1LTGC 1VQLP 3OFNG 1NTKH 2VWKA 4KXRA 4WBNB 5CCHD 2FKXA 1L0NG 1B3QA 2XHBA 1OVRA 1ZRTD 1XQ8A 3N4XA 5BXZA 2IBZE 3SJQC 1ZLLA 4U3FG 3RL0C 5IJ9B 1BGYJ 4I6MC 1N34B 1IXBA 1EDJA 4GODA 4UB6Z 3BVOA 1NVPB 2A06G 1FJGO 1LT9B 1OV9A 3ZRXA 3KCXA 1HTLC 2WLLA 3CXHH 2QIWA 3H1LD 2IBZH 4LF7O 3L73J 1FDMA 1GL2C 5B1NA 3K08A 5BMVB 2K9JB 4GDOA 1IZNB 4WBNA 3WB2A 3B71A 1MG1A 3E8BA 4IFFA 2IH1C 3N2GB 3G3ZA 5C39A 3H1IG 3HKDB 3GG2A 1KUQA 1Q43A 1ENVA 3O9OA 5AW4B 3TGUD 2V1DA 3O6QB 2OTJV 2K3RA 1TUBB 3X2QC 3U1CA 1L0NK 4YJ3B 3CCJP 1MA1A 5BR8O 3JAKB 3KHUA 5KAFE 4LFBO 2LFSA 3UM7A 1P7BA 5BMVA 3CP1A 5LMUO 1COWG 4LNUB 1M90Q 4RUFA 3OAKA 1FAFA 3CJHA 4CH3A 1DIPA 1GO3F 1J2JB 2AEMA 1SQXJ 1YTFB 3BCCE 5KAFH 1DLBA 1LWUA 1IBMB 3O6QA 3CX5H 1K04A 2E75B 1NH2D 1NTMH 1LTIC 4L76A 4LF4B 2FKWB 1BT8A 4LFAB 2Y9YA 4OH8B 2UXCO 4JI8B 1Y47A 2HLOA 4PI2A 1KILE 2CUGA 1OCRB 3MHHC 4YJ2B 2UUBB 3RK2B 1QR8A 4I55A 1URQC 1XTGB 5J2UA 2O01H 2L5GB 3B8NA 3K03A 4P2ZA 5B1AB 2P2UA 3CXHF 2FTKA 2N1TC 4NTYA 3V2RA 2Q6AA 1JO5A 5EBWC 3FYIB 4PDRA 2UUCB 2VRSA 4O4LB 1ZR4A 3SPJA 4JF7A 3G6BA 4N3YB 3A7OA 1IBKO 4JI2O 2NRGA 3CE2A 2M5AA 4JYAB 3HE5A 3OGCC 5KUKA 2KKWA 4LFCB 3ASOB 1FOSF 4NR1A 3HUSA 2PTMA 3ABLC 1M57C 2YXQB 5AVXB 2Q7GA 2YIAA 3KZIZ 1SQQG 3MD0A 1VQLV 1S76D 1R6KA 1ZX3A 2AXTE 1I0HA 2EIMB 5HFLA 4W7YA 2Q8VA 3MDSA 1KTMA 2F4VB 3B8EB 3OEEG 4JI7O 3I5DA 5C8YB 4Q20A 1S3JA 4U3JA 1EM1A 1IURA 3CCLP 2FYUJ 3JARB 4OWFA 2Y9ZA 2QM4A 1NJIQ 5F2VO 2JK5C 1EDLA 3CX5F 4JI4O 3L36A 1WPBA 3L73D 3U59A 4C7RA 5CJ4A 4NYKA 4J7JA 5LMNO 1Z56A 2MK3A 5KJ7A 4JI0B 3RYHB 2EIKC 5TISZ 3AK3A 4DYLA 5AVQB 3VTPC 4GUNA 4LF5B 3HE4B 3CLQA 4AQYO 3B2EE 1LUWA 2XDJA 3OR7C 1RH5B 5KA5A 3DC6A 1OW8A 4H37A 2D2CD 2FXMA 3WU2E 1YI2V 4H0LB 1SQQK 1K05A 2Q5UA 3EWKA 4RQFA 5BU8B 5IY5C 1VQ9P 1QU7A 2ZIMA 1FXKC 4KL1A 4C7NB 4J7ZA 1M9NA 2C2AA 1SFCD 1S72P 5AW6B 1GN2A 3SWYA 1PV3A 3A0RA 2PY5A 2RJZA 3L71G 5B5EE 2GBOA 2YKPA 4YXWG 2JDIH 5GTHZ 3JCUE 3P32A 4NPDA 1AR5A 2OYIC 3JD0A 3TETA 1SQXD 1SQPD 4UB8Z 3E1RA 1H2GA 1T2KD 3KQGA 5EYPB 5AW5B 4FLUA 2IFMA 4X1KA 2GDSA 3VQWA 1TAEA 4LF6B 3L74J 3BY6A 3JCUH 4WWIA 4PDLA 4I9WA 1FBMA 3CCEV 4IYHA 1IBLB 4D6TE 5EZYA 1KD1Q 1D5NA 2UUAO 2R44A 3H1JG 3JAWA 2UXDO 3L72E 1L0NE 1FS0G 3W7XA 3P3NA 2ARHA 3RVZA 2H8PC 2QE7G 4D6TH 4U3FE 1LTJB 1XL4A 1HWTC 3K5NA 5CMZA 2YC0A 5EYPA 4FLVA 3L72H 1ZV8A 2ZDIC 2DWEC 1YCIA 2OYHB 1BSNA 3VN0A 2A06E 1FZCB 2HHHB 2Q7EA 1BGYH 5CJ0A 1U57A 5E1AC 5KHKA 5L3CA 2YDEA 3QNEA 1FFXB 2ZIOA 4DJGA 5LYJB 3S3XA 4D7SA 1S77D 3L70G 3QO5A 2OCCC 2DW4A 5LGNA 1N8RW 1EDIA 2KLVA 4ZI7B 4NXNO 4MVMA 4PDVA 3H1IE 3JSLA 1KFNA 4AQRD 3UT5A 4DR6O 2JEUA 4JTAB 3GF3A 5JJJB 4O9BA 3Q1MA 3TJTA 1ZMEC 5H6RA 2LR2A 3RYFB 5KKZB 3H01A 3T4ZA 3B5ND 1Q7YQ 1AFOA 5K1XA 1F7YA 2FYUD 2QRXA 3A0HE 3BRTB 2E74C 2UU9B 1WA8A 2IYOA 4RESB 3IF4A 3V6IA 4BIZA 2E42A 4PA4A 2P06A 4DV1B 3D71A 3QF7A 3VOUA 4ZI7A 1P7GA 2B1GA 1CP9A 4NKGB 3A0HH 5LA6B 5GTIZ 4B3SO 1L4AC 2PF4E 4DR1B 1HNZO 4FZ0A 4GCZA 1PP9D 4X65B 4R50A 2BEQD 1K9MQ 1BCCE 2WPVB 3RYFA 5APUA 5B1OA 2BOBC 1JX9A 3OMAB 1VQ9V 1JFFA 2P4KA 4Z2WA 3JALA 3OM3B 1F51A 4TV9B 3TXSA 2CAZC 2E5LB 1ZSPA 5JH7B 3PJSK 3CWBG 4CH6A 1ZAUA 3R65A 1L8DA 4AUWA 1BCCH 1KMIZ 3FX7A 3CC7P 5GONA 1Q5OA 4O2AB 2QJPC 4CH4A 4QJFB 1J1DB 2JWDA 1NU1K 5LA6A 5LHHA 1J5EB 1H2SB 1PPJG 2YMKA 1X9VA 5JVDA 1M8OB 5KLVJ 5L3GA 1L0LJ 4X20B 2P90A 3ZN0A 1GN3A 3L74D 1RF1C 3U1AA 1EZVD 4JPRA 4N6JA 3K0DA 5APWA 2BSKA 2YUAA 4ZOLA 2FBWC 1R5SA 5BVZA 1QLEC 2WA4A 1ROPA 3H1HG 3O8ZA 4X1YB 3ZHUA 1LP1B 5H2FE 2KP8A 1BE3G 4MTXA 4CH5A 3RGBA 1JJ2U 1DD4A 4O2AA 1AVMA 1N7LA 1S4XA 2MKVA 1RFYA 3I5CA 2B5UA 1N36O 5AVTB 3ETQA 3K9AA 2CH7B 2ZE6A 1XBLA 2P10A 4B3TO 2PAJA 4DO2A 2CGOA 5LL6Y 1GDTA 2OIGA 1BHBA 4IIJB 2BASA 2IU3A 2K1EA 4X1YA 1VL2A 2Q3EA 1XHXA 3M9QA 3AEGC 1SQBK 2BE3A 4PJ0Z 4F6RB 3RYIB 3W7WA 3K04A 2R5BA 1YQ3C 1YSCA 1XMQB 2FYNC 2WLIB 3HB3B 2YEVB 4UCTA 2KB7P 4QPJA 1FC2C 1FDOA 4WBAA 1H2MA 3SFDC 1NTZJ 4XDJA 4B3RB 1KBHA 1Q81Q 4E2LA 3SGIA 2KS1B 1M56D 2A45G 3S4RA 3A0BZ 2AZ0A 2FFDB 3SJAC 1NKNA 3RW0A 3E2EA 5B3SC 3HD7B 3RYCB 1D7MA 2V7QJ 4X64O 3CL3D 4UVBA 5D5PA 1TU3F 1KN7A 3HTKB 1NJIW 4DV5B 2JS5A 3RYIA 1IVSA 1SRYA 4O2BB 2N05A 3B40A 3CXCU 2QSIA 2XAFA 3R4YA 2IJJA 4MVOA 3ZHTA 4GT1A 1Y4MA 2QGNA 1SQVK 2DWDC 2IM9A 4WFBV 4IL6E 3I55P 1OHHG 1NWQA 4CS4A 2B1IA 2KSDA 2YKQA 3JC22 3OW2O 1OCCC 3H1JE 2N9BA 1VF5C 2CTRA 2FFDA 4G2KA 4GX0A 3SYQA 3JATB 3HD7A 3RYCA 4HKZH 2IX7C 3CC7V 1YF2A 2CE4A 2KI7B 5AVZB 2PYJA 3BRVB 2XZRA 2JRIA 1N73C 1MV8A 2IJKA 1M1JB 5KLVD 1L0LD 3D3QA 3LSSA 1RF0C 1V55B 4JI1O 1NTKJ 4I0XA 1JCCA 1PV0A 2YIBD 2DJVA 3BASA 5AW2B 2J59M 3L9DA 3ZRWB 5KUMA 1DEEG 1X59A 2NPSB 4N21A 2W27A 1URQD 2D2CC 2ZINA 4LLHA 4HNAB 2PI5A 2F1MA 1JTHB 1QL1A 1GU5A 4GX1A 3HKEA 1IK7A 4GX5A 1MFTA 1YITP 1S5LX 2N1TD 2YIUC 5KX5A 1SETA 1J1EB 2P22C 1PM9A 1LT9C 2HJFC 4J9ZB 2E76B 3P8MC 3Q2YA 3E8FA 1Z5WA 1NU1E 3CYOA 3ZBHA 2XUMA 1S9KD 4JI5B 2BTQB 3ZRWA 1YIJV 2Y0PA 2NPSA 5L3BA 3Q5SA 1VQOP 1YJNP 2L35A 4B3MO 4YTPC 3T4DA 2KSEA 4ICGA 3E1IA 4ZKIA 3SPHA 4K0KB 1LGHB 3TYYA 2ITAA 1U7JA 4MVUA 1NU1H 3UIAA 4B08A 1FDIA 4X66B 1SA0B 1SQGA 2YKOA 1FXHA 4HH2A 1NTZD 2ZT9B 2K1AA 1VQ8P 4ASWA 1KILB 3HR0A 4ZMDA 3FWNA 4LF9B 2XT9A 1RE3A 3UO3A 3PLNA 1AILA 1VQ4P 3GWOA 4FFBB 4JI3O 4FK5C 4HAMA 1GK6A 3AEAC 2DN9A 4B7KA 1F4MA 1ZUQA 2E75C 5KAIE 1XREA 1UFIA 3BCCJ 2X6CA 4HYOA 2O01J 3HKBA 4GOFA 4TWKA 3JSNA 1FJPA 1SQBE 4MTOA 1OCRC 1V54B 3LDEA 3I55V 2HVKC 3RK2C 3ABKB 1Y67A 2XOKG 3H1HE 2H89C 1S5HC 4J42A 3AE6C 1BS3A 3K06A 4TUYA 1MSWD 3E8HA 2LJ2A 3GHGB 1SQBH 1P4RA 4WCEV 4WY4A 5IJ0B 2YXHA 4HZ3A 2HP8A 4QNHB 2QVAA 3B5NC 1EN5A 3GMAA 3SWKA 1QNMA 1GU4A 2QKCA 1XNRB 4KFMA 4X1IA 2W8ZA 5CA0B 3FGAD 3LNMB 3CRQA 2M6YA 1NTKD 5CCHA 1N4CA 2A0LA 1KECA 3ASOC 3SFEC 1VIBA 2Y4TA 4CS2A 3AE2C 2WA3A 4DUYB 2K9YA 2Y69B 2EIMC 1K73W 1SQVE 1U97A 1KYOI 3CC2P 2AEJA 5K1PA 1WP7A 2Q73A 3OTOO 1URFA 4DR7O 5IJ0A 2WT7A 1XUQA 1YITV 4BW5A 3A3YB 3BABA 4R6ZA 2IBZD 2E5YA 2WLKA 1PKXA 1JVMA 5K5GB 3AE7C 3FXDA 1SQVH 3AG1C 3TGUG 3SJCC 4W80A 4AI8A 3F5HA 3VMYA 3H9VA 1EQ7A 2LKMA 1AJPA 3CRAA 2HODA 2Q69A 1VQOV 1OXZA 2WITA 1EBOA 2NR5A 3ZHVA 2V7QH 1FZAA 1W0KG 2GUZA 3NXSA 3K57A 5LP6C 1Q82Q 1N7SB 3H1KG 4BIUA 4KJMA 1FYJA 1S5JA 1FKAO 1PFIA 1W0JG 2E74D 1QVGO 5CA3A 1N34O 4I9QA 5CN0A 2R32A 5AW1B 3G71P 5JWPA 2M8RA 3KPEA 1NTMD 1NT2B 3E83A 2WZ7A 2L6LA 4EFBA 2GUSA 3GVMA 5LXTA 2C9LY 2OT5A 3R66A 2V4HA 4DR3B 4IGGA 3G80A 1WLEA 1BSHA 1OCZB 3ZS8C 1AVYA 2WLLB 4BRYA 2W6JH 1K3EA 2KZJA 2NNUA 2KUBA 3ZDMA 4UUJC 4FLXA 4DV2B 2QJ1A 4FLZA 5KLIC 2AXCA 1SQFA 1LTSC 1D5AA 3MGNA 4D6TJ 1H88A 3KDPB 2M3EA 1VQPV 1MKMA 3CD6V 3L72J 4DR5B 1L0NJ 5JQGA 3CCQV 3MP7B 3H25A 1LTJC 5AW0B 2E43A 4PI0A 3N2KA 5A2QN 3JD2A 4H44B 4DR2O 1NYHA 3J7AU 4U3FJ 4I5SA 3EHBB 5LOVA 2OYHC 1AI6A 4JTCB 2YXRB 1M56C 1FZCC 5LBQA 3HRNA 1KB9I 3T1CA 3ZMUA 4JASA 1KQSU 1DD3A 1EXJA 1B04A 3MUDC 1IBMO 2OWOA 3JD1A 1NR7A 1HVVA 4N78E 3M0AA 1RQVA 3CJHB 1QLED 3CCMP 3USSA 1THZA 4B86A 4LFAO 1F4NA 1GM8A 1L1FA 3T1YO 1GK9A 4GKKB 4JI8O 2Q0OC 1LWUB 5EK0A 1Q2NA 3CC2V 2AHZA 1OW7A 2KOGA 2M7WA 2M0BA 3H1IJ 2Z3YA 3ASNB 3L73G 1KU9A 2PYLA 4IFDK 3AG4B 2B9ZA 2ZE8A 4KUMA 5EBLC 5HFMA 1KC8Q 3KZIE 1S5LZ 4TLFA 4I55B 1GTOA 5J2UB 4PHZA 2ZR3A 2V4DA 2UUCO 3V2QA 3K59A 2ZCEA 3HKCA 4FLTA 2FXPA 1NR1A 5IYZA 2Q68A 4I7ZB 4QE7A 3BPZA 2NN4A 1LNQA 4WF9V 4JYAO 1IFJA 1FZGA 4DK0A 1AQTA 5ITZA 4LFCO 4EFEA 2KQXA 3JCZA 1SFCA 4X9QA 4XBFA 4EIJA 1JMKC 1JY3O 1LTTC 3CMEV 3B09A 2M5AB 2WSSH 3HE5B 1H8HG 4ZIBA 1PNLA 1JY2O 1BCCJ 1DGSA 3HUSB 2KIKA 1H2LA 3BCCH 2BTOA 3LIEA 2F4VO 2H7HA 1SQXG 4H13B 1SQPG 2OIEA 1OIPA 3AG7A 1DF5A 1G6UA 5CMUA 5CCGC 2CK3H 5JJNB 1WRGA 4DR4B 3ICXA 1EZVI 1VQNP 3G71V 1QVFO 3A8TA 1J1DC 2ZXWB 4U3JB 1XTCC 4WVZA 3M9BA 5H6QA 2Z5UA 2NLJC 2P5OA 1GW3A 3M0DA 3M9HA 5J9PC 4PD4I 4JI0O 2GUVA 1G1JA 1AV1A 4LF5O 2Q9LA 2XAHA 3OD4A 4WFGA 2ILMA 2XNDH 5FPOA 5IDJA 5AVUB 1GMJA 1YTZT 5IYDO 1Q6HA 1GN4A 1N0JA 4D6TD 2QJKB 1EN4A 2SPZA 3UCSC 3CCUP 2IJHA 1VF5D 2YXYA 3DTUB 4B7EA 1H0TA 3L72D 4WFAV 1L0ND 1SQPK 4DV7O 3BATA 1BGYD 3UKMA 1G2CA 4TT3G 2WPQA 3VP8A 1SZTA 2AXTH 1VQKP 1FAVA 2LGWA 1JY3P 5KAFZ 3ZRSA 4GKJB 4DV4B 4JV5B 2H88C 1JA8A 4X89A 1K5QA 2C0WA 3TGUE 4YXDC 1YHQP 2UXCB 1JY2P 3AEFC 2R70A 4J9YB 4K8ZA 1H8EG 4LF6O 3OMNB 3CCMV 4NPEA 1H2KA 1Q86Q 2FYUG 3L4FA 1RM1B 4LF8O 3OA7A 3VOPA 4X1KB 1RPRA 3TNUA 3VQVA 4DXWA 1R3LC 1IFPA 1VP7A 3CCJV 1X0TA 2KK7A 1XNQO 3G9RA 3H1KE 3RK3B 3SPCA 5EZYB 3IAYA 2IFNA 1QBZA 2ZE5A 3EXAA 1NVPD 2ADQB 3JAWB 3WU2H 4X62B 3TCUA 5CBGA 1PL0A 4JYCA 1PP9G 1I94O 1GZLA 2WSEH 3T2MA 3D70A 1RPOA 4GZRB 3L35A 5L3FA 1XEQA 3G67A 4L87A 1CEZA 2HHHO 4LH6A 4DV3B 2ZM6B 5AVRB 4OX9B 1WNSA 5B5EH 3PN1A 3DXRA 3N27A 1ZWIC 4GKGA 4QMAA 5IE9A 3OMIB 4JI7B 3ZHRA 1QR9A 2ATKC 1BCCD 1SKVA 2QEXP 5JCOC 2JJLA 3ETDA 3WG7B 2GHYA 2VQFO 4JI4B 1XILA 2KXPB 4Z1VA 3H1JJ 3V5BA 1Q82W 5GTIE 3UT5B 3STLC 1BMFG 2F43G 3S9OA 3L74G 1QHTA 4NB5A 1EZVG 4LH7A 2HG5D 4UV8A 2UU9O 4PDMA 4AQYB 4ZNCA 4EOTA 5KA6A 1CI6A 2WTYA 1YTFD 3P8CE 1PGJA 1LJ2A 1M1JC 1L0NH 4JYBA 4UVCA 2YO3A 2E75D 4DV1O 2DOSA 2CTPA 1WA8B 1P84I 3I56P 1IZ3A 4BAYA 2WLJA 4U3FH 1ZTEA 3SDLA 1NGMB 4DR1O 1Y8AA 1XMOO 5KTBA 4X65O 3RK2D 1SESA 3CCVP 2A06H 5CBHA 3RL0B 3L75G 3CCUV 1KYOE 1Q8IA 2PUSA 1LT1A 4MN4C 3D36A 2YI8A 3W7SA 1AQ5A 4ZHQB 3AE5C 1J1EC 1GKFA 3FD9A 1GL2B 1K97A 3CCLV 1JFFB 2H3OA 1PD3A 2H94A 3H1IH 3JALB 1X22A 2Y0CA 1BSMA 4OGQB 1VQKV 2PI4A 2E76C 4L73A 2A45I 3C3TA 1MZ9A 4KHPB 1VF6C 5B5EZ 3ZRVA 1US6A 1J5EO 4PELA 1U96A 2JEXA 3FAVA 2UXNA 2O57A 2QM7A 2F66C 1E79G 5GONB 3JCUZ 4NXMB 1NU1J 2WMMA 3EQ2A 5IYBO 4UV9A 3SWFA 4DZOA 2UXDB 3CRMA 2QM8A 5J2TB 1WJZA 4HBNA 2CTQA 1HNXB 4EB6B 4UCVA 5JVDB 1NI8A 4ZHQA 3CB2A 1AP6A 3OT7A 4F4LA 1GL2A 3K5OA 4ZOLB 2BSKB 2UXXA 5APSA 1KILC 3K3WA 2WWWA 1IK9A 3W68A 1CW5A 1R6NA 3DC5A 3JD3A 1S72V 1SQPE 2H43A 4P9PA 2MJZA 4GOEA 1W5CE 3K58A 4GIFA 2W6AA 1KC8W 4OPAA 3Q5PA 1JEKA 5J2TA 1KQFB 3MAQA 4EB6A 3FX0A 4H0LD 2Q1KA 1K73Q 3WB0A 3BEHA 3T1HO 3WMM0 2BCCG 1JCHA 4HYTB 2ZXXA 3K5MA 3H32A 1N0NA 3ABKC 4JAAA 5B66E 1SQBJ 1XMQO 1SQQE 2QEXV 2AEFA 3H1HJ 3H1JD 1Z2GA 1IDSA 2CPBA 5KLVG 3GB7C 4W4KA 1L0LG 3GHGC 1X4TA 3CRCA 3D8CA 2HPCA 4JI6B 2FYZA 4B3RO 2QWOB 1FXVA 1WAZA 3SR2C 4CZZA 5B66H 4CBCA 2Q3IA 1SQQH 3APOA 3QO7A 1DH3A 1Q6IA 1QVGU 2B87A 5H2FH 4Y99B 2QWNB 1RE4C 1KB9E 3A0HZ 2ETNA 4XE5B 1URQA 4DUZB 1R5LA 4DV6B 2EJ7A 2LGQA 3CSXA 3CXHI 3KCYA 5B1BB 2N1TA 2OARA 1FU1A 4FFKA 4YIOA 1BHAA 3FB5C 1K5SA 3CCVV 4MTGA 4DW1A 4UFZA 1WPXA 3E86A 1AI7A 3ITKA 1SQVJ 4JTDB 2JKVA 2NZ2A 3ETEA 1R73A 1PL5A 3MHVA 5AVSB 3TSIA 2LQTA 2GA1A 2WSCH 4H33A 2ZYGA 3IC9A 3OJAB 3UQ8A 3ZJZA 3L71E 1T5EA 3C90A 5CB4A 2N04A 5FLXN 1PP9E 2IYPA 2G38A 3APQA 1Y66A 2R9IA 1NU1D 5EFWB 4O4JB 1NTZG 3L71H 1AA0A 5EC2C 1JMMA 1VARA 4MT8A 2N74A 3VMXA 4YXWH 1MABG 4J7KA 3C1LA 1BDCA 4I0XB 1N7SC 3M91A 3RK3E 3SSUA 3CX5I 1N32B 1E5WA 2UXBO 1Q86W 2YSUB 1GH6A 2KG7A 4U7JA 4YPCA 4QPKA 1YTZI 5CA1B 1FS0E 2OYIB 1G4YB 4G27B 4I4TA 3D6YA 4PA3A 1H89A 4IL6H 3HKEB 4LBEC 4GX2A 1EZVE 4O4JA 3H1JH 2X6AA 4J41A 5KX5B 4C7UA 2GTSA 1GW4A 4M3LA 4JI5O 3E7KA 1FXKA 2JJ1G 4PD4E 5EBMC 1OCZC 1KKDA 4DCKA 5BU5A 2X6BA 1HR0B 1NTZK 3D3IA 4RO2A 1AP5A 3S3WA 3WB1A 2QE7H 2ZYDA 1Y76A 3F7YC 5BZBA 2YI9A 3GW6A 1UJWB 3L70E 3QVNA 1SQBD 2LW1A 5CA1A 4PD4H 2OYIA 4IYIA 4R8CA 2FMLA 4X66O 3H1HD 3L75E 2YIDA 2QA4P 1W2EA 1NTKG 5CCGD 1HUCA 1SVFA 5EIBD 3L70H 4X64B 4JGSA 4ZKPA 2IZ0A 1YJWP 4LF9O 1M93A 3LIDA 2A79B 2EIJB 4LWSB 1RP3B 3ZMSA 2VS0A 1OFCX 1VEWA 2ZJSE 3VMAA 3J81N 2F93B 3THOA 3VYIA 2VWJA 4CC5A 3G4SP 4MW3A 3P3PA 1M7LA 4NPFX 4QIWF 3Q3DA 2WPRA 1EN6A 2IBZG 1IC2A 3RL0g 4DK1A 2KNCB 2Z0AA 1K7DA 3F5WC 1OMIA 1LWUC 2KYVA 3G6EP 4O4IA 3SJBC 2CPSA 2ITCC 3ABTA 2ZDIA 3ASNC 1GMGA 1SQVD 3AEEC 1QL2A 3HKBB 2AZ2A 1B06A 1BQZA 4DT0A 4LWSA 2ZXEB 2W6BA 5LGUA 2C0XA 1DK1A 3CWBE 4JI1B 1T3UA 2IPPA 2R3SA 1DTOA 4TUYB 3C8VA 4X8AA 3RT3C 1XNRO 2HG5C 1OCOB 2ZFCA 2KNCA 4WY4B 4LP8A 4AHCA 4G28B 1Q3EA 1BQ0A 1PPJE 1IO4A 3CWBH 4MW8A 5E79E 4P30A 4X1IB 5IWAB 2R3CA 4DUYO 4EDFA 3CPWO 2CTWA 2EINB 1GM9A 2BCCE 1HNWB 1LTAC 3HUSC 5IYCO 3CMAP 2VQEB 1NTMG 4H13C 1PPJH 2D3OW 5KAIH 5E79H 2JP3A 3U0ZA 4YY3B 1OX3A 5B1AC 1BE3E 4BXLA 1L4AA 2Z5HA 1JOCA 3CCSP 3HD7D 2WT7B 2ZXWC 3D6ZA 1LR1A 3H1HH 1IFMA 3JASA 1ZP0C 1ZLZA 5LHGA 2DYSB 1BE3H 2BEZF 1P84E 3DGEA 2RH0A 2HYNA 1ZW0A 2ZE7A 4MVSA 5KJ7C 4X88A 2IJIA 1AI4A 2X7RB 5LHIA 1PNKA 1H2NA 2HODB 2QJKC 3T97B 2KB1A 1FPOA 4JZGA 1NTMK 3H1LG 1AVOA 2QA4V 3QG5A 2PRRA 1CXZB 1R6TA 2GUZB 5DN6G 2Q5ZA 2XAGA 4RQEA 1RF1A 4DV0B 4QE9A 1YJWV 3K9SA 3PHLA 4BR6A 1FJKA 1OZ0A 4A7PA 1OW6A 1NH4A 5BY1A 4DR3O 1H38A 1NVOA 3TGUJ 2Z5IA 4IHJA 4TV8A 1NH2B 2WSFJ 1QCEA 3MTUE 3T97A 1HWYA 1YJNV 4N78D 2NPSD 3ZIAG 5LXTB 2RN0A 1N33O 4H0LC 4UB6E 3RBZA 2A45H 3ML0A 4DV2O 1FZEA 5TJHA 5KAIZ 2W90A 1SF9A 1XL6A 4W4LA 3ZHSA 4BRYB 1K8AW 1Y6XA 2BOCC 2WSEJ 2HFEC 1G8MA 3FFQA 1YDXA 2W0XA 1KFMA 4DR5O 4KP4A 1VQ8V 1PZQA 3H1KJ 2EZPA 4UB6H 2GV9A 2WPDG 2E76D 3AK2A 4RJTA 2JR8A 3CC4P 4N23A 3ZMZA 3BA8A 4D7TA 1VQ4V 5JQGB 3SYPA 1CZQA 3KG2A 3N2KB 2JDIG 4MS2A 2ZD9A 3EVKA 1JOYA 5LOVB 3BCCD 4XFJA 3SPIA 1S5LE 2J5UA 1Q6UA 1Y9BA 1JJOA 2PGDA 2PP6A 4GKKO 4J80A 1AI5A 2XNXA 2ZT9D 3OGIB 4U7OA 3V2PA 1KILD 2QWQB 5CBOA 3WG7C 3B4SA 3C3SA 2DQ0A 3LSQA 4K35A 1T6AA 4R4LA 3OUFA 1N73B 2GM4A 1QEXA 3CCSV 1JR9A 2EULA 4L75A 2JGDA 2DYRB 3AEDC 1USDA 4D6TG 3AE1C 3OE7G 4MSWC 2R9RB 1R3IC 1EC5A 2L91A 1O9HA 3L72G 1XOUA 2D2CB 2DW3A 3HKCB 2EILB 4JYYA 1BGYG 3CXHE 1SERA 5IYZB 2IH3C 2XTAA 4LF4O 3AG3B 5ITZB 2YIUB 3F5TA 4YHHB 2UUBO 1SFCB 4Q6GA 3A2FA 4FM0A 1HH0A 1N73A 3M99B 4ABMA 1RF0A 3OEHG 1KQGB 5KKZC 2W0FC 2QDOA 2WLHA 1FOSE 3FB8C 2G8YA 2ZYAA 2ODMA 1KKCA 4OGQC 4DR4O 2JWAA 2Y4UA 4DW0A 1IFIA 5AW7B 3TF5A 4O4HB 1YI2P 3STZC 3QWOC 2YMYA 2WLNA 2JIZG 4XDKA 4IOIH 1JM0A 5IJ9A 3KZIH 1VPCA 1N86A 3FXEA 1W2BO 1LT9A 4NTXA 3JAMN 1X8YA 1AJYA 4DR2B 3CX5E 2DMXA 3BFRA 1NTME 2Q7CA 5TISE 1GN6A 3QTCA 4J10A 2K9JA 1FJGB 3H1KD 2GSMB 2QR4A 4TQDA 4MVQA 4LF7B 3N2GA 3BAAA 4O4HA 3HKDA 1SQPJ 2RN9A 3PH0A 1AR4A 1PNMA 3O65A 5EIBC 3CC4V 1H0TB 5L8RJ 5GW7A 4RO0A 1TUBA 3AEBC 5TISH 1H8AA 4YJ3A 1M5IA 1R3JC 1YZBA 4DV4O 4JV5O 4GKJO 1BCCG 3EFGA 1GTWA 1G2CB 3T1YB 3CCEP 3JAKA 4IT5A 2ZVNB 3FWLA 1ZRTE 2JGUA 1GK4A 1HJBA 4MVRA 3JD4A 2Q6QA 1NHLA 3K5BA 1N7SD 2LW7A 2LP7A 5BR8B 1IFNA 5GTHE 4LNUA 3NTNA 3Q4HB 2KSJA 1SZXA 4LFBB 2YXLA 2O01N 1QLNA 2Y48A 1SQQJ 4UB8E 3B5NB 2QTOA 1D2DA 5LMUB 1JNMA 1SQXK 3H1LE 1PGPA 1IXMA 3TNUB 2XAJA 4X62O 3OW2U 5GTHH 2HR3A 2WLMA 2E3CA 1VF7A 3FYEB 4AILC 4JPZB 4U3FD 2I1KA 4RAIA 5AVYB 4Y99C 2OCHA 4E4EA 5AW3B 4YJ2A 4UB8H 3P8CD 4FPPA 3H1LH 1SS3A 2IZ1A 1ZR2A 2A06D 4DV3O 4GYCB 2ZM6O 1I5YA 4NTWA 4OX9O 3TXQA 2KLUA 3Q4HA 1JPXA 2RMKB 2QTSA 5B1BC 3AE3C 1ZN5A 4LC1A 2R5DA 4GLXA 4OPHA 1A02J 2Q7HA 2QJYB 3B5NA 1HDJA 4O4LA 4P9OA 3V4WA 3TGUH 1IBLO 2Q67A 1UIXA 4EEQA 2WSCJ 3DXRB 2WSFH 1AROP 2J58A 3H1ID 1WMKA 1KYOD 3V4QA 3FB6C 2K9PA 4DRXB 4H44D 3AG1B 2Q0AA 3FKSG 4I2LC 4MVZA 3U10A 3ETGA 1IBKB 2AHYA 4JI2B 5DEDA 3IJ4A 4FZ1A 3JYCA 1XHZA 3AG2B 3ABMB 4XDLA 2FFDC 1K33A 2LO1A 1L2PA 2Y0IA 3L71J 4PA6A 2ZAEB 3HD7C 3B8MA 3II6A 3H1KH 2CDYA 1T8ZA 1PP9J 1PGOA 2A7WA 3CS5A 4OXSA 4PV1B 5C8YA 2I1JA 3LW5J 1WN7A 1CI6B 3WFVA 5LP6B 3R2PA 3JARA 4DV7B 4ZKUA 2FYUK 4DRXA 1YBKA 2O1JA 3WUVA 1GM7A 3LSUA 3L37A 5M1BA 3AE8C 2A9HA 3RYHA 3Q5RA 3HE4A 1MFZA 5CHXA 3N7NA 2AXTZ 2C9NY 5LMNB 4FMTA 4FLYA 1EDKA 2YS8A 3PRJA 2XV5A 2JEEA 1S2EA 4LCUC 1VQNV 4RWUA 5FNVB 1F23A 4KHPO 5LP6A 3VP9A 5KMGB 1CPYA 4FJCC 1JCDA 4C7NA 4LF8B 1V55C 4BWAA 4NXMO 1VMGA 3AEIA 5GTIH 5KLIB 3B77A 3VMZA 2QSAA 4BW9A 4I1LA 3PTZA 1HGZA 2UWJE 3ZN1A 1Q90D 1HBWA 1VQ5P 1XNQB 1HNXO 2QWPB 3FAVB 3RWRD 1SP4A 2OQQA 1BGYE 1RQUA 2NPSC 5H5NA 4LGDE 4R7CA 4H13D 3L70J 2WQYC 3SYOA 2M3BA 2HLDG 1SQQD 2EX3A 3CPWU 4IL6X 1I94B 3WU2Z 1NQTA 3JSVC 3HPLC 2A3QA 2E5LO 5DM6V 3L75J 3L73E 5FNVA 1M56B 1OVVA 1GAXA 5KMGA 5IT9N 1TUEB 3ABUA 1V9PA 3J80N 2EIJC 2XAQA 1YQ4C 4R4MA 1VQMP 1KYOH 3ZMTA 1T3JA 2ZQMA 3CHXA 1QX8A 1M1KW 5KHIA 2F23A 3L73H 3CI9A 1RE3C 1YHQV 1KB9D 2UUAB 5KJ7D 3RGUA 3UO2A 1ZOYC 5LGTA 4FM2A 2Y0EA 2ZNJA 1LTJA 5APXA 3X2QB 2VQFB 2P7TC 2Y0DA 4JAVA 2OYHA 1KP3A 1FZCA 3TK1A 4WB4A 3BA9A 1FFXA 2ZT9C 5LYJA 1NU1G 3MUDA 3H32B 1Z5VA 4JI6O 2E5TA 1GD2E 1SQXE 1OZHA 3C9IA 1YJ9P 1YVWA 4PJ0E 4UCUA 1UIIA 3L71D 1NKDA 2B89A 1MMMA 3CWBJ 1I7FA 2ADPA 1OCOC 2HPCB 3QH9A 2IDBA 5CBNA 4Z1MG 1NO4A 4WY4C 3OR6C 1XMOB 4WFHA 1SQXH 4DUZO 1SQPH 4NXNB 2JVDA 4UCOA 4F6EA 4DV6O 2AW9A 1ZL8B 2B87B 5KHJA 4PJ0H 1JUNA 4DR6B 2XASA 1N2DC 3IR9A 3E22B 1HJ0A 5CCHC 5AW9B 3S1KA 3A0BE 1URQB 2EINC 5AVVB 1V54C 3SYCA 4U7NA 2HJDA 4UXNA 1RHZB 1X79B 4QGPA 3RK3D 2GTAA 2HFED 2BCCJ 2PFXA 2N1TB 1WB7A 1KQSO 1AB3A 2P4VA 1KYOF 3TDKA 2P6JA 1K34A 3E35A 1SS1A 3A0BH 1S0VA 1NAFA 2KZIA 1HF9A 1BE3J 4J11A 4Y28J 5A9GA 1M90W 2RQ6A 1RSOB 1JB0J 1NOHA 2YIBA 2PGGA 1Y74B 4PV1D 1ZL8A 1SQBG 2ZR2A 2P1JA 2DYSC 4B3SB 1IFDA 2ITDC 3ABLB 1HNZB 1M57B 3BVHA 3LDDA 3E22A 4TV9A 1MSDA 2ZVOB 5JH7A 1YYCA 1PL4A 5AW8B 4PD4D 3I56V 4DV5O 5APTA 5CB4B 1NS1A 2OTKE 2WVRA 3RFRA 5CCGA 4RKUJ 1N32O 1VQ5V 3A5TA 4TT3H 2IBZI 1A32A 1K8AQ 2Y69C 3L70D 2RMZA 2FYUE 1WP8A 3K0GA 1KB9H 3P30A 1KQLA 3ZHQA 5H9CA
chains in the Genus database with same CATH topology
3SFEC 2YMKA 2E74B 1RQVA 4IL6X 2G3AA 2ZT9D 1DIPA 3AE2C 3RK3E 3IAOA 4H13C 3O6QA 1K04A 1KORA 2K9YA 2E75B 4R4LA 2JP3A 1OW7A 2FBWC 4U7JA 1YQ4C 2D2CC 4R4MA 3G9RA 3GF7A 4PV1C 4I7ZC 1KILE 3D6YA 1IK7A 3D6ZA 3AEDC 1S5LX 1DD4A 1ZP0C 3AE1C 2YIUC 3AE7C 3D70A 2MKVA 1ZOYC 3Q5PA 2BEZF 1VF5B 2D2CB 2JO1A 3AE3C 1KQFB 2FXPA 2E76B 3Q2YA 4Z1MH 4I7ZB 3AECC 3GLMA 4H0LD 2P10A 3AE9C 1UIXA 2WSCJ 2QJKC 1WMKA 3T97B 1U57A 3Q5SA 2ZT9C 1VL2A 4KT0J 4OGQD 4YTPC 1EXIA 4H44D 3AE4C 3AEGC 1KQGB 5KKZC 2G8YA 1YQ3C 1FDIA 4H13B 4OGQC 2FYNC 2IDBA 3S9OA 1R8EA 2ZT9B 3GF3A 1FDOA 3Q1MA 1ZMEC 1KTMA 2E74D 3SFDC 4PV1B 1OW6A 3LW5J 1HJ0A 2WSFJ 2E75D 2E74C 3Q3DA 3RL0g 2V7QJ 3AEAC 4H0LC 1NGMB 1OMIA 1TU3F 1AJYA 2QIWA 2E75C 5M1BA 3AE8C 3D71A 3Q5RA 1GMJA 3AEEC 2O01J 2QSIA 4H44C 2WSEJ 3R4YA 5KLIC 4GDOA 3IN6A 1HF9A 2NZ2A 3B71A 4Y28J 1VF5D 1OW8A 2D2CD 1JB0J 1PL5A 4H0LB 2BEQD 2E76D 2WPVB 2H89C 3AE5C 4PV1D 3AE6C 1MKMA 1K05A 1S1CX 3EWKA 5L8RJ 3C8VA 3AEBC 3H25A 1VF5C 4OGQB 2E76C 4H44B 4H13D 1NYHA 2QJYC 1PV3A 3GMAA 4RKUJ 1Q90D 1KMIZ 1ZRTE 2H88C 4TT3H 3ABVC 2QJPC 4XFJA 4YXDC 2J5UA 2OQQA 1RQUA 3AEFC 1Y9BA 1DD3A 3FGAD 1EXJA 1PIXA 2WQYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF5 B;  2ZT9 B;  2D2C B;  2E74 B;  4IL6 X;  4Y28 J;  2E76 B;  1JB0 J;  4H0L B;  4I7Z B;  2WPV B;  4PV1 B;  3LW5 J;  5L8R J;  2WSC J;  2K9Y A;  3C8V A;  2E75 B;  2WSF J;  2QJK C;  4OGQ B;  4H44 B;  4KT0 J;  2QJY C;  4RKU J;  5KKZ C;  1ZRT E;  1Q90 D;  1S5L X;  2QIW A;  2QJP C;  2YIU C;  4H13 B;  2O01 J;  2FYN C;  2QSI A;  5KLI C;  2WSE J; 
#chains in the Genus database with same CATH topology
 4X20 A;  3L75 D;  1RSO A;  2Z4E A;  3K5L A;  1Y74 A;  5KLV K;  4BWN A;  1L0L K;  5DEC A;  3IAO A;  2WPS A;  1G1I A;  1WT6 A;  3CRR A;  4A5U B;  4JF3 A;  2FYU H;  1YIJ P;  2KG7 B;  2W6I G;  4NVP A;  1JQ0 A;  2EIK B;  3VQY A;  1VQM V;  2K37 A;  1K4D C;  3GF7 A;  1LP1 A;  3OAA G;  3T1H B;  1FZB A;  4FLW A;  1SQV G;  4I4T B;  5L3D A;  3CCR P;  3FB7 C;  2RCV A;  4K8X A;  2AGA A;  2RKL A;  3NMD A;  1HR0 O;  4W7Z A;  5AG2 A;  1IJD B;  1OWA A;  3RL0 D;  5IY5 B;  2OTL P;  2ZNI A;  3KXD A;  1FXK B;  1PP9 H;  2CH7 A;  5CBF A;  3W7U A;  2JS3 A;  2LXB A;  3GLM A;  3GWK C;  1JY3 N;  3LW5 H;  4WFF A;  2MW2 B;  1VDF A;  3IFX A;  2K88 A;  2V7Q G;  1N36 B;  1Y76 B;  1LUV A;  4IIJ A;  1GL2 D;  1JY2 N;  5AVW B;  5B66 Z;  3U11 A;  4OGQ D;  4YIP A;  4B3T B;  3WUT A;  4FM1 A;  1AJN A;  1YJ9 V;  5H2F Z;  2X0L A;  4RUE A;  4F6R A;  2QKA A;  3CWB D;  3L74 E;  2ZKO A;  3W67 A;  2WLI A;  2YEV A;  1O9G A;  1R8E A;  4CPG A;  3CEI A;  1U7M A;  1IX9 A;  4ZBM A;  4K3A A;  1PPJ D;  1KB9 F;  2FY8 A;  2QKS A;  2P58 A;  2KS1 A;  3L74 H;  1EZV H;  1QGK B;  1OVU A;  4K0K O;  2O1K A;  1A02 F;  2R9A A;  2BCC D;  2WAM A;  1WB8 A;  2W6J G;  1YXB A;  1W2B U;  1KZU B;  3HTK A;  3MHS C;  2W83 C;  3K79 A;  4BIO A;  3W7T A;  1QQC A;  2OGU A;  2FXO A;  4O2B A;  4O4I B;  3ZMV A;  3ZED A;  1FE6 A;  1XI1 A;  1FFT B;  1I08 A;  5D5Q A;  5FPR A;  1BE3 D;  5FL7 G;  4H44 C;  2R72 A;  3IN6 A;  3KKY A;  2DYR C;  1CSB A;  4CS3 A;  1MOF A;  3L75 H;  2Q9I A;  5JCO A;  2PZS A;  2OCC B;  3M06 A;  2XKM A;  3E89 A;  2VRZ A;  3M8A A;  1NKZ B;  1FD9 A;  1QVF U;  4TOI A;  3JAT A;  1TVK B;  2EIL C;  2UXB B;  1P84 D;  1FZF A;  5IWA O;  2RNB A;  3AG3 C;  4HJG H;  1J95 A;  3OTF A;  1KD1 W;  1HNW O;  2VQE O;  1SFC C;  1VQ6 V;  1M1J A;  2IW5 A;  3MIW A;  3RN4 A;  2B9B A;  3OUS A;  3VQX A;  2E74 B;  3AG4 C;  1E79 H;  2G3A A;  1ORQ C;  3VBB A;  4YY3 O;  4MTF A;  3WUU A;  4IL6 Z;  1NTK K;  4AYC A;  3SPG A;  1KOR A;  1M57 D;  2POH A;  1NBM G;  4ASU G;  1YEW A;  4HB1 A;  5KHG A;  4HNA A;  2HVJ C;  1T2K C;  1TVK A;  3DSQ A;  3ZCC A;  1JTH A;  3NFQ A;  1L4A B;  4I7Z C;  3CCR V;  3IFM A;  1UPG A;  3M7M X;  2LFR A;  2B88 A;  1EFR G;  3JAS B;  4IFM A;  3M0D C;  4PD4 F;  1SLQ A;  1MZF A;  2EJR A;  2OTL V;  1KP2 A;  5JJE B;  3LNN A;  2O3J A;  2EBO A;  1VQ7 P;  4Z1M H;  1W59 A;  3AEC C;  1VF6 A;  4UVA A;  5DJU B;  3AE9 C;  2BTQ A;  1P49 A;  3RVY A;  2WSS G;  2FB5 A;  1DX7 A;  3EFF K;  1Q7Y W;  5C93 A;  2QJP B;  1NTM J;  4OVN F;  5DJT B;  4EI2 A;  4KT0 J;  3BCC G;  5KLV E;  1L0L E;  3H6P A;  4DV0 O;  3AE4 C;  2BCC H;  3IGA C;  1M4U A;  1PGQ A;  2JJ2 G;  2XU6 A;  4B3M B;  1RF1 B;  4FVM A;  2CK3 G;  1BDD A;  2Q4P A;  1SA0 A;  3NR7 A;  5KLV H;  1KIL A;  3PP5 A;  1L0L H;  2FL4 A;  1QLE B;  1HP8 A;  2CGN A;  3QO8 A;  1AR1 B;  3A2A A;  4UCR A;  1VQP P;  1K9M W;  3CD6 P;  2HKO A;  3LUT B;  1NAY A;  1NZ6 A;  4IHJ B;  4FFB A;  4TV8 B;  3V2N A;  3CCQ P;  2XND G;  4I50 B;  1TA8 A;  1RY3 A;  1DF4 A;  3BRC A;  4L74 A;  5APY A;  1P84 H;  1E1R G;  1JMB A;  4JI3 B;  3ZX6 A;  2DQ3 A;  2RDC A;  1S9K E;  3H1L J;  5KHH A;  4WFE A;  1E1Q G;  4EKW A;  3SYA A;  3LDC A;  1BZK A;  4JZ2 A;  3RBX A;  2DE0 X;  1MZE A;  2IU0 A;  4JBZ A;  1S1C X;  2EZO A;  3GHG A;  3G4S V;  2OTJ P;  4TSF G;  3MZW B;  4I50 A;  2FYN B;  4KHX A;  2QJY C;  4EYY Q;  3AK1 A;  1NTZ E;  3CXH D;  2H8P D;  5APQ A;  1RM1 C;  3G6E V;  1KV4 A;  1MNG A;  3ABV C;  5E79 Z;  5APV A;  5CA0 A;  2OYO A;  1RE4 A;  5EC1 C;  1PIX A;  4TQF A;  1R3K C;  3RK3 C;  1NTZ H;  2I8D A;  4C46 A;  2QWR B;  1HGV A;  5B3S B;  4DOJ A;  1K4C C;  1HW7 A;  1ZXG A;  3AG2 C;  3ABM C;  4PA9 A;  2QG4 A;  2N9Y B;  2OYQ A;  3P7K A;  2P7J A;  3CME P;  4UCS A;  4PV1 C;  4LR3 A;  2LXC B;  3KYQ A;  2P67 A;  1XDC A;  2JGD B;  4PA7 A;  1BL8 A;  4ASV A;  3OTO B;  1USE A;  4L8J A;  4XA4 A;  4DR7 B;  3IC7 A;  1OCC B;  4CC6 A;  1P84 F;  1EZJ A;  2F95 B;  1TGO A;  1VF5 B;  1VQ7 V;  1OJH A;  1B6Q A;  3BHP A;  2JO1 A;  2YIC A;  3CMA V;  1R1B A;  4YHH O;  1MUU A;  3CX5 D;  4JQ0 D;  1AJQ A;  2HEP A;  2YO2 A;  1GRJ A;  1Q81 W;  1S5L H;  2YNY A;  4JAU A;  3D36 C;  1LTB C;  1NTK E;  1N8R Q;  1M1K Q;  3F89 A;  1EXI A;  1L4A D;  3F7V C;  1DEB A;  4WY4 D;  3E8G A;  4FIP C;  1N7S A;  1SC5 B;  5L3E A;  1K92 A;  1N33 B;  1I5X A;  1G1X B;  1VQ6 P;  1LTG C;  1VQL P;  3OFN G;  1NTK H;  2VWK A;  4KXR A;  4WBN B;  5CCH D;  2FKX A;  1L0N G;  1B3Q A;  2XHB A;  1OVR A;  1ZRT D;  1XQ8 A;  3N4X A;  5BXZ A;  2IBZ E;  3SJQ C;  1ZLL A;  4U3F G;  3RL0 C;  5IJ9 B;  1BGY J;  4I6M C;  1N34 B;  1IXB A;  1EDJ A;  4GOD A;  4UB6 Z;  3BVO A;  1NVP B;  2A06 G;  1FJG O;  1LT9 B;  1OV9 A;  3ZRX A;  3KCX A;  1HTL C;  2WLL A;  3CXH H;  2QIW A;  3H1L D;  2IBZ H;  4LF7 O;  3L73 J;  1FDM A;  1GL2 C;  5B1N A;  3K08 A;  5BMV B;  2K9J B;  4GDO A;  1IZN B;  4WBN A;  3WB2 A;  3B71 A;  1MG1 A;  3E8B A;  4IFF A;  2IH1 C;  3N2G B;  3G3Z A;  5C39 A;  3H1I G;  3HKD B;  3GG2 A;  1KUQ A;  1Q43 A;  1ENV A;  3O9O A;  5AW4 B;  3TGU D;  2V1D A;  3O6Q B;  2OTJ V;  2K3R A;  1TUB B;  3X2Q C;  3U1C A;  1L0N K;  4YJ3 B;  3CCJ P;  1MA1 A;  5BR8 O;  3JAK B;  3KHU A;  5KAF E;  4LFB O;  2LFS A;  3UM7 A;  1P7B A;  5BMV A;  3CP1 A;  5LMU O;  1COW G;  4LNU B;  1M90 Q;  4RUF A;  3OAK A;  1FAF A;  3CJH A;  4CH3 A;  1DIP A;  1GO3 F;  1J2J B;  2AEM A;  1SQX J;  1YTF B;  3BCC E;  5KAF H;  1DLB A;  1LWU A;  1IBM B;  3O6Q A;  3CX5 H;  1K04 A;  2E75 B;  1NH2 D;  1NTM H;  1LTI C;  4L76 A;  4LF4 B;  2FKW B;  1BT8 A;  4LFA B;  2Y9Y A;  4OH8 B;  2UXC O;  4JI8 B;  1Y47 A;  2HLO A;  4PI2 A;  1KIL E;  2CUG A;  1OCR B;  3MHH C;  4YJ2 B;  2UUB B;  3RK2 B;  1QR8 A;  4I55 A;  1URQ C;  1XTG B;  5J2U A;  2O01 H;  2L5G B;  3B8N A;  3K03 A;  4P2Z A;  5B1A B;  2P2U A;  3CXH F;  2FTK A;  2N1T C;  4NTY A;  3V2R A;  2Q6A A;  1JO5 A;  5EBW C;  3FYI B;  4PDR A;  2UUC B;  2VRS A;  4O4L B;  1ZR4 A;  3SPJ A;  4JF7 A;  3G6B A;  4N3Y B;  3A7O A;  1IBK O;  4JI2 O;  2NRG A;  3CE2 A;  2M5A A;  4JYA B;  3HE5 A;  3OGC C;  5KUK A;  2KKW A;  4LFC B;  3ASO B;  1FOS F;  4NR1 A;  3HUS A;  2PTM A;  3ABL C;  1M57 C;  2YXQ B;  5AVX B;  2Q7G A;  2YIA A;  3KZI Z;  1SQQ G;  3MD0 A;  1VQL V;  1S76 D;  1R6K A;  1ZX3 A;  2AXT E;  1I0H A;  2EIM B;  5HFL A;  4W7Y A;  2Q8V A;  3MDS A;  1KTM A;  2F4V B;  3B8E B;  3OEE G;  4JI7 O;  3I5D A;  5C8Y B;  4Q20 A;  1S3J A;  4U3J A;  1EM1 A;  1IUR A;  3CCL P;  2FYU J;  3JAR B;  4OWF A;  2Y9Z A;  2QM4 A;  1NJI Q;  5F2V O;  2JK5 C;  1EDL A;  3CX5 F;  4JI4 O;  3L36 A;  1WPB A;  3L73 D;  3U59 A;  4C7R A;  5CJ4 A;  4NYK A;  4J7J A;  5LMN O;  1Z56 A;  2MK3 A;  5KJ7 A;  4JI0 B;  3RYH B;  2EIK C;  5TIS Z;  3AK3 A;  4DYL A;  5AVQ B;  3VTP C;  4GUN A;  4LF5 B;  3HE4 B;  3CLQ A;  4AQY O;  3B2E E;  1LUW A;  2XDJ A;  3OR7 C;  1RH5 B;  5KA5 A;  3DC6 A;  1OW8 A;  4H37 A;  2D2C D;  2FXM A;  3WU2 E;  1YI2 V;  4H0L B;  1SQQ K;  1K05 A;  2Q5U A;  3EWK A;  4RQF A;  5BU8 B;  5IY5 C;  1VQ9 P;  1QU7 A;  2ZIM A;  1FXK C;  4KL1 A;  4C7N B;  4J7Z A;  1M9N A;  2C2A A;  1SFC D;  1S72 P;  5AW6 B;  1GN2 A;  3SWY A;  1PV3 A;  3A0R A;  2PY5 A;  2RJZ A;  3L71 G;  5B5E E;  2GBO A;  2YKP A;  4YXW G;  2JDI H;  5GTH Z;  3JCU E;  3P32 A;  4NPD A;  1AR5 A;  2OYI C;  3JD0 A;  3TET A;  1SQX D;  1SQP D;  4UB8 Z;  3E1R A;  1H2G A;  1T2K D;  3KQG A;  5EYP B;  5AW5 B;  4FLU A;  2IFM A;  4X1K A;  2GDS A;  3VQW A;  1TAE A;  4LF6 B;  3L74 J;  3BY6 A;  3JCU H;  4WWI A;  4PDL A;  4I9W A;  1FBM A;  3CCE V;  4IYH A;  1IBL B;  4D6T E;  5EZY A;  1KD1 Q;  1D5N A;  2UUA O;  2R44 A;  3H1J G;  3JAW A;  2UXD O;  3L72 E;  1L0N E;  1FS0 G;  3W7X A;  3P3N A;  2ARH A;  3RVZ A;  2H8P C;  2QE7 G;  4D6T H;  4U3F E;  1LTJ B;  1XL4 A;  1HWT C;  3K5N A;  5CMZ A;  2YC0 A;  5EYP A;  4FLV A;  3L72 H;  1ZV8 A;  2ZDI C;  2DWE C;  1YCI A;  2OYH B;  1BSN A;  3VN0 A;  2A06 E;  1FZC B;  2HHH B;  2Q7E A;  1BGY H;  5CJ0 A;  1U57 A;  5E1A C;  5KHK A;  5L3C A;  2YDE A;  3QNE A;  1FFX B;  2ZIO A;  4DJG A;  5LYJ B;  3S3X A;  4D7S A;  1S77 D;  3L70 G;  3QO5 A;  2OCC C;  2DW4 A;  5LGN A;  1N8R W;  1EDI A;  2KLV A;  4ZI7 B;  4NXN O;  4MVM A;  4PDV A;  3H1I E;  3JSL A;  1KFN A;  4AQR D;  3UT5 A;  4DR6 O;  2JEU A;  4JTA B;  3GF3 A;  5JJJ B;  4O9B A;  3Q1M A;  3TJT A;  1ZME C;  5H6R A;  2LR2 A;  3RYF B;  5KKZ B;  3H01 A;  3T4Z A;  3B5N D;  1Q7Y Q;  1AFO A;  5K1X A;  1F7Y A;  2FYU D;  2QRX A;  3A0H E;  3BRT B;  2E74 C;  2UU9 B;  1WA8 A;  2IYO A;  4RES B;  3IF4 A;  3V6I A;  4BIZ A;  2E42 A;  4PA4 A;  2P06 A;  4DV1 B;  3D71 A;  3QF7 A;  3VOU A;  4ZI7 A;  1P7G A;  2B1G A;  1CP9 A;  4NKG B;  3A0H H;  5LA6 B;  5GTI Z;  4B3S O;  1L4A C;  2PF4 E;  4DR1 B;  1HNZ O;  4FZ0 A;  4GCZ A;  1PP9 D;  4X65 B;  4R50 A;  2BEQ D;  1K9M Q;  1BCC E;  2WPV B;  3RYF A;  5APU A;  5B1O A;  2BOB C;  1JX9 A;  3OMA B;  1VQ9 V;  1JFF A;  2P4K A;  4Z2W A;  3JAL A;  3OM3 B;  1F51 A;  4TV9 B;  3TXS A;  2CAZ C;  2E5L B;  1ZSP A;  5JH7 B;  3PJS K;  3CWB G;  4CH6 A;  1ZAU A;  3R65 A;  1L8D A;  4AUW A;  1BCC H;  1KMI Z;  3FX7 A;  3CC7 P;  5GON A;  1Q5O A;  4O2A B;  2QJP C;  4CH4 A;  4QJF B;  1J1D B;  2JWD A;  1NU1 K;  5LA6 A;  5LHH A;  1J5E B;  1H2S B;  1PPJ G;  2YMK A;  1X9V A;  5JVD A;  1M8O B;  5KLV J;  5L3G A;  1L0L J;  4X20 B;  2P90 A;  3ZN0 A;  1GN3 A;  3L74 D;  1RF1 C;  3U1A A;  1EZV D;  4JPR A;  4N6J A;  3K0D A;  5APW A;  2BSK A;  2YUA A;  4ZOL A;  2FBW C;  1R5S A;  5BVZ A;  1QLE C;  2WA4 A;  1ROP A;  3H1H G;  3O8Z A;  4X1Y B;  3ZHU A;  1LP1 B;  5H2F E;  2KP8 A;  1BE3 G;  4MTX A;  4CH5 A;  3RGB A;  1JJ2 U;  1DD4 A;  4O2A A;  1AVM A;  1N7L A;  1S4X A;  2MKV A;  1RFY A;  3I5C A;  2B5U A;  1N36 O;  5AVT B;  3ETQ A;  3K9A A;  2CH7 B;  2ZE6 A;  1XBL A;  2P10 A;  4B3T O;  2PAJ A;  4DO2 A;  2CGO A;  5LL6 Y;  1GDT A;  2OIG A;  1BHB A;  4IIJ B;  2BAS A;  2IU3 A;  2K1E A;  4X1Y A;  1VL2 A;  2Q3E A;  1XHX A;  3M9Q A;  3AEG C;  1SQB K;  2BE3 A;  4PJ0 Z;  4F6R B;  3RYI B;  3W7W A;  3K04 A;  2R5B A;  1YQ3 C;  1YSC A;  1XMQ B;  2FYN C;  2WLI B;  3HB3 B;  2YEV B;  4UCT A;  2KB7 P;  4QPJ A;  1FC2 C;  1FDO A;  4WBA A;  1H2M A;  3SFD C;  1NTZ J;  4XDJ A;  4B3R B;  1KBH A;  1Q81 Q;  4E2L A;  3SGI A;  2KS1 B;  1M56 D;  2A45 G;  3S4R A;  3A0B Z;  2AZ0 A;  2FFD B;  3SJA C;  1NKN A;  3RW0 A;  3E2E A;  5B3S C;  3HD7 B;  3RYC B;  1D7M A;  2V7Q J;  4X64 O;  3CL3 D;  4UVB A;  5D5P A;  1TU3 F;  1KN7 A;  3HTK B;  1NJI W;  4DV5 B;  2JS5 A;  3RYI A;  1IVS A;  1SRY A;  4O2B B;  2N05 A;  3B40 A;  3CXC U;  2QSI A;  2XAF A;  3R4Y A;  2IJJ A;  4MVO A;  3ZHT A;  4GT1 A;  1Y4M A;  2QGN A;  1SQV K;  2DWD C;  2IM9 A;  4WFB V;  4IL6 E;  3I55 P;  1OHH G;  1NWQ A;  4CS4 A;  2B1I A;  2KSD A;  2YKQ A;  3JC2 2;  3OW2 O;  1OCC C;  3H1J E;  2N9B A;  1VF5 C;  2CTR A;  2FFD A;  4G2K A;  4GX0 A;  3SYQ A;  3JAT B;  3HD7 A;  3RYC A;  4HKZ H;  2IX7 C;  3CC7 V;  1YF2 A;  2CE4 A;  2KI7 B;  5AVZ B;  2PYJ A;  3BRV B;  2XZR A;  2JRI A;  1N73 C;  1MV8 A;  2IJK A;  1M1J B;  5KLV D;  1L0L D;  3D3Q A;  3LSS A;  1RF0 C;  1V55 B;  4JI1 O;  1NTK J;  4I0X A;  1JCC A;  1PV0 A;  2YIB D;  2DJV A;  3BAS A;  5AW2 B;  2J59 M;  3L9D A;  3ZRW B;  5KUM A;  1DEE G;  1X59 A;  2NPS B;  4N21 A;  2W27 A;  1URQ D;  2D2C C;  2ZIN A;  4LLH A;  4HNA B;  2PI5 A;  2F1M A;  1JTH B;  1QL1 A;  1GU5 A;  4GX1 A;  3HKE A;  1IK7 A;  4GX5 A;  1MFT A;  1YIT P;  1S5L X;  2N1T D;  2YIU C;  5KX5 A;  1SET A;  1J1E B;  2P22 C;  1PM9 A;  1LT9 C;  2HJF C;  4J9Z B;  2E76 B;  3P8M C;  3Q2Y A;  3E8F A;  1Z5W A;  1NU1 E;  3CYO A;  3ZBH A;  2XUM A;  1S9K D;  4JI5 B;  2BTQ B;  3ZRW A;  1YIJ V;  2Y0P A;  2NPS A;  5L3B A;  3Q5S A;  1VQO P;  1YJN P;  2L35 A;  4B3M O;  4YTP C;  3T4D A;  2KSE A;  4ICG A;  3E1I A;  4ZKI A;  3SPH A;  4K0K B;  1LGH B;  3TYY A;  2ITA A;  1U7J A;  4MVU A;  1NU1 H;  3UIA A;  4B08 A;  1FDI A;  4X66 B;  1SA0 B;  1SQG A;  2YKO A;  1FXH A;  4HH2 A;  1NTZ D;  2ZT9 B;  2K1A A;  1VQ8 P;  4ASW A;  1KIL B;  3HR0 A;  4ZMD A;  3FWN A;  4LF9 B;  2XT9 A;  1RE3 A;  3UO3 A;  3PLN A;  1AIL A;  1VQ4 P;  3GWO A;  4FFB B;  4JI3 O;  4FK5 C;  4HAM A;  1GK6 A;  3AEA C;  2DN9 A;  4B7K A;  1F4M A;  1ZUQ A;  2E75 C;  5KAI E;  1XRE A;  1UFI A;  3BCC J;  2X6C A;  4HYO A;  2O01 J;  3HKB A;  4GOF A;  4TWK A;  3JSN A;  1FJP A;  1SQB E;  4MTO A;  1OCR C;  1V54 B;  3LDE A;  3I55 V;  2HVK C;  3RK2 C;  3ABK B;  1Y67 A;  2XOK G;  3H1H E;  2H89 C;  1S5H C;  4J42 A;  3AE6 C;  1BS3 A;  3K06 A;  4TUY A;  1MSW D;  3E8H A;  2LJ2 A;  3GHG B;  1SQB H;  1P4R A;  4WCE V;  4WY4 A;  5IJ0 B;  2YXH A;  4HZ3 A;  2HP8 A;  4QNH B;  2QVA A;  3B5N C;  1EN5 A;  3GMA A;  3SWK A;  1QNM A;  1GU4 A;  2QKC A;  1XNR B;  4KFM A;  4X1I A;  2W8Z A;  5CA0 B;  3FGA D;  3LNM B;  3CRQ A;  2M6Y A;  1NTK D;  5CCH A;  1N4C A;  2A0L A;  1KEC A;  3ASO C;  3SFE C;  1VIB A;  2Y4T A;  4CS2 A;  3AE2 C;  2WA3 A;  4DUY B;  2K9Y A;  2Y69 B;  2EIM C;  1K73 W;  1SQV E;  1U97 A;  1KYO I;  3CC2 P;  2AEJ A;  5K1P A;  1WP7 A;  2Q73 A;  3OTO O;  1URF A;  4DR7 O;  5IJ0 A;  2WT7 A;  1XUQ A;  1YIT V;  4BW5 A;  3A3Y B;  3BAB A;  4R6Z A;  2IBZ D;  2E5Y A;  2WLK A;  1PKX A;  1JVM A;  5K5G B;  3AE7 C;  3FXD A;  1SQV H;  3AG1 C;  3TGU G;  3SJC C;  4W80 A;  4AI8 A;  3F5H A;  3VMY A;  3H9V A;  1EQ7 A;  2LKM A;  1AJP A;  3CRA A;  2HOD A;  2Q69 A;  1VQO V;  1OXZ A;  2WIT A;  1EBO A;  2NR5 A;  3ZHV A;  2V7Q H;  1FZA A;  1W0K G;  2GUZ A;  3NXS A;  3K57 A;  5LP6 C;  1Q82 Q;  1N7S B;  3H1K G;  4BIU A;  4KJM A;  1FYJ A;  1S5J A;  1FKA O;  1PFI A;  1W0J G;  2E74 D;  1QVG O;  5CA3 A;  1N34 O;  4I9Q A;  5CN0 A;  2R32 A;  5AW1 B;  3G71 P;  5JWP A;  2M8R A;  3KPE A;  1NTM D;  1NT2 B;  3E83 A;  2WZ7 A;  2L6L A;  4EFB A;  2GUS A;  3GVM A;  5LXT A;  2C9L Y;  2OT5 A;  3R66 A;  2V4H A;  4DR3 B;  4IGG A;  3G80 A;  1WLE A;  1BSH A;  1OCZ B;  3ZS8 C;  1AVY A;  2WLL B;  4BRY A;  2W6J H;  1K3E A;  2KZJ A;  2NNU A;  2KUB A;  3ZDM A;  4UUJ C;  4FLX A;  4DV2 B;  2QJ1 A;  4FLZ A;  5KLI C;  2AXC A;  1SQF A;  1LTS C;  1D5A A;  3MGN A;  4D6T J;  1H88 A;  3KDP B;  2M3E A;  1VQP V;  1MKM A;  3CD6 V;  3L72 J;  4DR5 B;  1L0N J;  5JQG A;  3CCQ V;  3MP7 B;  3H25 A;  1LTJ C;  5AW0 B;  2E43 A;  4PI0 A;  3N2K A;  5A2Q N;  3JD2 A;  4H44 B;  4DR2 O;  1NYH A;  3J7A U;  4U3F J;  4I5S A;  3EHB B;  5LOV A;  2OYH C;  1AI6 A;  4JTC B;  2YXR B;  1M56 C;  1FZC C;  5LBQ A;  3HRN A;  1KB9 I;  3T1C A;  3ZMU A;  4JAS A;  1KQS U;  1DD3 A;  1EXJ A;  1B04 A;  3MUD C;  1IBM O;  2OWO A;  3JD1 A;  1NR7 A;  1HVV A;  4N78 E;  3M0A A;  1RQV A;  3CJH B;  1QLE D;  3CCM P;  3USS A;  1THZ A;  4B86 A;  4LFA O;  1F4N A;  1GM8 A;  1L1F A;  3T1Y O;  1GK9 A;  4GKK B;  4JI8 O;  2Q0O C;  1LWU B;  5EK0 A;  1Q2N A;  3CC2 V;  2AHZ A;  1OW7 A;  2KOG A;  2M7W A;  2M0B A;  3H1I J;  2Z3Y A;  3ASN B;  3L73 G;  1KU9 A;  2PYL A;  4IFD K;  3AG4 B;  2B9Z A;  2ZE8 A;  4KUM A;  5EBL C;  5HFM A;  1KC8 Q;  3KZI E;  1S5L Z;  4TLF A;  4I55 B;  1GTO A;  5J2U B;  4PHZ A;  2ZR3 A;  2V4D A;  2UUC O;  3V2Q A;  3K59 A;  2ZCE A;  3HKC A;  4FLT A;  2FXP A;  1NR1 A;  5IYZ A;  2Q68 A;  4I7Z B;  4QE7 A;  3BPZ A;  2NN4 A;  1LNQ A;  4WF9 V;  4JYA O;  1IFJ A;  1FZG A;  4DK0 A;  1AQT A;  5ITZ A;  4LFC O;  4EFE A;  2KQX A;  3JCZ A;  1SFC A;  4X9Q A;  4XBF A;  4EIJ A;  1JMK C;  1JY3 O;  1LTT C;  3CME V;  3B09 A;  2M5A B;  2WSS H;  3HE5 B;  1H8H G;  4ZIB A;  1PNL A;  1JY2 O;  1BCC J;  1DGS A;  3HUS B;  2KIK A;  1H2L A;  3BCC H;  2BTO A;  3LIE A;  2F4V O;  2H7H A;  1SQX G;  4H13 B;  1SQP G;  2OIE A;  1OIP A;  3AG7 A;  1DF5 A;  1G6U A;  5CMU A;  5CCG C;  2CK3 H;  5JJN B;  1WRG A;  4DR4 B;  3ICX A;  1EZV I;  1VQN P;  3G71 V;  1QVF O;  3A8T A;  1J1D C;  2ZXW B;  4U3J B;  1XTC C;  4WVZ A;  3M9B A;  5H6Q A;  2Z5U A;  2NLJ C;  2P5O A;  1GW3 A;  3M0D A;  3M9H A;  5J9P C;  4PD4 I;  4JI0 O;  2GUV A;  1G1J A;  1AV1 A;  4LF5 O;  2Q9L A;  2XAH A;  3OD4 A;  4WFG A;  2ILM A;  2XND H;  5FPO A;  5IDJ A;  5AVU B;  1GMJ A;  1YTZ T;  5IYD O;  1Q6H A;  1GN4 A;  1N0J A;  4D6T D;  2QJK B;  1EN4 A;  2SPZ A;  3UCS C;  3CCU P;  2IJH A;  1VF5 D;  2YXY A;  3DTU B;  4B7E A;  1H0T A;  3L72 D;  4WFA V;  1L0N D;  1SQP K;  4DV7 O;  3BAT A;  1BGY D;  3UKM A;  1G2C A;  4TT3 G;  2WPQ A;  3VP8 A;  1SZT A;  2AXT H;  1VQK P;  1FAV A;  2LGW A;  1JY3 P;  5KAF Z;  3ZRS A;  4GKJ B;  4DV4 B;  4JV5 B;  2H88 C;  1JA8 A;  4X89 A;  1K5Q A;  2C0W A;  3TGU E;  4YXD C;  1YHQ P;  2UXC B;  1JY2 P;  3AEF C;  2R70 A;  4J9Y B;  4K8Z A;  1H8E G;  4LF6 O;  3OMN B;  3CCM V;  4NPE A;  1H2K A;  1Q86 Q;  2FYU G;  3L4F A;  1RM1 B;  4LF8 O;  3OA7 A;  3VOP A;  4X1K B;  1RPR A;  3TNU A;  3VQV A;  4DXW A;  1R3L C;  1IFP A;  1VP7 A;  3CCJ V;  1X0T A;  2KK7 A;  1XNQ O;  3G9R A;  3H1K E;  3RK3 B;  3SPC A;  5EZY B;  3IAY A;  2IFN A;  1QBZ A;  2ZE5 A;  3EXA A;  1NVP D;  2ADQ B;  3JAW B;  3WU2 H;  4X62 B;  3TCU A;  5CBG A;  1PL0 A;  4JYC A;  1PP9 G;  1I94 O;  1GZL A;  2WSE H;  3T2M A;  3D70 A;  1RPO A;  4GZR B;  3L35 A;  5L3F A;  1XEQ A;  3G67 A;  4L87 A;  1CEZ A;  2HHH O;  4LH6 A;  4DV3 B;  2ZM6 B;  5AVR B;  4OX9 B;  1WNS A;  5B5E H;  3PN1 A;  3DXR A;  3N27 A;  1ZWI C;  4GKG A;  4QMA A;  5IE9 A;  3OMI B;  4JI7 B;  3ZHR A;  1QR9 A;  2ATK C;  1BCC D;  1SKV A;  2QEX P;  5JCO C;  2JJL A;  3ETD A;  3WG7 B;  2GHY A;  2VQF O;  4JI4 B;  1XIL A;  2KXP B;  4Z1V A;  3H1J J;  3V5B A;  1Q82 W;  5GTI E;  3UT5 B;  3STL C;  1BMF G;  2F43 G;  3S9O A;  3L74 G;  1QHT A;  4NB5 A;  1EZV G;  4LH7 A;  2HG5 D;  4UV8 A;  2UU9 O;  4PDM A;  4AQY B;  4ZNC A;  4EOT A;  5KA6 A;  1CI6 A;  2WTY A;  1YTF D;  3P8C E;  1PGJ A;  1LJ2 A;  1M1J C;  1L0N H;  4JYB A;  4UVC A;  2YO3 A;  2E75 D;  4DV1 O;  2DOS A;  2CTP A;  1WA8 B;  1P84 I;  3I56 P;  1IZ3 A;  4BAY A;  2WLJ A;  4U3F H;  1ZTE A;  3SDL A;  1NGM B;  4DR1 O;  1Y8A A;  1XMO O;  5KTB A;  4X65 O;  3RK2 D;  1SES A;  3CCV P;  2A06 H;  5CBH A;  3RL0 B;  3L75 G;  3CCU V;  1KYO E;  1Q8I A;  2PUS A;  1LT1 A;  4MN4 C;  3D36 A;  2YI8 A;  3W7S A;  1AQ5 A;  4ZHQ B;  3AE5 C;  1J1E C;  1GKF A;  3FD9 A;  1GL2 B;  1K97 A;  3CCL V;  1JFF B;  2H3O A;  1PD3 A;  2H94 A;  3H1I H;  3JAL B;  1X22 A;  2Y0C A;  1BSM A;  4OGQ B;  1VQK V;  2PI4 A;  2E76 C;  4L73 A;  2A45 I;  3C3T A;  1MZ9 A;  4KHP B;  1VF6 C;  5B5E Z;  3ZRV A;  1US6 A;  1J5E O;  4PEL A;  1U96 A;  2JEX A;  3FAV A;  2UXN A;  2O57 A;  2QM7 A;  2F66 C;  1E79 G;  5GON B;  3JCU Z;  4NXM B;  1NU1 J;  2WMM A;  3EQ2 A;  5IYB O;  4UV9 A;  3SWF A;  4DZO A;  2UXD B;  3CRM A;  2QM8 A;  5J2T B;  1WJZ A;  4HBN A;  2CTQ A;  1HNX B;  4EB6 B;  4UCV A;  5JVD B;  1NI8 A;  4ZHQ A;  3CB2 A;  1AP6 A;  3OT7 A;  4F4L A;  1GL2 A;  3K5O A;  4ZOL B;  2BSK B;  2UXX A;  5APS A;  1KIL C;  3K3W A;  2WWW A;  1IK9 A;  3W68 A;  1CW5 A;  1R6N A;  3DC5 A;  3JD3 A;  1S72 V;  1SQP E;  2H43 A;  4P9P A;  2MJZ A;  4GOE A;  1W5C E;  3K58 A;  4GIF A;  2W6A A;  1KC8 W;  4OPA A;  3Q5P A;  1JEK A;  5J2T A;  1KQF B;  3MAQ A;  4EB6 A;  3FX0 A;  4H0L D;  2Q1K A;  1K73 Q;  3WB0 A;  3BEH A;  3T1H O;  3WMM 0;  2BCC G;  1JCH A;  4HYT B;  2ZXX A;  3K5M A;  3H32 A;  1N0N A;  3ABK C;  4JAA A;  5B66 E;  1SQB J;  1XMQ O;  1SQQ E;  2QEX V;  2AEF A;  3H1H J;  3H1J D;  1Z2G A;  1IDS A;  2CPB A;  5KLV G;  3GB7 C;  4W4K A;  1L0L G;  3GHG C;  1X4T A;  3CRC A;  3D8C A;  2HPC A;  4JI6 B;  2FYZ A;  4B3R O;  2QWO B;  1FXV A;  1WAZ A;  3SR2 C;  4CZZ A;  5B66 H;  4CBC A;  2Q3I A;  1SQQ H;  3APO A;  3QO7 A;  1DH3 A;  1Q6I A;  1QVG U;  2B87 A;  5H2F H;  4Y99 B;  2QWN B;  1RE4 C;  1KB9 E;  3A0H Z;  2ETN A;  4XE5 B;  1URQ A;  4DUZ B;  1R5L A;  4DV6 B;  2EJ7 A;  2LGQ A;  3CSX A;  3CXH I;  3KCY A;  5B1B B;  2N1T A;  2OAR A;  1FU1 A;  4FFK A;  4YIO A;  1BHA A;  3FB5 C;  1K5S A;  3CCV V;  4MTG A;  4DW1 A;  4UFZ A;  1WPX A;  3E86 A;  1AI7 A;  3ITK A;  1SQV J;  4JTD B;  2JKV A;  2NZ2 A;  3ETE A;  1R73 A;  1PL5 A;  3MHV A;  5AVS B;  3TSI A;  2LQT A;  2GA1 A;  2WSC H;  4H33 A;  2ZYG A;  3IC9 A;  3OJA B;  3UQ8 A;  3ZJZ A;  3L71 E;  1T5E A;  3C90 A;  5CB4 A;  2N04 A;  5FLX N;  1PP9 E;  2IYP A;  2G38 A;  3APQ A;  1Y66 A;  2R9I A;  1NU1 D;  5EFW B;  4O4J B;  1NTZ G;  3L71 H;  1AA0 A;  5EC2 C;  1JMM A;  1VAR A;  4MT8 A;  2N74 A;  3VMX A;  4YXW H;  1MAB G;  4J7K A;  3C1L A;  1BDC A;  4I0X B;  1N7S C;  3M91 A;  3RK3 E;  3SSU A;  3CX5 I;  1N32 B;  1E5W A;  2UXB O;  1Q86 W;  2YSU B;  1GH6 A;  2KG7 A;  4U7J A;  4YPC A;  4QPK A;  1YTZ I;  5CA1 B;  1FS0 E;  2OYI B;  1G4Y B;  4G27 B;  4I4T A;  3D6Y A;  4PA3 A;  1H89 A;  4IL6 H;  3HKE B;  4LBE C;  4GX2 A;  1EZV E;  4O4J A;  3H1J H;  2X6A A;  4J41 A;  5KX5 B;  4C7U A;  2GTS A;  1GW4 A;  4M3L A;  4JI5 O;  3E7K A;  1FXK A;  2JJ1 G;  4PD4 E;  5EBM C;  1OCZ C;  1KKD A;  4DCK A;  5BU5 A;  2X6B A;  1HR0 B;  1NTZ K;  3D3I A;  4RO2 A;  1AP5 A;  3S3W A;  3WB1 A;  2QE7 H;  2ZYD A;  1Y76 A;  3F7Y C;  5BZB A;  2YI9 A;  3GW6 A;  1UJW B;  3L70 E;  3QVN A;  1SQB D;  2LW1 A;  5CA1 A;  4PD4 H;  2OYI A;  4IYI A;  4R8C A;  2FML A;  4X66 O;  3H1H D;  3L75 E;  2YID A;  2QA4 P;  1W2E A;  1NTK G;  5CCG D;  1HUC A;  1SVF A;  5EIB D;  3L70 H;  4X64 B;  4JGS A;  4ZKP A;  2IZ0 A;  1YJW P;  4LF9 O;  1M93 A;  3LID A;  2A79 B;  2EIJ B;  4LWS B;  1RP3 B;  3ZMS A;  2VS0 A;  1OFC X;  1VEW A;  2ZJS E;  3VMA A;  3J81 N;  2F93 B;  3THO A;  3VYI A;  2VWJ A;  4CC5 A;  3G4S P;  4MW3 A;  3P3P A;  1M7L A;  4NPF X;  4QIW F;  3Q3D A;  2WPR A;  1EN6 A;  2IBZ G;  1IC2 A;  3RL0 g;  4DK1 A;  2KNC B;  2Z0A A;  1K7D A;  3F5W C;  1OMI A;  1LWU C;  2KYV A;  3G6E P;  4O4I A;  3SJB C;  2CPS A;  2ITC C;  3ABT A;  2ZDI A;  3ASN C;  1GMG A;  1SQV D;  3AEE C;  1QL2 A;  3HKB B;  2AZ2 A;  1B06 A;  1BQZ A;  4DT0 A;  4LWS A;  2ZXE B;  2W6B A;  5LGU A;  2C0X A;  1DK1 A;  3CWB E;  4JI1 B;  1T3U A;  2IPP A;  2R3S A;  1DTO A;  4TUY B;  3C8V A;  4X8A A;  3RT3 C;  1XNR O;  2HG5 C;  1OCO B;  2ZFC A;  2KNC A;  4WY4 B;  4LP8 A;  4AHC A;  4G28 B;  1Q3E A;  1BQ0 A;  1PPJ E;  1IO4 A;  3CWB H;  4MW8 A;  5E79 E;  4P30 A;  4X1I B;  5IWA B;  2R3C A;  4DUY O;  4EDF A;  3CPW O;  2CTW A;  2EIN B;  1GM9 A;  2BCC E;  1HNW B;  1LTA C;  3HUS C;  5IYC O;  3CMA P;  2VQE B;  1NTM G;  4H13 C;  1PPJ H;  2D3O W;  5KAI H;  5E79 H;  2JP3 A;  3U0Z A;  4YY3 B;  1OX3 A;  5B1A C;  1BE3 E;  4BXL A;  1L4A A;  2Z5H A;  1JOC A;  3CCS P;  3HD7 D;  2WT7 B;  2ZXW C;  3D6Z A;  1LR1 A;  3H1H H;  1IFM A;  3JAS A;  1ZP0 C;  1ZLZ A;  5LHG A;  2DYS B;  1BE3 H;  2BEZ F;  1P84 E;  3DGE A;  2RH0 A;  2HYN A;  1ZW0 A;  2ZE7 A;  4MVS A;  5KJ7 C;  4X88 A;  2IJI A;  1AI4 A;  2X7R B;  5LHI A;  1PNK A;  1H2N A;  2HOD B;  2QJK C;  3T97 B;  2KB1 A;  1FPO A;  4JZG A;  1NTM K;  3H1L G;  1AVO A;  2QA4 V;  3QG5 A;  2PRR A;  1CXZ B;  1R6T A;  2GUZ B;  5DN6 G;  2Q5Z A;  2XAG A;  4RQE A;  1RF1 A;  4DV0 B;  4QE9 A;  1YJW V;  3K9S A;  3PHL A;  4BR6 A;  1FJK A;  1OZ0 A;  4A7P A;  1OW6 A;  1NH4 A;  5BY1 A;  4DR3 O;  1H38 A;  1NVO A;  3TGU J;  2Z5I A;  4IHJ A;  4TV8 A;  1NH2 B;  2WSF J;  1QCE A;  3MTU E;  3T97 A;  1HWY A;  1YJN V;  4N78 D;  2NPS D;  3ZIA G;  5LXT B;  2RN0 A;  1N33 O;  4H0L C;  4UB6 E;  3RBZ A;  2A45 H;  3ML0 A;  4DV2 O;  1FZE A;  5TJH A;  5KAI Z;  2W90 A;  1SF9 A;  1XL6 A;  4W4L A;  3ZHS A;  4BRY B;  1K8A W;  1Y6X A;  2BOC C;  2WSE J;  2HFE C;  1G8M A;  3FFQ A;  1YDX A;  2W0X A;  1KFM A;  4DR5 O;  4KP4 A;  1VQ8 V;  1PZQ A;  3H1K J;  2EZP A;  4UB6 H;  2GV9 A;  2WPD G;  2E76 D;  3AK2 A;  4RJT A;  2JR8 A;  3CC4 P;  4N23 A;  3ZMZ A;  3BA8 A;  4D7T A;  1VQ4 V;  5JQG B;  3SYP A;  1CZQ A;  3KG2 A;  3N2K B;  2JDI G;  4MS2 A;  2ZD9 A;  3EVK A;  1JOY A;  5LOV B;  3BCC D;  4XFJ A;  3SPI A;  1S5L E;  2J5U A;  1Q6U A;  1Y9B A;  1JJO A;  2PGD A;  2PP6 A;  4GKK O;  4J80 A;  1AI5 A;  2XNX A;  2ZT9 D;  3OGI B;  4U7O A;  3V2P A;  1KIL D;  2QWQ B;  5CBO A;  3WG7 C;  3B4S A;  3C3S A;  2DQ0 A;  3LSQ A;  4K35 A;  1T6A A;  4R4L A;  3OUF A;  1N73 B;  2GM4 A;  1QEX A;  3CCS V;  1JR9 A;  2EUL A;  4L75 A;  2JGD A;  2DYR B;  3AED C;  1USD A;  4D6T G;  3AE1 C;  3OE7 G;  4MSW C;  2R9R B;  1R3I C;  1EC5 A;  2L91 A;  1O9H A;  3L72 G;  1XOU A;  2D2C B;  2DW3 A;  3HKC B;  2EIL B;  4JYY A;  1BGY G;  3CXH E;  1SER A;  5IYZ B;  2IH3 C;  2XTA A;  4LF4 O;  3AG3 B;  5ITZ B;  2YIU B;  3F5T A;  4YHH B;  2UUB O;  1SFC B;  4Q6G A;  3A2F A;  4FM0 A;  1HH0 A;  1N73 A;  3M99 B;  4ABM A;  1RF0 A;  3OEH G;  1KQG B;  5KKZ C;  2W0F C;  2QDO A;  2WLH A;  1FOS E;  3FB8 C;  2G8Y A;  2ZYA A;  2ODM A;  1KKC A;  4OGQ C;  4DR4 O;  2JWA A;  2Y4U A;  4DW0 A;  1IFI A;  5AW7 B;  3TF5 A;  4O4H B;  1YI2 P;  3STZ C;  3QWO C;  2YMY A;  2WLN A;  2JIZ G;  4XDK A;  4IOI H;  1JM0 A;  5IJ9 A;  3KZI H;  1VPC A;  1N86 A;  3FXE A;  1W2B O;  1LT9 A;  4NTX A;  3JAM N;  1X8Y A;  1AJY A;  4DR2 B;  3CX5 E;  2DMX A;  3BFR A;  1NTM E;  2Q7C A;  5TIS E;  1GN6 A;  3QTC A;  4J10 A;  2K9J A;  1FJG B;  3H1K D;  2GSM B;  2QR4 A;  4TQD A;  4MVQ A;  4LF7 B;  3N2G A;  3BAA A;  4O4H A;  3HKD A;  1SQP J;  2RN9 A;  3PH0 A;  1AR4 A;  1PNM A;  3O65 A;  5EIB C;  3CC4 V;  1H0T B;  5L8R J;  5GW7 A;  4RO0 A;  1TUB A;  3AEB C;  5TIS H;  1H8A A;  4YJ3 A;  1M5I A;  1R3J C;  1YZB A;  4DV4 O;  4JV5 O;  4GKJ O;  1BCC G;  3EFG A;  1GTW A;  1G2C B;  3T1Y B;  3CCE P;  3JAK A;  4IT5 A;  2ZVN B;  3FWL A;  1ZRT E;  2JGU A;  1GK4 A;  1HJB A;  4MVR A;  3JD4 A;  2Q6Q A;  1NHL A;  3K5B A;  1N7S D;  2LW7 A;  2LP7 A;  5BR8 B;  1IFN A;  5GTH E;  4LNU A;  3NTN A;  3Q4H B;  2KSJ A;  1SZX A;  4LFB B;  2YXL A;  2O01 N;  1QLN A;  2Y48 A;  1SQQ J;  4UB8 E;  3B5N B;  2QTO A;  1D2D A;  5LMU B;  1JNM A;  1SQX K;  3H1L E;  1PGP A;  1IXM A;  3TNU B;  2XAJ A;  4X62 O;  3OW2 U;  5GTH H;  2HR3 A;  2WLM A;  2E3C A;  1VF7 A;  3FYE B;  4AIL C;  4JPZ B;  4U3F D;  2I1K A;  4RAI A;  5AVY B;  4Y99 C;  2OCH A;  4E4E A;  5AW3 B;  4YJ2 A;  4UB8 H;  3P8C D;  4FPP A;  3H1L H;  1SS3 A;  2IZ1 A;  1ZR2 A;  2A06 D;  4DV3 O;  4GYC B;  2ZM6 O;  1I5Y A;  4NTW A;  4OX9 O;  3TXQ A;  2KLU A;  3Q4H A;  1JPX A;  2RMK B;  2QTS A;  5B1B C;  3AE3 C;  1ZN5 A;  4LC1 A;  2R5D A;  4GLX A;  4OPH A;  1A02 J;  2Q7H A;  2QJY B;  3B5N A;  1HDJ A;  4O4L A;  4P9O A;  3V4W A;  3TGU H;  1IBL O;  2Q67 A;  1UIX A;  4EEQ A;  2WSC J;  3DXR B;  2WSF H;  1ARO P;  2J58 A;  3H1I D;  1WMK A;  1KYO D;  3V4Q A;  3FB6 C;  2K9P A;  4DRX B;  4H44 D;  3AG1 B;  2Q0A A;  3FKS G;  4I2L C;  4MVZ A;  3U10 A;  3ETG A;  1IBK B;  2AHY A;  4JI2 B;  5DED A;  3IJ4 A;  4FZ1 A;  3JYC A;  1XHZ A;  3AG2 B;  3ABM B;  4XDL A;  2FFD C;  1K33 A;  2LO1 A;  1L2P A;  2Y0I A;  3L71 J;  4PA6 A;  2ZAE B;  3HD7 C;  3B8M A;  3II6 A;  3H1K H;  2CDY A;  1T8Z A;  1PP9 J;  1PGO A;  2A7W A;  3CS5 A;  4OXS A;  4PV1 B;  5C8Y A;  2I1J A;  3LW5 J;  1WN7 A;  1CI6 B;  3WFV A;  5LP6 B;  3R2P A;  3JAR A;  4DV7 B;  4ZKU A;  2FYU K;  4DRX A;  1YBK A;  2O1J A;  3WUV A;  1GM7 A;  3LSU A;  3L37 A;  5M1B A;  3AE8 C;  2A9H A;  3RYH A;  3Q5R A;  3HE4 A;  1MFZ A;  5CHX A;  3N7N A;  2AXT Z;  2C9N Y;  5LMN B;  4FMT A;  4FLY A;  1EDK A;  2YS8 A;  3PRJ A;  2XV5 A;  2JEE A;  1S2E A;  4LCU C;  1VQN V;  4RWU A;  5FNV B;  1F23 A;  4KHP O;  5LP6 A;  3VP9 A;  5KMG B;  1CPY A;  4FJC C;  1JCD A;  4C7N A;  4LF8 B;  1V55 C;  4BWA A;  4NXM O;  1VMG A;  3AEI A;  5GTI H;  5KLI B;  3B77 A;  3VMZ A;  2QSA A;  4BW9 A;  4I1L A;  3PTZ A;  1HGZ A;  2UWJ E;  3ZN1 A;  1Q90 D;  1HBW A;  1VQ5 P;  1XNQ B;  1HNX O;  2QWP B;  3FAV B;  3RWR D;  1SP4 A;  2OQQ A;  1BGY E;  1RQU A;  2NPS C;  5H5N A;  4LGD E;  4R7C A;  4H13 D;  3L70 J;  2WQY C;  3SYO A;  2M3B A;  2HLD G;  1SQQ D;  2EX3 A;  3CPW U;  4IL6 X;  1I94 B;  3WU2 Z;  1NQT A;  3JSV C;  3HPL C;  2A3Q A;  2E5L O;  5DM6 V;  3L75 J;  3L73 E;  5FNV A;  1M56 B;  1OVV A;  1GAX A;  5KMG A;  5IT9 N;  1TUE B;  3ABU A;  1V9P A;  3J80 N;  2EIJ C;  2XAQ A;  1YQ4 C;  4R4M A;  1VQM P;  1KYO H;  3ZMT A;  1T3J A;  2ZQM A;  3CHX A;  1QX8 A;  1M1K W;  5KHI A;  2F23 A;  3L73 H;  3CI9 A;  1RE3 C;  1YHQ V;  1KB9 D;  2UUA B;  5KJ7 D;  3RGU A;  3UO2 A;  1ZOY C;  5LGT A;  4FM2 A;  2Y0E A;  2ZNJ A;  1LTJ A;  5APX A;  3X2Q B;  2VQF B;  2P7T C;  2Y0D A;  4JAV A;  2OYH A;  1KP3 A;  1FZC A;  3TK1 A;  4WB4 A;  3BA9 A;  1FFX A;  2ZT9 C;  5LYJ A;  1NU1 G;  3MUD A;  3H32 B;  1Z5V A;  4JI6 O;  2E5T A;  1GD2 E;  1SQX E;  1OZH A;  3C9I A;  1YJ9 P;  1YVW A;  4PJ0 E;  4UCU A;  1UII A;  3L71 D;  1NKD A;  2B89 A;  1MMM A;  3CWB J;  1I7F A;  2ADP A;  1OCO C;  2HPC B;  3QH9 A;  2IDB A;  5CBN A;  4Z1M G;  1NO4 A;  4WY4 C;  3OR6 C;  1XMO B;  4WFH A;  1SQX H;  4DUZ O;  1SQP H;  4NXN B;  2JVD A;  4UCO A;  4F6E A;  4DV6 O;  2AW9 A;  1ZL8 B;  2B87 B;  5KHJ A;  4PJ0 H;  1JUN A;  4DR6 B;  2XAS A;  1N2D C;  3IR9 A;  3E22 B;  1HJ0 A;  5CCH C;  5AW9 B;  3S1K A;  3A0B E;  1URQ B;  2EIN C;  5AVV B;  1V54 C;  3SYC A;  4U7N A;  2HJD A;  4UXN A;  1RHZ B;  1X79 B;  4QGP A;  3RK3 D;  2GTA A;  2HFE D;  2BCC J;  2PFX A;  2N1T B;  1WB7 A;  1KQS O;  1AB3 A;  2P4V A;  1KYO F;  3TDK A;  2P6J A;  1K34 A;  3E35 A;  1SS1 A;  3A0B H;  1S0V A;  1NAF A;  2KZI A;  1HF9 A;  1BE3 J;  4J11 A;  4Y28 J;  5A9G A;  1M90 W;  2RQ6 A;  1RSO B;  1JB0 J;  1NOH A;  2YIB A;  2PGG A;  1Y74 B;  4PV1 D;  1ZL8 A;  1SQB G;  2ZR2 A;  2P1J A;  2DYS C;  4B3S B;  1IFD A;  2ITD C;  3ABL B;  1HNZ B;  1M57 B;  3BVH A;  3LDD A;  3E22 A;  4TV9 A;  1MSD A;  2ZVO B;  5JH7 A;  1YYC A;  1PL4 A;  5AW8 B;  4PD4 D;  3I56 V;  4DV5 O;  5APT A;  5CB4 B;  1NS1 A;  2OTK E;  2WVR A;  3RFR A;  5CCG A;  4RKU J;  1N32 O;  1VQ5 V;  3A5T A;  4TT3 H;  2IBZ I;  1A32 A;  1K8A Q;  2Y69 C;  3L70 D;  2RMZ A;  2FYU E;  1WP8 A;  3K0G A;  1KB9 H;  3P30 A;  1KQL A;  3ZHQ A;  5H9C A; 
#chains in the Genus database with same CATH homology
 3SFE C;  2YMK A;  2E74 B;  1RQV A;  4IL6 X;  2G3A A;  2ZT9 D;  1DIP A;  3AE2 C;  3RK3 E;  3IAO A;  4H13 C;  3O6Q A;  1K04 A;  1KOR A;  2K9Y A;  2E75 B;  4R4L A;  2JP3 A;  1OW7 A;  2FBW C;  4U7J A;  1YQ4 C;  2D2C C;  4R4M A;  3G9R A;  3GF7 A;  4PV1 C;  4I7Z C;  1KIL E;  3D6Y A;  1IK7 A;  3D6Z A;  3AED C;  1S5L X;  1DD4 A;  1ZP0 C;  3AE1 C;  2YIU C;  3AE7 C;  3D70 A;  2MKV A;  1ZOY C;  3Q5P A;  2BEZ F;  1VF5 B;  2D2C B;  2JO1 A;  3AE3 C;  1KQF B;  2FXP A;  2E76 B;  3Q2Y A;  4Z1M H;  4I7Z B;  3AEC C;  3GLM A;  4H0L D;  2P10 A;  3AE9 C;  1UIX A;  2WSC J;  2QJK C;  1WMK A;  3T97 B;  1U57 A;  3Q5S A;  2ZT9 C;  1VL2 A;  4KT0 J;  4OGQ D;  4YTP C;  1EXI A;  4H44 D;  3AE4 C;  3AEG C;  1KQG B;  5KKZ C;  2G8Y A;  1YQ3 C;  1FDI A;  4H13 B;  4OGQ C;  2FYN C;  2IDB A;  3S9O A;  1R8E A;  2ZT9 B;  3GF3 A;  1FDO A;  3Q1M A;  1ZME C;  1KTM A;  2E74 D;  3SFD C;  4PV1 B;  1OW6 A;  3LW5 J;  1HJ0 A;  2WSF J;  2E75 D;  2E74 C;  3Q3D A;  3RL0 g;  2V7Q J;  3AEA C;  4H0L C;  1NGM B;  1OMI A;  1TU3 F;  1AJY A;  2QIW A;  2E75 C;  5M1B A;  3AE8 C;  3D71 A;  3Q5R A;  1GMJ A;  3AEE C;  2O01 J;  2QSI A;  4H44 C;  2WSE J;  3R4Y A;  5KLI C;  4GDO A;  3IN6 A;  1HF9 A;  2NZ2 A;  3B71 A;  4Y28 J;  1VF5 D;  1OW8 A;  2D2C D;  1JB0 J;  1PL5 A;  4H0L B;  2BEQ D;  2E76 D;  2WPV B;  2H89 C;  3AE5 C;  4PV1 D;  3AE6 C;  1MKM A;  1K05 A;  1S1C X;  3EWK A;  5L8R J;  3C8V A;  3AEB C;  3H25 A;  1VF5 C;  4OGQ B;  2E76 C;  4H44 B;  4H13 D;  1NYH A;  2QJY C;  1PV3 A;  3GMA A;  4RKU J;  1Q90 D;  1KMI Z;  1ZRT E;  2H88 C;  4TT3 H;  3ABV C;  2QJP C;  4XFJ A;  4YXD C;  2J5U A;  2OQQ A;  1RQU A;  3AEF C;  1Y9B A;  1DD3 A;  3FGA D;  1EXJ A;  1PIX A;  2WQY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...