2D2CB

Crystal structure of cytochrome b6f complex with dbmib from m. laminosus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
137
structure length
137
Chain Sequence
b'LAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGAALPLDKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Intraprotein transfer of the quinone analogue inhibitor 2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone in the cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 19
structure length 137
sequence length 137
chains with identical sequence O
ec nomenclature
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2d2cB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2d2cB01
2K9YA 2WSEJ 4PV1B 3C8VA 5KKZC 2FYNC 4KT0J 1JB0J 1VF5B 2E76B 2QSIA 2QJPC 3LW5J 4IL6X 2QJKC 2E74B 4OGQB 1S5LX 4RKUJ 2WSFJ 4H0LB 2ZT9B 2E75B 2D2CB 4H44B 4I7ZB 2QIWA 2WPVB 1Q90D 2QJYC 2YIUC 5KLIC 4H13B 2WSCJ 5L8RJ 2O01J 4Y28J 1ZRTE
chains in the Genus database with same CATH superfamily
4R50A 1PKXA 4CC5A 2YO3A 2WLLA 4FFBA 4HAMA 1S5HC 1FXKB 1VQPP 4GKJB 2Y4UA 5IYBO 5EC1C 2YXHA 2CAZC 1NTKD 3KYQA 2FYNB 3V6IA 4B3TB 5AVRB 1OVRA 2E76D 2V7QJ 1FOSE 3M0AA 1WLEA 5DECA 2GUVA 4RESB 3RL0C 3OAKA 5DN6G 5AW5B 2PP6A 1YVWA 1AJPA 4I55B 1MUUA 2XAGA 1IC2A 1OCCC 2KQXA 3ZBHA 3II6A 4NTWA 1K33A 3CPWU 1PP9E 2XAFA 3HRNA 3EFFK 3CI9A 4HB1A 4UB8E 4W4KA 3N2GA 3BHPA 5GTHZ 1OCZC 1OZ0A 4EOTA 3ZRSA 2ZNIA 1SQXD 4JF7A 5FL7G 2RH0A 4KXRA 2W83C 1KQGB 2OYHB 3MHVA 2FFDA 1PPJE 2FKXA 3L37A 1BSNA 4YXWG 2A9HA 4JI7B 3ZCCA 1P7BA 3HD7B 3L72G 1Z56A 4JI0O 3PJSK 5KAFZ 1LP1B 2OWOA 3SJBC 1BE3E 5APUA 1Y6XA 3CCVP 1SZTA 3JAMN 4PA7A 3A0HH 4KT0J 3WUTA 5LOVB 1UIIA 1S0VA 3D6ZA 4DO2A 3Q2YA 1PZQA 5APYA 3CRCA 4LF6B 4JI3O 1T6AA 1TVKB 4DOJA 4AHCA 3E86A 3CMEV 1BGYG 1RE4C 3K03A 1BDDA 3RK2D 2R70A 4GCZA 3OTOO 4F6RA 1NU1G 1WPBA 1L1FA 4BW5A 4Y99B 2QR4A 3IGAC 4UFZA 4IL6E 3V2PA 3L75D 1RQUA 1A02J 3CYOA 3L70D 4K0KO 3N4XA 2CH7B 3RK3B 1QU7A 3FX7A 4LFAB 1QVFU 2JKVA 4LFBO 2QWOB 2V4DA 2RKLA 1XNRO 3MHHC 3T1CA 4X64B 4FJCC 4A7PA 1PM9A 5B3SC 1LT9A 4DV1B 1L0NE 5EBWC 2RN9A 1NVOA 3AEGC 4K3AA 5B1BC 3P8CD 2XAJA 2EBOA 1O9GA 1EDJA 3H1LG 4YXWH 2PTMA 3L72H 1GKFA 1I7FA 1V55C 1PL0A 1SS3A 5JQGB 3CXHH 3LSQA 1K05A 3M99B 2CUGA 2RQ6A 3FFQA 1IURA 3AEIA 2Q3EA 3E7KA 3ZMUA 3D3IA 3C9IA 3CWBG 3A0BH 3OTFA 4O2AA 4GKKB 4O4JB 3RK3D 5BU5A 1HH0A 4B08A 3FAVA 4O4LA 2KXPB 1XEQA 1Q5OA 3M0DC 3JAKB 2QE7G 3ETQA 5B1NA 4LF9O 1K9MW 1YHQV 3M9QA 3OE7G 1S9KD 3TF5A 1NU1H 1RHZB 5AW6B 2K9JB 3SFDC 1P84E 4U3FD 2EIMC 2LKMA 1X59A 1GN2A 1RPOA 1NWQA 3OR6C 4FMTA 4I0XB 1WB8A 4IL6Z 3X2QC 3B8NA 1VQKP 2ZXXA 3ABVC 1YYCA 3I5CA 2XUMA 4MSWC 1AFOA 1JO5A 3W7WA 5JWPA 2Z5HA 4JZGA 3I56V 2XV5A 3Q5SA 1NTME 5DJTB 2FXMA 3CD6P 3CMEP 3Q1MA 4H0LC 4L74A 3CL3D 3SPGA 5LP6A 4OWFA 2YI9A 3FB7C 2IFMA 4YJ3B 4YY3O 3LIDA 5KHIA 3SR2C 3N2KB 1M90Q 3SPIA 3VOUA 1H88A 2KS1A 5B1AC 3KG2A 1RF1A 1S2EA 3U59A 4KJMA 5K1XA 1Y66A 3H1LH 3WMM0 1KORA 3BAAA 1FE6A 2P6JA 2WT7B 2A06E 3GHGB 5CBGA 2KG7B 1PNLA 4LR3A 1VARA 1AJQA 1R3KC 1H8HG 2YDEA 2AEJA 1PNKA 5CMZA 3DGEA 1HWTC 3UM7A 5LHHA 5CCHA 4NYKA 2LFRA 3K5NA 1MABG 4WFFA 3A8TA 2KK7A 3CEIA 4DV3B 4DCKA 2QE7H 3JSNA 1H38A 5IWAO 4CC6A 2R3CA 2A7WA 2UWJE 1YQ3C 3MDSA 2O01H 4PJ0Z 2FYUG 2YUAA 3WB1A 1YJWV 5TISH 1LTJB 2WSEH 2YMKA 2QJYB 1URFA 1AI4A 1M1KQ 4B3MO 1HBWA 2AHZA 1LWUB 1FXKC 2O01N 2OYIA 4WF9V 2KSEA 3AE2C 4JI0B 1QX8A 4PA9A 4LP8A 3JASB 4NPDA 4UCTA 4I7ZB 4I4TB 3RYFB 5B5EE 3VQXA 5FNVB 2DJVA 1SQQE 3HPLC 4CH3A 3TCUA 4DV7B 1SESA 4JI3B 2Q3IA 2CH7A 1SQBJ 1QVGO 1AJNA 3BVOA 3NR7A 4J7KA 1N33O 2JP3A 2IZ1A 1PV0A 2HLDG 1YTZT 2OQQA 3OTOB 1EZJA 1FU1A 3F7YC 2EZOA 2QTSA 3LNNA 4HYOA 4WVZA 3DTUB 4DR5O 1NTZG 1DK1A 1DEBA 4HJGH 2YSUB 4MT8A 2UUCO 1EBOA 3RGUA 4LFBB 2OYHC 1TUBB 2B1GA 4D6TG 2BCCE 4OVNF 1JY3N 1XNRB 3ZRVA 1GL2B 2H3OA 3HD7C 5GONB 1ZR2A 2EIKB 2X6CA 1WRGA 3KQGA 1OCOB 1EZVI 1W2BU 1X9VA 1H0TA 1ZP0C 3AG3B 2FYUK 2HLOA 4UB6E 2X6AA 4X9QA 1GW3A 3GLMA 2GTAA 2ZE7A 3ZMTA 4X62O 1N4CA 1COWG 2F95B 1FDOA 5CJ4A 1N8RQ 4UUJC 3JAKA 1ZR4A 4QJFB 5IJ9B 5CBOA 4MTGA 2HP8A 1F7YA 1VL2A 3BRTB 4R4LA 5CB4B 4Y99C 3UO2A 4L75A 4DR7O 2WPDG 1SQVG 4I0XA 3H1IE 3E2EA 4ASVA 3CCQV 3E89A 4IIJA 2PYLA 4LF9B 3RK3C 3WU2E 4YIOA 4LH7A 1SQPJ 1K4CC 5IDJA 2KLVA 1MZ9A 4J41A 3L72J 1VIBA 4IHJB 1URQD 1EDIA 4JI6B 2KUBA 3OA7A 2QA4P 1J5EO 2WSFH 1L0LG 4EKWA 3J81N 4DV5O 1NTZH 1YJ9P 5K1PA 5FPRA 3VMYA 2UU9O 5CA3A 4I50A 1GK4A 1M8OB 2C9LY 1NTZK 1FZGA 4D6TH 4Z2WA 2QM7A 2DW3A 4WBAA 5LMNO 2N05A 1AVMA 5KLVE 1B06A 1NU1J 3L36A 3E8HA 2ZXEB 1IO4A 2O57A 2KIKA 1R1BA 1AILA 2R5BA 3K3WA 2IYPA 1XILA 2B9BA 1P84I 1I08A 1EXJA 4IT5A 3BCCE 4P30A 2ZJSE 1OVVA 4ZOLA 2IU3A 2Q7EA 1ZOYC 1GZLA 1LTJA 2HJDA 1KQSU 2KSJA 5CN0A 1NAYA 1V9PA 1BSHA 2R9RB 1SLQA 1SQVH 1VQ8V 2ARHA 2ZDIC 1N36O 1LWUA 2XHBA 1YJNV 1VQNV 5IWAB 3WU2Z 3H1LJ 3JCUE 3ABLB 4DYLA 1VQOP 1Q81Q 1PP9G 1Q6IA 1AV1A 2HKOA 1NQTA 3JASA 4ZI7B 1JY2N 1Q3EA 2ZYDA 4IFFA 2E75C 4B3MB 2WLJA 1GW4A 4L73A 3J80N 3AG2B 2WPSA 5EZYB 1L0LK 4PDLA 2JS3A 3VP9A 4NXNB 3W7XA 1NTKK 3N27A 1N7SB 3KCXA 2DN9A 3AK2A 4WFBV 1JCCA 3AK1A 4PDVA 1SC5B 1NGMB 2K1AA 4NXMO 3BY6A 3RYCA 1N7LA 3AE9C 3G4SV 2YEVB 5AVQB 1UJWB 1G1IA 2EULA 1PIXA 3FWLA 3GHGC 2IW5A 3CCMV 3L72D 3CXHD 2W6JG 4YHHO 1GN3A 2WSEJ 5KMGA 1XOUA 1PGPA 2IJJA 1I5XA 1S5LZ 2E5LB 4WFEA 2BE3A 5KX5B 3A0HZ 1FZBA 1LTAC 2IBZE 2M5AA 5EIBD 3CPWO 5A9GA 5IJ0B 1KYOE 2J58A 3C1LA 1N33B 3KKYA 4X1KA 1LT1A 4MVUA 1HGZA 2EILC 2P1JA 3H1KE 1V54B 2V7QG 2IPPA 3OGIB 5B1OA 5GONA 3K0DA 1BGYD 4XE5B 4I2LC 5KUKA 2F66C 4DR5B 1URQA 1IFDA 5DM6V 1NU1D 1MSWD 3CC7V 1JTHB 1HW7A 2OIEA 1W59A 1LWUC 2KZIA 1BS3A 1N7SD 1ZN5A 2WLNA 2NPSA 2OCHA 2QM4A 3AE1C 3JCUZ 5LGTA 2V1DA 1YXBA 1JY2O 1PP9H 5KHKA 4W7YA 2EX3A 4UB8H 3HUSA 1NO4A 4GKGA 1KILE 4X62B 1VQ6V 2WSCH 4P9OA 4KFMA 1ORQC 2PUSA 3W7SA 1K04A 4J42A 1HF9A 1OW6A 1H8EG 2HJFC 1KC8W 3H1LD 4X20B 3S3XA 3GF3A 4CPGA 5LGNA 4G27B 4IHJA 2W6JH 1FJPA 3SPHA 2RNBA 4XA4A 3IF4A 1BE3H 3CS5A 2PYJA 1U97A 2ZR2A 3JAWB 2QSAA 5KJ7D 3ZMZA 3CWBD 2QWQB 1NBMG 4IYIA 1I94B 2ZR3A 4BWNA 2WLIB 3HE5B 4JPZB 4FIPC 2V7QH 3TXSA 1IFNA 2B89A 1GL2C 5BR8O 4X89A 2EIKC 4DV5B 1BCCE 1QR8A 2X0LA 4QMAA 3KXDA 2UU9B 3AEAC 1GN6A 1HR0B 4H33A 1JMMA 3EQ2A 4C46A 3ZX6A 2JGDB 1Y74B 1FAFA 3CCRP 2H43A 3ETDA 3P8MC 1FJGO 3AG4C 1SFCB 1EDKA 5J9PC 1MKMA 4BR6A 1WP8A 2GSMB 3OJAB 1M1JB 2Q5UA 2WSFJ 5ITZA 2Y0EA 4QNHB 1Z5VA 3ITKA 3CC7P 3ZDMA 2O3JA 3IAYA 1K4DC 5IY5B 1T5EA 5LYJA 2DWEC 4JI4O 4LF5O 2NRGA 4ZMDA 3UQ8A 1KB9E 2XAQA 1YTZI 1NHLA 2HPCB 3JD3A 3SPJA 4QPJA 5J2UB 1S1CX 5LHGA 2C0XA 2X6BA 1KTMA 4IFMA 1JMKC 2I1JA 4TUYA 5APTA 1PL5A 1VQLV 2VWKA 1DLBA 1E79G 4WBNB 2B87A 2ZVOB 2K37A 4LC1A 2XASA 5H6RA 1SFCD 2QGNA 2QRXA 5KTBA 4WFAV 1K9MQ 2LW7A 1M4UA 3VBBA 2FYUD 4PD4I 1ZWIC 2QEXP 3AE7C 1GM7A 2W0XA 3WUUA 3AE8C 5CA1A 3ZS8C 4KP4A 1SQVJ 3CCEV 5KHHA 2KNCA 3CC2P 5LA6B 1WB7A 2DQ3A 1KILA 3C3TA 3D3QA 4X65O 4DV2O 3JD4A 2VQEO 1VF5B 1MZEA 3ZMSA 4JI5B 5CJ0A 4UVBA 1N73A 3UT5A 1VQPV 1J2JB 2YNYA 5JVDB 1FS0E 3RN4A 3E8FA 1JX9A 4YJ2A 1YITP 2ZXWC 2ZNJA 2B88A 5KJ7A 3THOA 5EIBC 1F4MA 3R65A 3L74J 2WQYC 2B1IA 3ZN1A 1QL2A 2ZCEA 3ABLC 2JRIA 1HNWO 1NI8A 2C0WA 2Q68A 3TNUB 4AUWA 2YI8A 3LUTB 3GWOA 1XL6A 5IYZB 4Q20A 2Q8VA 2Y48A 4ZHQA 1NTZD 2ITDC 3BA8A 3LW5J 1OCRB 3AG2C 4JTDB 1A32A 1EFRG 2HR3A 1E79H 2IBZI 2OIGA 3D6YA 1N7SC 1M93A 4D6TD 2K9PA 1VF5D 4QE9A 1NZ6A 1Y67A 3OMNB 2DW4A 5FPOA 5BU8B 1JJOA 1G4YB 4PI0A 4HNAB 1FFXA 1LUWA 1P4RA 3F5HA 3RVYA 2F23A 2JJ1G 3TGUE 2XTAA 4O2BB 1DD4A 4PA3A 1FZCC 1VQ9P 3GMAA 3V2QA 5GTHE 2C9NY 3CCVV 1PP9J 3QG5A 5LXTB 5B5EH 1AQTA 3CX5E 1SQBG 4I9WA 5KHGA 3H1IG 3S4RA 2WSCJ 4XDKA 3RYHB 2PI5A 4C7UA 5KAFE 4RQFA 5LBQA 1W2BO 5BR8B 2VS0A 3HKDA 3PP5A 3OT7A 3OMIB 2CPBA 3OD4A 4Q6GA 4AQYO 3SFEC 1KYOF 1BE3J 1L0LD 1NTKE 3MIWA 2Z5UA 3ZHQA 1SF9A 3D36C 2IX7C 4B3SB 3MGNA 4MVMA 1UPGA 1RE4A 5L3CA 5EYPB 2BCCH 1BQZA 1FJGB 1BHAA 3Q4HB 2UXBO 1VF6A 2PZSA 2VRSA 2H7HA 1AQ5A 4NVPA 3M9HA 3K9SA 1MOFA 2JEUA 4PHZA 2YIBD 1JY2P 5KAIH 2LXCB 3T4ZA 5JCOA 5JH7A 2OTKE 1IBKO 2EINB 1QGKB 3IC9A 4JI4B 3C90A 4RUFA 1XNQO 1CP9A 3CP1A 4OPAA 1TA8A 1NVPB 3O9OA 4G2KA 3T4DA 1D5NA 3BCCG 4ABMA 1MFZA 4YXDC 2XDJA 1NR7A 4B3RO 2IZ0A 1Q6UA 1SQXE 4Z1VA 1ROPA 3FD9A 3OW2U 2YKOA 1JFFB 3QWOC 1SQBH 1L0NJ 3H1IH 2JO1A 1HJBA 1SQPG 3SWFA 2FB5A 2BOBC 1SQBK 3MHSC 3QO5A 1NR1A 2YXRB 3RYIA 4LNUB 5AVVB 1RSOB 2BTQB 3HTKB 1SFCC 3BRCA 1RPRA 4J80A 1KB9I 1PP9D 2A45G 3KZIH 1ZSPA 1CI6B 1VQKV 1M1JC 2BSKB 2Y0DA 2QWPB 1NOHA 3NTNA 1VEWA 3OFNG 1YCIA 3M0DA 1KMIZ 3R66A 1N34O 3CD6V 5IY5C 4X65B 1NVPD 1EZVE 3ZRXA 1QR9A 4OPHA 1XI1A 1JM0A 1AP5A 2W6IG 3JD1A 3ZRWA 2VQEB 1PV3A 5GTIZ 1KQSO 2JWAA 4CS2A 3OAAG 5L3DA 2AXTH 1VF6C 4W80A 4RJTA 4JI2O 3OUSA 4LWSB 3P3PA 5A2QN 5K5GB 2R72A 3L75E 1GK6A 4FM2A 3L70E 3O6QA 4GX0A 1SA0A 4CZZA 4KL1A 5JCOC 5AVSB 2PY5A 3HD7D 3PTZA 1HNZO 3BCCH 3V2RA 3OGCC 3RBXA 2EJ7A 1HNWB 2UXCO 1IBMO 1XDCA 1RF0C 2G8YA 3W67A 1KU9A 3JARB 1M5IA 5EFWB 1XTCC 1DEEG 1YQ4C 3E22A 4C7RA 4LH6A 3P8CE 4HNAA 3K04A 1ZMEC 4U3JB 4ZBMA 1SQPH 3U10A 4LFCO 4ASWA 4EI2A 2HODA 1FDMA 3RWRD 4O2BA 5D5PA 2ZE6A 4DUYB 3JALB 2R32A 2ZVNB 3IFMA 1VF5C 2A45H 2YIBA 1JB0J 4XFJA 2YXLA 3MUDC 2XOKG 4JZ2A 4MN4C 4WCEV 3QH9A 1K92A 4I6MC 4JQ0D 5B66Z 1S9KE 5EK0A 1TGOA 3RYHA 2KZJA 4PJ0E 3HKEA 4FLVA 4GUNA 4U3FE 1ZUQA 1LGHB 4OH8B 4MW8A 2POHA 1KN7A 3T1YO 2ZKOA 2XNXA 1NU1K 1FXKA 2XNDG 2XZRA 4EYYQ 3B09A 4DR3O 4EDFA 2OTJP 1JR9A 3ZJZA 3A2FA 1OCRC 1KYOH 4U7JA 5EYPA 2E75B 1YZBA 2CTWA 2PFXA 3IC7A 3K57A 4F6EA 4I55A 1SQQJ 4HYTB 2ADQB 3H32B 3LDDA 1NJIW 3CX5I 2UXBB 2ITAA 1HVVA 4PV1B 4JASA 2ZINA 2HFED 2ZM6O 1K7DA 1D5AA 4OX9O 3AE3C 3H6PA 2P22C 5HFLA 1HTLC 2K88A 2XAHA 2OYHA 4DV6O 1AROP 2QIWA 2EILB 1AI6A 3EXAA 3HD7A 1M57B 2G3AA 4ZKPA 1Y8AA 2BCCJ 2YXQB 2E75D 3CJHB 3CC4P 1LP1A 2Y0CA 1KC8Q 5H5NA 2XT9A 2EIJB 1LNQA 3R2PA 4XDJA 5LOVA 2XNDH 3K08A 1MFTA 2VQFO 2MJZA 5BY1A 3E35A 1OFCX 4KHPO 4W4LA 5FLXN 2DYSB 1L4AB 3MD0A 1TVKA 4IL6X 4PV1D 4BXLA 1LUVA 4X66O 2RN0A 2QA4V 5H2FE 1YJ9V 3L73E 1ENVA 3LDEA 3B4SA 3ZHSA 4HKZH 4XBFA 2JR8A 3JATB 2F4VO 3CLQA 1W0JG 3G71P 4PI2A 1N34B 2EINC 1P7GA 3H1IJ 4K8XA 2Q4PA 2OT5A 2ZIOA 3ABKB 2L5GB 2Q9IA 1X79B 3JARA 1X0TA 4DUZO 3OUFA 2Y0IA 3A5TA 1VQMP 4WFGA 1VQ5P 4K0KB 4WB4A 4UCRA 4DW0A 2OYQA 1L4AD 2GUZB 3QTCA 3K5BA 3KPEA 3W68A 1FOSF 2CE4A 1G2CB 2WWWA 2KSDA 1IBMB 2Q0OC 5JQGA 3B5NB 5CCGD 3EFGA 1FYJA 5AG2A 4FM1A 2NLJC 1Z5WA 4N6JA 1TAEA 2IJKA 4K35A 1F51A 1JQ0A 1WT6A 5M1BA 5DEDA 4GOFA 4QPKA 5AW3B 5KLVJ 2A3QA 3CCLP 1GRJA 4JTAB 3FXDA 1SRYA 2OARA 3CB2A 2LGQA 4O4JA 3ML0A 3K9AA 2YS8A 1RFYA 2BEQD 2UXXA 1IBLO 4O4IB 1VQOV 3AG4B 3OM3B 4TOIA 4HH2A 1JJ2U 4QIWF 3HKCB 5JJNB 2BASA 3BCCJ 2KB1A 3ABUA 3K5LA 3H1HG 1FZEA 1FKAO 2FMLA 3LDCA 3PN1A 1XHXA 2K9JA 5H2FZ 1HP8A 4YIPA 1WJZA 2P4VA 1PD3A 2ZDIA 2W90A 1ZLZA 3LSSA 3RT3C 5BZBA 4Y28J 1JNMA 1E1QG 1KFNA 5E79H 4FLTA 3H01A 4TQDA 1GL2D 1SQFA 4X1YB 4H37A 3B5ND 4JI1O 2QKCA 1GM8A 2Z5IA 4BWAA 2K1EA 1S77D 2KLUA 4P2ZA 1KUQA 3VTPC 5AW7B 2AEFA 4YJ3A 5TJHA 1R3IC 3F7VC 3ETGA 3N2KA 4DR3B 2Z0AA 5AW8B 2Y0PA 4UV9A 1DX7A 3L74G 1SQBD 4BRYB 1Y9BA 3B2EE 3H1ID 4YTPC 1RP3B 5LGUA 4JF3A 4W7ZA 3GHGA 2WT7A 2KG7A 2L6LA 1Q82W 4YY3B 1HNXO 1USDA 3SJCC 2QJ1A 1S5LE 3C8VA 3A0HE 1H89A 5HFMA 4NKGB 2VWJA 1Q86W 2JJLA 5E1AC 5APQA 4GODA 4PD4E 1K97A 3DSQA 4UV8A 3KHUA 2N74A 3H1HH 3RGBA 1KZUB 5C93A 3H1KJ 1NT2B 3G6EP 2HFEC 1XREA 1HWYA 1R6NA 2ZXWB 1HUCA 3OEEG 5KAIZ 4C7NB 1ZRTE 3IFXA 2JEEA 1SQVK 4DR4O 1SS1A 1H2NA 3WG7B 4AQRD 2FKWB 1KECA 4R6ZA 4X1IB 1JUNA 3BCCD 3ZHRA 5GTHH 1Y47A 4I4TA 3R4YA 3L71E 3RYFA 2VQFB 5FNVA 3VQYA 4KHPB 1GU5A 3JCZA 1IFMA 3L74H 3GVMA 4YPCA 1RH5B 2RJZA 3JSLA 1PPJG 1Y76B 3CMAP 1B3QA 4E4EA 3D8CA 1P84F 4MS2A 4X66B 1SQPD 3CXHE 4PV1C 1BT8A 4PA4A 5AVZB 4I5SA 3CHXA 1Y4MA 1BE3G 1JPXA 1LR1A 1BL8A 3P32A 1Q7YW 3KZIZ 2F4VB 1R5LA 3LW5H 1W2EA 4NPFX 1OW8A 3A7OA 3BPZA 3CCRV 3BA9A 4GT1A 2J5UA 1FAVA 4JYCA 1FZCB 1TUBA 1AI7A 2GUZA 4R7CA 3E1IA 1BGYE 1EZVG 1GL2A 1M57C 2P67A 4FVMA 3OW2O 4DUZB 1Q90D 5KA5A 2WPRA 2ILMA 1IVSA 2WA3A 3GF7A 2EIJC 2UUCB 1YI2P 1KV4A 1BCCJ 1I0HA 4NTXA 2GV9A 2K9YA 2Y9ZA 2CTPA 3M8AA 3HKBB 3SJQC 4TT3G 2DYSC 4O4IA 4EB6B 3U0ZA 3VYIA 1L4AC 1KYOD 5KKZB 5IJ9A 3HKCA 4O4HB 5CCGC 4J9ZB 2WLHA 3S1KA 1YEWA 1OHHG 2JWDA 4CS3A 5CB4A 3S3WA 5CBHA 2QG4A 2WMMA 1B6QA 1L0NG 4PELA 3CRMA 2PGDA 1IBLB 3AG1B 4E2LA 4NPEA 1PPJH 3UCSC 2H94A 3H1LE 3AE6C 1J1DB 3MP7B 3H25A 1WP7A 3ABKC 3VMAA 1EC5A 2QEXV 2Q1KA 4DR7B 1KQFB 4EEQA 1WA8B 3Q5RA 1QVFO 4AI8A 3CC2V 3ZN0A 3CWBE 3H1JE 1OJHA 3A0BZ 1S72P 2B9ZA 1S5LX 3HR0A 2D2CB 2N1TB 1XTGB 1EZVH 5J2TB 3ASNB 3ETEA 3JYCA 1NKZB 1J5EB 1RQVA 1BHBA 5TISE 3B5NC 1VP7A 1W0KG 5LHIA 3B40A 1KKCA 1YITV 4IL6H 2HEPA 3C3SA 1TU3F 5IE9A 4JV5O 2PAJA 4TT3H 5LMNB 2UUBO 1AJYA 1VQ4P 3APQA 1H2LA 1VQ7P 2GDSA 1NTMG 1UFIA 5L3EA 3CCJP 2UXDO 3VMXA 4I1LA 4DT0A 1L0NH 4J7ZA 1S3JA 3CXCU 5C8YB 5KHJA 4TV8B 2D2CD 1L0NK 4GIFA 4WY4B 2N1TD 1PGJA 2B5UA 2LQTA 4B3TO 2Q9LA 2A06G 2ATKC 2QM8A 2QWNB 2M3BA 5APWA 4ZI7A 3STZC 2O1JA 4FFBB 3SYCA 1N36B 2PGGA 4CBCA 4CH5A 5EZYA 4OGQB 5IYDO 3AEFC 4DR4B 1N7SA 4CH6A 1GTWA 1VQ9V 2DYRB 1SVFA 1K3EA 2WLMA 3TJTA 2OCCB 2YEVA 2FYUE 3PLNA 3FWNA 5TISZ 4UCOA 3AEEC 3H1HJ 5AW1B 1P84H 1OX3A 2Z3YA 2OGUA 1F23A 3AE5C 5KX5A 1SETA 3WUVA 3WB0A 3V2NA 2K3RA 5IJ0A 3IAOA 4WY4D 1FZCA 4NXMB 2LFSA 2IFNA 3TGUJ 5H6QA 1NTMH 1OW7A 2QSIA 2NR5A 4YHHB 1T3UA 1AR1B 2BOCC 1JCDA 2Z4EA 1IXBA 3N2GB 4LLHA 4BAYA 3L73G 3AK3A 2LGWA 3L9DA 1S76D 1SQQG 1AVYA 4OGQD 1JTHA 4N3YB 2IH3C 3CRAA 4PA6A 2J59M 2FFDB 3E8GA 1SP4A 5EBMC 2HVJC 2A06H 1USEA 2JS5A 1NJIQ 3WG7C 1U7JA 4CH4A 3GWKC 1FZAA 2GHYA 1NTZE 3CXHI 4K8ZA 3USSA 1M56B 2YXYA 4NTYA 3D36A 4PD4F 2P7TC 2P10A 2WZ7A 4H44B 2NZ2A 3P30A 4D6TE 5BMVB 2CGOA 2BCCG 3FXEA 4X20A 2Q73A 1YTFB 3V4QA 2DOSA 4TV9B 1BDCA 5L8RJ 1K8AW 4LCUC 3J7AU 4F6RB 4X64O 3JAWA 1QL1A 4UCVA 3CRRA 3HB3B 2P7JA 1N0NA 2E42A 3VN0A 1FPOA 1U96A 1US6A 2WLIA 3HE5A 1FZFA 1ZTEA 1G6UA 2M8RA 1DF5A 4X88A 3L73H 2LW1A 4BW9A 2QKAA 2P2UA 3H1HD 1QCEA 1LT9B 2Q7GA 1M56D 1SQXJ 1SQQH 4LBEC 3NFQA 3SSUA 1B04A 3MZWB 4IGGA 1SQVD 1FC2C 4H44D 4FLZA 3PH0A 2JGDA 4DRXB 1Y74A 2FY8A 2AW9A 2R9AA 1SQQK 5E79Z 1W5CE 2WTYA 4N78D 1AI5A 1YTFD 2WSSG 3E1RA 2AZ0A 1SFCA 5KKZC 4U7OA 2CGNA 4LF4O 1L0LE 2XKMA 1M1JA 3APOA 2ZAEB 1EN6A 1E1RG 4O2AB 5EBLC 1MNGA 4O4LB 3AG1C 1S4XA 3L74D 5GTIE 5AW4B 3AEBC 4DR1O 1J1DC 1THZA 2ZIMA 5KLVG 1YIJP 2R44A 2W6AA 2HPCA 2KP8A 4UB6H 5J2UA 3FB8C 3SYPA 1IFPA 3L75J 3L70J 4J10A 4AILC 3JSVC 4LF5B 4GDOA 1MSDA 3BASA 1BQ0A 1AR5A 4WBNA 1RF0A 2D2CC 2R3SA 2N1TC 4LF7O 3P7KA 3ASNC 1H2GA 1K73W 5LP6B 3TXQA 4H13B 3LNMB 1VDFA 2CPSA 2JDIG 5LA6A 2KS1B 1RF1B 3B77A 1R6KA 1CXZB 3WU2H 1DF4A 3U11A 5AVXB 2MK3A 3PRJA 2JK5C 2JGUA 3E83A 1XMQO 2WSSH 3K06A 1GD2E 4DV3O 1Q8IA 4DZOA 3MUDA 3RK2B 3WFVA 5CBNA 1EM1A 4GX2A 5JVDA 1M7LA 2CTQA 4IYHA 2OTJV 3L71G 3SYAA 5B66E 4ZKIA 1H2KA 1K5SA 2IJHA 4JYAO 2Y9YA 3IR9A 4QE7A 2OTLP 3VQVA 1LTBC 3KDPB 1UIXA 4DV0O 4MVZA 4DV2B 2ADPA 5LMUO 4WY4C 1PPJD 2CDYA 2UXNA 3I55P 2N9YB 3OR7C 4GX5A 4RAIA 3L35A 5KLVH 1T8ZA 3F89A 4U3FJ 3L4FA 3CCUP 3TNUA 1Q82Q 1L2PA 1S5LH 1KP3A 5IYZA 1GM9A 1BE3D 4H13D 1ZAUA 5KLVK 2IBZG 2Q69A 3JD0A 4HZ3A 2HG5D 2OYIB 4MVRA 1XQ8A 4OGQC 4DV7O 1Q86Q 3CCSP 5BMVA 4PD4H 3JD2A 2DYRC 3BFRA 3H1KG 4JI8O 4RWUA 2OCCC 2RCVA 1EZVD 1NTMJ 4TV9A 1D7MA 2WA4A 3TYYA 1H8AA 3B71A 3G3ZA 3K79A 3EWKA 5CCHD 4KUMA 4XDLA 1KB9F 3TETA 2JDIH 1ZXGA 3JC22 4LGDE 2P5OA 2M0BA 3JCUH 3CC4V 4Z1MG 2WVRA 2LJ2A 1SQPK 4WWIA 1O9HA 5L3BA 3B8EB 2IM9A 4GOEA 1NS1A 5LXTA 5KA6A 3BATA 1JOYA 4UB8Z 2R9IA 3RK3E 3DC5A 1FBMA 2ODMA 3L71H 1U7MA 3NXSA 4GYCB 4PDMA 1L0ND 1ZLLA 3G9RA 1ZL8B 4DRXA 4IOIH 3K5MA 2FFDC 2LP7A 1MZFA 4X8AA 3BRVB 2A0LA 1FDIA 1WN7A 2M3EA 3G71V 3A2AA 1H0TB 1KKDA 1DGSA 2IBZH 1EXIA 5APXA 1Q7YQ 3UKMA 3H1JG 1M56C 1P49A 3FKSG 3IN6A 5AVYB 4H44C 2E74B 2YKPA 2SPZA 1GO3F 3H1KH 1IDSA 3Q4HA 1BGYH 5F2VO 5DJUB 4LF4B 4TSFG 4AQYB 1VQMV 1VQ5V 1EN4A 1KBHA 2IU0A 1BMFG 1BCCG 1WPXA 4JI6O 3EHBB 3L73J 1BSMA 1P84D 2JJ2G 2W0FC 1F4NA 3G6BA 1KFMA 2KB7P 5LL6Y 3QVNA 4DK1A 2F93B 1JEKA 4IIJB 4DR1B 3A0RA 1FFTB 3W7TA 3PHLA 4Z1MH 4FLUA 1RM1B 3CCLV 2H8PC 1NTMD 1CW5A 4DR2O 2ITCC 4UVAA 1IBKB 2ZT9B 1JFFA 4UCUA 1IFJA 2H89C 1LT9C 1XNQB 3U1CA 2WPVB 2ETNA 4I50B 4UXNA 3G67A 5D5QA 2E74D 2FYZA 2FTKA 1KP2A 4LF7B 4B3RB 4MVOA 2BTOA 4LNUA 1RSOA 2BTQA 3HTKA 2FL4A 2A06D 1X4TA 1CI6A 2E76C 2BSKA 2GUSA 1IX9A 2AGAA 3CWBH 3H1JH 4FK5C 1EDLA 4JAVA 3T97B 1CPYA 1PFIA 3DXRB 3ZMVA 1XMQB 3DC6A 2I8DA 3K0GA 1K5QA 1G1JA 1QHTA 2Y69B 5CA0B 5IYCO 4ZOLB 3TK1A 3FB6C 3CX5F 4LWSA 3K58A 1BCCH 1KD1W 2ZT9D 4TWKA 4JYAB 4HBNA 3VQWA 4JYBA 5APSA 4UVCA 4DV0B 1J95A 3QO7A 1M57D 5LMUB 1GN4A 4DV4O 1R6TA 4FLWA 4NXNO 2FYNC 2RMKB 4GX1A 1XL4A 4JI2B 1QNMA 3ZHVA 1YHQP 3F5TA 2QJPB 5LP6C 5AW0B 3O65A 1YBKA 1FS0G 3L73D 2LR2A 4U3JA 2E5LO 4H13C 3V5BA 1HNZB 1SQQD 1IJDB 2H88C 2GM4A 4JAUA 1JOCA 2HG5C 1RF1C 2UXCB 3O8ZA 4JI8B 3G6EV 3JALA 1KB9H 2WAMA 2QVAA 3RYCB 1JMBA 5AVWB 3VP8A 3I56P 5IT9N 3STLC 1M9NA 4DJGA 1Z2GA 3CE2A 5KMGB 1AA0A 3RK2C 2QWRB 1N2DC 1SQGA 3AEDC 1U57A 2GA1A 4B86A 4LFCB 2M5AB 1DH3A 1AVOA 1PL4A 4FFKA 5CCHC 1GMGA 1YF2A 1ZL8A 3LSUA 4X1KB 3LIEA 1R3JC 3M9BA 2W6BA 3VOPA 2BCCD 4RO0A 1AR4A 4TQFA 2FYUH 3ICXA 1URQB 5H9CA 5KAIE 1VMGA 1DTOA 5BXZA 3RW0A 4R4MA 2JIZG 3CMAV 2PRRA 3TGUG 2OYIC 3AG7A 4RQEA 2NPSB 2Q7HA 3SYQA 3SJAC 3I5DA 1QBZA 1YSCA 3T1YB 4BIOA 1WNSA 1YJWP 1DIPA 4LF8O 3UO3A 3IJ4A 3GG2A 3HUSB 2LO1A 3L71J 1SQBE 5B5EZ 3MAQA 1ZV8A 3H32A 2ZE8A 4RUEA 4L87A 1E5WA 4JYYA 1I94O 2R5DA 4B7KA 3SWYA 3H9VA 1R3LC 1YI2V 4GZRB 4DR6O 2O1KA 1MA1A 3G80A 3KZIE 3P3NA 2KKWA 5L3FA 3BEHA 1NTKG 3SGIA 1LTIC 2Q6AA 1G1XB 1QQCA 1FXHA 1JY3O 5APVA 4MTXA 2QJKB 1HR0O 1YDXA 2NPSD 2DQ0A 4I9QA 2ZM6B 4OX9B 3VMZA 3CJHA 2AXTE 1BGYJ 3BVHA 1WAZA 4DR2B 1RY3A 2YIDA 3GB7C 1ZX3A 2YIUB 4KHXA 1K8AQ 2M7WA 5KLVD 4DV6B 1CZQA 1CEZA 1PNMA 1LTSC 3QNEA 4UB6Z 1GK9A 5GW7A 3W7UA 3FX0A 3T97A 5C39A 3TGUH 1L4AA 2RMZA 1NH2B 2Q7CA 1Q6HA 3DXRA 2WLKA 2E74C 5CCGA 1I5YA 3ABMB 4JAAA 5CA0A 4PD4D 1FD9A 1FXVA 3RVZA 3RFRA 4OXSA 5EC2C 1SQXG 1LJ2A 2WITA 3F5WC 1TUEB 3ASOB 2L35A 3JATA 1S72V 1XHZA 5ITZB 3CX5H 1ZW0A 3AE4C 2X7RB 1SQPE 1J1EB 2HYNA 5LYJB 4MVQA 3L72E 5KAFH 1ZRTD 3MTUE 3T2MA 1OXZA 2PI4A 1RM1C 1OZHA 1L0LH 1BZKA 1T2KD 4DXWA 1NTKH 3A0BE 1SERA 2F1MA 2OYOA 2ZT9C 2E3CA 4BIUA 3AECC 2P06A 4ICGA 2QDOA 4TUYB 4DV4B 3CWBJ 1VQ4V 3H1JJ 3L71D 4RKUJ 3S9OA 1NH2D 4L8JA 1VQ7V 2GTSA 3CCQP 1G2CA 1QLEB 1N86A 4CS4A 2B87B 3B5NA 5GTIH 3CCJV 3M7MX 1NU1E 4DW1A 1A02F 2AXTZ 2O01J 4ZNCA 2YICA 4JI5O 3Q3DA 2C2AA 1JCHA 4MTFA 1NKNA 3L75G 3L70G 3ZHUA 2P90A 5CA1B 4M3LA 4N21A 2KNCB 1PGQA 2IBZD 1DD3A 2AZ2A 1KILB 3T1HO 3FYEB 2I1KA 1T3JA 3ZIAG 2HVKC 2Y69C 3H1KD 4J7JA 1N73B 1SQXH 1RE3A 3UT5B 1LTJC 1M90W 1K73Q 1D2DA 2QJYC 1GH6A 2ZE5A 5AW2B 4YJ2B 3SDLA 1SQXK 2KYVA 4IFDK 3V4WA 4X1YA 1QLED 2P4KA 2BEZF 1Q2NA 3SYOA 3M06A 4JBZA 1N32O 5KLIB 3GW6A 1XMOO 1JVMA 1NYHA 3D70A 3NMDA 1SKVA 3OMAB 4FZ0A 4A5UB 2QJPC 3K5OA 4I7ZC 2W8ZA 4ZHQB 2CTRA 5B66H 2NN4A 3UIAA 1VQ8P 4BRYA 2MW2B 4JI1B 4FM0A 1KILD 2E5YA 3HE4B 5AW9B 1YJNP 1VQNP 1GAXA 2KOGA 4U3FG 1H2SB 2ZD9A 3QF7A 1M1KW 3RL0B 1LTGC 4LF8B 2FYUJ 4UCSA 3L75H 2UUAO 4MVSA 3L70H 1PGOA 4DK0A 3ZEDA 1FFXB 5KUMA 1OVUA 2NNUA 1OCCB 2DE0X 1X22A 2FBWC 4FLYA 3H1JD 1GDTA 2HHHO 3RBZA 3SPCA 1R73A 1VF7A 1GU4A 1HNXB 3B8MA 1H2MA 1WMKA 4DR6B 2AHYA 1OCZB 4J9YB 1OV9A 3Q5PA 3CSXA 3G4SP 5AVTB 1LTTC 1RE3C 3CCMP 1OCOC 1URQC 4EFEA 1BCCD 4B7EA 4C7NA 2YKQA 3AG3C 4GKJO 2DMXA 4U7NA 3M91A 1Q43A 4FPPA 2V4HA 2Q67A 4B3SO 4X1IA 2NPSC 3RL0D 3HKDB 5JJJB 2N9BA 2XU6A 2E43A 2ZYGA 2WLLB 2E5TA 1NH4A 1MMMA 1IZ3A 3HUSC 3CRQA 1NTZJ 1S5JA 1JA8A 2EZPA 1Y76A 2IJIA 4JGSA 3EVKA 1OMIA 4PJ0H 2EJRA 1L8DA 4D6TJ 1QVGU 4BIZA 4QGPA 1CSBA 4U3FH 3K59A 3D71A 1KB9D 2WPQA 3SWKA 1HJ0A 2A79B 2IYOA 4O9BA 5CHXA 5JH7B 1XUQA 1AB3A 2F43G 1N8RW 2AXCA 1NAFA 2ZFCA 1VQ6P 4ZKUA 3N7NA 2RDCA 2QJKC 4TLFA 4J11A 4JI7O 1AP6A 2CK3G 4GLXA 1GTOA 5B3SB 1XBLA 4FLXA 4MTOA 1NTMK 1IXMA 2YIUC 4ASUG 5B1BB 1HDJA 3BABA 1SZXA 2GBOA 1T2KC 1KQLA 4L76A 5E79E 3HKBA 2FXOA 1V55B 4LF6O 4EB6A 2PF4E 4MW3A 5CBFA 1JY3P 3RL0g 1YIJV 2YO2A 4O4HA 4P9PA 3RYIB 1R8EA 1MV8A 3ABMC 2M6YA 3U1AA 4R8CA 2W27A 3WB2A 4NB5A 1L0LJ 1EN5A 3ASOC 1OWAA 1N0JA 2JVDA 1HGVA 1FJKA 1NTKJ 3FB5C 2A45I 3TSIA 3ZHTA 4PDRA 2G38A 2L91A 4NR1A 3T1HB 4LFAO 1J1EC 1R5SA 4EIJA 3ZRWB 5L3GA 4ZIBA 1IZNB 2N04A 4N23A 2EIMB 1QLNA 2KI7B 1WA8A 2ZYAA 2ZQMA 3X2QB 3FGAD 4DV1O 1IK7A 3O6QB 5JJEB 2MKVA 1EQ7A 1SA0B 5BVZA 2Q6QA 2Q5ZA 3HE4A 2N1TA 1N32B 2DWDC 5J2TA 5AVUB 1XMOB 4H0LB 2YIAA 4F4LA 2CK3H 1OIPA 1QLEC 3H1HE 4JPRA 1KYOI 2IH1C 4DUYO 1MG1A 3QO8A 2LXBA 5H2FH 4AYCA 4FZ1A 3E22B 1SQVE 1K34A 2AEMA 3ABTA 2OTLV 5B1AB 1IFIA 1KD1Q 2IDBA 4D7SA 3CXHF 4N78E 2QKSA 4GKKO 3I55V 1VPCA 1X8YA 2FXPA 2HODB 1VQLP 1G8MA 1Q81W 2P58A 5CMUA 2VRZA 4EFBA 2Q0AA 1KILC 2Y4TA 3TGUD 4WFHA 1QEXA 3E8BA 3CCUV 3FYIB 2E76B 1V54C 2UUAB 1N73C 3OEHG 1GMJA 4JV5B 2YMYA 1IK9A 5C8YA 2UUBB 3L74E 3CCSV 3FAVB 3A3YB 3KCYA 2HHHB 4TV8A 3CX5D 4WY4A 3CCEP 3TDKA 4D7TA 2D3OW 4JTCB 4H0LD 5KJ7C 2H8PD 4RO2A 3HKEB 1NKDA 2JEXA 2UXDB 2QTOA 4G28B 5KLIC 2YC0A
chains in the Genus database with same CATH topology
3O6QA 1K05A 4R4MA 3C8VA 2OQQA 1KQFB 4Z1MH 1DD4A 3Q5RA 1DD3A 3GMAA 1MKMA 2E75C 4IL6X 2QJKC 4PV1D 1S5LX 2G8YA 2P10A 2WSFJ 2ZT9B 1DIPA 2D2CB 4H44B 2H89C 2NZ2A 1YQ4C 2WPVB 2E76D 1UIXA 2V7QJ 1RQVA 2QJYC 1NGMB 1ZMEC 2YIUC 2E74D 2WSCJ 3SFDC 3AE9C 5L8RJ 1PIXA 1ZP0C 2BEZF 1ZRTE 2WSEJ 1TU3F 4H13D 3ABVC 3GLMA 3RL0g 2E76C 1NYHA 1VF5C 1S1CX 4TT3H 3SFEC 3D70A 1AJYA 1KTMA 1R8EA 1JB0J 1FDOA 4XFJA 3Q5SA 4OGQC 1PL5A 3T97B 2QJPC 3Q1MA 4H0LC 4I7ZC 3R4YA 1VL2A 4R4LA 1KQGB 3B71A 2ZT9D 3AE7C 3EWKA 2D2CD 4H44D 1KORA 3AE8C 4PV1C 5M1BA 3AE1C 3FGAD 5KKZC 1IK7A 2FYNC 2MKVA 4KT0J 2FBWC 1OW8A 3D6ZA 2BEQD 3Q2YA 1VF5B 2E74C 2J5UA 4U7JA 3RK3E 4YXDC 4OGQB 3AEFC 4H0LB 1WMKA 2E75B 1KILE 3Q5PA 3G9RA 1YQ3C 1K04A 4H13C 1Q90D 3AEBC 3AE4C 2H88C 1HF9A 3AEEC 1OW6A 2JO1A 2YMKA 2WQYC 3GF7A 3GF3A 2IDBA 4Y28J 1RQUA 1FDIA 3AE5C 2K9YA 2FXPA 4PV1B 3IAOA 1EXIA 3AE3C 3AEDC 4GDOA 1U57A 3AE2C 1EXJA 3IN6A 2E76B 1OW7A 2QSIA 3LW5J 2ZT9C 2D2CC 2E74B 4H44C 3AECC 4RKUJ 1GMJA 3S9OA 1KMIZ 1ZOYC 3D6YA 4I7ZB 2QIWA 1VF5D 1PV3A 3AEGC 1OMIA 1Y9BA 4OGQD 2G3AA 1HJ0A 4YTPC 4H13B 4H0LD 3AE6C 2E75D 2O01J 3D71A 3AEAC 3H25A 3Q3DA 5KLIC 2JP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9Y A;  2WSE J;  4PV1 B;  3C8V A;  5KKZ C;  2FYN C;  4KT0 J;  1JB0 J;  1VF5 B;  2E76 B;  2QSI A;  2QJP C;  3LW5 J;  4IL6 X;  2QJK C;  2E74 B;  4OGQ B;  1S5L X;  4RKU J;  2WSF J;  4H0L B;  2ZT9 B;  2E75 B;  2D2C B;  4H44 B;  4I7Z B;  2QIW A;  2WPV B;  1Q90 D;  2QJY C;  2YIU C;  5KLI C;  4H13 B;  2WSC J;  5L8R J;  2O01 J;  4Y28 J;  1ZRT E; 
#chains in the Genus database with same CATH topology
 4R50 A;  1PKX A;  4CC5 A;  2YO3 A;  2WLL A;  4FFB A;  4HAM A;  1S5H C;  1FXK B;  1VQP P;  4GKJ B;  2Y4U A;  5IYB O;  5EC1 C;  2YXH A;  2CAZ C;  1NTK D;  3KYQ A;  2FYN B;  3V6I A;  4B3T B;  5AVR B;  1OVR A;  2E76 D;  2V7Q J;  1FOS E;  3M0A A;  1WLE A;  5DEC A;  2GUV A;  4RES B;  3RL0 C;  3OAK A;  5DN6 G;  5AW5 B;  2PP6 A;  1YVW A;  1AJP A;  4I55 B;  1MUU A;  2XAG A;  1IC2 A;  1OCC C;  2KQX A;  3ZBH A;  3II6 A;  4NTW A;  1K33 A;  3CPW U;  1PP9 E;  2XAF A;  3HRN A;  3EFF K;  3CI9 A;  4HB1 A;  4UB8 E;  4W4K A;  3N2G A;  3BHP A;  5GTH Z;  1OCZ C;  1OZ0 A;  4EOT A;  3ZRS A;  2ZNI A;  1SQX D;  4JF7 A;  5FL7 G;  2RH0 A;  4KXR A;  2W83 C;  1KQG B;  2OYH B;  3MHV A;  2FFD A;  1PPJ E;  2FKX A;  3L37 A;  1BSN A;  4YXW G;  2A9H A;  4JI7 B;  3ZCC A;  1P7B A;  3HD7 B;  3L72 G;  1Z56 A;  4JI0 O;  3PJS K;  5KAF Z;  1LP1 B;  2OWO A;  3SJB C;  1BE3 E;  5APU A;  1Y6X A;  3CCV P;  1SZT A;  3JAM N;  4PA7 A;  3A0H H;  4KT0 J;  3WUT A;  5LOV B;  1UII A;  1S0V A;  3D6Z A;  4DO2 A;  3Q2Y A;  1PZQ A;  5APY A;  3CRC A;  4LF6 B;  4JI3 O;  1T6A A;  1TVK B;  4DOJ A;  4AHC A;  3E86 A;  3CME V;  1BGY G;  1RE4 C;  3K03 A;  1BDD A;  3RK2 D;  2R70 A;  4GCZ A;  3OTO O;  4F6R A;  1NU1 G;  1WPB A;  1L1F A;  4BW5 A;  4Y99 B;  2QR4 A;  3IGA C;  4UFZ A;  4IL6 E;  3V2P A;  3L75 D;  1RQU A;  1A02 J;  3CYO A;  3L70 D;  4K0K O;  3N4X A;  2CH7 B;  3RK3 B;  1QU7 A;  3FX7 A;  4LFA B;  1QVF U;  2JKV A;  4LFB O;  2QWO B;  2V4D A;  2RKL A;  1XNR O;  3MHH C;  3T1C A;  4X64 B;  4FJC C;  4A7P A;  1PM9 A;  5B3S C;  1LT9 A;  4DV1 B;  1L0N E;  5EBW C;  2RN9 A;  1NVO A;  3AEG C;  4K3A A;  5B1B C;  3P8C D;  2XAJ A;  2EBO A;  1O9G A;  1EDJ A;  3H1L G;  4YXW H;  2PTM A;  3L72 H;  1GKF A;  1I7F A;  1V55 C;  1PL0 A;  1SS3 A;  5JQG B;  3CXH H;  3LSQ A;  1K05 A;  3M99 B;  2CUG A;  2RQ6 A;  3FFQ A;  1IUR A;  3AEI A;  2Q3E A;  3E7K A;  3ZMU A;  3D3I A;  3C9I A;  3CWB G;  3A0B H;  3OTF A;  4O2A A;  4GKK B;  4O4J B;  3RK3 D;  5BU5 A;  1HH0 A;  4B08 A;  3FAV A;  4O4L A;  2KXP B;  1XEQ A;  1Q5O A;  3M0D C;  3JAK B;  2QE7 G;  3ETQ A;  5B1N A;  4LF9 O;  1K9M W;  1YHQ V;  3M9Q A;  3OE7 G;  1S9K D;  3TF5 A;  1NU1 H;  1RHZ B;  5AW6 B;  2K9J B;  3SFD C;  1P84 E;  4U3F D;  2EIM C;  2LKM A;  1X59 A;  1GN2 A;  1RPO A;  1NWQ A;  3OR6 C;  4FMT A;  4I0X B;  1WB8 A;  4IL6 Z;  3X2Q C;  3B8N A;  1VQK P;  2ZXX A;  3ABV C;  1YYC A;  3I5C A;  2XUM A;  4MSW C;  1AFO A;  1JO5 A;  3W7W A;  5JWP A;  2Z5H A;  4JZG A;  3I56 V;  2XV5 A;  3Q5S A;  1NTM E;  5DJT B;  2FXM A;  3CD6 P;  3CME P;  3Q1M A;  4H0L C;  4L74 A;  3CL3 D;  3SPG A;  5LP6 A;  4OWF A;  2YI9 A;  3FB7 C;  2IFM A;  4YJ3 B;  4YY3 O;  3LID A;  5KHI A;  3SR2 C;  3N2K B;  1M90 Q;  3SPI A;  3VOU A;  1H88 A;  2KS1 A;  5B1A C;  3KG2 A;  1RF1 A;  1S2E A;  3U59 A;  4KJM A;  5K1X A;  1Y66 A;  3H1L H;  3WMM 0;  1KOR A;  3BAA A;  1FE6 A;  2P6J A;  2WT7 B;  2A06 E;  3GHG B;  5CBG A;  2KG7 B;  1PNL A;  4LR3 A;  1VAR A;  1AJQ A;  1R3K C;  1H8H G;  2YDE A;  2AEJ A;  1PNK A;  5CMZ A;  3DGE A;  1HWT C;  3UM7 A;  5LHH A;  5CCH A;  4NYK A;  2LFR A;  3K5N A;  1MAB G;  4WFF A;  3A8T A;  2KK7 A;  3CEI A;  4DV3 B;  4DCK A;  2QE7 H;  3JSN A;  1H38 A;  5IWA O;  4CC6 A;  2R3C A;  2A7W A;  2UWJ E;  1YQ3 C;  3MDS A;  2O01 H;  4PJ0 Z;  2FYU G;  2YUA A;  3WB1 A;  1YJW V;  5TIS H;  1LTJ B;  2WSE H;  2YMK A;  2QJY B;  1URF A;  1AI4 A;  1M1K Q;  4B3M O;  1HBW A;  2AHZ A;  1LWU B;  1FXK C;  2O01 N;  2OYI A;  4WF9 V;  2KSE A;  3AE2 C;  4JI0 B;  1QX8 A;  4PA9 A;  4LP8 A;  3JAS B;  4NPD A;  4UCT A;  4I7Z B;  4I4T B;  3RYF B;  5B5E E;  3VQX A;  5FNV B;  2DJV A;  1SQQ E;  3HPL C;  4CH3 A;  3TCU A;  4DV7 B;  1SES A;  4JI3 B;  2Q3I A;  2CH7 A;  1SQB J;  1QVG O;  1AJN A;  3BVO A;  3NR7 A;  4J7K A;  1N33 O;  2JP3 A;  2IZ1 A;  1PV0 A;  2HLD G;  1YTZ T;  2OQQ A;  3OTO B;  1EZJ A;  1FU1 A;  3F7Y C;  2EZO A;  2QTS A;  3LNN A;  4HYO A;  4WVZ A;  3DTU B;  4DR5 O;  1NTZ G;  1DK1 A;  1DEB A;  4HJG H;  2YSU B;  4MT8 A;  2UUC O;  1EBO A;  3RGU A;  4LFB B;  2OYH C;  1TUB B;  2B1G A;  4D6T G;  2BCC E;  4OVN F;  1JY3 N;  1XNR B;  3ZRV A;  1GL2 B;  2H3O A;  3HD7 C;  5GON B;  1ZR2 A;  2EIK B;  2X6C A;  1WRG A;  3KQG A;  1OCO B;  1EZV I;  1W2B U;  1X9V A;  1H0T A;  1ZP0 C;  3AG3 B;  2FYU K;  2HLO A;  4UB6 E;  2X6A A;  4X9Q A;  1GW3 A;  3GLM A;  2GTA A;  2ZE7 A;  3ZMT A;  4X62 O;  1N4C A;  1COW G;  2F95 B;  1FDO A;  5CJ4 A;  1N8R Q;  4UUJ C;  3JAK A;  1ZR4 A;  4QJF B;  5IJ9 B;  5CBO A;  4MTG A;  2HP8 A;  1F7Y A;  1VL2 A;  3BRT B;  4R4L A;  5CB4 B;  4Y99 C;  3UO2 A;  4L75 A;  4DR7 O;  2WPD G;  1SQV G;  4I0X A;  3H1I E;  3E2E A;  4ASV A;  3CCQ V;  3E89 A;  4IIJ A;  2PYL A;  4LF9 B;  3RK3 C;  3WU2 E;  4YIO A;  4LH7 A;  1SQP J;  1K4C C;  5IDJ A;  2KLV A;  1MZ9 A;  4J41 A;  3L72 J;  1VIB A;  4IHJ B;  1URQ D;  1EDI A;  4JI6 B;  2KUB A;  3OA7 A;  2QA4 P;  1J5E O;  2WSF H;  1L0L G;  4EKW A;  3J81 N;  4DV5 O;  1NTZ H;  1YJ9 P;  5K1P A;  5FPR A;  3VMY A;  2UU9 O;  5CA3 A;  4I50 A;  1GK4 A;  1M8O B;  2C9L Y;  1NTZ K;  1FZG A;  4D6T H;  4Z2W A;  2QM7 A;  2DW3 A;  4WBA A;  5LMN O;  2N05 A;  1AVM A;  5KLV E;  1B06 A;  1NU1 J;  3L36 A;  3E8H A;  2ZXE B;  1IO4 A;  2O57 A;  2KIK A;  1R1B A;  1AIL A;  2R5B A;  3K3W A;  2IYP A;  1XIL A;  2B9B A;  1P84 I;  1I08 A;  1EXJ A;  4IT5 A;  3BCC E;  4P30 A;  2ZJS E;  1OVV A;  4ZOL A;  2IU3 A;  2Q7E A;  1ZOY C;  1GZL A;  1LTJ A;  2HJD A;  1KQS U;  2KSJ A;  5CN0 A;  1NAY A;  1V9P A;  1BSH A;  2R9R B;  1SLQ A;  1SQV H;  1VQ8 V;  2ARH A;  2ZDI C;  1N36 O;  1LWU A;  2XHB A;  1YJN V;  1VQN V;  5IWA B;  3WU2 Z;  3H1L J;  3JCU E;  3ABL B;  4DYL A;  1VQO P;  1Q81 Q;  1PP9 G;  1Q6I A;  1AV1 A;  2HKO A;  1NQT A;  3JAS A;  4ZI7 B;  1JY2 N;  1Q3E A;  2ZYD A;  4IFF A;  2E75 C;  4B3M B;  2WLJ A;  1GW4 A;  4L73 A;  3J80 N;  3AG2 B;  2WPS A;  5EZY B;  1L0L K;  4PDL A;  2JS3 A;  3VP9 A;  4NXN B;  3W7X A;  1NTK K;  3N27 A;  1N7S B;  3KCX A;  2DN9 A;  3AK2 A;  4WFB V;  1JCC A;  3AK1 A;  4PDV A;  1SC5 B;  1NGM B;  2K1A A;  4NXM O;  3BY6 A;  3RYC A;  1N7L A;  3AE9 C;  3G4S V;  2YEV B;  5AVQ B;  1UJW B;  1G1I A;  2EUL A;  1PIX A;  3FWL A;  3GHG C;  2IW5 A;  3CCM V;  3L72 D;  3CXH D;  2W6J G;  4YHH O;  1GN3 A;  2WSE J;  5KMG A;  1XOU A;  1PGP A;  2IJJ A;  1I5X A;  1S5L Z;  2E5L B;  4WFE A;  2BE3 A;  5KX5 B;  3A0H Z;  1FZB A;  1LTA C;  2IBZ E;  2M5A A;  5EIB D;  3CPW O;  5A9G A;  5IJ0 B;  1KYO E;  2J58 A;  3C1L A;  1N33 B;  3KKY A;  4X1K A;  1LT1 A;  4MVU A;  1HGZ A;  2EIL C;  2P1J A;  3H1K E;  1V54 B;  2V7Q G;  2IPP A;  3OGI B;  5B1O A;  5GON A;  3K0D A;  1BGY D;  4XE5 B;  4I2L C;  5KUK A;  2F66 C;  4DR5 B;  1URQ A;  1IFD A;  5DM6 V;  1NU1 D;  1MSW D;  3CC7 V;  1JTH B;  1HW7 A;  2OIE A;  1W59 A;  1LWU C;  2KZI A;  1BS3 A;  1N7S D;  1ZN5 A;  2WLN A;  2NPS A;  2OCH A;  2QM4 A;  3AE1 C;  3JCU Z;  5LGT A;  2V1D A;  1YXB A;  1JY2 O;  1PP9 H;  5KHK A;  4W7Y A;  2EX3 A;  4UB8 H;  3HUS A;  1NO4 A;  4GKG A;  1KIL E;  4X62 B;  1VQ6 V;  2WSC H;  4P9O A;  4KFM A;  1ORQ C;  2PUS A;  3W7S A;  1K04 A;  4J42 A;  1HF9 A;  1OW6 A;  1H8E G;  2HJF C;  1KC8 W;  3H1L D;  4X20 B;  3S3X A;  3GF3 A;  4CPG A;  5LGN A;  4G27 B;  4IHJ A;  2W6J H;  1FJP A;  3SPH A;  2RNB A;  4XA4 A;  3IF4 A;  1BE3 H;  3CS5 A;  2PYJ A;  1U97 A;  2ZR2 A;  3JAW B;  2QSA A;  5KJ7 D;  3ZMZ A;  3CWB D;  2QWQ B;  1NBM G;  4IYI A;  1I94 B;  2ZR3 A;  4BWN A;  2WLI B;  3HE5 B;  4JPZ B;  4FIP C;  2V7Q H;  3TXS A;  1IFN A;  2B89 A;  1GL2 C;  5BR8 O;  4X89 A;  2EIK C;  4DV5 B;  1BCC E;  1QR8 A;  2X0L A;  4QMA A;  3KXD A;  2UU9 B;  3AEA C;  1GN6 A;  1HR0 B;  4H33 A;  1JMM A;  3EQ2 A;  4C46 A;  3ZX6 A;  2JGD B;  1Y74 B;  1FAF A;  3CCR P;  2H43 A;  3ETD A;  3P8M C;  1FJG O;  3AG4 C;  1SFC B;  1EDK A;  5J9P C;  1MKM A;  4BR6 A;  1WP8 A;  2GSM B;  3OJA B;  1M1J B;  2Q5U A;  2WSF J;  5ITZ A;  2Y0E A;  4QNH B;  1Z5V A;  3ITK A;  3CC7 P;  3ZDM A;  2O3J A;  3IAY A;  1K4D C;  5IY5 B;  1T5E A;  5LYJ A;  2DWE C;  4JI4 O;  4LF5 O;  2NRG A;  4ZMD A;  3UQ8 A;  1KB9 E;  2XAQ A;  1YTZ I;  1NHL A;  2HPC B;  3JD3 A;  3SPJ A;  4QPJ A;  5J2U B;  1S1C X;  5LHG A;  2C0X A;  2X6B A;  1KTM A;  4IFM A;  1JMK C;  2I1J A;  4TUY A;  5APT A;  1PL5 A;  1VQL V;  2VWK A;  1DLB A;  1E79 G;  4WBN B;  2B87 A;  2ZVO B;  2K37 A;  4LC1 A;  2XAS A;  5H6R A;  1SFC D;  2QGN A;  2QRX A;  5KTB A;  4WFA V;  1K9M Q;  2LW7 A;  1M4U A;  3VBB A;  2FYU D;  4PD4 I;  1ZWI C;  2QEX P;  3AE7 C;  1GM7 A;  2W0X A;  3WUU A;  3AE8 C;  5CA1 A;  3ZS8 C;  4KP4 A;  1SQV J;  3CCE V;  5KHH A;  2KNC A;  3CC2 P;  5LA6 B;  1WB7 A;  2DQ3 A;  1KIL A;  3C3T A;  3D3Q A;  4X65 O;  4DV2 O;  3JD4 A;  2VQE O;  1VF5 B;  1MZE A;  3ZMS A;  4JI5 B;  5CJ0 A;  4UVB A;  1N73 A;  3UT5 A;  1VQP V;  1J2J B;  2YNY A;  5JVD B;  1FS0 E;  3RN4 A;  3E8F A;  1JX9 A;  4YJ2 A;  1YIT P;  2ZXW C;  2ZNJ A;  2B88 A;  5KJ7 A;  3THO A;  5EIB C;  1F4M A;  3R65 A;  3L74 J;  2WQY C;  2B1I A;  3ZN1 A;  1QL2 A;  2ZCE A;  3ABL C;  2JRI A;  1HNW O;  1NI8 A;  2C0W A;  2Q68 A;  3TNU B;  4AUW A;  2YI8 A;  3LUT B;  3GWO A;  1XL6 A;  5IYZ B;  4Q20 A;  2Q8V A;  2Y48 A;  4ZHQ A;  1NTZ D;  2ITD C;  3BA8 A;  3LW5 J;  1OCR B;  3AG2 C;  4JTD B;  1A32 A;  1EFR G;  2HR3 A;  1E79 H;  2IBZ I;  2OIG A;  3D6Y A;  1N7S C;  1M93 A;  4D6T D;  2K9P A;  1VF5 D;  4QE9 A;  1NZ6 A;  1Y67 A;  3OMN B;  2DW4 A;  5FPO A;  5BU8 B;  1JJO A;  1G4Y B;  4PI0 A;  4HNA B;  1FFX A;  1LUW A;  1P4R A;  3F5H A;  3RVY A;  2F23 A;  2JJ1 G;  3TGU E;  2XTA A;  4O2B B;  1DD4 A;  4PA3 A;  1FZC C;  1VQ9 P;  3GMA A;  3V2Q A;  5GTH E;  2C9N Y;  3CCV V;  1PP9 J;  3QG5 A;  5LXT B;  5B5E H;  1AQT A;  3CX5 E;  1SQB G;  4I9W A;  5KHG A;  3H1I G;  3S4R A;  2WSC J;  4XDK A;  3RYH B;  2PI5 A;  4C7U A;  5KAF E;  4RQF A;  5LBQ A;  1W2B O;  5BR8 B;  2VS0 A;  3HKD A;  3PP5 A;  3OT7 A;  3OMI B;  2CPB A;  3OD4 A;  4Q6G A;  4AQY O;  3SFE C;  1KYO F;  1BE3 J;  1L0L D;  1NTK E;  3MIW A;  2Z5U A;  3ZHQ A;  1SF9 A;  3D36 C;  2IX7 C;  4B3S B;  3MGN A;  4MVM A;  1UPG A;  1RE4 A;  5L3C A;  5EYP B;  2BCC H;  1BQZ A;  1FJG B;  1BHA A;  3Q4H B;  2UXB O;  1VF6 A;  2PZS A;  2VRS A;  2H7H A;  1AQ5 A;  4NVP A;  3M9H A;  3K9S A;  1MOF A;  2JEU A;  4PHZ A;  2YIB D;  1JY2 P;  5KAI H;  2LXC B;  3T4Z A;  5JCO A;  5JH7 A;  2OTK E;  1IBK O;  2EIN B;  1QGK B;  3IC9 A;  4JI4 B;  3C90 A;  4RUF A;  1XNQ O;  1CP9 A;  3CP1 A;  4OPA A;  1TA8 A;  1NVP B;  3O9O A;  4G2K A;  3T4D A;  1D5N A;  3BCC G;  4ABM A;  1MFZ A;  4YXD C;  2XDJ A;  1NR7 A;  4B3R O;  2IZ0 A;  1Q6U A;  1SQX E;  4Z1V A;  1ROP A;  3FD9 A;  3OW2 U;  2YKO A;  1JFF B;  3QWO C;  1SQB H;  1L0N J;  3H1I H;  2JO1 A;  1HJB A;  1SQP G;  3SWF A;  2FB5 A;  2BOB C;  1SQB K;  3MHS C;  3QO5 A;  1NR1 A;  2YXR B;  3RYI A;  4LNU B;  5AVV B;  1RSO B;  2BTQ B;  3HTK B;  1SFC C;  3BRC A;  1RPR A;  4J80 A;  1KB9 I;  1PP9 D;  2A45 G;  3KZI H;  1ZSP A;  1CI6 B;  1VQK V;  1M1J C;  2BSK B;  2Y0D A;  2QWP B;  1NOH A;  3NTN A;  1VEW A;  3OFN G;  1YCI A;  3M0D A;  1KMI Z;  3R66 A;  1N34 O;  3CD6 V;  5IY5 C;  4X65 B;  1NVP D;  1EZV E;  3ZRX A;  1QR9 A;  4OPH A;  1XI1 A;  1JM0 A;  1AP5 A;  2W6I G;  3JD1 A;  3ZRW A;  2VQE B;  1PV3 A;  5GTI Z;  1KQS O;  2JWA A;  4CS2 A;  3OAA G;  5L3D A;  2AXT H;  1VF6 C;  4W80 A;  4RJT A;  4JI2 O;  3OUS A;  4LWS B;  3P3P A;  5A2Q N;  5K5G B;  2R72 A;  3L75 E;  1GK6 A;  4FM2 A;  3L70 E;  3O6Q A;  4GX0 A;  1SA0 A;  4CZZ A;  4KL1 A;  5JCO C;  5AVS B;  2PY5 A;  3HD7 D;  3PTZ A;  1HNZ O;  3BCC H;  3V2R A;  3OGC C;  3RBX A;  2EJ7 A;  1HNW B;  2UXC O;  1IBM O;  1XDC A;  1RF0 C;  2G8Y A;  3W67 A;  1KU9 A;  3JAR B;  1M5I A;  5EFW B;  1XTC C;  1DEE G;  1YQ4 C;  3E22 A;  4C7R A;  4LH6 A;  3P8C E;  4HNA A;  3K04 A;  1ZME C;  4U3J B;  4ZBM A;  1SQP H;  3U10 A;  4LFC O;  4ASW A;  4EI2 A;  2HOD A;  1FDM A;  3RWR D;  4O2B A;  5D5P A;  2ZE6 A;  4DUY B;  3JAL B;  2R32 A;  2ZVN B;  3IFM A;  1VF5 C;  2A45 H;  2YIB A;  1JB0 J;  4XFJ A;  2YXL A;  3MUD C;  2XOK G;  4JZ2 A;  4MN4 C;  4WCE V;  3QH9 A;  1K92 A;  4I6M C;  4JQ0 D;  5B66 Z;  1S9K E;  5EK0 A;  1TGO A;  3RYH A;  2KZJ A;  4PJ0 E;  3HKE A;  4FLV A;  4GUN A;  4U3F E;  1ZUQ A;  1LGH B;  4OH8 B;  4MW8 A;  2POH A;  1KN7 A;  3T1Y O;  2ZKO A;  2XNX A;  1NU1 K;  1FXK A;  2XND G;  2XZR A;  4EYY Q;  3B09 A;  4DR3 O;  4EDF A;  2OTJ P;  1JR9 A;  3ZJZ A;  3A2F A;  1OCR C;  1KYO H;  4U7J A;  5EYP A;  2E75 B;  1YZB A;  2CTW A;  2PFX A;  3IC7 A;  3K57 A;  4F6E A;  4I55 A;  1SQQ J;  4HYT B;  2ADQ B;  3H32 B;  3LDD A;  1NJI W;  3CX5 I;  2UXB B;  2ITA A;  1HVV A;  4PV1 B;  4JAS A;  2ZIN A;  2HFE D;  2ZM6 O;  1K7D A;  1D5A A;  4OX9 O;  3AE3 C;  3H6P A;  2P22 C;  5HFL A;  1HTL C;  2K88 A;  2XAH A;  2OYH A;  4DV6 O;  1ARO P;  2QIW A;  2EIL B;  1AI6 A;  3EXA A;  3HD7 A;  1M57 B;  2G3A A;  4ZKP A;  1Y8A A;  2BCC J;  2YXQ B;  2E75 D;  3CJH B;  3CC4 P;  1LP1 A;  2Y0C A;  1KC8 Q;  5H5N A;  2XT9 A;  2EIJ B;  1LNQ A;  3R2P A;  4XDJ A;  5LOV A;  2XND H;  3K08 A;  1MFT A;  2VQF O;  2MJZ A;  5BY1 A;  3E35 A;  1OFC X;  4KHP O;  4W4L A;  5FLX N;  2DYS B;  1L4A B;  3MD0 A;  1TVK A;  4IL6 X;  4PV1 D;  4BXL A;  1LUV A;  4X66 O;  2RN0 A;  2QA4 V;  5H2F E;  1YJ9 V;  3L73 E;  1ENV A;  3LDE A;  3B4S A;  3ZHS A;  4HKZ H;  4XBF A;  2JR8 A;  3JAT B;  2F4V O;  3CLQ A;  1W0J G;  3G71 P;  4PI2 A;  1N34 B;  2EIN C;  1P7G A;  3H1I J;  4K8X A;  2Q4P A;  2OT5 A;  2ZIO A;  3ABK B;  2L5G B;  2Q9I A;  1X79 B;  3JAR A;  1X0T A;  4DUZ O;  3OUF A;  2Y0I A;  3A5T A;  1VQM P;  4WFG A;  1VQ5 P;  4K0K B;  4WB4 A;  4UCR A;  4DW0 A;  2OYQ A;  1L4A D;  2GUZ B;  3QTC A;  3K5B A;  3KPE A;  3W68 A;  1FOS F;  2CE4 A;  1G2C B;  2WWW A;  2KSD A;  1IBM B;  2Q0O C;  5JQG A;  3B5N B;  5CCG D;  3EFG A;  1FYJ A;  5AG2 A;  4FM1 A;  2NLJ C;  1Z5W A;  4N6J A;  1TAE A;  2IJK A;  4K35 A;  1F51 A;  1JQ0 A;  1WT6 A;  5M1B A;  5DED A;  4GOF A;  4QPK A;  5AW3 B;  5KLV J;  2A3Q A;  3CCL P;  1GRJ A;  4JTA B;  3FXD A;  1SRY A;  2OAR A;  3CB2 A;  2LGQ A;  4O4J A;  3ML0 A;  3K9A A;  2YS8 A;  1RFY A;  2BEQ D;  2UXX A;  1IBL O;  4O4I B;  1VQO V;  3AG4 B;  3OM3 B;  4TOI A;  4HH2 A;  1JJ2 U;  4QIW F;  3HKC B;  5JJN B;  2BAS A;  3BCC J;  2KB1 A;  3ABU A;  3K5L A;  3H1H G;  1FZE A;  1FKA O;  2FML A;  3LDC A;  3PN1 A;  1XHX A;  2K9J A;  5H2F Z;  1HP8 A;  4YIP A;  1WJZ A;  2P4V A;  1PD3 A;  2ZDI A;  2W90 A;  1ZLZ A;  3LSS A;  3RT3 C;  5BZB A;  4Y28 J;  1JNM A;  1E1Q G;  1KFN A;  5E79 H;  4FLT A;  3H01 A;  4TQD A;  1GL2 D;  1SQF A;  4X1Y B;  4H37 A;  3B5N D;  4JI1 O;  2QKC A;  1GM8 A;  2Z5I A;  4BWA A;  2K1E A;  1S77 D;  2KLU A;  4P2Z A;  1KUQ A;  3VTP C;  5AW7 B;  2AEF A;  4YJ3 A;  5TJH A;  1R3I C;  3F7V C;  3ETG A;  3N2K A;  4DR3 B;  2Z0A A;  5AW8 B;  2Y0P A;  4UV9 A;  1DX7 A;  3L74 G;  1SQB D;  4BRY B;  1Y9B A;  3B2E E;  3H1I D;  4YTP C;  1RP3 B;  5LGU A;  4JF3 A;  4W7Z A;  3GHG A;  2WT7 A;  2KG7 A;  2L6L A;  1Q82 W;  4YY3 B;  1HNX O;  1USD A;  3SJC C;  2QJ1 A;  1S5L E;  3C8V A;  3A0H E;  1H89 A;  5HFM A;  4NKG B;  2VWJ A;  1Q86 W;  2JJL A;  5E1A C;  5APQ A;  4GOD A;  4PD4 E;  1K97 A;  3DSQ A;  4UV8 A;  3KHU A;  2N74 A;  3H1H H;  3RGB A;  1KZU B;  5C93 A;  3H1K J;  1NT2 B;  3G6E P;  2HFE C;  1XRE A;  1HWY A;  1R6N A;  2ZXW B;  1HUC A;  3OEE G;  5KAI Z;  4C7N B;  1ZRT E;  3IFX A;  2JEE A;  1SQV K;  4DR4 O;  1SS1 A;  1H2N A;  3WG7 B;  4AQR D;  2FKW B;  1KEC A;  4R6Z A;  4X1I B;  1JUN A;  3BCC D;  3ZHR A;  5GTH H;  1Y47 A;  4I4T A;  3R4Y A;  3L71 E;  3RYF A;  2VQF B;  5FNV A;  3VQY A;  4KHP B;  1GU5 A;  3JCZ A;  1IFM A;  3L74 H;  3GVM A;  4YPC A;  1RH5 B;  2RJZ A;  3JSL A;  1PPJ G;  1Y76 B;  3CMA P;  1B3Q A;  4E4E A;  3D8C A;  1P84 F;  4MS2 A;  4X66 B;  1SQP D;  3CXH E;  4PV1 C;  1BT8 A;  4PA4 A;  5AVZ B;  4I5S A;  3CHX A;  1Y4M A;  1BE3 G;  1JPX A;  1LR1 A;  1BL8 A;  3P32 A;  1Q7Y W;  3KZI Z;  2F4V B;  1R5L A;  3LW5 H;  1W2E A;  4NPF X;  1OW8 A;  3A7O A;  3BPZ A;  3CCR V;  3BA9 A;  4GT1 A;  2J5U A;  1FAV A;  4JYC A;  1FZC B;  1TUB A;  1AI7 A;  2GUZ A;  4R7C A;  3E1I A;  1BGY E;  1EZV G;  1GL2 A;  1M57 C;  2P67 A;  4FVM A;  3OW2 O;  4DUZ B;  1Q90 D;  5KA5 A;  2WPR A;  2ILM A;  1IVS A;  2WA3 A;  3GF7 A;  2EIJ C;  2UUC B;  1YI2 P;  1KV4 A;  1BCC J;  1I0H A;  4NTX A;  2GV9 A;  2K9Y A;  2Y9Z A;  2CTP A;  3M8A A;  3HKB B;  3SJQ C;  4TT3 G;  2DYS C;  4O4I A;  4EB6 B;  3U0Z A;  3VYI A;  1L4A C;  1KYO D;  5KKZ B;  5IJ9 A;  3HKC A;  4O4H B;  5CCG C;  4J9Z B;  2WLH A;  3S1K A;  1YEW A;  1OHH G;  2JWD A;  4CS3 A;  5CB4 A;  3S3W A;  5CBH A;  2QG4 A;  2WMM A;  1B6Q A;  1L0N G;  4PEL A;  3CRM A;  2PGD A;  1IBL B;  3AG1 B;  4E2L A;  4NPE A;  1PPJ H;  3UCS C;  2H94 A;  3H1L E;  3AE6 C;  1J1D B;  3MP7 B;  3H25 A;  1WP7 A;  3ABK C;  3VMA A;  1EC5 A;  2QEX V;  2Q1K A;  4DR7 B;  1KQF B;  4EEQ A;  1WA8 B;  3Q5R A;  1QVF O;  4AI8 A;  3CC2 V;  3ZN0 A;  3CWB E;  3H1J E;  1OJH A;  3A0B Z;  1S72 P;  2B9Z A;  1S5L X;  3HR0 A;  2D2C B;  2N1T B;  1XTG B;  1EZV H;  5J2T B;  3ASN B;  3ETE A;  3JYC A;  1NKZ B;  1J5E B;  1RQV A;  1BHB A;  5TIS E;  3B5N C;  1VP7 A;  1W0K G;  5LHI A;  3B40 A;  1KKC A;  1YIT V;  4IL6 H;  2HEP A;  3C3S A;  1TU3 F;  5IE9 A;  4JV5 O;  2PAJ A;  4TT3 H;  5LMN B;  2UUB O;  1AJY A;  1VQ4 P;  3APQ A;  1H2L A;  1VQ7 P;  2GDS A;  1NTM G;  1UFI A;  5L3E A;  3CCJ P;  2UXD O;  3VMX A;  4I1L A;  4DT0 A;  1L0N H;  4J7Z A;  1S3J A;  3CXC U;  5C8Y B;  5KHJ A;  4TV8 B;  2D2C D;  1L0N K;  4GIF A;  4WY4 B;  2N1T D;  1PGJ A;  2B5U A;  2LQT A;  4B3T O;  2Q9L A;  2A06 G;  2ATK C;  2QM8 A;  2QWN B;  2M3B A;  5APW A;  4ZI7 A;  3STZ C;  2O1J A;  4FFB B;  3SYC A;  1N36 B;  2PGG A;  4CBC A;  4CH5 A;  5EZY A;  4OGQ B;  5IYD O;  3AEF C;  4DR4 B;  1N7S A;  4CH6 A;  1GTW A;  1VQ9 V;  2DYR B;  1SVF A;  1K3E A;  2WLM A;  3TJT A;  2OCC B;  2YEV A;  2FYU E;  3PLN A;  3FWN A;  5TIS Z;  4UCO A;  3AEE C;  3H1H J;  5AW1 B;  1P84 H;  1OX3 A;  2Z3Y A;  2OGU A;  1F23 A;  3AE5 C;  5KX5 A;  1SET A;  3WUV A;  3WB0 A;  3V2N A;  2K3R A;  5IJ0 A;  3IAO A;  4WY4 D;  1FZC A;  4NXM B;  2LFS A;  2IFN A;  3TGU J;  5H6Q A;  1NTM H;  1OW7 A;  2QSI A;  2NR5 A;  4YHH B;  1T3U A;  1AR1 B;  2BOC C;  1JCD A;  2Z4E A;  1IXB A;  3N2G B;  4LLH A;  4BAY A;  3L73 G;  3AK3 A;  2LGW A;  3L9D A;  1S76 D;  1SQQ G;  1AVY A;  4OGQ D;  1JTH A;  4N3Y B;  2IH3 C;  3CRA A;  4PA6 A;  2J59 M;  2FFD B;  3E8G A;  1SP4 A;  5EBM C;  2HVJ C;  2A06 H;  1USE A;  2JS5 A;  1NJI Q;  3WG7 C;  1U7J A;  4CH4 A;  3GWK C;  1FZA A;  2GHY A;  1NTZ E;  3CXH I;  4K8Z A;  3USS A;  1M56 B;  2YXY A;  4NTY A;  3D36 A;  4PD4 F;  2P7T C;  2P10 A;  2WZ7 A;  4H44 B;  2NZ2 A;  3P30 A;  4D6T E;  5BMV B;  2CGO A;  2BCC G;  3FXE A;  4X20 A;  2Q73 A;  1YTF B;  3V4Q A;  2DOS A;  4TV9 B;  1BDC A;  5L8R J;  1K8A W;  4LCU C;  3J7A U;  4F6R B;  4X64 O;  3JAW A;  1QL1 A;  4UCV A;  3CRR A;  3HB3 B;  2P7J A;  1N0N A;  2E42 A;  3VN0 A;  1FPO A;  1U96 A;  1US6 A;  2WLI A;  3HE5 A;  1FZF A;  1ZTE A;  1G6U A;  2M8R A;  1DF5 A;  4X88 A;  3L73 H;  2LW1 A;  4BW9 A;  2QKA A;  2P2U A;  3H1H D;  1QCE A;  1LT9 B;  2Q7G A;  1M56 D;  1SQX J;  1SQQ H;  4LBE C;  3NFQ A;  3SSU A;  1B04 A;  3MZW B;  4IGG A;  1SQV D;  1FC2 C;  4H44 D;  4FLZ A;  3PH0 A;  2JGD A;  4DRX B;  1Y74 A;  2FY8 A;  2AW9 A;  2R9A A;  1SQQ K;  5E79 Z;  1W5C E;  2WTY A;  4N78 D;  1AI5 A;  1YTF D;  2WSS G;  3E1R A;  2AZ0 A;  1SFC A;  5KKZ C;  4U7O A;  2CGN A;  4LF4 O;  1L0L E;  2XKM A;  1M1J A;  3APO A;  2ZAE B;  1EN6 A;  1E1R G;  4O2A B;  5EBL C;  1MNG A;  4O4L B;  3AG1 C;  1S4X A;  3L74 D;  5GTI E;  5AW4 B;  3AEB C;  4DR1 O;  1J1D C;  1THZ A;  2ZIM A;  5KLV G;  1YIJ P;  2R44 A;  2W6A A;  2HPC A;  2KP8 A;  4UB6 H;  5J2U A;  3FB8 C;  3SYP A;  1IFP A;  3L75 J;  3L70 J;  4J10 A;  4AIL C;  3JSV C;  4LF5 B;  4GDO A;  1MSD A;  3BAS A;  1BQ0 A;  1AR5 A;  4WBN A;  1RF0 A;  2D2C C;  2R3S A;  2N1T C;  4LF7 O;  3P7K A;  3ASN C;  1H2G A;  1K73 W;  5LP6 B;  3TXQ A;  4H13 B;  3LNM B;  1VDF A;  2CPS A;  2JDI G;  5LA6 A;  2KS1 B;  1RF1 B;  3B77 A;  1R6K A;  1CXZ B;  3WU2 H;  1DF4 A;  3U11 A;  5AVX B;  2MK3 A;  3PRJ A;  2JK5 C;  2JGU A;  3E83 A;  1XMQ O;  2WSS H;  3K06 A;  1GD2 E;  4DV3 O;  1Q8I A;  4DZO A;  3MUD A;  3RK2 B;  3WFV A;  5CBN A;  1EM1 A;  4GX2 A;  5JVD A;  1M7L A;  2CTQ A;  4IYH A;  2OTJ V;  3L71 G;  3SYA A;  5B66 E;  4ZKI A;  1H2K A;  1K5S A;  2IJH A;  4JYA O;  2Y9Y A;  3IR9 A;  4QE7 A;  2OTL P;  3VQV A;  1LTB C;  3KDP B;  1UIX A;  4DV0 O;  4MVZ A;  4DV2 B;  2ADP A;  5LMU O;  4WY4 C;  1PPJ D;  2CDY A;  2UXN A;  3I55 P;  2N9Y B;  3OR7 C;  4GX5 A;  4RAI A;  3L35 A;  5KLV H;  1T8Z A;  3F89 A;  4U3F J;  3L4F A;  3CCU P;  3TNU A;  1Q82 Q;  1L2P A;  1S5L H;  1KP3 A;  5IYZ A;  1GM9 A;  1BE3 D;  4H13 D;  1ZAU A;  5KLV K;  2IBZ G;  2Q69 A;  3JD0 A;  4HZ3 A;  2HG5 D;  2OYI B;  4MVR A;  1XQ8 A;  4OGQ C;  4DV7 O;  1Q86 Q;  3CCS P;  5BMV A;  4PD4 H;  3JD2 A;  2DYR C;  3BFR A;  3H1K G;  4JI8 O;  4RWU A;  2OCC C;  2RCV A;  1EZV D;  1NTM J;  4TV9 A;  1D7M A;  2WA4 A;  3TYY A;  1H8A A;  3B71 A;  3G3Z A;  3K79 A;  3EWK A;  5CCH D;  4KUM A;  4XDL A;  1KB9 F;  3TET A;  2JDI H;  1ZXG A;  3JC2 2;  4LGD E;  2P5O A;  2M0B A;  3JCU H;  3CC4 V;  4Z1M G;  2WVR A;  2LJ2 A;  1SQP K;  4WWI A;  1O9H A;  5L3B A;  3B8E B;  2IM9 A;  4GOE A;  1NS1 A;  5LXT A;  5KA6 A;  3BAT A;  1JOY A;  4UB8 Z;  2R9I A;  3RK3 E;  3DC5 A;  1FBM A;  2ODM A;  3L71 H;  1U7M A;  3NXS A;  4GYC B;  4PDM A;  1L0N D;  1ZLL A;  3G9R A;  1ZL8 B;  4DRX A;  4IOI H;  3K5M A;  2FFD C;  2LP7 A;  1MZF A;  4X8A A;  3BRV B;  2A0L A;  1FDI A;  1WN7 A;  2M3E A;  3G71 V;  3A2A A;  1H0T B;  1KKD A;  1DGS A;  2IBZ H;  1EXI A;  5APX A;  1Q7Y Q;  3UKM A;  3H1J G;  1M56 C;  1P49 A;  3FKS G;  3IN6 A;  5AVY B;  4H44 C;  2E74 B;  2YKP A;  2SPZ A;  1GO3 F;  3H1K H;  1IDS A;  3Q4H A;  1BGY H;  5F2V O;  5DJU B;  4LF4 B;  4TSF G;  4AQY B;  1VQM V;  1VQ5 V;  1EN4 A;  1KBH A;  2IU0 A;  1BMF G;  1BCC G;  1WPX A;  4JI6 O;  3EHB B;  3L73 J;  1BSM A;  1P84 D;  2JJ2 G;  2W0F C;  1F4N A;  3G6B A;  1KFM A;  2KB7 P;  5LL6 Y;  3QVN A;  4DK1 A;  2F93 B;  1JEK A;  4IIJ B;  4DR1 B;  3A0R A;  1FFT B;  3W7T A;  3PHL A;  4Z1M H;  4FLU A;  1RM1 B;  3CCL V;  2H8P C;  1NTM D;  1CW5 A;  4DR2 O;  2ITC C;  4UVA A;  1IBK B;  2ZT9 B;  1JFF A;  4UCU A;  1IFJ A;  2H89 C;  1LT9 C;  1XNQ B;  3U1C A;  2WPV B;  2ETN A;  4I50 B;  4UXN A;  3G67 A;  5D5Q A;  2E74 D;  2FYZ A;  2FTK A;  1KP2 A;  4LF7 B;  4B3R B;  4MVO A;  2BTO A;  4LNU A;  1RSO A;  2BTQ A;  3HTK A;  2FL4 A;  2A06 D;  1X4T A;  1CI6 A;  2E76 C;  2BSK A;  2GUS A;  1IX9 A;  2AGA A;  3CWB H;  3H1J H;  4FK5 C;  1EDL A;  4JAV A;  3T97 B;  1CPY A;  1PFI A;  3DXR B;  3ZMV A;  1XMQ B;  3DC6 A;  2I8D A;  3K0G A;  1K5Q A;  1G1J A;  1QHT A;  2Y69 B;  5CA0 B;  5IYC O;  4ZOL B;  3TK1 A;  3FB6 C;  3CX5 F;  4LWS A;  3K58 A;  1BCC H;  1KD1 W;  2ZT9 D;  4TWK A;  4JYA B;  4HBN A;  3VQW A;  4JYB A;  5APS A;  4UVC A;  4DV0 B;  1J95 A;  3QO7 A;  1M57 D;  5LMU B;  1GN4 A;  4DV4 O;  1R6T A;  4FLW A;  4NXN O;  2FYN C;  2RMK B;  4GX1 A;  1XL4 A;  4JI2 B;  1QNM A;  3ZHV A;  1YHQ P;  3F5T A;  2QJP B;  5LP6 C;  5AW0 B;  3O65 A;  1YBK A;  1FS0 G;  3L73 D;  2LR2 A;  4U3J A;  2E5L O;  4H13 C;  3V5B A;  1HNZ B;  1SQQ D;  1IJD B;  2H88 C;  2GM4 A;  4JAU A;  1JOC A;  2HG5 C;  1RF1 C;  2UXC B;  3O8Z A;  4JI8 B;  3G6E V;  3JAL A;  1KB9 H;  2WAM A;  2QVA A;  3RYC B;  1JMB A;  5AVW B;  3VP8 A;  3I56 P;  5IT9 N;  3STL C;  1M9N A;  4DJG A;  1Z2G A;  3CE2 A;  5KMG B;  1AA0 A;  3RK2 C;  2QWR B;  1N2D C;  1SQG A;  3AED C;  1U57 A;  2GA1 A;  4B86 A;  4LFC B;  2M5A B;  1DH3 A;  1AVO A;  1PL4 A;  4FFK A;  5CCH C;  1GMG A;  1YF2 A;  1ZL8 A;  3LSU A;  4X1K B;  3LIE A;  1R3J C;  3M9B A;  2W6B A;  3VOP A;  2BCC D;  4RO0 A;  1AR4 A;  4TQF A;  2FYU H;  3ICX A;  1URQ B;  5H9C A;  5KAI E;  1VMG A;  1DTO A;  5BXZ A;  3RW0 A;  4R4M A;  2JIZ G;  3CMA V;  2PRR A;  3TGU G;  2OYI C;  3AG7 A;  4RQE A;  2NPS B;  2Q7H A;  3SYQ A;  3SJA C;  3I5D A;  1QBZ A;  1YSC A;  3T1Y B;  4BIO A;  1WNS A;  1YJW P;  1DIP A;  4LF8 O;  3UO3 A;  3IJ4 A;  3GG2 A;  3HUS B;  2LO1 A;  3L71 J;  1SQB E;  5B5E Z;  3MAQ A;  1ZV8 A;  3H32 A;  2ZE8 A;  4RUE A;  4L87 A;  1E5W A;  4JYY A;  1I94 O;  2R5D A;  4B7K A;  3SWY A;  3H9V A;  1R3L C;  1YI2 V;  4GZR B;  4DR6 O;  2O1K A;  1MA1 A;  3G80 A;  3KZI E;  3P3N A;  2KKW A;  5L3F A;  3BEH A;  1NTK G;  3SGI A;  1LTI C;  2Q6A A;  1G1X B;  1QQC A;  1FXH A;  1JY3 O;  5APV A;  4MTX A;  2QJK B;  1HR0 O;  1YDX A;  2NPS D;  2DQ0 A;  4I9Q A;  2ZM6 B;  4OX9 B;  3VMZ A;  3CJH A;  2AXT E;  1BGY J;  3BVH A;  1WAZ A;  4DR2 B;  1RY3 A;  2YID A;  3GB7 C;  1ZX3 A;  2YIU B;  4KHX A;  1K8A Q;  2M7W A;  5KLV D;  4DV6 B;  1CZQ A;  1CEZ A;  1PNM A;  1LTS C;  3QNE A;  4UB6 Z;  1GK9 A;  5GW7 A;  3W7U A;  3FX0 A;  3T97 A;  5C39 A;  3TGU H;  1L4A A;  2RMZ A;  1NH2 B;  2Q7C A;  1Q6H A;  3DXR A;  2WLK A;  2E74 C;  5CCG A;  1I5Y A;  3ABM B;  4JAA A;  5CA0 A;  4PD4 D;  1FD9 A;  1FXV A;  3RVZ A;  3RFR A;  4OXS A;  5EC2 C;  1SQX G;  1LJ2 A;  2WIT A;  3F5W C;  1TUE B;  3ASO B;  2L35 A;  3JAT A;  1S72 V;  1XHZ A;  5ITZ B;  3CX5 H;  1ZW0 A;  3AE4 C;  2X7R B;  1SQP E;  1J1E B;  2HYN A;  5LYJ B;  4MVQ A;  3L72 E;  5KAF H;  1ZRT D;  3MTU E;  3T2M A;  1OXZ A;  2PI4 A;  1RM1 C;  1OZH A;  1L0L H;  1BZK A;  1T2K D;  4DXW A;  1NTK H;  3A0B E;  1SER A;  2F1M A;  2OYO A;  2ZT9 C;  2E3C A;  4BIU A;  3AEC C;  2P06 A;  4ICG A;  2QDO A;  4TUY B;  4DV4 B;  3CWB J;  1VQ4 V;  3H1J J;  3L71 D;  4RKU J;  3S9O A;  1NH2 D;  4L8J A;  1VQ7 V;  2GTS A;  3CCQ P;  1G2C A;  1QLE B;  1N86 A;  4CS4 A;  2B87 B;  3B5N A;  5GTI H;  3CCJ V;  3M7M X;  1NU1 E;  4DW1 A;  1A02 F;  2AXT Z;  2O01 J;  4ZNC A;  2YIC A;  4JI5 O;  3Q3D A;  2C2A A;  1JCH A;  4MTF A;  1NKN A;  3L75 G;  3L70 G;  3ZHU A;  2P90 A;  5CA1 B;  4M3L A;  4N21 A;  2KNC B;  1PGQ A;  2IBZ D;  1DD3 A;  2AZ2 A;  1KIL B;  3T1H O;  3FYE B;  2I1K A;  1T3J A;  3ZIA G;  2HVK C;  2Y69 C;  3H1K D;  4J7J A;  1N73 B;  1SQX H;  1RE3 A;  3UT5 B;  1LTJ C;  1M90 W;  1K73 Q;  1D2D A;  2QJY C;  1GH6 A;  2ZE5 A;  5AW2 B;  4YJ2 B;  3SDL A;  1SQX K;  2KYV A;  4IFD K;  3V4W A;  4X1Y A;  1QLE D;  2P4K A;  2BEZ F;  1Q2N A;  3SYO A;  3M06 A;  4JBZ A;  1N32 O;  5KLI B;  3GW6 A;  1XMO O;  1JVM A;  1NYH A;  3D70 A;  3NMD A;  1SKV A;  3OMA B;  4FZ0 A;  4A5U B;  2QJP C;  3K5O A;  4I7Z C;  2W8Z A;  4ZHQ B;  2CTR A;  5B66 H;  2NN4 A;  3UIA A;  1VQ8 P;  4BRY A;  2MW2 B;  4JI1 B;  4FM0 A;  1KIL D;  2E5Y A;  3HE4 B;  5AW9 B;  1YJN P;  1VQN P;  1GAX A;  2KOG A;  4U3F G;  1H2S B;  2ZD9 A;  3QF7 A;  1M1K W;  3RL0 B;  1LTG C;  4LF8 B;  2FYU J;  4UCS A;  3L75 H;  2UUA O;  4MVS A;  3L70 H;  1PGO A;  4DK0 A;  3ZED A;  1FFX B;  5KUM A;  1OVU A;  2NNU A;  1OCC B;  2DE0 X;  1X22 A;  2FBW C;  4FLY A;  3H1J D;  1GDT A;  2HHH O;  3RBZ A;  3SPC A;  1R73 A;  1VF7 A;  1GU4 A;  1HNX B;  3B8M A;  1H2M A;  1WMK A;  4DR6 B;  2AHY A;  1OCZ B;  4J9Y B;  1OV9 A;  3Q5P A;  3CSX A;  3G4S P;  5AVT B;  1LTT C;  1RE3 C;  3CCM P;  1OCO C;  1URQ C;  4EFE A;  1BCC D;  4B7E A;  4C7N A;  2YKQ A;  3AG3 C;  4GKJ O;  2DMX A;  4U7N A;  3M91 A;  1Q43 A;  4FPP A;  2V4H A;  2Q67 A;  4B3S O;  4X1I A;  2NPS C;  3RL0 D;  3HKD B;  5JJJ B;  2N9B A;  2XU6 A;  2E43 A;  2ZYG A;  2WLL B;  2E5T A;  1NH4 A;  1MMM A;  1IZ3 A;  3HUS C;  3CRQ A;  1NTZ J;  1S5J A;  1JA8 A;  2EZP A;  1Y76 A;  2IJI A;  4JGS A;  3EVK A;  1OMI A;  4PJ0 H;  2EJR A;  1L8D A;  4D6T J;  1QVG U;  4BIZ A;  4QGP A;  1CSB A;  4U3F H;  3K59 A;  3D71 A;  1KB9 D;  2WPQ A;  3SWK A;  1HJ0 A;  2A79 B;  2IYO A;  4O9B A;  5CHX A;  5JH7 B;  1XUQ A;  1AB3 A;  2F43 G;  1N8R W;  2AXC A;  1NAF A;  2ZFC A;  1VQ6 P;  4ZKU A;  3N7N A;  2RDC A;  2QJK C;  4TLF A;  4J11 A;  4JI7 O;  1AP6 A;  2CK3 G;  4GLX A;  1GTO A;  5B3S B;  1XBL A;  4FLX A;  4MTO A;  1NTM K;  1IXM A;  2YIU C;  4ASU G;  5B1B B;  1HDJ A;  3BAB A;  1SZX A;  2GBO A;  1T2K C;  1KQL A;  4L76 A;  5E79 E;  3HKB A;  2FXO A;  1V55 B;  4LF6 O;  4EB6 A;  2PF4 E;  4MW3 A;  5CBF A;  1JY3 P;  3RL0 g;  1YIJ V;  2YO2 A;  4O4H A;  4P9P A;  3RYI B;  1R8E A;  1MV8 A;  3ABM C;  2M6Y A;  3U1A A;  4R8C A;  2W27 A;  3WB2 A;  4NB5 A;  1L0L J;  1EN5 A;  3ASO C;  1OWA A;  1N0J A;  2JVD A;  1HGV A;  1FJK A;  1NTK J;  3FB5 C;  2A45 I;  3TSI A;  3ZHT A;  4PDR A;  2G38 A;  2L91 A;  4NR1 A;  3T1H B;  4LFA O;  1J1E C;  1R5S A;  4EIJ A;  3ZRW B;  5L3G A;  4ZIB A;  1IZN B;  2N04 A;  4N23 A;  2EIM B;  1QLN A;  2KI7 B;  1WA8 A;  2ZYA A;  2ZQM A;  3X2Q B;  3FGA D;  4DV1 O;  1IK7 A;  3O6Q B;  5JJE B;  2MKV A;  1EQ7 A;  1SA0 B;  5BVZ A;  2Q6Q A;  2Q5Z A;  3HE4 A;  2N1T A;  1N32 B;  2DWD C;  5J2T A;  5AVU B;  1XMO B;  4H0L B;  2YIA A;  4F4L A;  2CK3 H;  1OIP A;  1QLE C;  3H1H E;  4JPR A;  1KYO I;  2IH1 C;  4DUY O;  1MG1 A;  3QO8 A;  2LXB A;  5H2F H;  4AYC A;  4FZ1 A;  3E22 B;  1SQV E;  1K34 A;  2AEM A;  3ABT A;  2OTL V;  5B1A B;  1IFI A;  1KD1 Q;  2IDB A;  4D7S A;  3CXH F;  4N78 E;  2QKS A;  4GKK O;  3I55 V;  1VPC A;  1X8Y A;  2FXP A;  2HOD B;  1VQL P;  1G8M A;  1Q81 W;  2P58 A;  5CMU A;  2VRZ A;  4EFB A;  2Q0A A;  1KIL C;  2Y4T A;  3TGU D;  4WFH A;  1QEX A;  3E8B A;  3CCU V;  3FYI B;  2E76 B;  1V54 C;  2UUA B;  1N73 C;  3OEH G;  1GMJ A;  4JV5 B;  2YMY A;  1IK9 A;  5C8Y A;  2UUB B;  3L74 E;  3CCS V;  3FAV B;  3A3Y B;  3KCY A;  2HHH B;  4TV8 A;  3CX5 D;  4WY4 A;  3CCE P;  3TDK A;  4D7T A;  2D3O W;  4JTC B;  4H0L D;  5KJ7 C;  2H8P D;  4RO2 A;  3HKE B;  1NKD A;  2JEX A;  2UXD B;  2QTO A;  4G28 B;  5KLI C;  2YC0 A; 
#chains in the Genus database with same CATH homology
 3O6Q A;  1K05 A;  4R4M A;  3C8V A;  2OQQ A;  1KQF B;  4Z1M H;  1DD4 A;  3Q5R A;  1DD3 A;  3GMA A;  1MKM A;  2E75 C;  4IL6 X;  2QJK C;  4PV1 D;  1S5L X;  2G8Y A;  2P10 A;  2WSF J;  2ZT9 B;  1DIP A;  2D2C B;  4H44 B;  2H89 C;  2NZ2 A;  1YQ4 C;  2WPV B;  2E76 D;  1UIX A;  2V7Q J;  1RQV A;  2QJY C;  1NGM B;  1ZME C;  2YIU C;  2E74 D;  2WSC J;  3SFD C;  3AE9 C;  5L8R J;  1PIX A;  1ZP0 C;  2BEZ F;  1ZRT E;  2WSE J;  1TU3 F;  4H13 D;  3ABV C;  3GLM A;  3RL0 g;  2E76 C;  1NYH A;  1VF5 C;  1S1C X;  4TT3 H;  3SFE C;  3D70 A;  1AJY A;  1KTM A;  1R8E A;  1JB0 J;  1FDO A;  4XFJ A;  3Q5S A;  4OGQ C;  1PL5 A;  3T97 B;  2QJP C;  3Q1M A;  4H0L C;  4I7Z C;  3R4Y A;  1VL2 A;  4R4L A;  1KQG B;  3B71 A;  2ZT9 D;  3AE7 C;  3EWK A;  2D2C D;  4H44 D;  1KOR A;  3AE8 C;  4PV1 C;  5M1B A;  3AE1 C;  3FGA D;  5KKZ C;  1IK7 A;  2FYN C;  2MKV A;  4KT0 J;  2FBW C;  1OW8 A;  3D6Z A;  2BEQ D;  3Q2Y A;  1VF5 B;  2E74 C;  2J5U A;  4U7J A;  3RK3 E;  4YXD C;  4OGQ B;  3AEF C;  4H0L B;  1WMK A;  2E75 B;  1KIL E;  3Q5P A;  3G9R A;  1YQ3 C;  1K04 A;  4H13 C;  1Q90 D;  3AEB C;  3AE4 C;  2H88 C;  1HF9 A;  3AEE C;  1OW6 A;  2JO1 A;  2YMK A;  2WQY C;  3GF7 A;  3GF3 A;  2IDB A;  4Y28 J;  1RQU A;  1FDI A;  3AE5 C;  2K9Y A;  2FXP A;  4PV1 B;  3IAO A;  1EXI A;  3AE3 C;  3AED C;  4GDO A;  1U57 A;  3AE2 C;  1EXJ A;  3IN6 A;  2E76 B;  1OW7 A;  2QSI A;  3LW5 J;  2ZT9 C;  2D2C C;  2E74 B;  4H44 C;  3AEC C;  4RKU J;  1GMJ A;  3S9O A;  1KMI Z;  1ZOY C;  3D6Y A;  4I7Z B;  2QIW A;  1VF5 D;  1PV3 A;  3AEG C;  1OMI A;  1Y9B A;  4OGQ D;  2G3A A;  1HJ0 A;  4YTP C;  4H13 B;  4H0L D;  3AE6 C;  2E75 D;  2O01 J;  3D71 A;  3AEA C;  3H25 A;  3Q3D A;  5KLI C;  2JP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...