2D2CB

Crystal structure of cytochrome b6f complex with dbmib from m. laminosus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
137
structure length
137
Chain Sequence
LAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGAALPLDKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Cytochrome b6
publication title Intraprotein transfer of the quinone analogue inhibitor 2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone in the cytochrome b6f complex
pubmed doi rcsb
total genus 19
structure length 137
sequence length 137
chains with identical sequence O
ec nomenclature
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2d2cB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2d2cB01
2WSEJ 2QJPC 4IL6X 4Y28J 2E76B 4OGQB 4H13B 2WPVB 2WSCJ 2E74B 2QJKC 2WSFJ 5KLIC 2YIUC 4RKUJ 5KKZC 4KT0J 4I7ZB 3C8VA 3LW5J 1JB0J 5L8RJ 1Q90D 2E75B 4PV1B 2FYNC 2K9YA 4H44B 2QJYC 1S5LX 2D2CB 2QSIA 1VF5B 2QIWA 2ZT9B 2O01J 1ZRTE 4H0LB
chains in the Genus database with same CATH superfamily
2C9NY 3SJCC 3IR9A 2NPSB 3AE1C 2LJ2A 1SFCC 3K57A 3FAVA 1L0LG 3RYCA 2DW3A 2NNUA 1K73Q 4PD4I 3M9QA 3RBZA 4OH8B 2RMZA 4OPHA 2WLNA 4JI7O 1VARA 1YJNV 4IIJA 1NH4A 2RNBA 2Y0CA 3E1IA 1IXBA 1N34B 4DOJA 3X2QB 1W2BU 4X65B 2AXTH 1XILA 4X1YA 4TUYA 1J1DB 2KUBA 3W7WA 2JO1A 3GMAA 1I0HA 2QJKB 1ZRTE 4U7OA 2ZCEA 2JDIG 2Z5UA 1XL6A 5ITZA 2XHBA 1U7JA 3AE6C 2KOGA 1SQFA 4DV1B 2M6YA 3JARB 1OVRA 1RHZB 1SFCA 2IFNA 3H6PA 4B3SO 3THOA 1JR9A 4H33A 1PPJE 4Z2WA 2F23A 1S4XA 3CRAA 2KB1A 5IYCO 3KYQA 1U96A 2YEVA 4WVZA 2KNCB 1L0LJ 3AK3A 2ZM6O 2KP8A 2W0FC 1BE3H 3V2QA 1US6A 1SQVE 3H1HH 3CCMV 3CRCA 1L4AD 1Q81W 1P7GA 2XAHA 2LGWA 4KHXA 4HAMA 3B5NB 3Q5PA 3I5DA 3ZRWB 3NR7A 2WLJA 1TUEB 3E7KA 1M56B 2VRZA 3T2MA 3JCUE 4FK5C 2M8RA 4GYCB 1PPJG 2PI5A 5KLVK 5AG2A 4EI2A 5CA0B 1N73B 1LUWA 2BE3A 3AK1A 2P4VA 5KAIZ 1VPCA 1SQVG 4QMAA 2DQ0A 2XV5A 2HEPA 1NAFA 5IJ9B 3VQVA 5KJ7D 1YJ9V 4JYAB 1N34O 1XNRB 3VP9A 2D3OW 4JTCB 2ATKC 4X65O 4IFMA 1FXKC 3ZHVA 3A0HE 2RMKB 2VQEO 1BHAA 4H13B 1NH2D 3SWYA 2EBOA 3JD1A 3JAMN 2IH1C 1T6AA 5LMUB 1HTLC 4IFFA 2IU0A 2Z3YA 4JI6O 3R2PA 3SSUA 1PIXA 1SQQE 1G1IA 5B66Z 1EXJA 4G2KA 5H2FH 4FIPC 1TVKA 1EM1A 3OT7A 1LNQA 3ETDA 2JRIA 2W6AA 5D5PA 1ZTEA 3L73G 4H44D 1IJDB 2F66C 3BASA 1NKNA 4O4LA 1SQVJ 1QLED 1WA8A 1FZAA 1IVSA 3A0BH 1MSDA 4JZGA 2R5BA 1FXKA 3KCYA 4MTGA 2ZINA 4UUJC 1CPYA 2BEZF 4HB1A 4NKGB 4WFHA 3CCLV 3RK3B 1SQQG 1HJ0A 2EJRA 4LBEC 4JI3B 4KXRA 3P8CD 1GMGA 2CTPA 2V7QH 1JB0J 3G6EP 4WBNB 4ZMDA 1H0TB 1R6TA 2A3QA 3CD6P 4JGSA 3I5CA 3UM7A 1BGYD 3OUSA 4F6EA 2P1JA 4NR1A 1GTOA 1SQPH 1Z56A 4Z1VA 4DV7O 1K5SA 4O4HB 3RYHA 2HJFC 1XUQA 2POHA 5AVXB 3RK2C 4JYAO 4TV8A 1KD1W 1VQLP 3HKEB 4UB8H 2UXBB 5B5EH 3N27A 4QGPA 3AEBC 2WLMA 5IWAB 2J5UA 1NQTA 4XDLA 2W83C 1KP3A 5AVQB 3H1JH 2IDBA 4WY4C 4YPCA 3SWFA 4PDMA 2G38A 1AVMA 5JQGA 1E1QG 1GM9A 2WLLA 1AI4A 1FZBA 1S0VA 2DOSA 2OIGA 3H1KD 4PV1D 3K3WA 1LT9A 1GN3A 5AW5B 3CCJP 1BSMA 1VQ5P 1YIJP 2D2CC 2JKVA 3GHGB 2CK3H 1GK4A 2Q1KA 5KLIB 4R8CA 1P49A 3I55V 2ZIOA 1Y66A 3SPJA 1IO4A 4DW0A 2QKSA 1N7LA 1S72V 4RKUJ 3JAWA 4WY4A 1S5LH 1T2KD 3U11A 2GV9A 1DF5A 2WSFH 3H1ID 1A32A 4DR2O 3ZCCA 1XL4A 1Q5OA 1H8HG 2CTRA 1ZWIC 5LP6B 1PGOA 2H8PD 3CE2A 2A79B 4W7ZA 1IK7A 4LF7O 1LGHB 1RH5B 3E8HA 1YTZI 2AHZA 2YXQB 3RL0D 3MZWB 1HGVA 5IWAO 5LA6B 4NXMO 2IJJA 2NR5A 2P2UA 4I55B 1KB9F 3DC6A 4LCUC 2Q9LA 3AG3B 1FKAO 2QVAA 3CLQA 3P7KA 5FPRA 3M0DC 3ZHTA 1YTFB 2PZSA 4GLXA 1KKDA 1JTHB 2XNXA 3K5BA 3LUTB 4LFAO 4PD4E 5LHGA 1E79G 3NTNA 4O2BB 3H1IE 3UO2A 1IFJA 2Q73A 2AXTZ 1HNZB 1IBKO 5CBNA 2JGDA 1JUNA 3GF3A 1BGYJ 4RJTA 2AZ2A 4X1IA 4OGQC 2Y69C 5KHGA 3IF4A 4UB6H 1OCOC 1EBOA 1GN4A 3G71V 2I1KA 1YBKA 3HKDA 1F7YA 1LP1A 1FU1A 1VF5B 1SESA 1BL8A 4L87A 2KG7A 1KFMA 2Q6AA 3H1IG 5AVVB 5KJ7A 1FZCA 3CX5D 1OFCX 4TT3G 5BY1A 4GZRB 3V2NA 2RKLA 4BIUA 1KYOF 5JVDB 4GCZA 2C2AA 1AVOA 1FJPA 2P4KA 3II6A 3HD7D 3LIEA 1QR8A 1OMIA 2WLIA 5DN6G 3F5WC 3B09A 2AGAA 3TDKA 2Y9ZA 3ZHQA 1YITV 2Q7EA 1X0TA 2OTLP 1VQMV 5LHHA 1N7SD 3EXAA 4AILC 2GHYA 1PV3A 2BCCD 2YNYA 3W68A 2F1MA 4WFEA 3IAOA 2B88A 1MZFA 3F7YC 1KC8Q 5IY5C 3H1IJ 3HTKA 3A2AA 3CX5E 3WU2E 1ZX3A 2YI8A 3L74D 4XE5B 3SGIA 2DWDC 3MHSC 3MD0A 4DR5B 2DYSC 2GBOA 5B1AC 1OCRB 1AQTA 2Y0DA 2KI7B 3A5TA 2YKOA 3L70H 4DV0B 1GDTA 1VQ8P 4WFFA 2KXPB 1CW5A 2CTQA 2QIWA 1N32O 5B1BC 4YIPA 3E22A 1EZVH 1NU1D 1DF4A 2GTAA 2QJPB 3D71A 5GW7A 1BE3G 4WFGA 1R3JC 1YQ3C 2XKMA 1S76D 1YQ4C 1WAZA 4EEQA 3PJSK 4Q6GA 1D2DA 3LSUA 3FGAD 4E4EA 5FPOA 1SQXD 2YIUC 2BCCE 3TETA 2JK5C 4MVOA 1HR0B 2M5AB 4YY3O 2ITDC 5KHIA 2QWQB 3AEEC 1H2SB 1JOCA 2FY8A 1HWYA 2HVJC 4DRXA 2XASA 4LNUA 4ICGA 3FXEA 1NOHA 3AE4C 4CPGA 2WZ7A 2HFEC 3RW0A 3M9HA 4ASWA 3CCUP 1WMKA 4GDOA 1Q3EA 1NTMK 5AW0B 1EZVI 3L74E 1YHQV 1JVMA 1DGSA 5K1PA 2HODB 2N1TB 1T8ZA 2BCCG 1VQNV 2W8ZA 1GMJA 2OYIB 1GU5A 4I50A 2VRSA 5LYJB 2NPSC 3JSVC 1LTTC 1NU1E 1N36B 3M0AA 2AXCA 2QSAA 1Q82W 1BMFG 4DV2B 4LF6B 3IC9A 3OR6C 4P9PA 5CB4B 3AG7A 4RQEA 1YI2P 3BPZA 2QM7A 5AVWB 2PYLA 2Y4TA 4CH3A 2FFDB 1H2NA 4IL6H 3L74G 3RK3E 1KZUB 4PI2A 4NVPA 3E8GA 3JASA 1KB9D 1SQXK 2XAJA 1SC5B 1NTZH 5EZYB 3RVYA 3X2QC 3TSIA 5HFMA 3G9RA 1KILB 4UCVA 2QWRB 1J1DC 4HKZH 3K9SA 3CXCU 3CCSV 2QJKC 1YYCA 4UVAA 5KKZC 2L35A 1YJNP 4UVCA 3ABLB 1ZXGA 2NPSA 1VQOP 5GTIZ 1OVVA 3HE5B 1JMMA 2BCCJ 3L36A 4QNHB 2YDEA 1AI6A 3T1YB 4L75A 2JGUA 1AV1A 2UWJE 3HE4A 2NZ2A 1KTMA 4EB6B 1N4CA 1BS3A 3J7AU 4XFJA 1R5LA 1UFIA 2NLJC 4ZI7B 1L0NE 3L71H 3IN6A 4H0LB 1I94B 3B5NC 3L74J 1PV0A 3LNNA 4C46A 2FYUD 5CN0A 4O2AB 1M56C 4MW3A 3GWKC 4ZOLB 4ABMA 4E2LA 1RE4C 1Q8IA 3JARA 1W0KG 2P06A 3VOUA 3CCMP 2K9JA 1NU1J 3P32A 1OJHA 2X6AA 1PL5A 4OPAA 4PA6A 1OW8A 1N73C 2AHYA 4CS2A 4R4MA 1USDA 4UCOA 1J2JB 1B06A 4L76A 2IBZI 4AQYB 5AW3B 3Q5RA 1BCCG 3FX7A 3BCCH 1ZMEC 2L91A 3OA7A 1L0NG 1S9KD 1LTAC 3D36C 5APSA 3UKMA 1TUBA 3GLMA 1PP9D 3B5NA 2P5OA 5GONB 1QVGO 3V2PA 3S1KA 2QR4A 3SYPA 4H13C 4FM0A 4DZOA 3ZJZA 2PGGA 1I5XA 1RE4A 3WFVA 3H25A 1JY2O 4UB6Z 2FYUE 3T1YO 5CA0A 3LW5H 4MTFA 2IJIA 5L3CA 5LBQA 2IM9A 5FLXN 1VP7A 1ZLLA 4JTAB 1Q86W 4DR7O 3AEFC 5IJ9A 2A45G 4FZ1A 3OTFA 2UUAO 2E3CA 4WWIA 1L0NJ 1QNMA 1SFCD 1OV9A 3TXSA 3L75E 3MGNA 4AQRD 3R66A 2DWEC 1Y6XA 4MVSA 2QE7H 3RK3C 4KP4A 1S9KE 5KAIH 1RQUA 2FYUG 2KS1B 3LDCA 5KA6A 1N86A 1N8RW 3P3NA 5L3EA 1AI5A 3SYCA 2ITCC 1X9VA 5KTBA 1NTKD 1GRJA 1PZQA 5A2QN 2X6CA 4AQYO 1JY2N 3BAAA 3ZHUA 3CCLP 1S5JA 2CH7B 1JOYA 1LWUB 1LTJA 3IFMA 4FLYA 4U3FH 2OCCB 3L75G 2JVDA 1JCCA 2H43A 3W7UA 2RCVA 5B66H 4N23A 3M7MX 3PHLA 3EFFK 5L3FA 1WLEA 3G67A 1M90W 1RPOA 3K0GA 1IBLB 5JCOC 4CC5A 1D5AA 3O6QB 1K92A 1VQ7V 4YXDC 4WBNA 4J42A 1H0TA 2DW4A 1U7MA 2EIKB 3T1HB 1DEBA 5GTHH 3QTCA 2FYUJ 1K8AQ 1K73W 4FMTA 4JI1B 3I56V 1NH2B 1SQBE 3HKBB 1KN7A 1OW6A 2YC0A 3CS5A 4JAAA 2O57A 1NJIQ 3OR7C 1H2LA 4O4HA 3GHGC 2E76B 3KDPB 4QJFB 4UVBA 4UV9A 3HKEA 1NTKE 4LF4B 1PGPA 5KLIC 2QEXV 4Z1MH 1H89A 2ZFCA 1U97A 4JYYA 4LF8O 1Q90D 1XMQB 3E86A 5E1AC 4JZ2A 2I8DA 3SFDC 5KX5B 2YMYA 2Z4EA 2IJHA 1QU7A 3UO3A 1MV8A 4FPPA 1Y74B 1SQBG 3GW6A 3I55P 3SWKA 1WN7A 1SKVA 3G3ZA 4RO0A 1S72P 1E1RG 4TSFG 5LP6C 1J95A 2R70A 1NTKG 3ABUA 1P4RA 1AJNA 5AVZB 3GHGA 2CGNA 4QPKA 5IYZB 3ABVC 2YIAA 3OAKA 2GUVA 3LDDA 1P84I 3K08A 1ENVA 4JV5B 2LW1A 1BGYH 4BIZA 3E8FA 3AG3C 1EZJA 2DN9A 1RM1B 3F5HA 1T3JA 1W0JG 2E5TA 4K0KB 3OFNG 2G3AA 1CSBA 2SPZA 3V4WA 3AK2A 2P7JA 5C39A 5LP6A 1SQBJ 2R72A 2CAZC 4DUZB 1SERA 2WSEJ 4YTPC 3T97B 1EZVG 1QLNA 2WLHA 4MVMA 1IBMB 3PP5A 4PDVA 2PYJA 3STLC 2ITAA 3AG2B 4JYBA 1NTKJ 4OXSA 1VMGA 5LA6A 4MN4C 2LKMA 2Q69A 4I55A 5FL7G 1JY3O 3K04A 1VQKV 2KK7A 2GUZA 2Q0AA 3MP7B 3E89A 2YXLA 3H1KH 1L0LK 4P9OA 4JI5O 4L73A 2H7HA 4YJ3B 4JI8B 1HGZA 4DR1B 2Y0EA 2A06D 4LH6A 3SPHA 1VF5C 4DR4O 2ILMA 3ZRVA 3P30A 1PPJD 5APYA 1H8AA 2A7WA 1D5NA 2BSKA 1RF0C 3B71A 5LXTB 3OW2U 4OVNF 4B3RB 4O2BA 3HUSA 4X9QA 4WY4D 3OAAG 5FNVB 4WFBV 3OTOB 4W80A 2Q8VA 3G71P 1SQVD 2ZVOB 3L72E 2BOCC 4M3LA 3L35A 5E79E 4DR3B 1JFFB 3ZS8C 1EDIA 3Q4HA 3CXHD 2IJKA 5LL6Y 4LFCO 2O01N 2PRRA 4MTOA 2ZR3A 3QWOC 3E35A 4RAIA 5CBFA 2D2CD 4AHCA 4PD4F 1XREA 3ABMB 1JY3N 3ZEDA 2LQTA 1QL2A 2R5DA 3OE7G 1N33B 3CWBE 1FE6A 2YMKA 3CYOA 2B89A 5KKZB 5LGUA 2R3SA 3B40A 5EBWC 1KQSU 2IBZE 4DUZO 2Q9IA 3PH0A 1EN5A 3L72G 2A06E 3H32A 3TNUB 3N4XA 2JIZG 1YITP 5JVDA 4C7NB 4HYTB 1GN6A 3L73D 2QWPB 1H2MA 2N05A 5KHJA 1YZBA 2EIMB 2HG5C 2IH3C 1RY3A 5JJEB 5BR8B 3JATB 3JD3A 2A0LA 1OCRC 2C9LY 1K9MQ 2KIKA 4UCUA 4JI8O 3C3TA 3CWBG 4DR1O 4DV6O 2LW7A 3LNMB 1SQQD 3CXHE 2DJVA 1SQVK 4NXNB 1ZR2A 2IBZG 1K7DA 2UUBO 2QJPC 1JNMA 2A06G 2WTYA 1OIPA 2YXRB 1KORA 3L71G 2O3JA 1XBLA 2M0BA 1OCCB 1PL4A 1K97A 3AE5C 4GOFA 1NVPB 5J2TA 3D3QA 5KMGB 4GKKB 3RYIB 3L72J 2UXCB 2ZR2A 1MNGA 1MMMA 3A0HZ 3QF7A 1XI1A 3TGUE 4XDKA 1JX9A 2WPSA 1XHXA 2ZT9B 2ZYDA 2Y48A 4JF3A 1Q7YW 2H89C 3K5OA 4TQDA 1FDOA 3L73E 3H01A 2FL4A 1QBZA 3RN4A 2ZJSE 1Z2GA 5C8YB 4K8XA 1QVFU 1CI6B 3CWBJ 3BA8A 2N1TC 5CCGC 4F4LA 1X22A 3G6BA 3O65A 5B1NA 4DV1O 3NMDA 4OGQD 3BVHA 1AR1B 3CX5F 1DIPA 2OYIC 4P30A 3D70A 4D6TE 1JMBA 2K9YA 3TGUG 2RDCA 2OYOA 1SQQK 2IX7C 4BAYA 4O4JA 1WT6A 1YHQP 4I0XB 5CBOA 3OM3B 3E1RA 5BR8O 5KLVG 4TV9B 5B3SB 5B1OA 5GTHZ 3MAQA 2FFDC 2PGDA 1VQNP 4CH6A 1T3UA 3N2KB 3BHPA 1NTMH 4DT0A 4DV4B 2K1AA 2ADPA 2ZDIC 3TK1A 5IDJA 1VQPV 1KILC 2K3RA 4YHHB 2N1TA 5EK0A 1WB7A 4NPDA 2DYRB 4D6TG 4DYLA 2WMMA 4B7KA 3ABLC 3CHXA 4J9YB 2OCHA 3FX0A 1OXZA 3H1LD 1WNSA 2HLOA 3G4SV 1I7FA 1V54B 2R9AA 1PD3A 2CUGA 3HKCB 4DV5B 3CCSP 1XNRO 3SFEC 1SS1A 1GW3A 4PA7A 4BXLA 1SQXH 3L73J 5EZYA 2ZDIA 1ZAUA 5AVTB 4H0LC 4G27B 2E5LB 2FB5A 4B86A 5D5QA 4LH7A 3JD0A 5LMUO 2WPDG 4DW1A 2WSCH 1K34A 2QM8A 3W7XA 2ZE5A 1SQQJ 1H2KA 5IE9A 4D6TJ 3RVZA 4CZZA 1H8EG 1P84E 2Q3IA 1XQ8A 2ZAEB 4EB6A 1KKCA 4W4LA 4HNAB 4OX9B 5IYBO 3UQ8A 4I2LC 2GDSA 1JA8A 2E74B 1G6UA 5CJ0A 4DV4O 1SRYA 3H1LE 1Q81Q 5J2UB 1UIIA 5GTIH 2KLVA 4FVMA 1ZW0A 2QJYB 4PD4D 2UU9B 4JI3O 4JI0B 1HNXB 4YXWH 4RO2A 2E75B 3VBBA 4BIOA 1KC8W 2ZE8A 1OVUA 4MVRA 1HW7A 2JJ2G 4PDLA 1I08A 2HFED 1KB9H 1IFMA 2LO1A 1PNMA 1M1KQ 1QHTA 1YJWV 4JF7A 4IGGA 2KQXA 2CTWA 2V4DA 4DV5O 1H38A 4JAUA 2UXBO 3H1LG 1BQ0A 2N04A 4TQFA 1M5IA 2JJLA 3MTUE 1RSOA 3OGCC 1G4YB 2NPSD 1ZOYC 2DQ3A 2FYNB 3G80A 2G8YA 5GONA 2XNDH 2XAQA 5H6QA 5DJTB 2OARA 4J11A 1BDDA 4I9WA 3ABKB 4ZKUA 2YSUB 1NR7A 1FS0G 4WF9V 1ZL8A 1SA0B 4D7SA 2O01J 2VQFB 2PFXA 4U7JA 4I6MC 4OX9O 3VQXA 1ZV8A 1LWUC 2WSSH 2ARHA 1NGMB 3FXDA 3ZMVA 1O9GA 1VL2A 2OCCC 2GTSA 3U10A 1URQB 1TAEA 4J10A 3T4ZA 5L3BA 4LWSB 3H1LJ 3V6IA 3JYCA 5CMUA 4YJ2B 4JI0O 3CCRV 1HNXO 2UU9O 1KYOH 1V55B 2AEFA 2ZYGA 4P2ZA 3M0DA 1BE3D 1ZUQA 2HKOA 5EC1C 2E5YA 4N6JA 5AW9B 1GKFA 2JWDA 4RESB 2EIKC 2E42A 5EIBC 3EQ2A 1Y4MA 1PP9H 2ZNJA 3B5ND 1WP8A 3KZIH 3J81N 4PJ0H 4I4TA 1GU4A 5LOVB 5EBMC 3U1AA 2CH7A 1M56D 2E76C 5DJUB 4LLHA 5L8RJ 3UIAA 1DLBA 1VQ7P 2PUSA 1KBHA 1W2BO 1Y67A 1KD1Q 2ZNIA 2ZQMA 3ZMUA 2OT5A 3GB7C 5F2VO 4EOTA 1EXIA 1FZGA 3DXRB 1UPGA 4TUYB 1KYOI 3I56P 1RFYA 1R3KC 5L3GA 2XUMA 5ITZB 3O6QA 5JWPA 2QRXA 1A02J 2QEXP 1QCEA 3Q3DA 2HLDG 2F4VB 1TGOA 2VQFO 2B9BA 3HKBA 5EYPA 4Q20A 3ZN1A 1BE3E 1KFNA 2YEVB 1WJZA 5AW1B 3H1HE 3KCXA 1HNZO 3VQYA 3Q1MA 4H13D 2WT7B 5KA5A 1EQ7A 4GX2A 2YIBA 1QX8A 4G28B 2UUCB 3BATA 3M91A 4DR6B 1KECA 1B6QA 5JH7B 1FAFA 1K05A 1HDJA 3STZC 2DMXA 5LHIA 5TISH 1BQZA 2B5UA 2IPPA 2B9ZA 5KX5A 1RM1C 4L8JA 3S9OA 4EFEA 3U1CA 1I5YA 1Y74A 3K03A 1Y47A 3ASNB 3H1HG 4NTYA 2DE0X 4LF5B 3SPGA 1IK9A 2FYZA 1Q6HA 5APXA 3QNEA 5CCHC 2HHHB 5CBHA 3VMXA 3CPWU 3RK3D 2XAFA 3GWOA 1L1FA 3AG2C 3K79A 4L74A 4DCKA 1V9PA 3U0ZA 4MVUA 1IFNA 1M57B 2Q7CA 3A7OA 3ZX6A 2OYQA 3WUUA 1GL2B 5H2FE 3OUFA 4O4IB 2FMLA 2UXXA 2F4VO 3CI9A 1Q6UA 1VQKP 4GIFA 4DV3B 1X4TA 1BE3J 2HPCA 5CCHA 1FDMA 2RN9A 4GX5A 3H1HJ 4X1KB 3KHUA 3B8NA 4CS4A 3A0BE 1M4UA 1BCCD 2UUCO 4Y99B 1FZEA 2JS3A 1NU1K 1L0ND 4O4LB 1RF1B 1SVFA 1WA8B 1DK1A 4HBNA 3AE2C 4DR5O 1AJQA 2AEMA 4DV0O 2IW5A 3SJAC 3IC7A 4U3JA 1L0LH 1VQ6V 1EDJA 2ODMA 2R44A 4YJ3A 1MFTA 2RJZA 3OEHG 1JM0A 3ABMC 1IFDA 1R6NA 1XEQA 3WUVA 1MG1A 1HVVA 1SQPE 1ZLZA 1EN6A 2YICA 1LTSC 2A9HA 2XDJA 3QO8A 2QWOB 3B8EB 4KT0J 1K33A 4XA4A 5H9CA 1NTMG 5KAFE 4WBAA 4UB8E 2HHHO 5B5EE 1HR0O 2Z5IA 5FNVA 3RYHB 2Y4UA 2ZYAA 4FLXA 4TV8B 1YVWA 1ZSPA 4ZIBA 2JDIH 3H1JE 1JFFA 2V7QG 4ZKIA 3K06A 1N0NA 2EIMC 2W90A 1OZ0A 4FFBB 1BCCE 4QPJA 3VP8A 4TWKA 2HP8A 1SQPG 2VS0A 1W5CE 1PNLA 3A0RA 5APUA 1K8AW 1L0NK 3VMYA 1MSWD 4CS3A 1S77D 1NJIW 1LT9B 2ZE6A 1N36O 3CMEV 3AG1B 1OCCC 5JJNB 2UXNA 1FZFA 4DV2O 1YF2A 4LF6O 3H1JG 1AQ5A 1K5QA 2PP6A 2N9BA 4C7NA 1AB3A 4GKJB 4X64B 3WMM0 1S5LE 3RYFB 3K5MA 4JI2B 2XAGA 4X62B 1YTFD 1COWG 1KMIZ 4LP8A 5DECA 1PPJH 2QKAA 4LR3A 2KNCA 3L75D 1Z5VA 3BRTB 3JAWB 3JATA 2ZT9C 3F7VC 2V7QJ 2F93B 3A2FA 1LTIC 3U59A 1HUCA 1UJWB 3JSNA 3ZRWA 2QKCA 1SQVH 4BRYB 4FLWA 1BDCA 2CK3G 2XTAA 1SQPJ 2GA1A 3J80N 3D6ZA 4UXNA 4BR6A 3QH9A 1YJ9P 1GW4A 3JCUH 4U7NA 1N73A 2P6JA 1TA8A 3BRVB 2JWAA 1FJGB 2FYUK 1OHHG 1VF5D 4RUFA 1HNWB 5BU5A 1B3QA 4RWUA 3CXHF 5B3SC 1D7MA 4MT8A 1AFOA 5APTA 3D36A 3CRQA 4MTXA 3AE9C 5EC2C 1BCCJ 3MUDC 1I94O 3PRJA 4IFDK 3KZIZ 4PJ0Z 4UCRA 5BZBA 2Z0AA 1O9HA 3UT5B 4B3TB 3BVOA 3L73H 2P67A 1SQBD 1MFZA 2EZPA 3A0HH 1L4AB 2DYRC 3D3IA 4NB5A 3SYOA 5KUMA 2B87B 4GKJO 5DM6V 4GT1A 1NKDA 1SQQH 3AG4B 1YSCA 3CJHB 4UB6E 1Q82Q 4X62O 4DUYB 1VQPP 1NWQA 2LGQA 2FTKA 2M3EA 1V54C 4TV9A 2F95B 5KHHA 3ZN0A 2WSFJ 4KUMA 4NTWA 3ZMTA 3K9AA 2V1DA 1LP1B 3SYAA 2KG7B 1FZCB 1UIXA 2EULA 3G4SP 1PFIA 5CA3A 5AW2B 2HG5D 1PGJA 1ZP0C 2M3BA 3E8BA 2ZXWB 1XNQB 4XDJA 4NPFX 2LXCB 4UFZA 1CEZA 1J5EB 2EIJB 5TISZ 3TXQA 1EZVD 1FJGO 5CHXA 2LXBA 3LSSA 2YXYA 4BW9A 3ETGA 3HKCA 2YUAA 1SQBK 4X20B 1P7BA 1K4CC 3EFGA 4N3YB 4J9ZB 2E74C 3BA9A 4FZ0A 1GAXA 1GK9A 1NTKK 4N78E 3L75J 2W6JH 4H44B 2QJYC 1VIBA 1JPXA 5JCOA 2M7WA 1SQGA 2QTSA 2E75C 1QLEB 5BXZA 1BSHA 3JD2A 1NHLA 3HTKB 5CMZA 1FXHA 3ZDMA 1VQ9V 1G1JA 1IFPA 3AE8C 4C7UA 4DUYO 3SPCA 1DTOA 2OYHB 2FXOA 3L70E 1NR1A 2O01H 2N74A 4HNAA 1K9MW 3KPEA 2N1TD 1EZVE 3RFRA 2WVRA 2Q0OC 2J59M 4B3MB 4GOEA 2FYNC 4FLZA 3K58A 1IBLO 2EINB 1MUUA 2OTJV 3TCUA 4JPZB 4LC1A 1YJWP 2VWKA 3BEHA 1FYJA 2MJZA 3ABKC 1XNQO 3T1HO 4EDFA 1P84F 3JALB 3L72D 1L8DA 1RPRA 4JI1O 2Y0PA 3L70G 5K5GB 2PY5A 1SS3A 1JJ2U 1GZLA 3RGUA 2KYVA 4DRXB 3S3XA 1KILD 1OWAA 4JI7B 4LF4O 4R4LA 1M1JB 1Q86Q 2AZ0A 3F89A 2YO3A 3QG5A 2HJDA 4PV1B 1E79H 1URQC 2W0XA 3DC5A 1EFRG 2WLKA 2WITA 3CWBD 2QJ1A 1XMQO 2QSIA 1ORQC 2P58A 4FJCC 3ZBHA 3GG2A 2IBZD 1V55C 3HPLC 4A5UB 2IZ0A 4MS2A 4F6RB 3DTUB 1QQCA 4PA9A 3E83A 4PA4A 3K5NA 3CCUV 4I50B 1JTHA 5TJHA 3RK2D 3OMAB 5IYDO 2GUSA 3L71D 1Y76B 2QGNA 5E79Z 1SP4A 1HBWA 2WA4A 3AE7C 1SZXA 1IURA 4IL6E 3PN1A 4H0LD 4PD4H 2OWOA 3ZMSA 1NTZE 1WRGA 4FLVA 2ZM6B 3H1IH 1CP9A 1M7LA 1Q2NA 5BVZA 2EILB 4B3MO 2UXDB 1URQA 1S2EA 4JV5O 4TT3H 3SYQA 2ZXEB 1KILE 1A02F 4GX0A 1S1CX 4QE9A 3BCCD 3HB3B 3RL0B 1M90Q 3DSQA 3AEDC 4K0KO 2OQQA 1LR1A 1KV4A 1IXMA 1R3IC 2QDOA 3CCEV 2JEEA 1Q6IA 1OX3A 1RF0A 2CPBA 2P10A 3HE4B 1NTZG 3TGUD 2CDYA 2ZD9A 3WG7B 4B08A 1FDIA 3JSLA 5LOVA 1IBMO 4IOIH 3L71E 1SF9A 1VQMP 1R6KA 1VQOV 5KLVD 3V4QA 2Q5ZA 1N2DC 1VQ4V 3C1LA 1LUVA 2XZRA 3ETEA 2O1JA 2JEXA 3TYYA 3UCSC 3H9VA 3JCUZ 3DXRA 2KSDA 4ZBMA 2IYPA 3LDEA 1TU3F 1QL1A 2VQEB 4ZKPA 2MK3A 2W6BA 4K8ZA 4ASUG 2VWJA 4HYOA 5C93A 4FLUA 2ADQB 4AYCA 3R65A 4JI6B 4D6TD 4J7KA 4DK0A 2W6IG 2K9JB 1AJPA 1LT1A 1OZHA 2KLUA 3ASNC 3BCCE 2R9RB 3CB2A 3CMAV 2BTQB 4B3RO 1KQLA 3OTOO 2Q68A 2IYOA 1FPOA 3TF5A 4JI4B 2H94A 1Y9BA 2WT7A 2EJ7A 4DR3O 1NTZJ 3RL0g 1F4MA 1Q43A 2UXDO 3B8MA 3ZIAG 3AECC 5AW8B 1TUBB 5JH7A 3MHVA 1M57C 3CX5H 2WAMA 3WU2H 1W59A 3N2GB 1N0JA 3CC2V 1XTCC 5KLVE 2IZ1A 4IT5A 1AA0A 3QO5A 1MZEA 2FXPA 1GL2C 1CXZB 2WPRA 3HD7B 1N33O 4U3FD 3BCCG 2Q7GA 1E5WA 1G2CB 4B7EA 5LGTA 1M1KW 3USSA 3P3PA 2K9PA 2QA4V 1N7SB 1GO3F 3CCQV 4DV7B 1S5LX 2M5AA 5KUKA 3L71J 3FD9A 4UV8A 5J9PC 4Y99C 5LMNB 2BCCH 2Z5HA 1RF1C 3ML0A 4H37A 4X89A 2XT9A 3CX5I 2CPSA 1WP7A 5KAIE 5EIBD 2Q4PA 4OWFA 2WPVB 1GL2A 4NXNO 4O4IA 2WA3A 5IJ0B 5K1XA 4J41A 4LGDE 1XMOB 1W2EA 2E76D 2HODA 2YIBD 3L74H 1IDSA 3BFRA 5CCGA 2EX3A 2KB7P 1P84D 3BCCJ 1J1EB 2OYIA 5LYJA 4U3FE 5CA1B 3W7TA 1VQ6P 4JI4O 4X1KA 1F4NA 3AEIA 1WPBA 4GKKO 1FOSE 2QE7G 2UXCO 1LTJB 5CB4A 1RQVA 4J7ZA 5EFWB 5B66E 1NU1H 1JO5A 3S3WA 1RF1A 4EKWA 1DD3A 1NVOA 3TGUJ 2FFDA 2CE4A 4Y28J 1JMKC 5HFLA 5KLVJ 4IYHA 5GTHE 2N9YB 3EHBB 1KILA 3LW5J 5M1BA 4U3FG 4DR2B 1AROP 2XU6A 3V2RA 3JC22 3APQA 3CCVV 3VOPA 2PI4A 1LT9C 3JAKB 3AG1C 3HE5A 4LF7B 4LFBB 1IZNB 5LMNO 4IYIA 5KAFH 3L4FA 1OCZB 4RQFA 4NXMB 5AVYB 2RQ6A 2HVKC 3C9IA 3IFXA 4FFBA 4PA3A 4ZI7A 3CMEP 2NN4A 3O9OA 1YCIA 2ZXXA 5CCHD 1XMOO 3D8CA 4YHHO 1BCCH 5AVRB 2PF4E 4O2AA 1L0NH 4BW5A 4Z1MG 4ZHQB 2YKQA 4LFAB 4ZOLA 2KZIA 3P8CE 1XDCA 4J80A 2KSEA 3CC4V 4FM1A 4U3FJ 3KG2A 1PGQA 1OW7A 3VN0A 2W6JG 1FXVA 2YS8A 4D7TA 3GVMA 1BGYE 3RYFA 1IBKB 1HWTC 1FS0E 3BY6A 3M9BA 1DD4A 2X0LA 3RBXA 1MOFA 3FB6C 1XTGB 5APVA 1Q7YQ 2HYNA 3C8VA 2Q5UA 3M06A 3LSQA 3GF7A 2E5LO 5AW7B 1GN2A 2RN0A 4BRYA 3VTPC 1HH0A 2A45H 2BTOA 3SDLA 4PELA 1QVGU 3KKYA 2P7TC 2LFSA 4CH5A 1X59A 1L4AC 1KB9I 2F43G 5BMVB 1BHBA 4UCSA 2B1GA 4IHJB 4LFBO 1BGYG 2JP3A 2OTKE 3FWLA 1FFXB 3AG4C 2R3CA 3ICXA 3H1KE 2FYUH 3FFQA 2HR3A 2GUZB 3OD4A 3A3YB 1L2PA 1SETA 1BZKA 2OGUA 1IFIA 4CC6A 3N7NA 3CC7V 1SLQA 3ABTA 4X8AA 1BSNA 3UT5A 3S4RA 3EWKA 1HF9A 2A45I 1M93A 3FB8C 2RH0A 2W27A 1HP8A 3QVNA 5KJ7C 1FZCC 3OW2O 3L75H 2KS1A 2BSKB 1L4AA 3VMZA 3H1HD 4W4KA 3HUSB 2ZXWC 3H1KG 3P8MC 3FAVB 1R1BA 3RYCB 2B87A 1AP6A 2EIJC 4WB4A 3CJHA 4JTDB 1RP3B 1M9NA 3Q4HB 3B4SA 3OEEG 1PKXA 1LWUA 4IIJB 3RGBA 4I7ZB 5JJJB 2R9IA 4JAVA 1KU9A 2AXTE 3WB0A 3MIWA 1URFA 2KKWA 3ASOB 1NVPD 1N32B 4X1YB 4I9QA 1VEWA 2AW9A 1KQSO 4H44C 1EDLA 1QLEC 3PLNA 1PL0A 5A9GA 3T1CA 1PNKA 1SFCB 2ZT9D 3H32B 3WU2Z 4IL6X 1USEA 1GM7A 1XHZA 1WPXA 2BASA 1DH3A 4YY3B 3SPIA 3B77A 3RT3C 3H1KJ 2OYHC 2YIDA 3BABA 4JASA 1NT2B 4KL1A 1SQBH 2WSEH 4X20A 1CZQA 2Y9YA 1R8EA 1GD2E 1NBMG 4BWNA 3C3SA 2QG4A 3FYEB 3D6YA 1VQ9P 4O9BA 1NTKH 1VF6C 2EINC 2Y0IA 3M8AA 2FXMA 1K04A 1H2GA 4X66B 1NTMD 4WCEV 5AVUB 5J2TB 1JY2P 3OMNB 2Q7HA 5DEDA 1MKMA 3AE3C 2OYHA 2QWNB 2OTJP 3ZHSA 2ZVNB 1AI7A 1QEXA 1X79B 2ZKOA 5H2FZ 1M1JC 1YDXA 4K3AA 5IYZA 4ZNCA 4PV1C 1R5SA 1QVFO 1VF6A 1SQPD 1IZ3A 2X7RB 3CRRA 4TOIA 3L37A 1GH6A 3FKSG 3KXDA 3A0BZ 2FKWB 1AR4A 3JALA 3CL3D 1TVKB 3H1JD 1S3JA 4O4JB 3K0DA 3T97A 1T2KC 2K37A 4JBZA 1QR9A 1NTME 2K1EA 3CRMA 4DR6O 1M1JA 1AR5A 1F23A 3RWRD 2EILC 4DK1A 3F5TA 1FXKB 2H8PC 3MHHC 3ETQA 1FAVA 1JJOA 4CBCA 2NRGA 4UCTA 5KAFZ 3OMIB 4UB8Z 3T4DA 1EDKA 5B5EZ 3B2EE 3RL0C 1ZR4A 4AI8A 4JYCA 4F6RA 1NO4A 2JJ1G 2GSMB 4X66O 4PDRA 2P22C 1Y76A 1T5EA 4LF5O 2E74D 1MABG 1AILA 4BWAA 5LXTA 1SQPK 1S5HC 2YXHA 1FJKA 3WG7C 2LP7A 3VQWA 1SQXE 4EYYQ 4YIOA 3G6EV 1G1XB 3APOA 2E75D 1AP5A 3CD6V 3MDSA 4MVZA 3ZRXA 4QE7A 1NYHA 3CCEP 3L72H 5E79H 1VDFA 3ZMZA 1NU1G 5JQGB 1VQLV 2WQYC 1FBMA 5AW4B 3BRCA 2WLLB 3KQGA 4R7CA 1S5LZ 1VQ4P 4QIWF 2C0WA 4DV3O 2J58A 1SQXG 3CWBH 2B1IA 3TNUA 1B04A 4WFAV 2IBZH 1ZN5A 3RK2B 5BU8B 5EBLC 3EVKA 4DR7B 1NTMJ 5GTIE 2A06H 3O8ZA 1KP2A 4LF9B 2O1KA 4DO2A 2UUAB 4EIJA 3CCJV 1YIJV 2FBWC 1VQ5V 4WY4B 1XOUA 3CMAP 2LR2A 3NXSA 1FC2C 1LJ2A 1KB9E 3R4YA 4FLTA 3JD4A 1G8MA 3HD7C 2AEJA 1IX9A 4A7PA 3V5BA 3CXHH 2LFRA 1NAYA 1URQD 2BTQA 3OGIB 3K59A 3IAYA 2D2CB 1KYOD 4X88A 4HZ3A 1N7SC 3CC2P 4GODA 5KMGA 1SQXJ 4YXWG 3RYIA 1SZTA 3ITKA 3H1JJ 1KUQA 1RSOB 3IGAC 3WB1A 2WWWA 2OIEA 4DXWA 1JY3P 4GX1A 2KSJA 2WSCJ 3N2GA 3TGUH 2BEQD 2QA4P 2GM4A 3CCQP 3HD7A 5C8YA 2JS5A 1PM9A 2X6BA 1GM8A 3SR2C 4XBFA 5KLVH 1CI6A 4MW8A 1G2CA 1M8OB 3CXHI 3Q5SA 4AUWA 5AVSB 1ZL8B 1YXBA 2L5GB 1JCDA 1Y8AA 1J1EC 1N7SA 4NTXA 5H5NA 3W67A 2XNDG 4X64O 2Q6QA 4ASVA 4MVQA 1LTJC 3FB7C 2JGDB 2Q67A 4JPRA 4JI2O 1AVYA 4LF9O 3Q2YA 2P90A 4I0XA 4X1IB 4D6TH 1KYOE 4FFKA 4N78D 1LTBC 4PI0A 3VMAA 4MSWC 4JQ0D 3WUTA 4LF8B 3MUDA 3N2KA 3IJ4A 3JCZA 3HKDB 1KQFB 1R3LC 4KFMA 5IJ0A 1IC2A 1DEEG 1PP9E 4DJGA 2R32A 1Z5WA 1NZ6A 3PTZA 3KZIE 2MKVA 4PJ0E 2WSSG 1DX7A 1GK6A 3VYIA 3L70D 2IU3A 4I4TB 2H88C 5CA1A 2XOKG 1JCHA 2IFMA 4GKGA 2PAJA 1HNWO 2K88A 1YEWA 1OCZC 2Y69B 4OGQB 2JR8A 3AEAC 2WLIB 1R73A 3ZHRA 5IT9N 1OCOB 3M99B 4KHPB 4EFBA 3CCVP 5CBGA 1PP9G 4I5SA 3CSXA 4KJMA 3CEIA 3TJTA 4B3TO 1HJBA 2ZIMA 2H3OA 5H6RA 3K5LA 4HJGH 3FWNA 1FOSF 5EYPB 1M57D 3SJBC 1F51A 3JAKA 5APWA 4NPEA 2OTLV 2ETNA 1JQ0A 2I1JA 3AEGC 4PHZA 3E2EA 3FYIB 1GL2D 5TISE 4RUEA 4NYKA 3WB2A 1EN4A 5CCGD 1P84H 4C7RA 3CC4P 2Q3EA 1NI8A 4JI5B 2FKXA 3E22B 5J2UA 1NKZB 2YI9A 1PP9J 2QM4A 3ZRSA 4CH4A 4DR4B 5CJ4A 2KZJA 3FB5C 3H1LH 1FFTB 4ZHQA 2QTOA 5APQA 1U57A 1VQ8V 1L0LD 5IY5B 3CPWO 4R6ZA 4FM2A 2E43A 1J5EO 2YKPA 1NTZD 4J7JA 4W7YA 2YO2A 1K3EA 1MA1A 4K35A 3LIDA 4I1LA 2EZOA 1X8YA 1THZA 1AJYA 4LNUB 5B1AB 2DYSB 1VF7A 4KHPO 2C0XA 1ROPA 4LFCB 3HR0A 3CP1A 5B1BB 3A8TA 3SJQC 2JEUA 1MZ9A 1LTGC 1BT8A 3W7SA 4IL6Z 2ZE7A 1GTWA 3C90A 3DGEA 5KHKA 1FD9A 2BOBC 1WB8A 2PTMA 1RE3C 2V4HA 2YIUB 2HPCB 5BMVA 5LGNA 2MW2B 4GUNA 4IHJA 3HUSC 1N8RQ 4B3SB 3CC7P 1SA0A 1FFXA 4R50A 1L0LE 3CCRP 3L70J 1K4DC 1EC5A 4I7ZC 2WPQA 1ZRTD 1KQGB 4U3JB 3HRNA 1QGKB 3JASB 4TLFA 2L6LA 1NTZK 2CGOA 3L9DA 4LWSA 1NS1A 4DV6B 4N21A 3ASOC 4HH2A 4YJ2A 1YTZT 1YI2V 3NFQA 3OJAB 2UUBB 5L3DA 5AW6B 1JEKA 1H88A 3QO7A 1RE3A
chains in the Genus database with same CATH topology
2WSEJ 4IL6X 4YTPC 3T97B 4OGQB 2BEZF 3AE1C 3AEAC 2WQYC 3GF3A 1GMJA 1HJ0A 4OGQC 4OGQD 1ZOYC 1JB0J 1DIPA 2G8YA 1RQUA 3D70A 3D6ZA 2FYNC 1R8EA 1Y9BA 2K9YA 3RL0g 3D6YA 1VF5B 3AECC 3RK3E 1OW7A 1VF5C 1VF5D 2JO1A 3GMAA 2O01J 1K04A 1ZRTE 3G9RA 3AEBC 3AEGC 2FBWC 2FXPA 2J5UA 3AE6C 4U7JA 1DD4A 3AE9C 3B71A 2QJKC 2IDBA 1NGMB 3R4YA 5KKZC 1VL2A 1MKMA 3AE3C 3C8VA 4R4LA 1OMIA 3GF7A 4PV1B 2NZ2A 1S5LX 1KTMA 2D2CB 2QSIA 4YXDC 3AE2C 4PV1C 4PV1D 4XFJA 1PV3A 2D2CC 2D2CD 1U57A 3Q5PA 2JP3A 3IAOA 1OW6A 3SFEC 3IN6A 4H0LB 2YMKA 2E76B 2WPVB 2WSCJ 3AE7C 2WSFJ 5KLIC 4Z1MH 2BEQD 4H0LC 4H0LD 4RKUJ 1AJYA 4KT0J 2E76C 2E76D 5L8RJ 1EXIA 1Q90D 3Q5SA 1PL5A 1UIXA 1OW8A 3EWKA 3SFDC 1HF9A 4TT3H 1KILE 4R4MA 1ZP0C 2QIWA 1RQVA 3Q5RA 1ZMEC 3O6QA 1S1CX 3D71A 1IK7A 1DD3A 3AEDC 3Q2YA 2OQQA 1YQ3C 3Q3DA 1YQ4C 2QJPC 3GLMA 4Y28J 4H13B 2E74B 3FGAD 2YIUC 2P10A 1KORA 4H13C 1PIXA 4H13D 3Q1MA 4I7ZB 2E74C 3ABVC 2E74D 3LW5J 1FDIA 5M1BA 3AE5C 1KQFB 3AEEC 1EXJA 2E75B 4I7ZC 3H25A 1K05A 2MKVA 1KQGB 4H44B 2QJYC 3AE4C 2E75C 2E75D 4H44C 4H44D 2ZT9B 1WMKA 4GDOA 2H88C 1KMIZ 2G3AA 1NYHA 2H89C 3S9OA 1TU3F 3AEFC 1FDOA 2ZT9C 2ZT9D 3AE8C 2V7QJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSE J;  2QJP C;  4IL6 X;  4Y28 J;  2E76 B;  4OGQ B;  4H13 B;  2WPV B;  2WSC J;  2E74 B;  2QJK C;  2WSF J;  5KLI C;  2YIU C;  4RKU J;  5KKZ C;  4KT0 J;  4I7Z B;  3C8V A;  3LW5 J;  1JB0 J;  5L8R J;  1Q90 D;  2E75 B;  4PV1 B;  2FYN C;  2K9Y A;  4H44 B;  2QJY C;  1S5L X;  2D2C B;  2QSI A;  1VF5 B;  2QIW A;  2ZT9 B;  2O01 J;  1ZRT E;  4H0L B; 
#chains in the Genus database with same CATH topology
 2C9N Y;  3SJC C;  3IR9 A;  2NPS B;  3AE1 C;  2LJ2 A;  1SFC C;  3K57 A;  3FAV A;  1L0L G;  3RYC A;  2DW3 A;  2NNU A;  1K73 Q;  4PD4 I;  3M9Q A;  3RBZ A;  4OH8 B;  2RMZ A;  4OPH A;  2WLN A;  4JI7 O;  1VAR A;  1YJN V;  4IIJ A;  1NH4 A;  2RNB A;  2Y0C A;  3E1I A;  1IXB A;  1N34 B;  4DOJ A;  3X2Q B;  1W2B U;  4X65 B;  2AXT H;  1XIL A;  4X1Y A;  4TUY A;  1J1D B;  2KUB A;  3W7W A;  2JO1 A;  3GMA A;  1I0H A;  2QJK B;  1ZRT E;  4U7O A;  2ZCE A;  2JDI G;  2Z5U A;  1XL6 A;  5ITZ A;  2XHB A;  1U7J A;  3AE6 C;  2KOG A;  1SQF A;  4DV1 B;  2M6Y A;  3JAR B;  1OVR A;  1RHZ B;  1SFC A;  2IFN A;  3H6P A;  4B3S O;  3THO A;  1JR9 A;  4H33 A;  1PPJ E;  4Z2W A;  2F23 A;  1S4X A;  3CRA A;  2KB1 A;  5IYC O;  3KYQ A;  1U96 A;  2YEV A;  4WVZ A;  2KNC B;  1L0L J;  3AK3 A;  2ZM6 O;  2KP8 A;  2W0F C;  1BE3 H;  3V2Q A;  1US6 A;  1SQV E;  3H1H H;  3CCM V;  3CRC A;  1L4A D;  1Q81 W;  1P7G A;  2XAH A;  2LGW A;  4KHX A;  4HAM A;  3B5N B;  3Q5P A;  3I5D A;  3ZRW B;  3NR7 A;  2WLJ A;  1TUE B;  3E7K A;  1M56 B;  2VRZ A;  3T2M A;  3JCU E;  4FK5 C;  2M8R A;  4GYC B;  1PPJ G;  2PI5 A;  5KLV K;  5AG2 A;  4EI2 A;  5CA0 B;  1N73 B;  1LUW A;  2BE3 A;  3AK1 A;  2P4V A;  5KAI Z;  1VPC A;  1SQV G;  4QMA A;  2DQ0 A;  2XV5 A;  2HEP A;  1NAF A;  5IJ9 B;  3VQV A;  5KJ7 D;  1YJ9 V;  4JYA B;  1N34 O;  1XNR B;  3VP9 A;  2D3O W;  4JTC B;  2ATK C;  4X65 O;  4IFM A;  1FXK C;  3ZHV A;  3A0H E;  2RMK B;  2VQE O;  1BHA A;  4H13 B;  1NH2 D;  3SWY A;  2EBO A;  3JD1 A;  3JAM N;  2IH1 C;  1T6A A;  5LMU B;  1HTL C;  4IFF A;  2IU0 A;  2Z3Y A;  4JI6 O;  3R2P A;  3SSU A;  1PIX A;  1SQQ E;  1G1I A;  5B66 Z;  1EXJ A;  4G2K A;  5H2F H;  4FIP C;  1TVK A;  1EM1 A;  3OT7 A;  1LNQ A;  3ETD A;  2JRI A;  2W6A A;  5D5P A;  1ZTE A;  3L73 G;  4H44 D;  1IJD B;  2F66 C;  3BAS A;  1NKN A;  4O4L A;  1SQV J;  1QLE D;  1WA8 A;  1FZA A;  1IVS A;  3A0B H;  1MSD A;  4JZG A;  2R5B A;  1FXK A;  3KCY A;  4MTG A;  2ZIN A;  4UUJ C;  1CPY A;  2BEZ F;  4HB1 A;  4NKG B;  4WFH A;  3CCL V;  3RK3 B;  1SQQ G;  1HJ0 A;  2EJR A;  4LBE C;  4JI3 B;  4KXR A;  3P8C D;  1GMG A;  2CTP A;  2V7Q H;  1JB0 J;  3G6E P;  4WBN B;  4ZMD A;  1H0T B;  1R6T A;  2A3Q A;  3CD6 P;  4JGS A;  3I5C A;  3UM7 A;  1BGY D;  3OUS A;  4F6E A;  2P1J A;  4NR1 A;  1GTO A;  1SQP H;  1Z56 A;  4Z1V A;  4DV7 O;  1K5S A;  4O4H B;  3RYH A;  2HJF C;  1XUQ A;  2POH A;  5AVX B;  3RK2 C;  4JYA O;  4TV8 A;  1KD1 W;  1VQL P;  3HKE B;  4UB8 H;  2UXB B;  5B5E H;  3N27 A;  4QGP A;  3AEB C;  2WLM A;  5IWA B;  2J5U A;  1NQT A;  4XDL A;  2W83 C;  1KP3 A;  5AVQ B;  3H1J H;  2IDB A;  4WY4 C;  4YPC A;  3SWF A;  4PDM A;  2G38 A;  1AVM A;  5JQG A;  1E1Q G;  1GM9 A;  2WLL A;  1AI4 A;  1FZB A;  1S0V A;  2DOS A;  2OIG A;  3H1K D;  4PV1 D;  3K3W A;  1LT9 A;  1GN3 A;  5AW5 B;  3CCJ P;  1BSM A;  1VQ5 P;  1YIJ P;  2D2C C;  2JKV A;  3GHG B;  2CK3 H;  1GK4 A;  2Q1K A;  5KLI B;  4R8C A;  1P49 A;  3I55 V;  2ZIO A;  1Y66 A;  3SPJ A;  1IO4 A;  4DW0 A;  2QKS A;  1N7L A;  1S72 V;  4RKU J;  3JAW A;  4WY4 A;  1S5L H;  1T2K D;  3U11 A;  2GV9 A;  1DF5 A;  2WSF H;  3H1I D;  1A32 A;  4DR2 O;  3ZCC A;  1XL4 A;  1Q5O A;  1H8H G;  2CTR A;  1ZWI C;  5LP6 B;  1PGO A;  2H8P D;  3CE2 A;  2A79 B;  4W7Z A;  1IK7 A;  4LF7 O;  1LGH B;  1RH5 B;  3E8H A;  1YTZ I;  2AHZ A;  2YXQ B;  3RL0 D;  3MZW B;  1HGV A;  5IWA O;  5LA6 B;  4NXM O;  2IJJ A;  2NR5 A;  2P2U A;  4I55 B;  1KB9 F;  3DC6 A;  4LCU C;  2Q9L A;  3AG3 B;  1FKA O;  2QVA A;  3CLQ A;  3P7K A;  5FPR A;  3M0D C;  3ZHT A;  1YTF B;  2PZS A;  4GLX A;  1KKD A;  1JTH B;  2XNX A;  3K5B A;  3LUT B;  4LFA O;  4PD4 E;  5LHG A;  1E79 G;  3NTN A;  4O2B B;  3H1I E;  3UO2 A;  1IFJ A;  2Q73 A;  2AXT Z;  1HNZ B;  1IBK O;  5CBN A;  2JGD A;  1JUN A;  3GF3 A;  1BGY J;  4RJT A;  2AZ2 A;  4X1I A;  4OGQ C;  2Y69 C;  5KHG A;  3IF4 A;  4UB6 H;  1OCO C;  1EBO A;  1GN4 A;  3G71 V;  2I1K A;  1YBK A;  3HKD A;  1F7Y A;  1LP1 A;  1FU1 A;  1VF5 B;  1SES A;  1BL8 A;  4L87 A;  2KG7 A;  1KFM A;  2Q6A A;  3H1I G;  5AVV B;  5KJ7 A;  1FZC A;  3CX5 D;  1OFC X;  4TT3 G;  5BY1 A;  4GZR B;  3V2N A;  2RKL A;  4BIU A;  1KYO F;  5JVD B;  4GCZ A;  2C2A A;  1AVO A;  1FJP A;  2P4K A;  3II6 A;  3HD7 D;  3LIE A;  1QR8 A;  1OMI A;  2WLI A;  5DN6 G;  3F5W C;  3B09 A;  2AGA A;  3TDK A;  2Y9Z A;  3ZHQ A;  1YIT V;  2Q7E A;  1X0T A;  2OTL P;  1VQM V;  5LHH A;  1N7S D;  3EXA A;  4AIL C;  2GHY A;  1PV3 A;  2BCC D;  2YNY A;  3W68 A;  2F1M A;  4WFE A;  3IAO A;  2B88 A;  1MZF A;  3F7Y C;  1KC8 Q;  5IY5 C;  3H1I J;  3HTK A;  3A2A A;  3CX5 E;  3WU2 E;  1ZX3 A;  2YI8 A;  3L74 D;  4XE5 B;  3SGI A;  2DWD C;  3MHS C;  3MD0 A;  4DR5 B;  2DYS C;  2GBO A;  5B1A C;  1OCR B;  1AQT A;  2Y0D A;  2KI7 B;  3A5T A;  2YKO A;  3L70 H;  4DV0 B;  1GDT A;  1VQ8 P;  4WFF A;  2KXP B;  1CW5 A;  2CTQ A;  2QIW A;  1N32 O;  5B1B C;  4YIP A;  3E22 A;  1EZV H;  1NU1 D;  1DF4 A;  2GTA A;  2QJP B;  3D71 A;  5GW7 A;  1BE3 G;  4WFG A;  1R3J C;  1YQ3 C;  2XKM A;  1S76 D;  1YQ4 C;  1WAZ A;  4EEQ A;  3PJS K;  4Q6G A;  1D2D A;  3LSU A;  3FGA D;  4E4E A;  5FPO A;  1SQX D;  2YIU C;  2BCC E;  3TET A;  2JK5 C;  4MVO A;  1HR0 B;  2M5A B;  4YY3 O;  2ITD C;  5KHI A;  2QWQ B;  3AEE C;  1H2S B;  1JOC A;  2FY8 A;  1HWY A;  2HVJ C;  4DRX A;  2XAS A;  4LNU A;  4ICG A;  3FXE A;  1NOH A;  3AE4 C;  4CPG A;  2WZ7 A;  2HFE C;  3RW0 A;  3M9H A;  4ASW A;  3CCU P;  1WMK A;  4GDO A;  1Q3E A;  1NTM K;  5AW0 B;  1EZV I;  3L74 E;  1YHQ V;  1JVM A;  1DGS A;  5K1P A;  2HOD B;  2N1T B;  1T8Z A;  2BCC G;  1VQN V;  2W8Z A;  1GMJ A;  2OYI B;  1GU5 A;  4I50 A;  2VRS A;  5LYJ B;  2NPS C;  3JSV C;  1LTT C;  1NU1 E;  1N36 B;  3M0A A;  2AXC A;  2QSA A;  1Q82 W;  1BMF G;  4DV2 B;  4LF6 B;  3IC9 A;  3OR6 C;  4P9P A;  5CB4 B;  3AG7 A;  4RQE A;  1YI2 P;  3BPZ A;  2QM7 A;  5AVW B;  2PYL A;  2Y4T A;  4CH3 A;  2FFD B;  1H2N A;  4IL6 H;  3L74 G;  3RK3 E;  1KZU B;  4PI2 A;  4NVP A;  3E8G A;  3JAS A;  1KB9 D;  1SQX K;  2XAJ A;  1SC5 B;  1NTZ H;  5EZY B;  3RVY A;  3X2Q C;  3TSI A;  5HFM A;  3G9R A;  1KIL B;  4UCV A;  2QWR B;  1J1D C;  4HKZ H;  3K9S A;  3CXC U;  3CCS V;  2QJK C;  1YYC A;  4UVA A;  5KKZ C;  2L35 A;  1YJN P;  4UVC A;  3ABL B;  1ZXG A;  2NPS A;  1VQO P;  5GTI Z;  1OVV A;  3HE5 B;  1JMM A;  2BCC J;  3L36 A;  4QNH B;  2YDE A;  1AI6 A;  3T1Y B;  4L75 A;  2JGU A;  1AV1 A;  2UWJ E;  3HE4 A;  2NZ2 A;  1KTM A;  4EB6 B;  1N4C A;  1BS3 A;  3J7A U;  4XFJ A;  1R5L A;  1UFI A;  2NLJ C;  4ZI7 B;  1L0N E;  3L71 H;  3IN6 A;  4H0L B;  1I94 B;  3B5N C;  3L74 J;  1PV0 A;  3LNN A;  4C46 A;  2FYU D;  5CN0 A;  4O2A B;  1M56 C;  4MW3 A;  3GWK C;  4ZOL B;  4ABM A;  4E2L A;  1RE4 C;  1Q8I A;  3JAR A;  1W0K G;  2P06 A;  3VOU A;  3CCM P;  2K9J A;  1NU1 J;  3P32 A;  1OJH A;  2X6A A;  1PL5 A;  4OPA A;  4PA6 A;  1OW8 A;  1N73 C;  2AHY A;  4CS2 A;  4R4M A;  1USD A;  4UCO A;  1J2J B;  1B06 A;  4L76 A;  2IBZ I;  4AQY B;  5AW3 B;  3Q5R A;  1BCC G;  3FX7 A;  3BCC H;  1ZME C;  2L91 A;  3OA7 A;  1L0N G;  1S9K D;  1LTA C;  3D36 C;  5APS A;  3UKM A;  1TUB A;  3GLM A;  1PP9 D;  3B5N A;  2P5O A;  5GON B;  1QVG O;  3V2P A;  3S1K A;  2QR4 A;  3SYP A;  4H13 C;  4FM0 A;  4DZO A;  3ZJZ A;  2PGG A;  1I5X A;  1RE4 A;  3WFV A;  3H25 A;  1JY2 O;  4UB6 Z;  2FYU E;  3T1Y O;  5CA0 A;  3LW5 H;  4MTF A;  2IJI A;  5L3C A;  5LBQ A;  2IM9 A;  5FLX N;  1VP7 A;  1ZLL A;  4JTA B;  1Q86 W;  4DR7 O;  3AEF C;  5IJ9 A;  2A45 G;  4FZ1 A;  3OTF A;  2UUA O;  2E3C A;  4WWI A;  1L0N J;  1QNM A;  1SFC D;  1OV9 A;  3TXS A;  3L75 E;  3MGN A;  4AQR D;  3R66 A;  2DWE C;  1Y6X A;  4MVS A;  2QE7 H;  3RK3 C;  4KP4 A;  1S9K E;  5KAI H;  1RQU A;  2FYU G;  2KS1 B;  3LDC A;  5KA6 A;  1N86 A;  1N8R W;  3P3N A;  5L3E A;  1AI5 A;  3SYC A;  2ITC C;  1X9V A;  5KTB A;  1NTK D;  1GRJ A;  1PZQ A;  5A2Q N;  2X6C A;  4AQY O;  1JY2 N;  3BAA A;  3ZHU A;  3CCL P;  1S5J A;  2CH7 B;  1JOY A;  1LWU B;  1LTJ A;  3IFM A;  4FLY A;  4U3F H;  2OCC B;  3L75 G;  2JVD A;  1JCC A;  2H43 A;  3W7U A;  2RCV A;  5B66 H;  4N23 A;  3M7M X;  3PHL A;  3EFF K;  5L3F A;  1WLE A;  3G67 A;  1M90 W;  1RPO A;  3K0G A;  1IBL B;  5JCO C;  4CC5 A;  1D5A A;  3O6Q B;  1K92 A;  1VQ7 V;  4YXD C;  4WBN A;  4J42 A;  1H0T A;  2DW4 A;  1U7M A;  2EIK B;  3T1H B;  1DEB A;  5GTH H;  3QTC A;  2FYU J;  1K8A Q;  1K73 W;  4FMT A;  4JI1 B;  3I56 V;  1NH2 B;  1SQB E;  3HKB B;  1KN7 A;  1OW6 A;  2YC0 A;  3CS5 A;  4JAA A;  2O57 A;  1NJI Q;  3OR7 C;  1H2L A;  4O4H A;  3GHG C;  2E76 B;  3KDP B;  4QJF B;  4UVB A;  4UV9 A;  3HKE A;  1NTK E;  4LF4 B;  1PGP A;  5KLI C;  2QEX V;  4Z1M H;  1H89 A;  2ZFC A;  1U97 A;  4JYY A;  4LF8 O;  1Q90 D;  1XMQ B;  3E86 A;  5E1A C;  4JZ2 A;  2I8D A;  3SFD C;  5KX5 B;  2YMY A;  2Z4E A;  2IJH A;  1QU7 A;  3UO3 A;  1MV8 A;  4FPP A;  1Y74 B;  1SQB G;  3GW6 A;  3I55 P;  3SWK A;  1WN7 A;  1SKV A;  3G3Z A;  4RO0 A;  1S72 P;  1E1R G;  4TSF G;  5LP6 C;  1J95 A;  2R70 A;  1NTK G;  3ABU A;  1P4R A;  1AJN A;  5AVZ B;  3GHG A;  2CGN A;  4QPK A;  5IYZ B;  3ABV C;  2YIA A;  3OAK A;  2GUV A;  3LDD A;  1P84 I;  3K08 A;  1ENV A;  4JV5 B;  2LW1 A;  1BGY H;  4BIZ A;  3E8F A;  3AG3 C;  1EZJ A;  2DN9 A;  1RM1 B;  3F5H A;  1T3J A;  1W0J G;  2E5T A;  4K0K B;  3OFN G;  2G3A A;  1CSB A;  2SPZ A;  3V4W A;  3AK2 A;  2P7J A;  5C39 A;  5LP6 A;  1SQB J;  2R72 A;  2CAZ C;  4DUZ B;  1SER A;  2WSE J;  4YTP C;  3T97 B;  1EZV G;  1QLN A;  2WLH A;  4MVM A;  1IBM B;  3PP5 A;  4PDV A;  2PYJ A;  3STL C;  2ITA A;  3AG2 B;  4JYB A;  1NTK J;  4OXS A;  1VMG A;  5LA6 A;  4MN4 C;  2LKM A;  2Q69 A;  4I55 A;  5FL7 G;  1JY3 O;  3K04 A;  1VQK V;  2KK7 A;  2GUZ A;  2Q0A A;  3MP7 B;  3E89 A;  2YXL A;  3H1K H;  1L0L K;  4P9O A;  4JI5 O;  4L73 A;  2H7H A;  4YJ3 B;  4JI8 B;  1HGZ A;  4DR1 B;  2Y0E A;  2A06 D;  4LH6 A;  3SPH A;  1VF5 C;  4DR4 O;  2ILM A;  3ZRV A;  3P30 A;  1PPJ D;  5APY A;  1H8A A;  2A7W A;  1D5N A;  2BSK A;  1RF0 C;  3B71 A;  5LXT B;  3OW2 U;  4OVN F;  4B3R B;  4O2B A;  3HUS A;  4X9Q A;  4WY4 D;  3OAA G;  5FNV B;  4WFB V;  3OTO B;  4W80 A;  2Q8V A;  3G71 P;  1SQV D;  2ZVO B;  3L72 E;  2BOC C;  4M3L A;  3L35 A;  5E79 E;  4DR3 B;  1JFF B;  3ZS8 C;  1EDI A;  3Q4H A;  3CXH D;  2IJK A;  5LL6 Y;  4LFC O;  2O01 N;  2PRR A;  4MTO A;  2ZR3 A;  3QWO C;  3E35 A;  4RAI A;  5CBF A;  2D2C D;  4AHC A;  4PD4 F;  1XRE A;  3ABM B;  1JY3 N;  3ZED A;  2LQT A;  1QL2 A;  2R5D A;  3OE7 G;  1N33 B;  3CWB E;  1FE6 A;  2YMK A;  3CYO A;  2B89 A;  5KKZ B;  5LGU A;  2R3S A;  3B40 A;  5EBW C;  1KQS U;  2IBZ E;  4DUZ O;  2Q9I A;  3PH0 A;  1EN5 A;  3L72 G;  2A06 E;  3H32 A;  3TNU B;  3N4X A;  2JIZ G;  1YIT P;  5JVD A;  4C7N B;  4HYT B;  1GN6 A;  3L73 D;  2QWP B;  1H2M A;  2N05 A;  5KHJ A;  1YZB A;  2EIM B;  2HG5 C;  2IH3 C;  1RY3 A;  5JJE B;  5BR8 B;  3JAT B;  3JD3 A;  2A0L A;  1OCR C;  2C9L Y;  1K9M Q;  2KIK A;  4UCU A;  4JI8 O;  3C3T A;  3CWB G;  4DR1 O;  4DV6 O;  2LW7 A;  3LNM B;  1SQQ D;  3CXH E;  2DJV A;  1SQV K;  4NXN B;  1ZR2 A;  2IBZ G;  1K7D A;  2UUB O;  2QJP C;  1JNM A;  2A06 G;  2WTY A;  1OIP A;  2YXR B;  1KOR A;  3L71 G;  2O3J A;  1XBL A;  2M0B A;  1OCC B;  1PL4 A;  1K97 A;  3AE5 C;  4GOF A;  1NVP B;  5J2T A;  3D3Q A;  5KMG B;  4GKK B;  3RYI B;  3L72 J;  2UXC B;  2ZR2 A;  1MNG A;  1MMM A;  3A0H Z;  3QF7 A;  1XI1 A;  3TGU E;  4XDK A;  1JX9 A;  2WPS A;  1XHX A;  2ZT9 B;  2ZYD A;  2Y48 A;  4JF3 A;  1Q7Y W;  2H89 C;  3K5O A;  4TQD A;  1FDO A;  3L73 E;  3H01 A;  2FL4 A;  1QBZ A;  3RN4 A;  2ZJS E;  1Z2G A;  5C8Y B;  4K8X A;  1QVF U;  1CI6 B;  3CWB J;  3BA8 A;  2N1T C;  5CCG C;  4F4L A;  1X22 A;  3G6B A;  3O65 A;  5B1N A;  4DV1 O;  3NMD A;  4OGQ D;  3BVH A;  1AR1 B;  3CX5 F;  1DIP A;  2OYI C;  4P30 A;  3D70 A;  4D6T E;  1JMB A;  2K9Y A;  3TGU G;  2RDC A;  2OYO A;  1SQQ K;  2IX7 C;  4BAY A;  4O4J A;  1WT6 A;  1YHQ P;  4I0X B;  5CBO A;  3OM3 B;  3E1R A;  5BR8 O;  5KLV G;  4TV9 B;  5B3S B;  5B1O A;  5GTH Z;  3MAQ A;  2FFD C;  2PGD A;  1VQN P;  4CH6 A;  1T3U A;  3N2K B;  3BHP A;  1NTM H;  4DT0 A;  4DV4 B;  2K1A A;  2ADP A;  2ZDI C;  3TK1 A;  5IDJ A;  1VQP V;  1KIL C;  2K3R A;  4YHH B;  2N1T A;  5EK0 A;  1WB7 A;  4NPD A;  2DYR B;  4D6T G;  4DYL A;  2WMM A;  4B7K A;  3ABL C;  3CHX A;  4J9Y B;  2OCH A;  3FX0 A;  1OXZ A;  3H1L D;  1WNS A;  2HLO A;  3G4S V;  1I7F A;  1V54 B;  2R9A A;  1PD3 A;  2CUG A;  3HKC B;  4DV5 B;  3CCS P;  1XNR O;  3SFE C;  1SS1 A;  1GW3 A;  4PA7 A;  4BXL A;  1SQX H;  3L73 J;  5EZY A;  2ZDI A;  1ZAU A;  5AVT B;  4H0L C;  4G27 B;  2E5L B;  2FB5 A;  4B86 A;  5D5Q A;  4LH7 A;  3JD0 A;  5LMU O;  2WPD G;  4DW1 A;  2WSC H;  1K34 A;  2QM8 A;  3W7X A;  2ZE5 A;  1SQQ J;  1H2K A;  5IE9 A;  4D6T J;  3RVZ A;  4CZZ A;  1H8E G;  1P84 E;  2Q3I A;  1XQ8 A;  2ZAE B;  4EB6 A;  1KKC A;  4W4L A;  4HNA B;  4OX9 B;  5IYB O;  3UQ8 A;  4I2L C;  2GDS A;  1JA8 A;  2E74 B;  1G6U A;  5CJ0 A;  4DV4 O;  1SRY A;  3H1L E;  1Q81 Q;  5J2U B;  1UII A;  5GTI H;  2KLV A;  4FVM A;  1ZW0 A;  2QJY B;  4PD4 D;  2UU9 B;  4JI3 O;  4JI0 B;  1HNX B;  4YXW H;  4RO2 A;  2E75 B;  3VBB A;  4BIO A;  1KC8 W;  2ZE8 A;  1OVU A;  4MVR A;  1HW7 A;  2JJ2 G;  4PDL A;  1I08 A;  2HFE D;  1KB9 H;  1IFM A;  2LO1 A;  1PNM A;  1M1K Q;  1QHT A;  1YJW V;  4JF7 A;  4IGG A;  2KQX A;  2CTW A;  2V4D A;  4DV5 O;  1H38 A;  4JAU A;  2UXB O;  3H1L G;  1BQ0 A;  2N04 A;  4TQF A;  1M5I A;  2JJL A;  3MTU E;  1RSO A;  3OGC C;  1G4Y B;  2NPS D;  1ZOY C;  2DQ3 A;  2FYN B;  3G80 A;  2G8Y A;  5GON A;  2XND H;  2XAQ A;  5H6Q A;  5DJT B;  2OAR A;  4J11 A;  1BDD A;  4I9W A;  3ABK B;  4ZKU A;  2YSU B;  1NR7 A;  1FS0 G;  4WF9 V;  1ZL8 A;  1SA0 B;  4D7S A;  2O01 J;  2VQF B;  2PFX A;  4U7J A;  4I6M C;  4OX9 O;  3VQX A;  1ZV8 A;  1LWU C;  2WSS H;  2ARH A;  1NGM B;  3FXD A;  3ZMV A;  1O9G A;  1VL2 A;  2OCC C;  2GTS A;  3U10 A;  1URQ B;  1TAE A;  4J10 A;  3T4Z A;  5L3B A;  4LWS B;  3H1L J;  3V6I A;  3JYC A;  5CMU A;  4YJ2 B;  4JI0 O;  3CCR V;  1HNX O;  2UU9 O;  1KYO H;  1V55 B;  2AEF A;  2ZYG A;  4P2Z A;  3M0D A;  1BE3 D;  1ZUQ A;  2HKO A;  5EC1 C;  2E5Y A;  4N6J A;  5AW9 B;  1GKF A;  2JWD A;  4RES B;  2EIK C;  2E42 A;  5EIB C;  3EQ2 A;  1Y4M A;  1PP9 H;  2ZNJ A;  3B5N D;  1WP8 A;  3KZI H;  3J81 N;  4PJ0 H;  4I4T A;  1GU4 A;  5LOV B;  5EBM C;  3U1A A;  2CH7 A;  1M56 D;  2E76 C;  5DJU B;  4LLH A;  5L8R J;  3UIA A;  1DLB A;  1VQ7 P;  2PUS A;  1KBH A;  1W2B O;  1Y67 A;  1KD1 Q;  2ZNI A;  2ZQM A;  3ZMU A;  2OT5 A;  3GB7 C;  5F2V O;  4EOT A;  1EXI A;  1FZG A;  3DXR B;  1UPG A;  4TUY B;  1KYO I;  3I56 P;  1RFY A;  1R3K C;  5L3G A;  2XUM A;  5ITZ B;  3O6Q A;  5JWP A;  2QRX A;  1A02 J;  2QEX P;  1QCE A;  3Q3D A;  2HLD G;  2F4V B;  1TGO A;  2VQF O;  2B9B A;  3HKB A;  5EYP A;  4Q20 A;  3ZN1 A;  1BE3 E;  1KFN A;  2YEV B;  1WJZ A;  5AW1 B;  3H1H E;  3KCX A;  1HNZ O;  3VQY A;  3Q1M A;  4H13 D;  2WT7 B;  5KA5 A;  1EQ7 A;  4GX2 A;  2YIB A;  1QX8 A;  4G28 B;  2UUC B;  3BAT A;  3M91 A;  4DR6 B;  1KEC A;  1B6Q A;  5JH7 B;  1FAF A;  1K05 A;  1HDJ A;  3STZ C;  2DMX A;  5LHI A;  5TIS H;  1BQZ A;  2B5U A;  2IPP A;  2B9Z A;  5KX5 A;  1RM1 C;  4L8J A;  3S9O A;  4EFE A;  3U1C A;  1I5Y A;  1Y74 A;  3K03 A;  1Y47 A;  3ASN B;  3H1H G;  4NTY A;  2DE0 X;  4LF5 B;  3SPG A;  1IK9 A;  2FYZ A;  1Q6H A;  5APX A;  3QNE A;  5CCH C;  2HHH B;  5CBH A;  3VMX A;  3CPW U;  3RK3 D;  2XAF A;  3GWO A;  1L1F A;  3AG2 C;  3K79 A;  4L74 A;  4DCK A;  1V9P A;  3U0Z A;  4MVU A;  1IFN A;  1M57 B;  2Q7C A;  3A7O A;  3ZX6 A;  2OYQ A;  3WUU A;  1GL2 B;  5H2F E;  3OUF A;  4O4I B;  2FML A;  2UXX A;  2F4V O;  3CI9 A;  1Q6U A;  1VQK P;  4GIF A;  4DV3 B;  1X4T A;  1BE3 J;  2HPC A;  5CCH A;  1FDM A;  2RN9 A;  4GX5 A;  3H1H J;  4X1K B;  3KHU A;  3B8N A;  4CS4 A;  3A0B E;  1M4U A;  1BCC D;  2UUC O;  4Y99 B;  1FZE A;  2JS3 A;  1NU1 K;  1L0N D;  4O4L B;  1RF1 B;  1SVF A;  1WA8 B;  1DK1 A;  4HBN A;  3AE2 C;  4DR5 O;  1AJQ A;  2AEM A;  4DV0 O;  2IW5 A;  3SJA C;  3IC7 A;  4U3J A;  1L0L H;  1VQ6 V;  1EDJ A;  2ODM A;  2R44 A;  4YJ3 A;  1MFT A;  2RJZ A;  3OEH G;  1JM0 A;  3ABM C;  1IFD A;  1R6N A;  1XEQ A;  3WUV A;  1MG1 A;  1HVV A;  1SQP E;  1ZLZ A;  1EN6 A;  2YIC A;  1LTS C;  2A9H A;  2XDJ A;  3QO8 A;  2QWO B;  3B8E B;  4KT0 J;  1K33 A;  4XA4 A;  5H9C A;  1NTM G;  5KAF E;  4WBA A;  4UB8 E;  2HHH O;  5B5E E;  1HR0 O;  2Z5I A;  5FNV A;  3RYH B;  2Y4U A;  2ZYA A;  4FLX A;  4TV8 B;  1YVW A;  1ZSP A;  4ZIB A;  2JDI H;  3H1J E;  1JFF A;  2V7Q G;  4ZKI A;  3K06 A;  1N0N A;  2EIM C;  2W90 A;  1OZ0 A;  4FFB B;  1BCC E;  4QPJ A;  3VP8 A;  4TWK A;  2HP8 A;  1SQP G;  2VS0 A;  1W5C E;  1PNL A;  3A0R A;  5APU A;  1K8A W;  1L0N K;  3VMY A;  1MSW D;  4CS3 A;  1S77 D;  1NJI W;  1LT9 B;  2ZE6 A;  1N36 O;  3CME V;  3AG1 B;  1OCC C;  5JJN B;  2UXN A;  1FZF A;  4DV2 O;  1YF2 A;  4LF6 O;  3H1J G;  1AQ5 A;  1K5Q A;  2PP6 A;  2N9B A;  4C7N A;  1AB3 A;  4GKJ B;  4X64 B;  3WMM 0;  1S5L E;  3RYF B;  3K5M A;  4JI2 B;  2XAG A;  4X62 B;  1YTF D;  1COW G;  1KMI Z;  4LP8 A;  5DEC A;  1PPJ H;  2QKA A;  4LR3 A;  2KNC A;  3L75 D;  1Z5V A;  3BRT B;  3JAW B;  3JAT A;  2ZT9 C;  3F7V C;  2V7Q J;  2F93 B;  3A2F A;  1LTI C;  3U59 A;  1HUC A;  1UJW B;  3JSN A;  3ZRW A;  2QKC A;  1SQV H;  4BRY B;  4FLW A;  1BDC A;  2CK3 G;  2XTA A;  1SQP J;  2GA1 A;  3J80 N;  3D6Z A;  4UXN A;  4BR6 A;  3QH9 A;  1YJ9 P;  1GW4 A;  3JCU H;  4U7N A;  1N73 A;  2P6J A;  1TA8 A;  3BRV B;  2JWA A;  1FJG B;  2FYU K;  1OHH G;  1VF5 D;  4RUF A;  1HNW B;  5BU5 A;  1B3Q A;  4RWU A;  3CXH F;  5B3S C;  1D7M A;  4MT8 A;  1AFO A;  5APT A;  3D36 A;  3CRQ A;  4MTX A;  3AE9 C;  5EC2 C;  1BCC J;  3MUD C;  1I94 O;  3PRJ A;  4IFD K;  3KZI Z;  4PJ0 Z;  4UCR A;  5BZB A;  2Z0A A;  1O9H A;  3UT5 B;  4B3T B;  3BVO A;  3L73 H;  2P67 A;  1SQB D;  1MFZ A;  2EZP A;  3A0H H;  1L4A B;  2DYR C;  3D3I A;  4NB5 A;  3SYO A;  5KUM A;  2B87 B;  4GKJ O;  5DM6 V;  4GT1 A;  1NKD A;  1SQQ H;  3AG4 B;  1YSC A;  3CJH B;  4UB6 E;  1Q82 Q;  4X62 O;  4DUY B;  1VQP P;  1NWQ A;  2LGQ A;  2FTK A;  2M3E A;  1V54 C;  4TV9 A;  2F95 B;  5KHH A;  3ZN0 A;  2WSF J;  4KUM A;  4NTW A;  3ZMT A;  3K9A A;  2V1D A;  1LP1 B;  3SYA A;  2KG7 B;  1FZC B;  1UIX A;  2EUL A;  3G4S P;  1PFI A;  5CA3 A;  5AW2 B;  2HG5 D;  1PGJ A;  1ZP0 C;  2M3B A;  3E8B A;  2ZXW B;  1XNQ B;  4XDJ A;  4NPF X;  2LXC B;  4UFZ A;  1CEZ A;  1J5E B;  2EIJ B;  5TIS Z;  3TXQ A;  1EZV D;  1FJG O;  5CHX A;  2LXB A;  3LSS A;  2YXY A;  4BW9 A;  3ETG A;  3HKC A;  2YUA A;  1SQB K;  4X20 B;  1P7B A;  1K4C C;  3EFG A;  4N3Y B;  4J9Z B;  2E74 C;  3BA9 A;  4FZ0 A;  1GAX A;  1GK9 A;  1NTK K;  4N78 E;  3L75 J;  2W6J H;  4H44 B;  2QJY C;  1VIB A;  1JPX A;  5JCO A;  2M7W A;  1SQG A;  2QTS A;  2E75 C;  1QLE B;  5BXZ A;  1BSH A;  3JD2 A;  1NHL A;  3HTK B;  5CMZ A;  1FXH A;  3ZDM A;  1VQ9 V;  1G1J A;  1IFP A;  3AE8 C;  4C7U A;  4DUY O;  3SPC A;  1DTO A;  2OYH B;  2FXO A;  3L70 E;  1NR1 A;  2O01 H;  2N74 A;  4HNA A;  1K9M W;  3KPE A;  2N1T D;  1EZV E;  3RFR A;  2WVR A;  2Q0O C;  2J59 M;  4B3M B;  4GOE A;  2FYN C;  4FLZ A;  3K58 A;  1IBL O;  2EIN B;  1MUU A;  2OTJ V;  3TCU A;  4JPZ B;  4LC1 A;  1YJW P;  2VWK A;  3BEH A;  1FYJ A;  2MJZ A;  3ABK C;  1XNQ O;  3T1H O;  4EDF A;  1P84 F;  3JAL B;  3L72 D;  1L8D A;  1RPR A;  4JI1 O;  2Y0P A;  3L70 G;  5K5G B;  2PY5 A;  1SS3 A;  1JJ2 U;  1GZL A;  3RGU A;  2KYV A;  4DRX B;  3S3X A;  1KIL D;  1OWA A;  4JI7 B;  4LF4 O;  4R4L A;  1M1J B;  1Q86 Q;  2AZ0 A;  3F89 A;  2YO3 A;  3QG5 A;  2HJD A;  4PV1 B;  1E79 H;  1URQ C;  2W0X A;  3DC5 A;  1EFR G;  2WLK A;  2WIT A;  3CWB D;  2QJ1 A;  1XMQ O;  2QSI A;  1ORQ C;  2P58 A;  4FJC C;  3ZBH A;  3GG2 A;  2IBZ D;  1V55 C;  3HPL C;  4A5U B;  2IZ0 A;  4MS2 A;  4F6R B;  3DTU B;  1QQC A;  4PA9 A;  3E83 A;  4PA4 A;  3K5N A;  3CCU V;  4I50 B;  1JTH A;  5TJH A;  3RK2 D;  3OMA B;  5IYD O;  2GUS A;  3L71 D;  1Y76 B;  2QGN A;  5E79 Z;  1SP4 A;  1HBW A;  2WA4 A;  3AE7 C;  1SZX A;  1IUR A;  4IL6 E;  3PN1 A;  4H0L D;  4PD4 H;  2OWO A;  3ZMS A;  1NTZ E;  1WRG A;  4FLV A;  2ZM6 B;  3H1I H;  1CP9 A;  1M7L A;  1Q2N A;  5BVZ A;  2EIL B;  4B3M O;  2UXD B;  1URQ A;  1S2E A;  4JV5 O;  4TT3 H;  3SYQ A;  2ZXE B;  1KIL E;  1A02 F;  4GX0 A;  1S1C X;  4QE9 A;  3BCC D;  3HB3 B;  3RL0 B;  1M90 Q;  3DSQ A;  3AED C;  4K0K O;  2OQQ A;  1LR1 A;  1KV4 A;  1IXM A;  1R3I C;  2QDO A;  3CCE V;  2JEE A;  1Q6I A;  1OX3 A;  1RF0 A;  2CPB A;  2P10 A;  3HE4 B;  1NTZ G;  3TGU D;  2CDY A;  2ZD9 A;  3WG7 B;  4B08 A;  1FDI A;  3JSL A;  5LOV A;  1IBM O;  4IOI H;  3L71 E;  1SF9 A;  1VQM P;  1R6K A;  1VQO V;  5KLV D;  3V4Q A;  2Q5Z A;  1N2D C;  1VQ4 V;  3C1L A;  1LUV A;  2XZR A;  3ETE A;  2O1J A;  2JEX A;  3TYY A;  3UCS C;  3H9V A;  3JCU Z;  3DXR A;  2KSD A;  4ZBM A;  2IYP A;  3LDE A;  1TU3 F;  1QL1 A;  2VQE B;  4ZKP A;  2MK3 A;  2W6B A;  4K8Z A;  4ASU G;  2VWJ A;  4HYO A;  5C93 A;  4FLU A;  2ADQ B;  4AYC A;  3R65 A;  4JI6 B;  4D6T D;  4J7K A;  4DK0 A;  2W6I G;  2K9J B;  1AJP A;  1LT1 A;  1OZH A;  2KLU A;  3ASN C;  3BCC E;  2R9R B;  3CB2 A;  3CMA V;  2BTQ B;  4B3R O;  1KQL A;  3OTO O;  2Q68 A;  2IYO A;  1FPO A;  3TF5 A;  4JI4 B;  2H94 A;  1Y9B A;  2WT7 A;  2EJ7 A;  4DR3 O;  1NTZ J;  3RL0 g;  1F4M A;  1Q43 A;  2UXD O;  3B8M A;  3ZIA G;  3AEC C;  5AW8 B;  1TUB B;  5JH7 A;  3MHV A;  1M57 C;  3CX5 H;  2WAM A;  3WU2 H;  1W59 A;  3N2G B;  1N0J A;  3CC2 V;  1XTC C;  5KLV E;  2IZ1 A;  4IT5 A;  1AA0 A;  3QO5 A;  1MZE A;  2FXP A;  1GL2 C;  1CXZ B;  2WPR A;  3HD7 B;  1N33 O;  4U3F D;  3BCC G;  2Q7G A;  1E5W A;  1G2C B;  4B7E A;  5LGT A;  1M1K W;  3USS A;  3P3P A;  2K9P A;  2QA4 V;  1N7S B;  1GO3 F;  3CCQ V;  4DV7 B;  1S5L X;  2M5A A;  5KUK A;  3L71 J;  3FD9 A;  4UV8 A;  5J9P C;  4Y99 C;  5LMN B;  2BCC H;  2Z5H A;  1RF1 C;  3ML0 A;  4H37 A;  4X89 A;  2XT9 A;  3CX5 I;  2CPS A;  1WP7 A;  5KAI E;  5EIB D;  2Q4P A;  4OWF A;  2WPV B;  1GL2 A;  4NXN O;  4O4I A;  2WA3 A;  5IJ0 B;  5K1X A;  4J41 A;  4LGD E;  1XMO B;  1W2E A;  2E76 D;  2HOD A;  2YIB D;  3L74 H;  1IDS A;  3BFR A;  5CCG A;  2EX3 A;  2KB7 P;  1P84 D;  3BCC J;  1J1E B;  2OYI A;  5LYJ A;  4U3F E;  5CA1 B;  3W7T A;  1VQ6 P;  4JI4 O;  4X1K A;  1F4N A;  3AEI A;  1WPB A;  4GKK O;  1FOS E;  2QE7 G;  2UXC O;  1LTJ B;  5CB4 A;  1RQV A;  4J7Z A;  5EFW B;  5B66 E;  1NU1 H;  1JO5 A;  3S3W A;  1RF1 A;  4EKW A;  1DD3 A;  1NVO A;  3TGU J;  2FFD A;  2CE4 A;  4Y28 J;  1JMK C;  5HFL A;  5KLV J;  4IYH A;  5GTH E;  2N9Y B;  3EHB B;  1KIL A;  3LW5 J;  5M1B A;  4U3F G;  4DR2 B;  1ARO P;  2XU6 A;  3V2R A;  3JC2 2;  3APQ A;  3CCV V;  3VOP A;  2PI4 A;  1LT9 C;  3JAK B;  3AG1 C;  3HE5 A;  4LF7 B;  4LFB B;  1IZN B;  5LMN O;  4IYI A;  5KAF H;  3L4F A;  1OCZ B;  4RQF A;  4NXM B;  5AVY B;  2RQ6 A;  2HVK C;  3C9I A;  3IFX A;  4FFB A;  4PA3 A;  4ZI7 A;  3CME P;  2NN4 A;  3O9O A;  1YCI A;  2ZXX A;  5CCH D;  1XMO O;  3D8C A;  4YHH O;  1BCC H;  5AVR B;  2PF4 E;  4O2A A;  1L0N H;  4BW5 A;  4Z1M G;  4ZHQ B;  2YKQ A;  4LFA B;  4ZOL A;  2KZI A;  3P8C E;  1XDC A;  4J80 A;  2KSE A;  3CC4 V;  4FM1 A;  4U3F J;  3KG2 A;  1PGQ A;  1OW7 A;  3VN0 A;  2W6J G;  1FXV A;  2YS8 A;  4D7T A;  3GVM A;  1BGY E;  3RYF A;  1IBK B;  1HWT C;  1FS0 E;  3BY6 A;  3M9B A;  1DD4 A;  2X0L A;  3RBX A;  1MOF A;  3FB6 C;  1XTG B;  5APV A;  1Q7Y Q;  2HYN A;  3C8V A;  2Q5U A;  3M06 A;  3LSQ A;  3GF7 A;  2E5L O;  5AW7 B;  1GN2 A;  2RN0 A;  4BRY A;  3VTP C;  1HH0 A;  2A45 H;  2BTO A;  3SDL A;  4PEL A;  1QVG U;  3KKY A;  2P7T C;  2LFS A;  4CH5 A;  1X59 A;  1L4A C;  1KB9 I;  2F43 G;  5BMV B;  1BHB A;  4UCS A;  2B1G A;  4IHJ B;  4LFB O;  1BGY G;  2JP3 A;  2OTK E;  3FWL A;  1FFX B;  3AG4 C;  2R3C A;  3ICX A;  3H1K E;  2FYU H;  3FFQ A;  2HR3 A;  2GUZ B;  3OD4 A;  3A3Y B;  1L2P A;  1SET A;  1BZK A;  2OGU A;  1IFI A;  4CC6 A;  3N7N A;  3CC7 V;  1SLQ A;  3ABT A;  4X8A A;  1BSN A;  3UT5 A;  3S4R A;  3EWK A;  1HF9 A;  2A45 I;  1M93 A;  3FB8 C;  2RH0 A;  2W27 A;  1HP8 A;  3QVN A;  5KJ7 C;  1FZC C;  3OW2 O;  3L75 H;  2KS1 A;  2BSK B;  1L4A A;  3VMZ A;  3H1H D;  4W4K A;  3HUS B;  2ZXW C;  3H1K G;  3P8M C;  3FAV B;  1R1B A;  3RYC B;  2B87 A;  1AP6 A;  2EIJ C;  4WB4 A;  3CJH A;  4JTD B;  1RP3 B;  1M9N A;  3Q4H B;  3B4S A;  3OEE G;  1PKX A;  1LWU A;  4IIJ B;  3RGB A;  4I7Z B;  5JJJ B;  2R9I A;  4JAV A;  1KU9 A;  2AXT E;  3WB0 A;  3MIW A;  1URF A;  2KKW A;  3ASO B;  1NVP D;  1N32 B;  4X1Y B;  4I9Q A;  1VEW A;  2AW9 A;  1KQS O;  4H44 C;  1EDL A;  1QLE C;  3PLN A;  1PL0 A;  5A9G A;  3T1C A;  1PNK A;  1SFC B;  2ZT9 D;  3H32 B;  3WU2 Z;  4IL6 X;  1USE A;  1GM7 A;  1XHZ A;  1WPX A;  2BAS A;  1DH3 A;  4YY3 B;  3SPI A;  3B77 A;  3RT3 C;  3H1K J;  2OYH C;  2YID A;  3BAB A;  4JAS A;  1NT2 B;  4KL1 A;  1SQB H;  2WSE H;  4X20 A;  1CZQ A;  2Y9Y A;  1R8E A;  1GD2 E;  1NBM G;  4BWN A;  3C3S A;  2QG4 A;  3FYE B;  3D6Y A;  1VQ9 P;  4O9B A;  1NTK H;  1VF6 C;  2EIN C;  2Y0I A;  3M8A A;  2FXM A;  1K04 A;  1H2G A;  4X66 B;  1NTM D;  4WCE V;  5AVU B;  5J2T B;  1JY2 P;  3OMN B;  2Q7H A;  5DED A;  1MKM A;  3AE3 C;  2OYH A;  2QWN B;  2OTJ P;  3ZHS A;  2ZVN B;  1AI7 A;  1QEX A;  1X79 B;  2ZKO A;  5H2F Z;  1M1J C;  1YDX A;  4K3A A;  5IYZ A;  4ZNC A;  4PV1 C;  1R5S A;  1QVF O;  1VF6 A;  1SQP D;  1IZ3 A;  2X7R B;  3CRR A;  4TOI A;  3L37 A;  1GH6 A;  3FKS G;  3KXD A;  3A0B Z;  2FKW B;  1AR4 A;  3JAL A;  3CL3 D;  1TVK B;  3H1J D;  1S3J A;  4O4J B;  3K0D A;  3T97 A;  1T2K C;  2K37 A;  4JBZ A;  1QR9 A;  1NTM E;  2K1E A;  3CRM A;  4DR6 O;  1M1J A;  1AR5 A;  1F23 A;  3RWR D;  2EIL C;  4DK1 A;  3F5T A;  1FXK B;  2H8P C;  3MHH C;  3ETQ A;  1FAV A;  1JJO A;  4CBC A;  2NRG A;  4UCT A;  5KAF Z;  3OMI B;  4UB8 Z;  3T4D A;  1EDK A;  5B5E Z;  3B2E E;  3RL0 C;  1ZR4 A;  4AI8 A;  4JYC A;  4F6R A;  1NO4 A;  2JJ1 G;  2GSM B;  4X66 O;  4PDR A;  2P22 C;  1Y76 A;  1T5E A;  4LF5 O;  2E74 D;  1MAB G;  1AIL A;  4BWA A;  5LXT A;  1SQP K;  1S5H C;  2YXH A;  1FJK A;  3WG7 C;  2LP7 A;  3VQW A;  1SQX E;  4EYY Q;  4YIO A;  3G6E V;  1G1X B;  3APO A;  2E75 D;  1AP5 A;  3CD6 V;  3MDS A;  4MVZ A;  3ZRX A;  4QE7 A;  1NYH A;  3CCE P;  3L72 H;  5E79 H;  1VDF A;  3ZMZ A;  1NU1 G;  5JQG B;  1VQL V;  2WQY C;  1FBM A;  5AW4 B;  3BRC A;  2WLL B;  3KQG A;  4R7C A;  1S5L Z;  1VQ4 P;  4QIW F;  2C0W A;  4DV3 O;  2J58 A;  1SQX G;  3CWB H;  2B1I A;  3TNU A;  1B04 A;  4WFA V;  2IBZ H;  1ZN5 A;  3RK2 B;  5BU8 B;  5EBL C;  3EVK A;  4DR7 B;  1NTM J;  5GTI E;  2A06 H;  3O8Z A;  1KP2 A;  4LF9 B;  2O1K A;  4DO2 A;  2UUA B;  4EIJ A;  3CCJ V;  1YIJ V;  2FBW C;  1VQ5 V;  4WY4 B;  1XOU A;  3CMA P;  2LR2 A;  3NXS A;  1FC2 C;  1LJ2 A;  1KB9 E;  3R4Y A;  4FLT A;  3JD4 A;  1G8M A;  3HD7 C;  2AEJ A;  1IX9 A;  4A7P A;  3V5B A;  3CXH H;  2LFR A;  1NAY A;  1URQ D;  2BTQ A;  3OGI B;  3K59 A;  3IAY A;  2D2C B;  1KYO D;  4X88 A;  4HZ3 A;  1N7S C;  3CC2 P;  4GOD A;  5KMG A;  1SQX J;  4YXW G;  3RYI A;  1SZT A;  3ITK A;  3H1J J;  1KUQ A;  1RSO B;  3IGA C;  3WB1 A;  2WWW A;  2OIE A;  4DXW A;  1JY3 P;  4GX1 A;  2KSJ A;  2WSC J;  3N2G A;  3TGU H;  2BEQ D;  2QA4 P;  2GM4 A;  3CCQ P;  3HD7 A;  5C8Y A;  2JS5 A;  1PM9 A;  2X6B A;  1GM8 A;  3SR2 C;  4XBF A;  5KLV H;  1CI6 A;  4MW8 A;  1G2C A;  1M8O B;  3CXH I;  3Q5S A;  4AUW A;  5AVS B;  1ZL8 B;  1YXB A;  2L5G B;  1JCD A;  1Y8A A;  1J1E C;  1N7S A;  4NTX A;  5H5N A;  3W67 A;  2XND G;  4X64 O;  2Q6Q A;  4ASV A;  4MVQ A;  1LTJ C;  3FB7 C;  2JGD B;  2Q67 A;  4JPR A;  4JI2 O;  1AVY A;  4LF9 O;  3Q2Y A;  2P90 A;  4I0X A;  4X1I B;  4D6T H;  1KYO E;  4FFK A;  4N78 D;  1LTB C;  4PI0 A;  3VMA A;  4MSW C;  4JQ0 D;  3WUT A;  4LF8 B;  3MUD A;  3N2K A;  3IJ4 A;  3JCZ A;  3HKD B;  1KQF B;  1R3L C;  4KFM A;  5IJ0 A;  1IC2 A;  1DEE G;  1PP9 E;  4DJG A;  2R32 A;  1Z5W A;  1NZ6 A;  3PTZ A;  3KZI E;  2MKV A;  4PJ0 E;  2WSS G;  1DX7 A;  1GK6 A;  3VYI A;  3L70 D;  2IU3 A;  4I4T B;  2H88 C;  5CA1 A;  2XOK G;  1JCH A;  2IFM A;  4GKG A;  2PAJ A;  1HNW O;  2K88 A;  1YEW A;  1OCZ C;  2Y69 B;  4OGQ B;  2JR8 A;  3AEA C;  2WLI B;  1R73 A;  3ZHR A;  5IT9 N;  1OCO B;  3M99 B;  4KHP B;  4EFB A;  3CCV P;  5CBG A;  1PP9 G;  4I5S A;  3CSX A;  4KJM A;  3CEI A;  3TJT A;  4B3T O;  1HJB A;  2ZIM A;  2H3O A;  5H6R A;  3K5L A;  4HJG H;  3FWN A;  1FOS F;  5EYP B;  1M57 D;  3SJB C;  1F51 A;  3JAK A;  5APW A;  4NPE A;  2OTL V;  2ETN A;  1JQ0 A;  2I1J A;  3AEG C;  4PHZ A;  3E2E A;  3FYI B;  1GL2 D;  5TIS E;  4RUE A;  4NYK A;  3WB2 A;  1EN4 A;  5CCG D;  1P84 H;  4C7R A;  3CC4 P;  2Q3E A;  1NI8 A;  4JI5 B;  2FKX A;  3E22 B;  5J2U A;  1NKZ B;  2YI9 A;  1PP9 J;  2QM4 A;  3ZRS A;  4CH4 A;  4DR4 B;  5CJ4 A;  2KZJ A;  3FB5 C;  3H1L H;  1FFT B;  4ZHQ A;  2QTO A;  5APQ A;  1U57 A;  1VQ8 V;  1L0L D;  5IY5 B;  3CPW O;  4R6Z A;  4FM2 A;  2E43 A;  1J5E O;  2YKP A;  1NTZ D;  4J7J A;  4W7Y A;  2YO2 A;  1K3E A;  1MA1 A;  4K35 A;  3LID A;  4I1L A;  2EZO A;  1X8Y A;  1THZ A;  1AJY A;  4LNU B;  5B1A B;  2DYS B;  1VF7 A;  4KHP O;  2C0X A;  1ROP A;  4LFC B;  3HR0 A;  3CP1 A;  5B1B B;  3A8T A;  3SJQ C;  2JEU A;  1MZ9 A;  1LTG C;  1BT8 A;  3W7S A;  4IL6 Z;  2ZE7 A;  1GTW A;  3C90 A;  3DGE A;  5KHK A;  1FD9 A;  2BOB C;  1WB8 A;  2PTM A;  1RE3 C;  2V4H A;  2YIU B;  2HPC B;  5BMV A;  5LGN A;  2MW2 B;  4GUN A;  4IHJ A;  3HUS C;  1N8R Q;  4B3S B;  3CC7 P;  1SA0 A;  1FFX A;  4R50 A;  1L0L E;  3CCR P;  3L70 J;  1K4D C;  1EC5 A;  4I7Z C;  2WPQ A;  1ZRT D;  1KQG B;  4U3J B;  3HRN A;  1QGK B;  3JAS B;  4TLF A;  2L6L A;  1NTZ K;  2CGO A;  3L9D A;  4LWS A;  1NS1 A;  4DV6 B;  4N21 A;  3ASO C;  4HH2 A;  4YJ2 A;  1YTZ T;  1YI2 V;  3NFQ A;  3OJA B;  2UUB B;  5L3D A;  5AW6 B;  1JEK A;  1H88 A;  3QO7 A;  1RE3 A; 
#chains in the Genus database with same CATH homology
 2WSE J;  4IL6 X;  4YTP C;  3T97 B;  4OGQ B;  2BEZ F;  3AE1 C;  3AEA C;  2WQY C;  3GF3 A;  1GMJ A;  1HJ0 A;  4OGQ C;  4OGQ D;  1ZOY C;  1JB0 J;  1DIP A;  2G8Y A;  1RQU A;  3D70 A;  3D6Z A;  2FYN C;  1R8E A;  1Y9B A;  2K9Y A;  3RL0 g;  3D6Y A;  1VF5 B;  3AEC C;  3RK3 E;  1OW7 A;  1VF5 C;  1VF5 D;  2JO1 A;  3GMA A;  2O01 J;  1K04 A;  1ZRT E;  3G9R A;  3AEB C;  3AEG C;  2FBW C;  2FXP A;  2J5U A;  3AE6 C;  4U7J A;  1DD4 A;  3AE9 C;  3B71 A;  2QJK C;  2IDB A;  1NGM B;  3R4Y A;  5KKZ C;  1VL2 A;  1MKM A;  3AE3 C;  3C8V A;  4R4L A;  1OMI A;  3GF7 A;  4PV1 B;  2NZ2 A;  1S5L X;  1KTM A;  2D2C B;  2QSI A;  4YXD C;  3AE2 C;  4PV1 C;  4PV1 D;  4XFJ A;  1PV3 A;  2D2C C;  2D2C D;  1U57 A;  3Q5P A;  2JP3 A;  3IAO A;  1OW6 A;  3SFE C;  3IN6 A;  4H0L B;  2YMK A;  2E76 B;  2WPV B;  2WSC J;  3AE7 C;  2WSF J;  5KLI C;  4Z1M H;  2BEQ D;  4H0L C;  4H0L D;  4RKU J;  1AJY A;  4KT0 J;  2E76 C;  2E76 D;  5L8R J;  1EXI A;  1Q90 D;  3Q5S A;  1PL5 A;  1UIX A;  1OW8 A;  3EWK A;  3SFD C;  1HF9 A;  4TT3 H;  1KIL E;  4R4M A;  1ZP0 C;  2QIW A;  1RQV A;  3Q5R A;  1ZME C;  3O6Q A;  1S1C X;  3D71 A;  1IK7 A;  1DD3 A;  3AED C;  3Q2Y A;  2OQQ A;  1YQ3 C;  3Q3D A;  1YQ4 C;  2QJP C;  3GLM A;  4Y28 J;  4H13 B;  2E74 B;  3FGA D;  2YIU C;  2P10 A;  1KOR A;  4H13 C;  1PIX A;  4H13 D;  3Q1M A;  4I7Z B;  2E74 C;  3ABV C;  2E74 D;  3LW5 J;  1FDI A;  5M1B A;  3AE5 C;  1KQF B;  3AEE C;  1EXJ A;  2E75 B;  4I7Z C;  3H25 A;  1K05 A;  2MKV A;  1KQG B;  4H44 B;  2QJY C;  3AE4 C;  2E75 C;  2E75 D;  4H44 C;  4H44 D;  2ZT9 B;  1WMK A;  4GDO A;  2H88 C;  1KMI Z;  2G3A A;  1NYH A;  2H89 C;  3S9O A;  1TU3 F;  3AEF C;  1FDO A;  2ZT9 C;  2ZT9 D;  3AE8 C;  2V7Q J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...