2D2CB

Crystal structure of cytochrome b6f complex with dbmib from m. laminosus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
137
structure length
137
Chain Sequence
LAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGAALPLDKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intraprotein transfer of the quinone analogue inhibitor 2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone in the cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 19
structure length 137
sequence length 137
chains with identical sequence O
ec nomenclature
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2d2cB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2d2cB01
2E74B 2WPVB 2YIUC 1S5LX 4OGQB 4IL6X 4RKUJ 2QSIA 2WSEJ 4Y28J 5KKZC 2O01J 2QJYC 4H13B 2QJKC 2E76B 3C8VA 1VF5B 4H0LB 4I7ZB 2QJPC 5L8RJ 2QIWA 3LW5J 2FYNC 1JB0J 1Q90D 2D2CB 2ZT9B 4PV1B 1ZRTE 2WSCJ 4H44B 4KT0J 2K9YA 5KLIC 2WSFJ 2E75B
chains in the Genus database with same CATH superfamily
1KV4A 4EKWA 1WA8A 2WPVB 3OAAG 2GUZA 1JJ2U 3KCYA 1Y74A 2MJZA 3FWNA 4O4IA 4WY4B 1VQKP 1QNMA 2DE0X 2HLDG 1URFA 2FL4A 1L8DA 3ZIAG 3H1JE 1LTJA 1SQXK 3RL0C 2Q7EA 2OYIB 3QTCA 4MSWC 3JATB 1GN2A 3JARB 3STZC 1J1DB 1LP1A 1OIPA 2IBZH 4F6RA 1EDKA 4R4LA 4DR4B 2N9YB 4X1KB 4CS4A 1X59A 2FYNC 1ZUQA 5EK0A 3AE8C 4YPCA 1EXIA 1T3JA 4UV8A 2KLUA 2RN0A 2WSCJ 1YTZT 3H1JG 3L4FA 1YXBA 3B8NA 4PDVA 1LTIC 1T5EA 3MDSA 1AA0A 3D71A 1H89A 2QWNB 2P58A 4DV7O 2UUCO 4LF8O 4WWIA 4C7NA 1NS1A 1DEEG 3AG2C 1PP9G 2F4VB 2CUGA 3V6IA 1SS3A 3JAMN 3L73H 4X20B 2HYNA 3OM3B 3B40A 4K8ZA 2WSSG 4H13D 4LFAO 5CCHC 4JI0O 3CCUV 1M1KW 2HVJC 1N73C 1IDSA 3IC7A 4I1LA 4EYYQ 1KKCA 1W2BO 1BGYD 5JJNB 1U57A 2OYQA 2WZ7A 4IFFA 3RL0D 3AE5C 3CX5E 3NR7A 3C3SA 4PELA 3L71D 2QJPB 1G6UA 3OEEG 1QLEC 5E1AC 2WA4A 1BQ0A 3L73E 3Q4HB 4M3LA 2M5AA 3M0DA 2QWOB 2J5UA 1IK9A 2ZFCA 5GTHE 1SQBE 4PI2A 1G1XB 3UKMA 5E79E 4D6TJ 5CA0A 2E3CA 1GL2A 1SQXJ 1JMMA 3OGIB 2FFDC 1GMJA 3FXDA 5AVXB 1RP3B 3WU2H 3CD6V 2RKLA 1JA8A 5KLVD 5LHHA 1EN6A 1ZX3A 1YEWA 4JYAB 3RYCB 4N6JA 1BCCG 2P1JA 3WG7B 1J1EB 1WP7A 4PA7A 1OCOC 1XQ8A 4GIFA 1U96A 4GT1A 3MHHC 3ABKB 2P10A 3NTNA 4BIOA 1Q6HA 1T3UA 2YXHA 5KMGA 4UCRA 2AHYA 2Y9ZA 3ZN0A 4LR3A 4H0LB 2L91A 2BE3A 1BS3A 2XKMA 1AILA 3JCUZ 1J95A 4LF5O 1HUCA 1WMKA 2VWJA 2FFDB 3CCVP 2YXRB 1GDTA 2XAJA 2YICA 2P4KA 1NU1J 3WB2A 2BCCE 3FXEA 1EBOA 4RWUA 5EYPB 2F23A 4NXNO 1BE3J 1ZXGA 2P2UA 2CAZC 2Y69C 4LWSA 2DYSC 4MW8A 1K04A 1NTKJ 1L4AC 2F1MA 1AR4A 1Q7YQ 4FMTA 1P84D 2Q4PA 3ABTA 1BSHA 1H0TA 4ASVA 2QR4A 2FFDA 3RYFA 1G1IA 1GL2C 2BCCG 4H0LD 2PZSA 5KJ7C 2ZXWC 3QO8A 4U3FE 1SZXA 2JEXA 3CLQA 3I5CA 3L75E 1OCCB 1OCOB 1CPYA 4KUMA 5CBNA 3OTOB 3A7OA 3AK3A 5CA1A 3AEDC 2X7RB 5AVYB 1MUUA 3S4RA 1AVMA 1PPJD 2ZNIA 1S5LH 5IJ9B 1SQGA 4NTYA 4B86A 5APVA 1LT9B 2QE7H 1S9KE 3VBBA 3WMM0 1Q90D 1QQCA 4JQ0D 1RF1C 3ZRVA 1S3JA 3O6QA 1QR9A 2C9NY 4J9YB 1S5LZ 4I4TB 1KFNA 2E75B 5B1OA 3K57A 2H7HA 5AG2A 3N7NA 2IZ0A 2ZE7A 3C90A 1NTKH 5IJ9A 1OWAA 3G9RA 2OARA 2OCCB 4P9OA 4Y28J 2Z0AA 2M8RA 2UXDB 3W7XA 3X2QB 4ZHQA 1IFJA 4X1YB 3CCSP 3JAKB 3L74E 2W6JG 1KN7A 4XA4A 2W90A 3G6BA 3K58A 4HKZH 1NVPD 4YJ3A 2YC0A 5CBHA 1FPOA 1T6AA 1F23A 4E4EA 1AP6A 3ZN1A 3P8CD 1XHZA 3BCCJ 4X66B 2XUMA 1GTOA 3DXRB 2PF4E 3E8BA 4YHHO 1M4UA 2PP6A 3O9OA 1PGJA 4B7EA 2NZ2A 5CJ0A 3VMZA 5CB4B 4KL1A 3UIAA 1NTKD 3JCUE 4YJ3B 3MD0A 5LP6B 2XNXA 1QX8A 1XBLA 3SPJA 3SYOA 4GKJB 2E5LO 4Z1MG 1G2CB 3GHGB 3LW5J 1NGMB 5APQA 2RH0A 5KLVG 5H6RA 2JS5A 2ETNA 1OX3A 2E76D 2UU9B 1J1DC 1G1JA 4DV5B 1WA8B 4O2BB 3ABMC 1I08A 2P6JA 2GUZB 5H5NA 5BVZA 1Q81Q 1QCEA 1NU1G 3KQGA 3HKEA 2ZM6B 1HR0B 1OW8A 4NXMO 4GX2A 3Q2YA 3TCUA 4I50A 3BAAA 3ZMUA 1PP9E 3V2QA 4EDFA 1MZEA 3MP7B 4WCEV 1URQB 2AXTZ 2L6LA 4QPJA 5C8YA 3CCLP 2UXBO 3KXDA 1DK1A 4WY4C 1K8AW 3QVNA 3NXSA 1PGOA 5B5EE 3E22B 5B3SB 3T1YO 4JI5O 4Z1MH 1H8EG 2GA1A 1I5YA 1NKNA 1QHTA 1L4AD 3WU2E 2GM4A 1PFIA 3CXHH 3PTZA 5B66H 1IFMA 1H2NA 5IE9A 5KAIH 3CMEV 3ABLB 2DYRC 2HFEC 1HNXB 3K5BA 2DQ3A 1AI6A 3AE3C 3HUSB 1L4AA 2CTQA 5GTHH 3JAWA 4DUYB 1OW7A 4AUWA 2JO1A 5JJJB 5FNVA 4HH2A 1DGSA 1LTBC 3KDPB 3APOA 1JY3N 3H1LH 4JI7O 1MFTA 1H2SB 1NTMG 5GTHZ 3LSQA 2EJ7A 1K7DA 3BABA 2YEVB 3MHVA 1Q3EA 2JS3A 5KA5A 1SESA 1AJQA 1WJZA 1AVOA 4DR6O 2K1EA 3B71A 1BCCE 1YJWV 1YQ4C 2Y4TA 5LMNO 2H94A 1QGKB 1JM0A 1EZVH 4TQFA 5IYDO 2XZRA 4LCUC 4JI7B 3BRTB 1GM9A 2KYVA 2CE4A 2A45H 2EX3A 4DZOA 3JCUH 1VQLV 2D2CD 2JGDA 3JD3A 2J59M 1PL5A 3VQWA 4IOIH 1VQ7V 3SPHA 1HW7A 3W7SA 1K97A 4B3RO 1NTZG 1BDDA 1K3EA 1KB9I 1CI6B 5KLIB 3FYEB 4DV1B 2XAHA 1SERA 1VF7A 5LP6C 1I0HA 4F4LA 2G3AA 2OTLP 2JEEA 2C0WA 3EFGA 4R4MA 1B6QA 2DN9A 3STLC 1NH4A 5IYCO 2WLHA 3G4SV 4A7PA 4UFZA 2QJYB 1YDXA 1FZCB 4N21A 5LL6Y 1B04A 4CS2A 2QM7A 2ZDIA 4HZ3A 2FKXA 3D70A 4IT5A 4B3SB 3VOPA 3M06A 4UUJC 1LWUA 3ASNB 3D36C 1RM1B 4UVBA 3HTKB 1Y76B 3M8AA 1ZN5A 3M99B 3UT5A 1SRYA 3L75G 3HD7B 2AZ0A 1N73A 4ZI7A 5JH7B 5CCHA 4DV5O 1N7SC 3CCMV 3BATA 3PN1A 2Q69A 4DV0B 3FGAD 5IY5B 2PAJA 3CXHE 4JI4B 4P9PA 2ZXXA 1NTZK 2LR2A 3BHPA 1FJGO 2HPCA 2WA3A 1YI2V 3SDLA 5KUKA 2P22C 1IBKO 1OMIA 2Q7HA 3CCQV 1BZKA 3UM7A 3G71P 1N0NA 1FXKB 4JI6O 4I7ZC 4BIUA 2LFSA 1VP7A 3IGAC 2PTMA 5JH7A 2WLIA 5B1AB 1KYOD 2LW7A 3CX5F 4WY4A 2Y48A 4I55A 1EZVI 3ABMB 2NPSA 2OYHA 1FOSF 2RNBA 1WAZA 4JV5O 4KFMA 3BEHA 2Q68A 3OE7G 3CXHF 1Q86W 2XHBA 2Y0PA 4W4KA 1YYCA 1NH2B 1BSNA 1ZTEA 2QJKB 1FXVA 1MOFA 3VQYA 1FDIA 4W80A 1NTMK 3ZRXA 5C93A 1VQ6P 1UJWB 4IHJA 5AVVB 2HJFC 1NH2D 4Z2WA 2MW2B 3L73J 1SF9A 2QKSA 4FZ0A 4B3RB 3M9HA 3V2NA 1W59A 1WNSA 2XAQA 1HP8A 3FFQA 3RK2C 2X6BA 1KYOH 3LSSA 1SVFA 1XDCA 3A0HH 4MN4C 3AG7A 5C8YB 3AEGC 2O1KA 2RDCA 3H1HH 5B1AC 2GUSA 4MTGA 4DV3O 1Y66A 3UO2A 1CW5A 4GCZA 4DV1O 3RL0g 3LIDA 5CN0A 2LJ2A 1VQOV 1E5WA 2Q6AA 2WSFJ 2HODB 2Y4UA 1KD1W 3ML0A 4PI0A 1AI5A 2OYIC 2QE7G 4O4JA 5JCOA 3E2EA 3GLMA 3JAWB 3V2RA 1RSOB 2KSJA 2ZIMA 4FLXA 4NXNB 4HJGH 3CXHD 3HPLC 3CMEP 4DR3B 2Q6QA 4O4HB 1R6TA 2JWAA 2XV5A 1M90Q 3GHGA 1YSCA 1FJGB 1SQQK 1NTKE 2K3RA 1NJIQ 2EILB 3TGUH 2C2AA 5AW7B 1P7GA 1VEWA 1R5LA 1VQ9V 1VQKV 1PM9A 1JEKA 4U7JA 5GONB 5H6QA 5L3BA 4YXWG 1NAFA 1HNWO 1J2JB 1ZV8A 5LGNA 4XDKA 5EBWC 3ZHTA 2A3QA 4UB8E 2CTWA 1XMOO 4CBCA 1H88A 1I94B 2RMZA 3H1LJ 1IZNB 1WRGA 1QVFU 1EFRG 1URQA 2M7WA 2W6BA 3GWKC 5IYZB 1I5XA 2D2CB 3ZMZA 3E1RA 5APSA 3H1IE 3WUUA 3HKDA 1VQNP 1ZR2A 1SFCC 1ORQC 1UPGA 4BXLA 2MKVA 1DX7A 3MAQA 4LWSB 1OW6A 2UWJE 5LMNB 2PYLA 1MSWD 4DR2O 4H44D 4DR4O 4DW0A 2FYUG 1KYOE 4LBEC 2E42A 1BE3D 5GW7A 1D5AA 2V4HA 5DECA 3BCCG 1N0JA 2JP3A 4DV4B 1GW3A 1Z5WA 1BL8A 1AI4A 2ZYDA 3VMAA 1BT8A 3E8FA 2R32A 3SYCA 1FZAA 4ZBMA 2Q3IA 3B5NB 3V2PA 2N04A 4ZI7B 1KB9D 1IFNA 4FK5C 2K88A 1Q6IA 3BCCE 4B08A 1NR1A 1GK9A 2ZJSE 3R2PA 2KQXA 3CC4P 4U3FD 3A2AA 3L71G 3MUDA 3F5WC 1IC2A 1R6KA 2OYHC 1ZWIC 1LR1A 1XREA 1LNQA 1XHXA 5AVWB 1VQ4P 2C9LY 4JI0B 3CCJP 1M1KQ 4O9BA 3CD6P 4FLZA 5LA6B 3K5OA 4I4TA 5LGTA 2KXPB 4GX5A 3RK2B 1Q82Q 4ZKUA 3L37A 3CX5I 1NVPB 4IFMA 2QTSA 1S1CX 1GW4A 4FLUA 4RKUJ 1FFXA 2DWDC 5EC1C 3BVOA 4JYCA 4MVUA 4N78E 1W0KG 5IJ0A 3T4DA 1MFZA 3OEHG 1FZCA 3J81N 3JATA 1K5SA 2E75D 3BCCH 3M7MX 3BCCD 3AG4B 5KLVJ 4QJFB 1KB9E 1LTAC 3CCVV 3L71J 5CA3A 2QEXV 1S9KD 3D3QA 3JD1A 3WFVA 3UQ8A 5EIBD 2I1KA 1FZCC 2OTJV 2N1TC 2IFNA 2NNUA 3RK2D 5JQGB 3FD9A 2GBOA 3CXCU 1VQ5V 3E83A 3HD7A 1JO5A 1YHQV 5LP6A 5CJ4A 1HWYA 1PD3A 1M1JC 4UXNA 5APWA 5GTIZ 1F51A 1ZSPA 1HWTC 4TV8B 3GF3A 4X62B 4D7SA 2WTYA 1SETA 1VIBA 1HJ0A 4JI2B 1KQFB 1Q5OA 1JJOA 5JQGA 4GUNA 3L73D 4LF9O 5GTIH 5AW1B 1FXKA 1KUQA 4G2KA 1AQTA 2B87B 1V54B 5TISE 1QBZA 3H1HJ 4K0KO 5LBQA 2VQFO 3M0AA 3RVZA 4X62O 1SQQH 2OTJP 4E2LA 1YQ3C 1IURA 1BCCH 3OTFA 4X64B 3CCQP 4L87A 2EIKB 2DOSA 3CXHI 1JPXA 4TWKA 5KLVH 1YHQP 4HAMA 4UCSA 1ZAUA 1PV3A 2KSDA 2Y0CA 1YJNP 1FDOA 1YF2A 2YSUB 1V55C 1TA8A 4MTFA 3TETA 2F95B 4ZKPA 1KP3A 2IJJA 2AXTH 1N2DC 4CH5A 1GH6A 4D6TH 3L70D 1YTFB 3W67A 1R73A 3E1IA 3IN6A 1QVFO 2KKWA 1CXZB 1AQ5A 3OUSA 2YXYA 1VF5D 1N33O 3AECC 3JSNA 2VQEB 1GM7A 4I0XB 1F7YA 4JI8B 3QNEA 2QJYC 2P06A 1S5LE 1ZOYC 1R3KC 4K3AA 1SQBJ 3SYPA 1BCCD 1PNMA 1DF5A 3MIWA 5B3SC 2KI7B 4PJ0E 3JSVC 2Q73A 2VS0A 4R50A 2LXBA 3CC2V 3FAVA 3K59A 3KCXA 3L75D 4PD4I 2GDSA 1ZW0A 4I6MC 4FJCC 1FS0G 1R3IC 2YO2A 5KAFH 1HBWA 3CCRV 3HRNA 1DTOA 3WU2Z 5LOVA 1FKAO 3I56P 4JI6B 4KJMA 1XUQA 2EIMB 3HKBB 4IIJA 1YTZI 2KG7B 2WLMA 1V55B 2IM9A 4NR1A 5LXTB 1VF6C 3WG7C 4PDLA 1Q7YW 2FTKA 1PZQA 3JSLA 5L3EA 2O01N 2JK5C 1OVUA 3G67A 1VQPP 2BOBC 5IWAB 2EIKC 3ZMSA 5B1BC 2FKWB 1F4NA 1FFTB 3GWOA 2LW1A 4MVOA 1TVKA 1SQXD 4GLXA 3C3TA 1T2KD 2BCCJ 2FB5A 2R44A 4FM1A 1BCCJ 2H88C 4C7RA 1XEQA 3D6YA 3SJCC 4PA3A 4J80A 3G3ZA 3RN4A 4WBAA 2KNCB 2XASA 3AE6C 2EIJC 2A45G 2Q67A 1HNXO 1GK4A 4JF3A 1LP1B 1VQ4V 2E5TA 3S9OA 1XMOB 3TNUA 2XAGA 2N05A 2LFRA 5HFLA 4H44B 1GN6A 3FB7C 1BGYJ 1OCCC 3L36A 4FFBA 1VMGA 2CTRA 1L0LE 2YIBA 4RUFA 5IJ0B 1SQBG 3ETEA 5CBFA 2X0LA 4CZZA 2BASA 1N73B 4G28B 2N9BA 1UIXA 5IT9N 4DRXB 2PGDA 2WSEJ 2AEJA 2QM8A 4MVQA 4OWFA 1FAFA 2K9JA 1SFCD 4I9WA 4DR1B 2HPCB 1K34A 1AB3A 5KHHA 1YCIA 5JJEB 2NRGA 2GSMB 1JR9A 2JEUA 2KB1A 1RF1A 1S5JA 1ZRTE 3VQVA 4D6TE 4WBNB 3DTUB 1E1RG 3TGUG 3CWBG 3A0HZ 1TVKB 1M5IA 1XNQB 3JASA 4O4LB 4YHHB 1L0NJ 2N1TA 4NPFX 3IC9A 1BGYE 1RQVA 2W6IG 2V7QJ 3TK1A 2P5OA 1ROPA 1KD1Q 2YKOA 2FXOA 1YITP 2NPSC 5L3DA 3JALA 2VWKA 1SQXG 4Z1VA 1THZA 1FBMA 1WN7A 4DV7B 4DV6O 2E5YA 3RT3C 4BR6A 1NZ6A 1FJPA 2A06H 4X66O 2IDBA 4B3TB 1E79G 1VQLP 4OPAA 2WWWA 3IAYA 1L0NE 2AXCA 3DGEA 1SQQG 4YY3O 1BMFG 4TOIA 4AHCA 1XTCC 3IAOA 4O2BA 4U3JA 1RE4A 2W0FC 2JDIG 3ABVC 4WF9V 2XTAA 2OTLV 1YITV 1LWUC 2HKOA 4DUZB 2FYUD 2KK7A 3L71H 3U59A 4DK1A 1L0LD 3BFRA 4EB6A 2JJ2G 3BA8A 1BGYH 5CBGA 3M91A 1CP9A 4U3JB 2GTSA 3SPIA 4D7TA 1GL2D 4H0LC 2VRZA 4JAUA 1K8AQ 3H1JJ 3T97A 3U11A 1NU1E 2IJHA 3A0BE 1MA1A 1P84E 3CCMP 4O4HA 1URQD 1PNLA 1IBKB 1ZR4A 2YI8A 3AE1C 4C46A 4FM0A 5E79Z 3Q4HA 1KFMA 5BR8O 3P3PA 5JWPA 3PHLA 4TLFA 2C0XA 1M90W 2AGAA 4JI3B 2KB7P 4EFEA 2Y69B 1SQBK 5TJHA 3L70J 5EZYA 1VDFA 2P90A 3Q1MA 3S3XA 4JTDB 5KA6A 1YI2P 3TF5A 1SA0B 5KX5A 1U7JA 2ZXWB 5GONA 2RN9A 1R3LC 5CA0B 1A02J 4D6TD 1JCHA 1JVMA 1NAYA 5LHIA 5BR8B 2W0XA 3TDKA 3K5NA 2R3CA 1KILD 4J7JA 3RYCA 1YTFD 2QJPC 4TV9B 4JPZB 4RO2A 2BOCC 5KX5B 4LF6B 3W68A 3HUSC 1FU1A 3RW0A 1PPJH 2JGDB 2H89C 2KUBA 2B88A 3ASOC 1AFOA 3OMIB 4X65O 3MHSC 2JGUA 1IVSA 1BE3E 3B5ND 4GKKO 3JCZA 3IJ4A 1PNKA 4UCTA 1R5SA 3AEFC 4UCUA 2W6AA 2K1AA 2ILMA 1J1EC 1IFDA 4TUYB 2IU0A 2XNDG 4OXSA 3J80N 1LT1A 2XAFA 1IFIA 1LTTC 3ZEDA 1FOSE 4JGSA 1K92A 3U1AA 1CEZA 4JI2O 2Q0OC 2ZR2A 4Y99B 1YJ9P 1AJNA 1SQXE 3KPEA 3R66A 1EN4A 4OPHA 3ZS8C 1LTJC 2IBZE 3C1LA 1EZVD 1UFIA 4TT3G 1EXJA 1EDIA 1GK6A 2IBZD 1XILA 2Z3YA 1KQSO 1KC8Q 1L2PA 2YKQA 2O57A 5EBLC 3ZHSA 2JJLA 2RJZA 1M57C 2N1TB 2YIDA 4DR6B 1GTWA 5B1BB 2H3OA 4PJ0Z 3CHXA 3RWRD 1G2CA 2VRSA 3AE2C 3JARA 2YDEA 3RYIB 4U7OA 2K9YA 1HNZO 2L35A 3A0RA 3JALB 4GODA 3K03A 4X1KA 4XDLA 1XTGB 4HBNA 2QKAA 5K1PA 5AW6B 1HTLC 3A2FA 5JVDB 1PPJG 2ZKOA 2DQ0A 4LFAB 3B8EB 4EIJA 3RVYA 2FYUE 4H13B 2EINB 1MSDA 1QEXA 2HR3A 4IGGA 1GU5A 3SPCA 2QWQB 3ZMVA 1QLED 3AG3C 2W6JH 3JD4A 3GB7C 1X0TA 4KHXA 4LH6A 4RUEA 5J2UA 3RK3C 3OR6C 1FS0E 5GTIE 3X2QC 2ZE8A 2JDIH 4CH3A 1IBMO 3OD4A 3CWBE 2A06D 1N34B 4PD4E 1EZJA 4PDMA 2OIEA 3DC6A 4Y99C 3CRAA 2CPBA 2V7QG 4J9ZB 4O2AA 2FYUK 2HEPA 4XE5B 3L74G 3ZRWA 2E5LB 5J2UB 3OW2U 3RL0B 3HUSA 1W5CE 4BW5A 4FLYA 3CS5A 1XNQO 3OGCC 1N7SB 3LDEA 4R8CA 2CGNA 3D6ZA 1HGZA 3O8ZA 4X20A 1SQQJ 3SR2C 3D36A 3K79A 2Q5ZA 3H1IJ 1NHLA 2QWRB 3B2EE 3O65A 4J41A 1D5NA 2HODA 4O2AB 1LJ2A 4ASWA 3LIEA 2E75C 2D3OW 1M7LA 2IYOA 2A9HA 1XMQO 3V4QA 3A5TA 4U3FG 5EIBC 3CMAV 3CCJV 3ZMTA 5BMVB 5KAFE 4MS2A 1NTMJ 4DV3B 1KORA 4FIPC 4HNAB 4L74A 4L75A 1RFYA 3GVMA 1S77D 5APTA 3EVKA 1K73Q 2WLLB 3TXQA 4RQEA 4LFCO 1I7FA 3BPZA 4MVRA 3CCLV 3SFDC 5KLIC 1BQZA 4J7KA 5KLVK 2V4DA 1VQMV 1KQLA 4AILC 1TGOA 3TGUJ 4OVNF 3N2KA 4BRYB 1Y8AA 1NQTA 4DR7O 2F4VO 3NMDA 1SQBH 3SPGA 1USEA 1KKDA 1Z2GA 4BAYA 1SQBD 1A32A 2B9BA 3ZCCA 3H25A 1TUBB 1WP8A 3B77A 4JPRA 3DC5A 5IYBO 4JI1B 3GMAA 5APXA 2AZ2A 5LHGA 2H8PD 3L70E 1IBLB 2YMYA 4JAAA 3ITKA 2AXTE 1QR8A 4FPPA 3CX5H 2WPRA 2QA4P 1IFPA 1DF4A 2CPSA 1EZVG 3GF7A 2WLNA 4UB6H 3OW2O 1P7BA 1D2DA 4LNUA 2JVDA 3IF4A 2AEFA 4J10A 3B5NC 1LUVA 2OYOA 2E43A 2Q1KA 5KMGB 4JAVA 3I5DA 1RE4C 3IFXA 3KYQA 3TYYA 1N4CA 2Y9YA 1GN3A 3ASNC 5KHGA 5K1XA 2R5BA 4HB1A 4X64O 1SQXH 2M3BA 1TUEB 1USDA 4EEQA 2Q5UA 3N2GB 1QL2A 3LNMB 3KZIH 2M3EA 3F5HA 4TSFG 1IK7A 1M8OB 1R8EA 2L5GB 2UXNA 1JUNA 1SFCA 3M9BA 1AR5A 4UVAA 3Q5SA 2WT7B 3K04A 3APQA 2EZPA 3KZIZ 1NKZB 1JMBA 4I5SA 2XU6A 1OHHG 4WB4A 1SQVK 2IZ1A 4JTCB 4UB8H 2R70A 3RYIA 2Q7CA 2PI5A 1KU9A 4UB6E 1M1JB 5AVQB 2GTAA 4WFEA 3MZWB 1SFCB 1P84I 2BSKA 5JVDA 2W27A 3UCSC 1RF0A 2HG5C 3JAKA 3HD7D 1PIXA 4FVMA 3OAKA 3B4SA 3ZJZA 2ADQB 3A8TA 2QM4A 1NU1H 4YXWH 1L1FA 2PUSA 3AG3B 4FM2A 4YIPA 3AG4C 4JTAB 3CEIA 2XOKG 4F6RB 4N78D 2KS1B 3OR7C 5H2FH 4JV5B 3VYIA 1TU3F 1FXHA 2WLKA 1QLNA 2GHYA 3T1CA 3P8MC 1FFXB 2A7WA 2ZR3A 2YI9A 2XDJA 3GHGC 1BHAA 2IPPA 2ZT9C 1OCRB 3O6QB 1NTZE 4C7NB 3WB0A 3OJAB 1SC5B 5B1NA 3A0BZ 1K5QA 4QIWF 4Q20A 3V4WA 4JI3O 5DEDA 1SQPJ 3AEAC 4JBZA 3ABLC 3OFNG 3RGUA 1M56C 1R6NA 3K06A 2IBZG 2FYUJ 4X1YA 3RK3E 4O4JB 3G80A 2FXMA 1SQFA 1FZEA 2OTKE 4DV2O 2OT5A 2HG5D 3H1HE 4A5UB 3G6EP 3QO5A 3HE4A 1S72V 2WITA 1N36O 3L74J 1N8RQ 3CSXA 2F93B 1RM1C 5TISZ 3Q5PA 1FE6A 2OYHB 1XMQB 4DR1O 4CPGA 1H8AA 1M9NA 3PRJA 4OGQD 4LLHA 3T1HB 4DK0A 2M5AB 4WY4D 3H1HG 1VF6A 1VQ6V 3L35A 2V1DA 5AW0B 1N34O 1VQPV 1GMGA 1P49A 2UXXA 4NB5A 3CB2A 2WSSH 3HE4B 2HLOA 3K5MA 1NI8A 4F6EA 2WSFH 2X6AA 3RK3B 4DV4O 2UXBB 1RPRA 3CMAP 2WLLA 1L0NH 3L70H 3QG5A 1JY2N 2QVAA 1VF5B 1SLQA 4X9QA 3K0DA 3VOUA 4EB6B 3CRQA 1JTHA 2GUVA 1NT2B 3LDDA 3ASOB 3N2KB 3OUFA 3H1IH 4H13C 1SQQD 1L4AB 1HNWB 1JCDA 2F66C 2WPSA 5M1BA 1BDCA 4W7ZA 1IX9A 3KG2A 3VTPC 3T97B 1YJWP 4MW3A 4ZMDA 1KILA 5AW4B 2UU9O 3K3WA 4P2ZA 3AG1C 2E76C 3L74D 5DJTB 2O3JA 5L3FA 4TT3H 1WPBA 3CE2A 3FWLA 4GKJO 1N7SA 1EM1A 2Z5UA 1RSOA 5AW5B 2Q7GA 3ICXA 2Z5IA 2J58A 2PY5A 5CCGC 1HDJA 4DV2B 1SQPD 1NO4A 5EYPA 3B5NA 3FAVB 4B7KA 2ITCC 4WFAV 4H44C 1VQ9P 1BSMA 1VF5C 3K08A 2DYRB 4JZGA 3G4SP 3D3IA 4FLVA 1X4TA 3U10A 1L0LK 4L8JA 2UUBB 2ADPA 1ZLZA 3L72G 3C9IA 1FJKA 1FXKC 4I7ZB 1LGHB 5C39A 3HKBA 2IYPA 1EDLA 2KP8A 1OXZA 3IR9A 3L75H 4PV1B 2B9ZA 1WB7A 2CTPA 2A45I 2Q8VA 5KKZB 3EWKA 3K0GA 4X1IB 5IY5C 1PGQA 4MVZA 1SQVJ 2R9IA 3L72E 4GX0A 3CPWO 2P4VA 2NLJC 4W4LA 4UCVA 1K05A 1M1JA 4RO0A 1W0JG 4LF7O 2IBZI 2AHZA 3HKDB 4PA4A 1PP9J 1Y76A 3UO3A 4K35A 1QL1A 3AK2A 5EBMC 2OGUA 4RJTA 1DIPA 4WFBV 1ZLLA 4ZNCA 1NWQA 5FLXN 3HE5A 3TXSA 1MZFA 1M56B 1OVVA 2YKPA 4KHPO 1AV1A 4TQDA 1H38A 4J42A 3M0DC 2YXQB 5IWAO 1DEBA 3AK1A 3I55V 1OFCX 4U7NA 1VPCA 3B8MA 3FX0A 4FFBB 4CH6A 1DLBA 3QWOC 1QVGU 3FX7A 3CWBH 2B89A 5LYJA 1X8YA 3HE5B 4LFBO 4DRXA 3CCSV 4JF7A 5KAIE 1GD2E 1YZBA 2P7TC 1FDMA 3P32A 4BWAA 1S2EA 3RYHB 3ZHUA 5IDJA 2ARHA 3HTKA 5KLVE 1YBKA 1M56D 3H32B 5CB4A 1Y47A 2PGGA 4DR3O 3H1KG 3E8HA 4WBNA 4DR5B 1Y74B 1IXBA 1HJBA 2QGNA 2DJVA 4LF4B 1SQPE 1XNRB 1BGYG 4IHJB 1UIIA 4JASA 4ASUG 3MUDC 3SYAA 4LC1A 2IJIA 3ZBHA 4DV0O 1DH3A 3ZRSA 1NTZJ 2KOGA 1SQVG 5FPRA 4DO2A 1V9PA 1XL6A 1LT9A 2WSEH 3H1ID 4K8XA 1Y67A 4KXRA 2POHA 5APYA 1JB0J 2OIGA 3JD2A 5AW2B 2A79B 1RHZB 3L71E 3L75J 2DMXA 3JD0A 4EFBA 2YMKA 5EC2C 3L72J 1YIJV 1SQVE 2OCCC 1KZUB 5D5PA 1SQQE 2KIKA 1Q82W 3WUVA 1QLEB 1ZL8A 4GYCB 2O01J 4GKGA 3ZRWB 2LXCB 1IZ3A 1QU7A 5BU5A 3PH0A 1H2GA 2R72A 5L8RJ 2H43A 5KHKA 3TGUD 3CCRP 1SQPH 1EN5A 4DR7B 1BHBA 2ZT9B 3SYQA 3BRCA 2UUBO 3NFQA 4KT0J 4NTXA 2HHHB 4YTPC 3AEIA 1OZHA 2GV9A 2I8DA 2F43G 1L0NG 1OV9A 4KP4A 3CWBJ 1SP4A 3L73G 1GU4A 4R7CA 1P4RA 3EFFK 3P3NA 3HR0A 2CK3G 1MV8A 1NTMD 1YIJP 3L74H 3CJHA 5BMVA 1JX9A 2ZINA 1MNGA 1T2KC 3H1JH 4ABMA 5BU8B 2IH3C 4GX1A 4HNAA 1SKVA 4UB6Z 1NU1K 3IFMA 5FPOA 1PKXA 2KG7A 1GL2B 2IX7C 2YIAA 3H1HD 5H2FE 2YEVA 3THOA 5DN6G 2ITDC 5CMUA 2E74C 3TGUE 3RK3D 4YIOA 4DR2B 4J7ZA 2WLJA 3KHUA 3CCEV 5AW8B 1IBLO 3G6EV 1QVGO 1JCCA 3VP9A 5A9GA 2UUCB 4LF8B 4JI5B 2O01H 4R6ZA 1JOCA 1P84F 3H1LD 4XBFA 2SPZA 1RF0C 3SWYA 1TAEA 1NTZD 5KHIA 1K4DC 5JCOC 2FMLA 2QKCA 4FLWA 4LF5B 2EULA 3L9DA 4OX9B 2O1JA 1H2MA 4IYHA 4ZKIA 4YY3B 3W7WA 3PP5A 3SWFA 3ZHQA 1JOYA 3BASA 4I0XA 4KHPB 2CK3H 3MGNA 4OX9O 1ENVA 1NBMG 3A3YB 3FB5C 4TV9A 5KJ7D 3S3WA 4X89A 3RGBA 4QMAA 1LTGC 2ATKC 3E22A 4PA6A 4U3FH 1LTSC 4UB8Z 3ABKC 1PL4A 3HKCB 1S4XA 3BVHA 1KILB 4DJGA 1FAVA 1US6A 1J5EB 4PA9A 5KJ7A 2Z4EA 3SWKA 4QE7A 1HNZB 2K37A 3GW6A 4IL6Z 2A06G 1Y6XA 3Q5RA 5L3GA 3I56V 2KZIA 3SJBC 1KMIZ 1GAXA 1H0TB 1O9GA 4J11A 1NTME 1HR0O 1X79B 1N36B 1GRJA 3AEEC 4W7YA 3LDCA 3M9QA 1RE3A 2WPQA 4MVMA 2HVKC 4EI2A 5A2QN 2WT7A 1LT9C 4QGPA 4DUYO 3QO7A 4P30A 2E74B 3K5LA 5CCGD 4DYLA 1EC5A 4DXWA 3RYHA 1NYHA 2HFED 2I1JA 3E86A 3FKSG 1KILE 1KP2A 3QH9A 4PV1D 4NKGB 1EQ7A 1Q43A 1S76D 2W8ZA 1N32O 2WSCH 1W2EA 1RY3A 5D5QA 2NPSD 3C8VA 2BSKB 1S5HC 3L70G 4IFDK 1G4YB 1CZQA 3CRMA 2K9PA 4N3YB 2KNCA 4I2LC 4I55B 2NPSB 2ITAA 3G71V 3CC7P 1JY2P 1A02F 1COWG 5L3CA 2KS1A 3TNUB 4RAIA 5CCHD 2DYSB 1PV0A 5AW3B 5TISH 3LW5H 1VQMP 1FYJA 1GKFA 3W7TA 1JY3O 1PP9D 5LA6A 2Q3EA 4GZRB 2JR8A 1LTJB 3LNNA 1NU1D 2OWOA 4NTWA 4JI8O 4IYIA 5BXZA 4MT8A 1AI7A 1JY2O 1I94O 2LO1A 4H37A 1ZL8B 1LWUB 2QA4V 5KTBA 2QDOA 3LUTB 4YJ2A 1NTKG 1U97A 3UT5B 2ZM6O 4PDRA 4NPEA 1PPJE 1NTMH 2RCVA 3H01A 4I9QA 5LYJB 1BE3G 1Y9BA 3CC7V 2OQQA 2PYJA 2ZIOA 3PJSK 4LGDE 5KHJA 2P7JA 1H2KA 1YJNV 2CDYA 3I55P 1GM8A 2EJRA 1AJYA 2Q9IA 1SQPG 1O9HA 4ZOLA 2WAMA 3SGIA 1AR1B 2QIWA 3AEBC 4JZ2A 3TSIA 3H9VA 3L72H 3U0ZA 1N8RW 3P7KA 4YJ2B 2LKMA 4LF4O 2UUAB 2BEQD 2YS8A 3EHBB 3AE4C 1VQOP 1JMKC 2ZE6A 3H32A 1X22A 3KKYA 1GO3F 2Q9LA 3HB3B 5KAIZ 4GDOA 1NVOA 3H1KE 2WLIB 2RQ6A 1SA0A 4LP8A 1HGVA 2ZT9D 3HKEB 1Q6UA 2FY8A 1N7SD 1NTZH 3OA7A 1KECA 5FL7G 1FZBA 3VP8A 1KB9F 4I50B 4JYBA 2YXLA 3N27A 4WFGA 2R9RB 4WFHA 4UV9A 4X8AA 1HH0A 2QJ1A 5HFMA 5DM6V 1Z5VA 2E76B 3AG1B 1IO4A 3WB1A 1ZP0C 3F5TA 3ZHRA 1OVRA 1GZLA 5AW9B 4DCKA 1YVWA 3E8GA 3F89A 1P84H 1FC2C 4PD4D 1WPXA 2RMKB 5APUA 2EZOA 3ZX6A 2BTQA 1G8MA 4G27B 5ITZA 1VQ8V 1ZRTD 1RQUA 3T4ZA 2FYNB 3J7AU 2A0LA 4WVZA 1SQPK 3H6PA 1N86A 1N33B 4OH8B 5AVTB 3EQ2A 4L73A 1Y4MA 4LFCB 3CRRA 1KILC 3R65A 5IYZA 4DUZO 4PV1C 4JI1O 3CI9A 3FYIB 5B66Z 4WFFA 3E7KA 2LQTA 5FNVB 2ZXEB 3CL3D 4AQRD 3BY6A 3H1JD 1MG1A 1DD3A 1FZGA 2ODMA 5F2VO 3USSA 1M57D 3VQXA 3K9AA 3BRVB 1EDJA 4ZIBA 2YIUC 2EILC 3CP1A 3DSQA 3KZIE 2CGOA 2VQFB 2V7QH 3OTOO 2WQYC 3WUTA 1VQ8P 1JFFA 3CJHB 1RPOA 2IJKA 3FB6C 1S72P 4IL6E 1R1BA 1Q8IA 4D6TG 2WPDG 2FXPA 4DOJA 1AJPA 4PHZA 4QE9A 3GG2A 3V5BA 1W2BU 1AVYA 3P8CE 1AROP 3CX5D 4U3FJ 1KYOF 1SQVH 3FB8C 1KBHA 1NR7A 5KUMA 4H33A 1D7MA 1SQVD 4FLTA 3R4YA 1KQGB 1EZVE 3U1CA 4MTXA 3W7UA 1H2LA 3RYFB 2JJ1G 1JFFB 5CMZA 4CC6A 5LOVB 1XL4A 2DWEC 2ZAEB 2IU3A 1IBMB 4DT0A 1CSBA 3MTUE 4BWNA 5LXTA 2IH1C 4MVSA 4O4IB 3Q3DA 4L76A 2QTOA 1HVVA 4B3SO 5B5EZ 3H1LG 2N74A 2A06E 2ZVNB 2EBOA 2OYIA 3CCEP 2Y0EA 3JC22 4HYOA 1Z56A 3AE9C 2K9JB 2Y0IA 4NPDA 2KLVA 3AG2B 1B3QA 1J5EO 4RESB 2QRXA 2R9AA 3T1YB 3F7VC 1YJ9V 3PLNA 3H1KJ 1MZ9A 4DW1A 4TUYA 1XI1A 4UVCA 3SFEC 2BEZF 3CCUP 1F4MA 4CS3A 2QSIA 1K4CC 4LH7A 4AI8A 5LGUA 1R3JC 2PFXA 2KSEA 1VQNV 1KB9H 2ZCEA 4GOEA 3BA9A 1H8HG 2DW4A 2M6YA 4CC5A 3VMXA 3SSUA 3A0BH 1L0ND 3RBXA 1JQ0A 1ZMEC 4DV6B 3HD7C 1Q86Q 4NVPA 4B3MB 2G8YA 2B5UA 4OGQB 3JYCA 4ZOLB 5H9CA 2Z5HA 5EFWB 2ZYAA 2ZYGA 3LSUA 5AVRB 2LGWA 1RF1B 4BW9A 1V54C 2M0BA 1LUWA 4AQYB 2JKVA 2B87A 1U7MA 5H2FZ 3CC4V 3JASB 4O4LA 3L72D 4FFKA 1FD9A 4PD4H 1E1QG 5LMUO 1VQ7P 3H1KD 2UXDO 3H1KH 2QG4A 2PRRA 3H1IG 1WB8A 3A0HE 1OCZC 3ABUA 3ETQA 3ETGA 1VL2A 1K9MQ 4IL6X 3ZHVA 2EIMC 4XFJA 1GN4A 2UXCO 1OCRC 2BCCH 4N23A 1Q81W 1TUBA 1L0LG 2FYUH 4FZ1A 2YUAA 1VARA 4GKKB 4GOFA 1NTKK 1HF9A 2VQEO 2ZDIC 3AE7C 4X65B 3CRCA 3T1HO 1JTHB 1X9VA 1K73W 1K33A 2R5DA 5J9PC 1XNRO 2BTOA 1PL0A 3EXAA 4NXMB 2P67A 4DR5O 1S5LX 1M93A 2NR5A 2IW5A 1RE3C 3D8CA 3B09A 4C7UA 4RQFA 2H8PC 2NN4A 2D2CC 1AP5A 2QEXP 2UUAO 3SJAC 1E79H 1IXMA 2YIUB 1NJIW 4JI4O 1WT6A 2W83C 2XNDH 2BCCD 4OGQC 4TV8A 2AW9A 3OMNB 5CBOA 1VQ5P 3T2MA 1KQSU 3P30A 2HHHO 2XT9A 4CH4A 2PI4A 4YXDC 2EIJB 3RFRA 5AVZB 2ZNJA 1L0LH 1KC8W 5E79H 1IJDB 3F7YC 4MTOA 2ZD9A 1MABG 4NYKA 5BZBA 2AEMA 4XDJA 1SS1A 1SZTA 1T8ZA 5CA1B 2QWPB 4JYYA 2OCHA 5KKZC 1URQC 2JWDA 2DW3A 3CPWU 4QPKA 3VMYA 4Q6GA 2JIZG 2JRIA 4BRYA 1FZFA 1KYOI 5EZYB 4X88A 2HP8A 1JY3P 1BE3H 5CCGA 3VN0A 3OT7A 2KZJA 2UXCB 5AVSB 1Q2NA 2BTQB 5ITZB 3HKCA 3K9SA 2IFMA 5KAFZ 2FYZA 2CH7A 5AVUB 2HJDA 3TJTA 4AYCA 4X1IA 4ICGA 1K9MW 3E35A 2X6CA 3ETDA 4UCOA 4B3TO 2YIBD 1S0VA 1RH5B 1CI6A 5J2TB 4LNUB 3SJQC 1M57B 3N4XA 2E74D 3E89A 1NOHA 5K5GB 4K0KB 4ZHQB 4IL6H 1MKMA 5DJUB 4LF6O 2FBWC 3II6A 3ZDMA 3QF7A 4EOTA 4LF7B 2CH7B 1N32B 4LF9B 4JYAO 2WVRA 1DD4A 1L0NK 1OCZB 4PD4F 1NKDA 2YNYA 5B66E 5J2TA 1KTMA 2LGQA 1N7LA 3DXRA 3N2GA 2WMMA 2Q0AA 5LMUB 2ZVOB 1OZ0A 2EINC 4QNHB 1JNMA 2QSAA 4LFBB 2N1TD 4PJ0H 5B5EH 5CHXA 3CC2P 2ZQMA 4IIJB 4AQYO 2QJKC 2MK3A 2YO3A 2Y0DA 3H1LE 1WLEA 1PGPA 4HYTB 1B06A 1XOUA 2B1IA 5BY1A 1PP9H 3CWBD 3OMAB 2ZE5A 2G38A 4B3MO 3S1KA 1MMMA 2B1GA 1OJHA 2LP7A 2R3SA 3CYOA 3RBZA 1L0LJ 4BIZA
chains in the Genus database with same CATH topology
2WPVB 1S5LX 1Y9BA 4U7JA 2OQQA 2H88C 1OW8A 3Q3DA 3D6YA 2D2CC 4H13B 3Q2YA 1K04A 3AE6C 3AE1C 1AJYA 1VF5B 4OGQC 3FGAD 4R4LA 3AE9C 2QIWA 3S9OA 3AEBC 2FYNC 3GF3A 1EXIA 3AE8C 1HJ0A 1KQFB 2D2CB 2BEQD 4H0LD 4H13C 2WSCJ 3AE4C 4H44B 1IK7A 1OMIA 1R8EA 5M1BA 3D71A 4GDOA 3Q1MA 4I7ZC 3Q5SA 3T97B 4Z1MH 2ZT9D 3SFEC 2BEZF 2MKVA 3AEDC 1UIXA 1OW6A 2QSIA 2WSEJ 4H44D 2E76C 5KKZC 1YQ3C 3Q5RA 1KMIZ 4TT3H 2E76B 3AE3C 1ZP0C 2JP3A 1OW7A 2QJPC 4H13D 1PV3A 2JO1A 3AEEC 1JB0J 1FDIA 1FDOA 3D6ZA 1Q90D 1ZMEC 1ZRTE 1U57A 1PIXA 3O6QA 3AE5C 2YMKA 1RQUA 2E75B 2H89C 3IN6A 4H44C 2E74B 1RQVA 2V7QJ 2G8YA 1VF5D 1VF5C 4OGQB 3AECC 1NYHA 2E75C 3G9RA 1KILE 3B71A 1TU3F 4Y28J 2O01J 2QJYC 1YQ4C 2J5UA 4PV1D 4PV1C 1ZOYC 2E74D 3AEGC 3AEFC 1MKMA 3C8VA 1KORA 2ZT9C 4I7ZB 5L8RJ 2FBWC 1DD3A 3RL0g 2ZT9B 4PV1B 1DD4A 2D2CD 1GMJA 4KT0J 4YTPC 3SFDC 1PL5A 2IDBA 3EWKA 5KLIC 3AEAC 2WSFJ 1KTMA 1S1CX 2YIUC 3GLMA 1VL2A 1K05A 3IAOA 4IL6X 3RK3E 4YXDC 4RKUJ 2WQYC 2G3AA 2NZ2A 4XFJA 3ABVC 1EXJA 3H25A 4R4MA 2FXPA 2P10A 1DIPA 2QJKC 3GMAA 4H0LB 3LW5J 3Q5PA 1NGMB 2E75D 3AE2C 1HF9A 3AE7C 3R4YA 1KQGB 4OGQD 2E74C 2E76D 2K9YA 3GF7A 3D70A 1WMKA 4H0LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E74 B;  2WPV B;  2YIU C;  1S5L X;  4OGQ B;  4IL6 X;  4RKU J;  2QSI A;  2WSE J;  4Y28 J;  5KKZ C;  2O01 J;  2QJY C;  4H13 B;  2QJK C;  2E76 B;  3C8V A;  1VF5 B;  4H0L B;  4I7Z B;  2QJP C;  5L8R J;  2QIW A;  3LW5 J;  2FYN C;  1JB0 J;  1Q90 D;  2D2C B;  2ZT9 B;  4PV1 B;  1ZRT E;  2WSC J;  4H44 B;  4KT0 J;  2K9Y A;  5KLI C;  2WSF J;  2E75 B; 
#chains in the Genus database with same CATH topology
 1KV4 A;  4EKW A;  1WA8 A;  2WPV B;  3OAA G;  2GUZ A;  1JJ2 U;  3KCY A;  1Y74 A;  2MJZ A;  3FWN A;  4O4I A;  4WY4 B;  1VQK P;  1QNM A;  2DE0 X;  2HLD G;  1URF A;  2FL4 A;  1L8D A;  3ZIA G;  3H1J E;  1LTJ A;  1SQX K;  3RL0 C;  2Q7E A;  2OYI B;  3QTC A;  4MSW C;  3JAT B;  1GN2 A;  3JAR B;  3STZ C;  1J1D B;  1LP1 A;  1OIP A;  2IBZ H;  4F6R A;  1EDK A;  4R4L A;  4DR4 B;  2N9Y B;  4X1K B;  4CS4 A;  1X59 A;  2FYN C;  1ZUQ A;  5EK0 A;  3AE8 C;  4YPC A;  1EXI A;  1T3J A;  4UV8 A;  2KLU A;  2RN0 A;  2WSC J;  1YTZ T;  3H1J G;  3L4F A;  1YXB A;  3B8N A;  4PDV A;  1LTI C;  1T5E A;  3MDS A;  1AA0 A;  3D71 A;  1H89 A;  2QWN B;  2P58 A;  4DV7 O;  2UUC O;  4LF8 O;  4WWI A;  4C7N A;  1NS1 A;  1DEE G;  3AG2 C;  1PP9 G;  2F4V B;  2CUG A;  3V6I A;  1SS3 A;  3JAM N;  3L73 H;  4X20 B;  2HYN A;  3OM3 B;  3B40 A;  4K8Z A;  2WSS G;  4H13 D;  4LFA O;  5CCH C;  4JI0 O;  3CCU V;  1M1K W;  2HVJ C;  1N73 C;  1IDS A;  3IC7 A;  4I1L A;  4EYY Q;  1KKC A;  1W2B O;  1BGY D;  5JJN B;  1U57 A;  2OYQ A;  2WZ7 A;  4IFF A;  3RL0 D;  3AE5 C;  3CX5 E;  3NR7 A;  3C3S A;  4PEL A;  3L71 D;  2QJP B;  1G6U A;  3OEE G;  1QLE C;  5E1A C;  2WA4 A;  1BQ0 A;  3L73 E;  3Q4H B;  4M3L A;  2M5A A;  3M0D A;  2QWO B;  2J5U A;  1IK9 A;  2ZFC A;  5GTH E;  1SQB E;  4PI2 A;  1G1X B;  3UKM A;  5E79 E;  4D6T J;  5CA0 A;  2E3C A;  1GL2 A;  1SQX J;  1JMM A;  3OGI B;  2FFD C;  1GMJ A;  3FXD A;  5AVX B;  1RP3 B;  3WU2 H;  3CD6 V;  2RKL A;  1JA8 A;  5KLV D;  5LHH A;  1EN6 A;  1ZX3 A;  1YEW A;  4JYA B;  3RYC B;  4N6J A;  1BCC G;  2P1J A;  3WG7 B;  1J1E B;  1WP7 A;  4PA7 A;  1OCO C;  1XQ8 A;  4GIF A;  1U96 A;  4GT1 A;  3MHH C;  3ABK B;  2P10 A;  3NTN A;  4BIO A;  1Q6H A;  1T3U A;  2YXH A;  5KMG A;  4UCR A;  2AHY A;  2Y9Z A;  3ZN0 A;  4LR3 A;  4H0L B;  2L91 A;  2BE3 A;  1BS3 A;  2XKM A;  1AIL A;  3JCU Z;  1J95 A;  4LF5 O;  1HUC A;  1WMK A;  2VWJ A;  2FFD B;  3CCV P;  2YXR B;  1GDT A;  2XAJ A;  2YIC A;  2P4K A;  1NU1 J;  3WB2 A;  2BCC E;  3FXE A;  1EBO A;  4RWU A;  5EYP B;  2F23 A;  4NXN O;  1BE3 J;  1ZXG A;  2P2U A;  2CAZ C;  2Y69 C;  4LWS A;  2DYS C;  4MW8 A;  1K04 A;  1NTK J;  1L4A C;  2F1M A;  1AR4 A;  1Q7Y Q;  4FMT A;  1P84 D;  2Q4P A;  3ABT A;  1BSH A;  1H0T A;  4ASV A;  2QR4 A;  2FFD A;  3RYF A;  1G1I A;  1GL2 C;  2BCC G;  4H0L D;  2PZS A;  5KJ7 C;  2ZXW C;  3QO8 A;  4U3F E;  1SZX A;  2JEX A;  3CLQ A;  3I5C A;  3L75 E;  1OCC B;  1OCO B;  1CPY A;  4KUM A;  5CBN A;  3OTO B;  3A7O A;  3AK3 A;  5CA1 A;  3AED C;  2X7R B;  5AVY B;  1MUU A;  3S4R A;  1AVM A;  1PPJ D;  2ZNI A;  1S5L H;  5IJ9 B;  1SQG A;  4NTY A;  4B86 A;  5APV A;  1LT9 B;  2QE7 H;  1S9K E;  3VBB A;  3WMM 0;  1Q90 D;  1QQC A;  4JQ0 D;  1RF1 C;  3ZRV A;  1S3J A;  3O6Q A;  1QR9 A;  2C9N Y;  4J9Y B;  1S5L Z;  4I4T B;  1KFN A;  2E75 B;  5B1O A;  3K57 A;  2H7H A;  5AG2 A;  3N7N A;  2IZ0 A;  2ZE7 A;  3C90 A;  1NTK H;  5IJ9 A;  1OWA A;  3G9R A;  2OAR A;  2OCC B;  4P9O A;  4Y28 J;  2Z0A A;  2M8R A;  2UXD B;  3W7X A;  3X2Q B;  4ZHQ A;  1IFJ A;  4X1Y B;  3CCS P;  3JAK B;  3L74 E;  2W6J G;  1KN7 A;  4XA4 A;  2W90 A;  3G6B A;  3K58 A;  4HKZ H;  1NVP D;  4YJ3 A;  2YC0 A;  5CBH A;  1FPO A;  1T6A A;  1F23 A;  4E4E A;  1AP6 A;  3ZN1 A;  3P8C D;  1XHZ A;  3BCC J;  4X66 B;  2XUM A;  1GTO A;  3DXR B;  2PF4 E;  3E8B A;  4YHH O;  1M4U A;  2PP6 A;  3O9O A;  1PGJ A;  4B7E A;  2NZ2 A;  5CJ0 A;  3VMZ A;  5CB4 B;  4KL1 A;  3UIA A;  1NTK D;  3JCU E;  4YJ3 B;  3MD0 A;  5LP6 B;  2XNX A;  1QX8 A;  1XBL A;  3SPJ A;  3SYO A;  4GKJ B;  2E5L O;  4Z1M G;  1G2C B;  3GHG B;  3LW5 J;  1NGM B;  5APQ A;  2RH0 A;  5KLV G;  5H6R A;  2JS5 A;  2ETN A;  1OX3 A;  2E76 D;  2UU9 B;  1J1D C;  1G1J A;  4DV5 B;  1WA8 B;  4O2B B;  3ABM C;  1I08 A;  2P6J A;  2GUZ B;  5H5N A;  5BVZ A;  1Q81 Q;  1QCE A;  1NU1 G;  3KQG A;  3HKE A;  2ZM6 B;  1HR0 B;  1OW8 A;  4NXM O;  4GX2 A;  3Q2Y A;  3TCU A;  4I50 A;  3BAA A;  3ZMU A;  1PP9 E;  3V2Q A;  4EDF A;  1MZE A;  3MP7 B;  4WCE V;  1URQ B;  2AXT Z;  2L6L A;  4QPJ A;  5C8Y A;  3CCL P;  2UXB O;  3KXD A;  1DK1 A;  4WY4 C;  1K8A W;  3QVN A;  3NXS A;  1PGO A;  5B5E E;  3E22 B;  5B3S B;  3T1Y O;  4JI5 O;  4Z1M H;  1H8E G;  2GA1 A;  1I5Y A;  1NKN A;  1QHT A;  1L4A D;  3WU2 E;  2GM4 A;  1PFI A;  3CXH H;  3PTZ A;  5B66 H;  1IFM A;  1H2N A;  5IE9 A;  5KAI H;  3CME V;  3ABL B;  2DYR C;  2HFE C;  1HNX B;  3K5B A;  2DQ3 A;  1AI6 A;  3AE3 C;  3HUS B;  1L4A A;  2CTQ A;  5GTH H;  3JAW A;  4DUY B;  1OW7 A;  4AUW A;  2JO1 A;  5JJJ B;  5FNV A;  4HH2 A;  1DGS A;  1LTB C;  3KDP B;  3APO A;  1JY3 N;  3H1L H;  4JI7 O;  1MFT A;  1H2S B;  1NTM G;  5GTH Z;  3LSQ A;  2EJ7 A;  1K7D A;  3BAB A;  2YEV B;  3MHV A;  1Q3E A;  2JS3 A;  5KA5 A;  1SES A;  1AJQ A;  1WJZ A;  1AVO A;  4DR6 O;  2K1E A;  3B71 A;  1BCC E;  1YJW V;  1YQ4 C;  2Y4T A;  5LMN O;  2H94 A;  1QGK B;  1JM0 A;  1EZV H;  4TQF A;  5IYD O;  2XZR A;  4LCU C;  4JI7 B;  3BRT B;  1GM9 A;  2KYV A;  2CE4 A;  2A45 H;  2EX3 A;  4DZO A;  3JCU H;  1VQL V;  2D2C D;  2JGD A;  3JD3 A;  2J59 M;  1PL5 A;  3VQW A;  4IOI H;  1VQ7 V;  3SPH A;  1HW7 A;  3W7S A;  1K97 A;  4B3R O;  1NTZ G;  1BDD A;  1K3E A;  1KB9 I;  1CI6 B;  5KLI B;  3FYE B;  4DV1 B;  2XAH A;  1SER A;  1VF7 A;  5LP6 C;  1I0H A;  4F4L A;  2G3A A;  2OTL P;  2JEE A;  2C0W A;  3EFG A;  4R4M A;  1B6Q A;  2DN9 A;  3STL C;  1NH4 A;  5IYC O;  2WLH A;  3G4S V;  4A7P A;  4UFZ A;  2QJY B;  1YDX A;  1FZC B;  4N21 A;  5LL6 Y;  1B04 A;  4CS2 A;  2QM7 A;  2ZDI A;  4HZ3 A;  2FKX A;  3D70 A;  4IT5 A;  4B3S B;  3VOP A;  3M06 A;  4UUJ C;  1LWU A;  3ASN B;  3D36 C;  1RM1 B;  4UVB A;  3HTK B;  1Y76 B;  3M8A A;  1ZN5 A;  3M99 B;  3UT5 A;  1SRY A;  3L75 G;  3HD7 B;  2AZ0 A;  1N73 A;  4ZI7 A;  5JH7 B;  5CCH A;  4DV5 O;  1N7S C;  3CCM V;  3BAT A;  3PN1 A;  2Q69 A;  4DV0 B;  3FGA D;  5IY5 B;  2PAJ A;  3CXH E;  4JI4 B;  4P9P A;  2ZXX A;  1NTZ K;  2LR2 A;  3BHP A;  1FJG O;  2HPC A;  2WA3 A;  1YI2 V;  3SDL A;  5KUK A;  2P22 C;  1IBK O;  1OMI A;  2Q7H A;  3CCQ V;  1BZK A;  3UM7 A;  3G71 P;  1N0N A;  1FXK B;  4JI6 O;  4I7Z C;  4BIU A;  2LFS A;  1VP7 A;  3IGA C;  2PTM A;  5JH7 A;  2WLI A;  5B1A B;  1KYO D;  2LW7 A;  3CX5 F;  4WY4 A;  2Y48 A;  4I55 A;  1EZV I;  3ABM B;  2NPS A;  2OYH A;  1FOS F;  2RNB A;  1WAZ A;  4JV5 O;  4KFM A;  3BEH A;  2Q68 A;  3OE7 G;  3CXH F;  1Q86 W;  2XHB A;  2Y0P A;  4W4K A;  1YYC A;  1NH2 B;  1BSN A;  1ZTE A;  2QJK B;  1FXV A;  1MOF A;  3VQY A;  1FDI A;  4W80 A;  1NTM K;  3ZRX A;  5C93 A;  1VQ6 P;  1UJW B;  4IHJ A;  5AVV B;  2HJF C;  1NH2 D;  4Z2W A;  2MW2 B;  3L73 J;  1SF9 A;  2QKS A;  4FZ0 A;  4B3R B;  3M9H A;  3V2N A;  1W59 A;  1WNS A;  2XAQ A;  1HP8 A;  3FFQ A;  3RK2 C;  2X6B A;  1KYO H;  3LSS A;  1SVF A;  1XDC A;  3A0H H;  4MN4 C;  3AG7 A;  5C8Y B;  3AEG C;  2O1K A;  2RDC A;  3H1H H;  5B1A C;  2GUS A;  4MTG A;  4DV3 O;  1Y66 A;  3UO2 A;  1CW5 A;  4GCZ A;  4DV1 O;  3RL0 g;  3LID A;  5CN0 A;  2LJ2 A;  1VQO V;  1E5W A;  2Q6A A;  2WSF J;  2HOD B;  2Y4U A;  1KD1 W;  3ML0 A;  4PI0 A;  1AI5 A;  2OYI C;  2QE7 G;  4O4J A;  5JCO A;  3E2E A;  3GLM A;  3JAW B;  3V2R A;  1RSO B;  2KSJ A;  2ZIM A;  4FLX A;  4NXN B;  4HJG H;  3CXH D;  3HPL C;  3CME P;  4DR3 B;  2Q6Q A;  4O4H B;  1R6T A;  2JWA A;  2XV5 A;  1M90 Q;  3GHG A;  1YSC A;  1FJG B;  1SQQ K;  1NTK E;  2K3R A;  1NJI Q;  2EIL B;  3TGU H;  2C2A A;  5AW7 B;  1P7G A;  1VEW A;  1R5L A;  1VQ9 V;  1VQK V;  1PM9 A;  1JEK A;  4U7J A;  5GON B;  5H6Q A;  5L3B A;  4YXW G;  1NAF A;  1HNW O;  1J2J B;  1ZV8 A;  5LGN A;  4XDK A;  5EBW C;  3ZHT A;  2A3Q A;  4UB8 E;  2CTW A;  1XMO O;  4CBC A;  1H88 A;  1I94 B;  2RMZ A;  3H1L J;  1IZN B;  1WRG A;  1QVF U;  1EFR G;  1URQ A;  2M7W A;  2W6B A;  3GWK C;  5IYZ B;  1I5X A;  2D2C B;  3ZMZ A;  3E1R A;  5APS A;  3H1I E;  3WUU A;  3HKD A;  1VQN P;  1ZR2 A;  1SFC C;  1ORQ C;  1UPG A;  4BXL A;  2MKV A;  1DX7 A;  3MAQ A;  4LWS B;  1OW6 A;  2UWJ E;  5LMN B;  2PYL A;  1MSW D;  4DR2 O;  4H44 D;  4DR4 O;  4DW0 A;  2FYU G;  1KYO E;  4LBE C;  2E42 A;  1BE3 D;  5GW7 A;  1D5A A;  2V4H A;  5DEC A;  3BCC G;  1N0J A;  2JP3 A;  4DV4 B;  1GW3 A;  1Z5W A;  1BL8 A;  1AI4 A;  2ZYD A;  3VMA A;  1BT8 A;  3E8F A;  2R32 A;  3SYC A;  1FZA A;  4ZBM A;  2Q3I A;  3B5N B;  3V2P A;  2N04 A;  4ZI7 B;  1KB9 D;  1IFN A;  4FK5 C;  2K88 A;  1Q6I A;  3BCC E;  4B08 A;  1NR1 A;  1GK9 A;  2ZJS E;  3R2P A;  2KQX A;  3CC4 P;  4U3F D;  3A2A A;  3L71 G;  3MUD A;  3F5W C;  1IC2 A;  1R6K A;  2OYH C;  1ZWI C;  1LR1 A;  1XRE A;  1LNQ A;  1XHX A;  5AVW B;  1VQ4 P;  2C9L Y;  4JI0 B;  3CCJ P;  1M1K Q;  4O9B A;  3CD6 P;  4FLZ A;  5LA6 B;  3K5O A;  4I4T A;  5LGT A;  2KXP B;  4GX5 A;  3RK2 B;  1Q82 Q;  4ZKU A;  3L37 A;  3CX5 I;  1NVP B;  4IFM A;  2QTS A;  1S1C X;  1GW4 A;  4FLU A;  4RKU J;  1FFX A;  2DWD C;  5EC1 C;  3BVO A;  4JYC A;  4MVU A;  4N78 E;  1W0K G;  5IJ0 A;  3T4D A;  1MFZ A;  3OEH G;  1FZC A;  3J81 N;  3JAT A;  1K5S A;  2E75 D;  3BCC H;  3M7M X;  3BCC D;  3AG4 B;  5KLV J;  4QJF B;  1KB9 E;  1LTA C;  3CCV V;  3L71 J;  5CA3 A;  2QEX V;  1S9K D;  3D3Q A;  3JD1 A;  3WFV A;  3UQ8 A;  5EIB D;  2I1K A;  1FZC C;  2OTJ V;  2N1T C;  2IFN A;  2NNU A;  3RK2 D;  5JQG B;  3FD9 A;  2GBO A;  3CXC U;  1VQ5 V;  3E83 A;  3HD7 A;  1JO5 A;  1YHQ V;  5LP6 A;  5CJ4 A;  1HWY A;  1PD3 A;  1M1J C;  4UXN A;  5APW A;  5GTI Z;  1F51 A;  1ZSP A;  1HWT C;  4TV8 B;  3GF3 A;  4X62 B;  4D7S A;  2WTY A;  1SET A;  1VIB A;  1HJ0 A;  4JI2 B;  1KQF B;  1Q5O A;  1JJO A;  5JQG A;  4GUN A;  3L73 D;  4LF9 O;  5GTI H;  5AW1 B;  1FXK A;  1KUQ A;  4G2K A;  1AQT A;  2B87 B;  1V54 B;  5TIS E;  1QBZ A;  3H1H J;  4K0K O;  5LBQ A;  2VQF O;  3M0A A;  3RVZ A;  4X62 O;  1SQQ H;  2OTJ P;  4E2L A;  1YQ3 C;  1IUR A;  1BCC H;  3OTF A;  4X64 B;  3CCQ P;  4L87 A;  2EIK B;  2DOS A;  3CXH I;  1JPX A;  4TWK A;  5KLV H;  1YHQ P;  4HAM A;  4UCS A;  1ZAU A;  1PV3 A;  2KSD A;  2Y0C A;  1YJN P;  1FDO A;  1YF2 A;  2YSU B;  1V55 C;  1TA8 A;  4MTF A;  3TET A;  2F95 B;  4ZKP A;  1KP3 A;  2IJJ A;  2AXT H;  1N2D C;  4CH5 A;  1GH6 A;  4D6T H;  3L70 D;  1YTF B;  3W67 A;  1R73 A;  3E1I A;  3IN6 A;  1QVF O;  2KKW A;  1CXZ B;  1AQ5 A;  3OUS A;  2YXY A;  1VF5 D;  1N33 O;  3AEC C;  3JSN A;  2VQE B;  1GM7 A;  4I0X B;  1F7Y A;  4JI8 B;  3QNE A;  2QJY C;  2P06 A;  1S5L E;  1ZOY C;  1R3K C;  4K3A A;  1SQB J;  3SYP A;  1BCC D;  1PNM A;  1DF5 A;  3MIW A;  5B3S C;  2KI7 B;  4PJ0 E;  3JSV C;  2Q73 A;  2VS0 A;  4R50 A;  2LXB A;  3CC2 V;  3FAV A;  3K59 A;  3KCX A;  3L75 D;  4PD4 I;  2GDS A;  1ZW0 A;  4I6M C;  4FJC C;  1FS0 G;  1R3I C;  2YO2 A;  5KAF H;  1HBW A;  3CCR V;  3HRN A;  1DTO A;  3WU2 Z;  5LOV A;  1FKA O;  3I56 P;  4JI6 B;  4KJM A;  1XUQ A;  2EIM B;  3HKB B;  4IIJ A;  1YTZ I;  2KG7 B;  2WLM A;  1V55 B;  2IM9 A;  4NR1 A;  5LXT B;  1VF6 C;  3WG7 C;  4PDL A;  1Q7Y W;  2FTK A;  1PZQ A;  3JSL A;  5L3E A;  2O01 N;  2JK5 C;  1OVU A;  3G67 A;  1VQP P;  2BOB C;  5IWA B;  2EIK C;  3ZMS A;  5B1B C;  2FKW B;  1F4N A;  1FFT B;  3GWO A;  2LW1 A;  4MVO A;  1TVK A;  1SQX D;  4GLX A;  3C3T A;  1T2K D;  2BCC J;  2FB5 A;  2R44 A;  4FM1 A;  1BCC J;  2H88 C;  4C7R A;  1XEQ A;  3D6Y A;  3SJC C;  4PA3 A;  4J80 A;  3G3Z A;  3RN4 A;  4WBA A;  2KNC B;  2XAS A;  3AE6 C;  2EIJ C;  2A45 G;  2Q67 A;  1HNX O;  1GK4 A;  4JF3 A;  1LP1 B;  1VQ4 V;  2E5T A;  3S9O A;  1XMO B;  3TNU A;  2XAG A;  2N05 A;  2LFR A;  5HFL A;  4H44 B;  1GN6 A;  3FB7 C;  1BGY J;  1OCC C;  3L36 A;  4FFB A;  1VMG A;  2CTR A;  1L0L E;  2YIB A;  4RUF A;  5IJ0 B;  1SQB G;  3ETE A;  5CBF A;  2X0L A;  4CZZ A;  2BAS A;  1N73 B;  4G28 B;  2N9B A;  1UIX A;  5IT9 N;  4DRX B;  2PGD A;  2WSE J;  2AEJ A;  2QM8 A;  4MVQ A;  4OWF A;  1FAF A;  2K9J A;  1SFC D;  4I9W A;  4DR1 B;  2HPC B;  1K34 A;  1AB3 A;  5KHH A;  1YCI A;  5JJE B;  2NRG A;  2GSM B;  1JR9 A;  2JEU A;  2KB1 A;  1RF1 A;  1S5J A;  1ZRT E;  3VQV A;  4D6T E;  4WBN B;  3DTU B;  1E1R G;  3TGU G;  3CWB G;  3A0H Z;  1TVK B;  1M5I A;  1XNQ B;  3JAS A;  4O4L B;  4YHH B;  1L0N J;  2N1T A;  4NPF X;  3IC9 A;  1BGY E;  1RQV A;  2W6I G;  2V7Q J;  3TK1 A;  2P5O A;  1ROP A;  1KD1 Q;  2YKO A;  2FXO A;  1YIT P;  2NPS C;  5L3D A;  3JAL A;  2VWK A;  1SQX G;  4Z1V A;  1THZ A;  1FBM A;  1WN7 A;  4DV7 B;  4DV6 O;  2E5Y A;  3RT3 C;  4BR6 A;  1NZ6 A;  1FJP A;  2A06 H;  4X66 O;  2IDB A;  4B3T B;  1E79 G;  1VQL P;  4OPA A;  2WWW A;  3IAY A;  1L0N E;  2AXC A;  3DGE A;  1SQQ G;  4YY3 O;  1BMF G;  4TOI A;  4AHC A;  1XTC C;  3IAO A;  4O2B A;  4U3J A;  1RE4 A;  2W0F C;  2JDI G;  3ABV C;  4WF9 V;  2XTA A;  2OTL V;  1YIT V;  1LWU C;  2HKO A;  4DUZ B;  2FYU D;  2KK7 A;  3L71 H;  3U59 A;  4DK1 A;  1L0L D;  3BFR A;  4EB6 A;  2JJ2 G;  3BA8 A;  1BGY H;  5CBG A;  3M91 A;  1CP9 A;  4U3J B;  2GTS A;  3SPI A;  4D7T A;  1GL2 D;  4H0L C;  2VRZ A;  4JAU A;  1K8A Q;  3H1J J;  3T97 A;  3U11 A;  1NU1 E;  2IJH A;  3A0B E;  1MA1 A;  1P84 E;  3CCM P;  4O4H A;  1URQ D;  1PNL A;  1IBK B;  1ZR4 A;  2YI8 A;  3AE1 C;  4C46 A;  4FM0 A;  5E79 Z;  3Q4H A;  1KFM A;  5BR8 O;  3P3P A;  5JWP A;  3PHL A;  4TLF A;  2C0X A;  1M90 W;  2AGA A;  4JI3 B;  2KB7 P;  4EFE A;  2Y69 B;  1SQB K;  5TJH A;  3L70 J;  5EZY A;  1VDF A;  2P90 A;  3Q1M A;  3S3X A;  4JTD B;  5KA6 A;  1YI2 P;  3TF5 A;  1SA0 B;  5KX5 A;  1U7J A;  2ZXW B;  5GON A;  2RN9 A;  1R3L C;  5CA0 B;  1A02 J;  4D6T D;  1JCH A;  1JVM A;  1NAY A;  5LHI A;  5BR8 B;  2W0X A;  3TDK A;  3K5N A;  2R3C A;  1KIL D;  4J7J A;  3RYC A;  1YTF D;  2QJP C;  4TV9 B;  4JPZ B;  4RO2 A;  2BOC C;  5KX5 B;  4LF6 B;  3W68 A;  3HUS C;  1FU1 A;  3RW0 A;  1PPJ H;  2JGD B;  2H89 C;  2KUB A;  2B88 A;  3ASO C;  1AFO A;  3OMI B;  4X65 O;  3MHS C;  2JGU A;  1IVS A;  1BE3 E;  3B5N D;  4GKK O;  3JCZ A;  3IJ4 A;  1PNK A;  4UCT A;  1R5S A;  3AEF C;  4UCU A;  2W6A A;  2K1A A;  2ILM A;  1J1E C;  1IFD A;  4TUY B;  2IU0 A;  2XND G;  4OXS A;  3J80 N;  1LT1 A;  2XAF A;  1IFI A;  1LTT C;  3ZED A;  1FOS E;  4JGS A;  1K92 A;  3U1A A;  1CEZ A;  4JI2 O;  2Q0O C;  2ZR2 A;  4Y99 B;  1YJ9 P;  1AJN A;  1SQX E;  3KPE A;  3R66 A;  1EN4 A;  4OPH A;  3ZS8 C;  1LTJ C;  2IBZ E;  3C1L A;  1EZV D;  1UFI A;  4TT3 G;  1EXJ A;  1EDI A;  1GK6 A;  2IBZ D;  1XIL A;  2Z3Y A;  1KQS O;  1KC8 Q;  1L2P A;  2YKQ A;  2O57 A;  5EBL C;  3ZHS A;  2JJL A;  2RJZ A;  1M57 C;  2N1T B;  2YID A;  4DR6 B;  1GTW A;  5B1B B;  2H3O A;  4PJ0 Z;  3CHX A;  3RWR D;  1G2C A;  2VRS A;  3AE2 C;  3JAR A;  2YDE A;  3RYI B;  4U7O A;  2K9Y A;  1HNZ O;  2L35 A;  3A0R A;  3JAL B;  4GOD A;  3K03 A;  4X1K A;  4XDL A;  1XTG B;  4HBN A;  2QKA A;  5K1P A;  5AW6 B;  1HTL C;  3A2F A;  5JVD B;  1PPJ G;  2ZKO A;  2DQ0 A;  4LFA B;  3B8E B;  4EIJ A;  3RVY A;  2FYU E;  4H13 B;  2EIN B;  1MSD A;  1QEX A;  2HR3 A;  4IGG A;  1GU5 A;  3SPC A;  2QWQ B;  3ZMV A;  1QLE D;  3AG3 C;  2W6J H;  3JD4 A;  3GB7 C;  1X0T A;  4KHX A;  4LH6 A;  4RUE A;  5J2U A;  3RK3 C;  3OR6 C;  1FS0 E;  5GTI E;  3X2Q C;  2ZE8 A;  2JDI H;  4CH3 A;  1IBM O;  3OD4 A;  3CWB E;  2A06 D;  1N34 B;  4PD4 E;  1EZJ A;  4PDM A;  2OIE A;  3DC6 A;  4Y99 C;  3CRA A;  2CPB A;  2V7Q G;  4J9Z B;  4O2A A;  2FYU K;  2HEP A;  4XE5 B;  3L74 G;  3ZRW A;  2E5L B;  5J2U B;  3OW2 U;  3RL0 B;  3HUS A;  1W5C E;  4BW5 A;  4FLY A;  3CS5 A;  1XNQ O;  3OGC C;  1N7S B;  3LDE A;  4R8C A;  2CGN A;  3D6Z A;  1HGZ A;  3O8Z A;  4X20 A;  1SQQ J;  3SR2 C;  3D36 A;  3K79 A;  2Q5Z A;  3H1I J;  1NHL A;  2QWR B;  3B2E E;  3O65 A;  4J41 A;  1D5N A;  2HOD A;  4O2A B;  1LJ2 A;  4ASW A;  3LIE A;  2E75 C;  2D3O W;  1M7L A;  2IYO A;  2A9H A;  1XMQ O;  3V4Q A;  3A5T A;  4U3F G;  5EIB C;  3CMA V;  3CCJ V;  3ZMT A;  5BMV B;  5KAF E;  4MS2 A;  1NTM J;  4DV3 B;  1KOR A;  4FIP C;  4HNA B;  4L74 A;  4L75 A;  1RFY A;  3GVM A;  1S77 D;  5APT A;  3EVK A;  1K73 Q;  2WLL B;  3TXQ A;  4RQE A;  4LFC O;  1I7F A;  3BPZ A;  4MVR A;  3CCL V;  3SFD C;  5KLI C;  1BQZ A;  4J7K A;  5KLV K;  2V4D A;  1VQM V;  1KQL A;  4AIL C;  1TGO A;  3TGU J;  4OVN F;  3N2K A;  4BRY B;  1Y8A A;  1NQT A;  4DR7 O;  2F4V O;  3NMD A;  1SQB H;  3SPG A;  1USE A;  1KKD A;  1Z2G A;  4BAY A;  1SQB D;  1A32 A;  2B9B A;  3ZCC A;  3H25 A;  1TUB B;  1WP8 A;  3B77 A;  4JPR A;  3DC5 A;  5IYB O;  4JI1 B;  3GMA A;  5APX A;  2AZ2 A;  5LHG A;  2H8P D;  3L70 E;  1IBL B;  2YMY A;  4JAA A;  3ITK A;  2AXT E;  1QR8 A;  4FPP A;  3CX5 H;  2WPR A;  2QA4 P;  1IFP A;  1DF4 A;  2CPS A;  1EZV G;  3GF7 A;  2WLN A;  4UB6 H;  3OW2 O;  1P7B A;  1D2D A;  4LNU A;  2JVD A;  3IF4 A;  2AEF A;  4J10 A;  3B5N C;  1LUV A;  2OYO A;  2E43 A;  2Q1K A;  5KMG B;  4JAV A;  3I5D A;  1RE4 C;  3IFX A;  3KYQ A;  3TYY A;  1N4C A;  2Y9Y A;  1GN3 A;  3ASN C;  5KHG A;  5K1X A;  2R5B A;  4HB1 A;  4X64 O;  1SQX H;  2M3B A;  1TUE B;  1USD A;  4EEQ A;  2Q5U A;  3N2G B;  1QL2 A;  3LNM B;  3KZI H;  2M3E A;  3F5H A;  4TSF G;  1IK7 A;  1M8O B;  1R8E A;  2L5G B;  2UXN A;  1JUN A;  1SFC A;  3M9B A;  1AR5 A;  4UVA A;  3Q5S A;  2WT7 B;  3K04 A;  3APQ A;  2EZP A;  3KZI Z;  1NKZ B;  1JMB A;  4I5S A;  2XU6 A;  1OHH G;  4WB4 A;  1SQV K;  2IZ1 A;  4JTC B;  4UB8 H;  2R70 A;  3RYI A;  2Q7C A;  2PI5 A;  1KU9 A;  4UB6 E;  1M1J B;  5AVQ B;  2GTA A;  4WFE A;  3MZW B;  1SFC B;  1P84 I;  2BSK A;  5JVD A;  2W27 A;  3UCS C;  1RF0 A;  2HG5 C;  3JAK A;  3HD7 D;  1PIX A;  4FVM A;  3OAK A;  3B4S A;  3ZJZ A;  2ADQ B;  3A8T A;  2QM4 A;  1NU1 H;  4YXW H;  1L1F A;  2PUS A;  3AG3 B;  4FM2 A;  4YIP A;  3AG4 C;  4JTA B;  3CEI A;  2XOK G;  4F6R B;  4N78 D;  2KS1 B;  3OR7 C;  5H2F H;  4JV5 B;  3VYI A;  1TU3 F;  1FXH A;  2WLK A;  1QLN A;  2GHY A;  3T1C A;  3P8M C;  1FFX B;  2A7W A;  2ZR3 A;  2YI9 A;  2XDJ A;  3GHG C;  1BHA A;  2IPP A;  2ZT9 C;  1OCR B;  3O6Q B;  1NTZ E;  4C7N B;  3WB0 A;  3OJA B;  1SC5 B;  5B1N A;  3A0B Z;  1K5Q A;  4QIW F;  4Q20 A;  3V4W A;  4JI3 O;  5DED A;  1SQP J;  3AEA C;  4JBZ A;  3ABL C;  3OFN G;  3RGU A;  1M56 C;  1R6N A;  3K06 A;  2IBZ G;  2FYU J;  4X1Y A;  3RK3 E;  4O4J B;  3G80 A;  2FXM A;  1SQF A;  1FZE A;  2OTK E;  4DV2 O;  2OT5 A;  2HG5 D;  3H1H E;  4A5U B;  3G6E P;  3QO5 A;  3HE4 A;  1S72 V;  2WIT A;  1N36 O;  3L74 J;  1N8R Q;  3CSX A;  2F93 B;  1RM1 C;  5TIS Z;  3Q5P A;  1FE6 A;  2OYH B;  1XMQ B;  4DR1 O;  4CPG A;  1H8A A;  1M9N A;  3PRJ A;  4OGQ D;  4LLH A;  3T1H B;  4DK0 A;  2M5A B;  4WY4 D;  3H1H G;  1VF6 A;  1VQ6 V;  3L35 A;  2V1D A;  5AW0 B;  1N34 O;  1VQP V;  1GMG A;  1P49 A;  2UXX A;  4NB5 A;  3CB2 A;  2WSS H;  3HE4 B;  2HLO A;  3K5M A;  1NI8 A;  4F6E A;  2WSF H;  2X6A A;  3RK3 B;  4DV4 O;  2UXB B;  1RPR A;  3CMA P;  2WLL A;  1L0N H;  3L70 H;  3QG5 A;  1JY2 N;  2QVA A;  1VF5 B;  1SLQ A;  4X9Q A;  3K0D A;  3VOU A;  4EB6 B;  3CRQ A;  1JTH A;  2GUV A;  1NT2 B;  3LDD A;  3ASO B;  3N2K B;  3OUF A;  3H1I H;  4H13 C;  1SQQ D;  1L4A B;  1HNW B;  1JCD A;  2F66 C;  2WPS A;  5M1B A;  1BDC A;  4W7Z A;  1IX9 A;  3KG2 A;  3VTP C;  3T97 B;  1YJW P;  4MW3 A;  4ZMD A;  1KIL A;  5AW4 B;  2UU9 O;  3K3W A;  4P2Z A;  3AG1 C;  2E76 C;  3L74 D;  5DJT B;  2O3J A;  5L3F A;  4TT3 H;  1WPB A;  3CE2 A;  3FWL A;  4GKJ O;  1N7S A;  1EM1 A;  2Z5U A;  1RSO A;  5AW5 B;  2Q7G A;  3ICX A;  2Z5I A;  2J58 A;  2PY5 A;  5CCG C;  1HDJ A;  4DV2 B;  1SQP D;  1NO4 A;  5EYP A;  3B5N A;  3FAV B;  4B7K A;  2ITC C;  4WFA V;  4H44 C;  1VQ9 P;  1BSM A;  1VF5 C;  3K08 A;  2DYR B;  4JZG A;  3G4S P;  3D3I A;  4FLV A;  1X4T A;  3U10 A;  1L0L K;  4L8J A;  2UUB B;  2ADP A;  1ZLZ A;  3L72 G;  3C9I A;  1FJK A;  1FXK C;  4I7Z B;  1LGH B;  5C39 A;  3HKB A;  2IYP A;  1EDL A;  2KP8 A;  1OXZ A;  3IR9 A;  3L75 H;  4PV1 B;  2B9Z A;  1WB7 A;  2CTP A;  2A45 I;  2Q8V A;  5KKZ B;  3EWK A;  3K0G A;  4X1I B;  5IY5 C;  1PGQ A;  4MVZ A;  1SQV J;  2R9I A;  3L72 E;  4GX0 A;  3CPW O;  2P4V A;  2NLJ C;  4W4L A;  4UCV A;  1K05 A;  1M1J A;  4RO0 A;  1W0J G;  4LF7 O;  2IBZ I;  2AHZ A;  3HKD B;  4PA4 A;  1PP9 J;  1Y76 A;  3UO3 A;  4K35 A;  1QL1 A;  3AK2 A;  5EBM C;  2OGU A;  4RJT A;  1DIP A;  4WFB V;  1ZLL A;  4ZNC A;  1NWQ A;  5FLX N;  3HE5 A;  3TXS A;  1MZF A;  1M56 B;  1OVV A;  2YKP A;  4KHP O;  1AV1 A;  4TQD A;  1H38 A;  4J42 A;  3M0D C;  2YXQ B;  5IWA O;  1DEB A;  3AK1 A;  3I55 V;  1OFC X;  4U7N A;  1VPC A;  3B8M A;  3FX0 A;  4FFB B;  4CH6 A;  1DLB A;  3QWO C;  1QVG U;  3FX7 A;  3CWB H;  2B89 A;  5LYJ A;  1X8Y A;  3HE5 B;  4LFB O;  4DRX A;  3CCS V;  4JF7 A;  5KAI E;  1GD2 E;  1YZB A;  2P7T C;  1FDM A;  3P32 A;  4BWA A;  1S2E A;  3RYH B;  3ZHU A;  5IDJ A;  2ARH A;  3HTK A;  5KLV E;  1YBK A;  1M56 D;  3H32 B;  5CB4 A;  1Y47 A;  2PGG A;  4DR3 O;  3H1K G;  3E8H A;  4WBN A;  4DR5 B;  1Y74 B;  1IXB A;  1HJB A;  2QGN A;  2DJV A;  4LF4 B;  1SQP E;  1XNR B;  1BGY G;  4IHJ B;  1UII A;  4JAS A;  4ASU G;  3MUD C;  3SYA A;  4LC1 A;  2IJI A;  3ZBH A;  4DV0 O;  1DH3 A;  3ZRS A;  1NTZ J;  2KOG A;  1SQV G;  5FPR A;  4DO2 A;  1V9P A;  1XL6 A;  1LT9 A;  2WSE H;  3H1I D;  4K8X A;  1Y67 A;  4KXR A;  2POH A;  5APY A;  1JB0 J;  2OIG A;  3JD2 A;  5AW2 B;  2A79 B;  1RHZ B;  3L71 E;  3L75 J;  2DMX A;  3JD0 A;  4EFB A;  2YMK A;  5EC2 C;  3L72 J;  1YIJ V;  1SQV E;  2OCC C;  1KZU B;  5D5P A;  1SQQ E;  2KIK A;  1Q82 W;  3WUV A;  1QLE B;  1ZL8 A;  4GYC B;  2O01 J;  4GKG A;  3ZRW B;  2LXC B;  1IZ3 A;  1QU7 A;  5BU5 A;  3PH0 A;  1H2G A;  2R72 A;  5L8R J;  2H43 A;  5KHK A;  3TGU D;  3CCR P;  1SQP H;  1EN5 A;  4DR7 B;  1BHB A;  2ZT9 B;  3SYQ A;  3BRC A;  2UUB O;  3NFQ A;  4KT0 J;  4NTX A;  2HHH B;  4YTP C;  3AEI A;  1OZH A;  2GV9 A;  2I8D A;  2F43 G;  1L0N G;  1OV9 A;  4KP4 A;  3CWB J;  1SP4 A;  3L73 G;  1GU4 A;  4R7C A;  1P4R A;  3EFF K;  3P3N A;  3HR0 A;  2CK3 G;  1MV8 A;  1NTM D;  1YIJ P;  3L74 H;  3CJH A;  5BMV A;  1JX9 A;  2ZIN A;  1MNG A;  1T2K C;  3H1J H;  4ABM A;  5BU8 B;  2IH3 C;  4GX1 A;  4HNA A;  1SKV A;  4UB6 Z;  1NU1 K;  3IFM A;  5FPO A;  1PKX A;  2KG7 A;  1GL2 B;  2IX7 C;  2YIA A;  3H1H D;  5H2F E;  2YEV A;  3THO A;  5DN6 G;  2ITD C;  5CMU A;  2E74 C;  3TGU E;  3RK3 D;  4YIO A;  4DR2 B;  4J7Z A;  2WLJ A;  3KHU A;  3CCE V;  5AW8 B;  1IBL O;  3G6E V;  1QVG O;  1JCC A;  3VP9 A;  5A9G A;  2UUC B;  4LF8 B;  4JI5 B;  2O01 H;  4R6Z A;  1JOC A;  1P84 F;  3H1L D;  4XBF A;  2SPZ A;  1RF0 C;  3SWY A;  1TAE A;  1NTZ D;  5KHI A;  1K4D C;  5JCO C;  2FML A;  2QKC A;  4FLW A;  4LF5 B;  2EUL A;  3L9D A;  4OX9 B;  2O1J A;  1H2M A;  4IYH A;  4ZKI A;  4YY3 B;  3W7W A;  3PP5 A;  3SWF A;  3ZHQ A;  1JOY A;  3BAS A;  4I0X A;  4KHP B;  2CK3 H;  3MGN A;  4OX9 O;  1ENV A;  1NBM G;  3A3Y B;  3FB5 C;  4TV9 A;  5KJ7 D;  3S3W A;  4X89 A;  3RGB A;  4QMA A;  1LTG C;  2ATK C;  3E22 A;  4PA6 A;  4U3F H;  1LTS C;  4UB8 Z;  3ABK C;  1PL4 A;  3HKC B;  1S4X A;  3BVH A;  1KIL B;  4DJG A;  1FAV A;  1US6 A;  1J5E B;  4PA9 A;  5KJ7 A;  2Z4E A;  3SWK A;  4QE7 A;  1HNZ B;  2K37 A;  3GW6 A;  4IL6 Z;  2A06 G;  1Y6X A;  3Q5R A;  5L3G A;  3I56 V;  2KZI A;  3SJB C;  1KMI Z;  1GAX A;  1H0T B;  1O9G A;  4J11 A;  1NTM E;  1HR0 O;  1X79 B;  1N36 B;  1GRJ A;  3AEE C;  4W7Y A;  3LDC A;  3M9Q A;  1RE3 A;  2WPQ A;  4MVM A;  2HVK C;  4EI2 A;  5A2Q N;  2WT7 A;  1LT9 C;  4QGP A;  4DUY O;  3QO7 A;  4P30 A;  2E74 B;  3K5L A;  5CCG D;  4DYL A;  1EC5 A;  4DXW A;  3RYH A;  1NYH A;  2HFE D;  2I1J A;  3E86 A;  3FKS G;  1KIL E;  1KP2 A;  3QH9 A;  4PV1 D;  4NKG B;  1EQ7 A;  1Q43 A;  1S76 D;  2W8Z A;  1N32 O;  2WSC H;  1W2E A;  1RY3 A;  5D5Q A;  2NPS D;  3C8V A;  2BSK B;  1S5H C;  3L70 G;  4IFD K;  1G4Y B;  1CZQ A;  3CRM A;  2K9P A;  4N3Y B;  2KNC A;  4I2L C;  4I55 B;  2NPS B;  2ITA A;  3G71 V;  3CC7 P;  1JY2 P;  1A02 F;  1COW G;  5L3C A;  2KS1 A;  3TNU B;  4RAI A;  5CCH D;  2DYS B;  1PV0 A;  5AW3 B;  5TIS H;  3LW5 H;  1VQM P;  1FYJ A;  1GKF A;  3W7T A;  1JY3 O;  1PP9 D;  5LA6 A;  2Q3E A;  4GZR B;  2JR8 A;  1LTJ B;  3LNN A;  1NU1 D;  2OWO A;  4NTW A;  4JI8 O;  4IYI A;  5BXZ A;  4MT8 A;  1AI7 A;  1JY2 O;  1I94 O;  2LO1 A;  4H37 A;  1ZL8 B;  1LWU B;  2QA4 V;  5KTB A;  2QDO A;  3LUT B;  4YJ2 A;  1NTK G;  1U97 A;  3UT5 B;  2ZM6 O;  4PDR A;  4NPE A;  1PPJ E;  1NTM H;  2RCV A;  3H01 A;  4I9Q A;  5LYJ B;  1BE3 G;  1Y9B A;  3CC7 V;  2OQQ A;  2PYJ A;  2ZIO A;  3PJS K;  4LGD E;  5KHJ A;  2P7J A;  1H2K A;  1YJN V;  2CDY A;  3I55 P;  1GM8 A;  2EJR A;  1AJY A;  2Q9I A;  1SQP G;  1O9H A;  4ZOL A;  2WAM A;  3SGI A;  1AR1 B;  2QIW A;  3AEB C;  4JZ2 A;  3TSI A;  3H9V A;  3L72 H;  3U0Z A;  1N8R W;  3P7K A;  4YJ2 B;  2LKM A;  4LF4 O;  2UUA B;  2BEQ D;  2YS8 A;  3EHB B;  3AE4 C;  1VQO P;  1JMK C;  2ZE6 A;  3H32 A;  1X22 A;  3KKY A;  1GO3 F;  2Q9L A;  3HB3 B;  5KAI Z;  4GDO A;  1NVO A;  3H1K E;  2WLI B;  2RQ6 A;  1SA0 A;  4LP8 A;  1HGV A;  2ZT9 D;  3HKE B;  1Q6U A;  2FY8 A;  1N7S D;  1NTZ H;  3OA7 A;  1KEC A;  5FL7 G;  1FZB A;  3VP8 A;  1KB9 F;  4I50 B;  4JYB A;  2YXL A;  3N27 A;  4WFG A;  2R9R B;  4WFH A;  4UV9 A;  4X8A A;  1HH0 A;  2QJ1 A;  5HFM A;  5DM6 V;  1Z5V A;  2E76 B;  3AG1 B;  1IO4 A;  3WB1 A;  1ZP0 C;  3F5T A;  3ZHR A;  1OVR A;  1GZL A;  5AW9 B;  4DCK A;  1YVW A;  3E8G A;  3F89 A;  1P84 H;  1FC2 C;  4PD4 D;  1WPX A;  2RMK B;  5APU A;  2EZO A;  3ZX6 A;  2BTQ A;  1G8M A;  4G27 B;  5ITZ A;  1VQ8 V;  1ZRT D;  1RQU A;  3T4Z A;  2FYN B;  3J7A U;  2A0L A;  4WVZ A;  1SQP K;  3H6P A;  1N86 A;  1N33 B;  4OH8 B;  5AVT B;  3EQ2 A;  4L73 A;  1Y4M A;  4LFC B;  3CRR A;  1KIL C;  3R65 A;  5IYZ A;  4DUZ O;  4PV1 C;  4JI1 O;  3CI9 A;  3FYI B;  5B66 Z;  4WFF A;  3E7K A;  2LQT A;  5FNV B;  2ZXE B;  3CL3 D;  4AQR D;  3BY6 A;  3H1J D;  1MG1 A;  1DD3 A;  1FZG A;  2ODM A;  5F2V O;  3USS A;  1M57 D;  3VQX A;  3K9A A;  3BRV B;  1EDJ A;  4ZIB A;  2YIU C;  2EIL C;  3CP1 A;  3DSQ A;  3KZI E;  2CGO A;  2VQF B;  2V7Q H;  3OTO O;  2WQY C;  3WUT A;  1VQ8 P;  1JFF A;  3CJH B;  1RPO A;  2IJK A;  3FB6 C;  1S72 P;  4IL6 E;  1R1B A;  1Q8I A;  4D6T G;  2WPD G;  2FXP A;  4DOJ A;  1AJP A;  4PHZ A;  4QE9 A;  3GG2 A;  3V5B A;  1W2B U;  1AVY A;  3P8C E;  1ARO P;  3CX5 D;  4U3F J;  1KYO F;  1SQV H;  3FB8 C;  1KBH A;  1NR7 A;  5KUM A;  4H33 A;  1D7M A;  1SQV D;  4FLT A;  3R4Y A;  1KQG B;  1EZV E;  3U1C A;  4MTX A;  3W7U A;  1H2L A;  3RYF B;  2JJ1 G;  1JFF B;  5CMZ A;  4CC6 A;  5LOV B;  1XL4 A;  2DWE C;  2ZAE B;  2IU3 A;  1IBM B;  4DT0 A;  1CSB A;  3MTU E;  4BWN A;  5LXT A;  2IH1 C;  4MVS A;  4O4I B;  3Q3D A;  4L76 A;  2QTO A;  1HVV A;  4B3S O;  5B5E Z;  3H1L G;  2N74 A;  2A06 E;  2ZVN B;  2EBO A;  2OYI A;  3CCE P;  2Y0E A;  3JC2 2;  4HYO A;  1Z56 A;  3AE9 C;  2K9J B;  2Y0I A;  4NPD A;  2KLV A;  3AG2 B;  1B3Q A;  1J5E O;  4RES B;  2QRX A;  2R9A A;  3T1Y B;  3F7V C;  1YJ9 V;  3PLN A;  3H1K J;  1MZ9 A;  4DW1 A;  4TUY A;  1XI1 A;  4UVC A;  3SFE C;  2BEZ F;  3CCU P;  1F4M A;  4CS3 A;  2QSI A;  1K4C C;  4LH7 A;  4AI8 A;  5LGU A;  1R3J C;  2PFX A;  2KSE A;  1VQN V;  1KB9 H;  2ZCE A;  4GOE A;  3BA9 A;  1H8H G;  2DW4 A;  2M6Y A;  4CC5 A;  3VMX A;  3SSU A;  3A0B H;  1L0N D;  3RBX A;  1JQ0 A;  1ZME C;  4DV6 B;  3HD7 C;  1Q86 Q;  4NVP A;  4B3M B;  2G8Y A;  2B5U A;  4OGQ B;  3JYC A;  4ZOL B;  5H9C A;  2Z5H A;  5EFW B;  2ZYA A;  2ZYG A;  3LSU A;  5AVR B;  2LGW A;  1RF1 B;  4BW9 A;  1V54 C;  2M0B A;  1LUW A;  4AQY B;  2JKV A;  2B87 A;  1U7M A;  5H2F Z;  3CC4 V;  3JAS B;  4O4L A;  3L72 D;  4FFK A;  1FD9 A;  4PD4 H;  1E1Q G;  5LMU O;  1VQ7 P;  3H1K D;  2UXD O;  3H1K H;  2QG4 A;  2PRR A;  3H1I G;  1WB8 A;  3A0H E;  1OCZ C;  3ABU A;  3ETQ A;  3ETG A;  1VL2 A;  1K9M Q;  4IL6 X;  3ZHV A;  2EIM C;  4XFJ A;  1GN4 A;  2UXC O;  1OCR C;  2BCC H;  4N23 A;  1Q81 W;  1TUB A;  1L0L G;  2FYU H;  4FZ1 A;  2YUA A;  1VAR A;  4GKK B;  4GOF A;  1NTK K;  1HF9 A;  2VQE O;  2ZDI C;  3AE7 C;  4X65 B;  3CRC A;  3T1H O;  1JTH B;  1X9V A;  1K73 W;  1K33 A;  2R5D A;  5J9P C;  1XNR O;  2BTO A;  1PL0 A;  3EXA A;  4NXM B;  2P67 A;  4DR5 O;  1S5L X;  1M93 A;  2NR5 A;  2IW5 A;  1RE3 C;  3D8C A;  3B09 A;  4C7U A;  4RQF A;  2H8P C;  2NN4 A;  2D2C C;  1AP5 A;  2QEX P;  2UUA O;  3SJA C;  1E79 H;  1IXM A;  2YIU B;  1NJI W;  4JI4 O;  1WT6 A;  2W83 C;  2XND H;  2BCC D;  4OGQ C;  4TV8 A;  2AW9 A;  3OMN B;  5CBO A;  1VQ5 P;  3T2M A;  1KQS U;  3P30 A;  2HHH O;  2XT9 A;  4CH4 A;  2PI4 A;  4YXD C;  2EIJ B;  3RFR A;  5AVZ B;  2ZNJ A;  1L0L H;  1KC8 W;  5E79 H;  1IJD B;  3F7Y C;  4MTO A;  2ZD9 A;  1MAB G;  4NYK A;  5BZB A;  2AEM A;  4XDJ A;  1SS1 A;  1SZT A;  1T8Z A;  5CA1 B;  2QWP B;  4JYY A;  2OCH A;  5KKZ C;  1URQ C;  2JWD A;  2DW3 A;  3CPW U;  4QPK A;  3VMY A;  4Q6G A;  2JIZ G;  2JRI A;  4BRY A;  1FZF A;  1KYO I;  5EZY B;  4X88 A;  2HP8 A;  1JY3 P;  1BE3 H;  5CCG A;  3VN0 A;  3OT7 A;  2KZJ A;  2UXC B;  5AVS B;  1Q2N A;  2BTQ B;  5ITZ B;  3HKC A;  3K9S A;  2IFM A;  5KAF Z;  2FYZ A;  2CH7 A;  5AVU B;  2HJD A;  3TJT A;  4AYC A;  4X1I A;  4ICG A;  1K9M W;  3E35 A;  2X6C A;  3ETD A;  4UCO A;  4B3T O;  2YIB D;  1S0V A;  1RH5 B;  1CI6 A;  5J2T B;  4LNU B;  3SJQ C;  1M57 B;  3N4X A;  2E74 D;  3E89 A;  1NOH A;  5K5G B;  4K0K B;  4ZHQ B;  4IL6 H;  1MKM A;  5DJU B;  4LF6 O;  2FBW C;  3II6 A;  3ZDM A;  3QF7 A;  4EOT A;  4LF7 B;  2CH7 B;  1N32 B;  4LF9 B;  4JYA O;  2WVR A;  1DD4 A;  1L0N K;  1OCZ B;  4PD4 F;  1NKD A;  2YNY A;  5B66 E;  5J2T A;  1KTM A;  2LGQ A;  1N7L A;  3DXR A;  3N2G A;  2WMM A;  2Q0A A;  5LMU B;  2ZVO B;  1OZ0 A;  2EIN C;  4QNH B;  1JNM A;  2QSA A;  4LFB B;  2N1T D;  4PJ0 H;  5B5E H;  5CHX A;  3CC2 P;  2ZQM A;  4IIJ B;  4AQY O;  2QJK C;  2MK3 A;  2YO3 A;  2Y0D A;  3H1L E;  1WLE A;  1PGP A;  4HYT B;  1B06 A;  1XOU A;  2B1I A;  5BY1 A;  1PP9 H;  3CWB D;  3OMA B;  2ZE5 A;  2G38 A;  4B3M O;  3S1K A;  1MMM A;  2B1G A;  1OJH A;  2LP7 A;  2R3S A;  3CYO A;  3RBZ A;  1L0L J;  4BIZ A; 
#chains in the Genus database with same CATH homology
 2WPV B;  1S5L X;  1Y9B A;  4U7J A;  2OQQ A;  2H88 C;  1OW8 A;  3Q3D A;  3D6Y A;  2D2C C;  4H13 B;  3Q2Y A;  1K04 A;  3AE6 C;  3AE1 C;  1AJY A;  1VF5 B;  4OGQ C;  3FGA D;  4R4L A;  3AE9 C;  2QIW A;  3S9O A;  3AEB C;  2FYN C;  3GF3 A;  1EXI A;  3AE8 C;  1HJ0 A;  1KQF B;  2D2C B;  2BEQ D;  4H0L D;  4H13 C;  2WSC J;  3AE4 C;  4H44 B;  1IK7 A;  1OMI A;  1R8E A;  5M1B A;  3D71 A;  4GDO A;  3Q1M A;  4I7Z C;  3Q5S A;  3T97 B;  4Z1M H;  2ZT9 D;  3SFE C;  2BEZ F;  2MKV A;  3AED C;  1UIX A;  1OW6 A;  2QSI A;  2WSE J;  4H44 D;  2E76 C;  5KKZ C;  1YQ3 C;  3Q5R A;  1KMI Z;  4TT3 H;  2E76 B;  3AE3 C;  1ZP0 C;  2JP3 A;  1OW7 A;  2QJP C;  4H13 D;  1PV3 A;  2JO1 A;  3AEE C;  1JB0 J;  1FDI A;  1FDO A;  3D6Z A;  1Q90 D;  1ZME C;  1ZRT E;  1U57 A;  1PIX A;  3O6Q A;  3AE5 C;  2YMK A;  1RQU A;  2E75 B;  2H89 C;  3IN6 A;  4H44 C;  2E74 B;  1RQV A;  2V7Q J;  2G8Y A;  1VF5 D;  1VF5 C;  4OGQ B;  3AEC C;  1NYH A;  2E75 C;  3G9R A;  1KIL E;  3B71 A;  1TU3 F;  4Y28 J;  2O01 J;  2QJY C;  1YQ4 C;  2J5U A;  4PV1 D;  4PV1 C;  1ZOY C;  2E74 D;  3AEG C;  3AEF C;  1MKM A;  3C8V A;  1KOR A;  2ZT9 C;  4I7Z B;  5L8R J;  2FBW C;  1DD3 A;  3RL0 g;  2ZT9 B;  4PV1 B;  1DD4 A;  2D2C D;  1GMJ A;  4KT0 J;  4YTP C;  3SFD C;  1PL5 A;  2IDB A;  3EWK A;  5KLI C;  3AEA C;  2WSF J;  1KTM A;  1S1C X;  2YIU C;  3GLM A;  1VL2 A;  1K05 A;  3IAO A;  4IL6 X;  3RK3 E;  4YXD C;  4RKU J;  2WQY C;  2G3A A;  2NZ2 A;  4XFJ A;  3ABV C;  1EXJ A;  3H25 A;  4R4M A;  2FXP A;  2P10 A;  1DIP A;  2QJK C;  3GMA A;  4H0L B;  3LW5 J;  3Q5P A;  1NGM B;  2E75 D;  3AE2 C;  1HF9 A;  3AE7 C;  3R4Y A;  1KQG B;  4OGQ D;  2E74 C;  2E76 D;  2K9Y A;  3GF7 A;  3D70 A;  1WMK A;  4H0L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...