2D2CB

Crystal structure of cytochrome b6f complex with dbmib from m. laminosus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
137
structure length
137
Chain Sequence
LAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGAALPLDKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Intraprotein transfer of the quinone analogue inhibitor 2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone in the cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 19
structure length 137
sequence length 137
chains with identical sequence O
ec nomenclature
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 2d2cB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2d2cB01
2FYNC 2QJKC 2E74B 1ZRTE 2O01J 4I7ZB 2WPVB 4KT0J 2E75B 3LW5J 4Y28J 5KLIC 1S5LX 1Q90D 2E76B 2WSEJ 2ZT9B 4H13B 4PV1B 2WSCJ 4H44B 1VF5B 2QJPC 1JB0J 2QSIA 2WSFJ 2QJYC 5KKZC 2D2CB 2K9YA 2QIWA 2YIUC 4RKUJ 4IL6X 4H0LB 5L8RJ 4OGQB 3C8VA
chains in the Genus database with same CATH superfamily
4CS2A 3JAKB 3I5CA 1PP9D 2Q7HA 3KKYA 1ZRTE 1V54C 2WLHA 2FYZA 5TISE 1BE3E 1VF6C 3BCCH 2J59M 2KS1A 2HJDA 2H8PD 3T1YO 5B66H 1MMMA 4LF7O 1K9MQ 5CMUA 1G1IA 4DV5O 2I1JA 3M06A 1VQNV 3FAVB 2FYUK 3V2PA 4R7CA 4UVCA 3ABTA 2PRRA 3RK3B 2BSKA 3RYIB 1N8RQ 3D70A 2JS3A 1NJIW 2WLJA 5IE9A 3G6EV 4UCVA 2OTKE 4BW5A 2QKCA 3G67A 1FZAA 1IFPA 4QGPA 4X89A 2ZFCA 2ZD9A 1N7SB 4O4JB 4ZHQA 1X79B 1NI8A 2Q7CA 1S5HC 3HPLC 1HDJA 3HE4A 2WAMA 5AVTB 3GMAA 2HG5D 4W4KA 1M4UA 4LCUC 3WG7B 3JSVC 4JASA 1VQLV 1XMQO 2E5YA 4NPDA 2KG7B 1OW6A 1XTGB 1SVFA 1HVVA 2K9JB 4TLFA 1AFOA 1N36B 1S72P 4PD4H 2HODB 1FAFA 2ZNJA 5KHIA 2VRZA 2P58A 1PNKA 1JO5A 4DK1A 1QCEA 1NVOA 3O9OA 2ODMA 4DV2O 2Q3IA 5CCGC 1J2JB 4XDKA 3ABMB 3H1IH 1JJ2U 1GTWA 4W80A 4QMAA 3DGEA 5JWPA 5IWAB 5KA5A 3JAKA 2BOBC 4PDRA 1OW7A 4QNHB 1XTCC 3D3IA 2A3QA 3J7AU 4CH6A 1J95A 3RK2B 3VMYA 1Q6HA 4MVZA 3AEAC 2ZM6B 1J1DB 3CCRP 3FAVA 1ZP0C 4DOJA 1BDDA 3AG3C 2E3CA 1A32A 4X65B 3FD9A 3RYIA 3H01A 4UB6H 4IT5A 4QE9A 4X1KB 3A0HZ 5LGNA 4FPPA 1CW5A 3F5TA 4DV3O 2YICA 5APYA 2AXTZ 1YIJP 3I56V 3V5BA 1WP7A 3GB7C 4XFJA 2OYHC 5IT9N 4O4JA 5IYCO 1N7SA 1OFCX 3ETGA 3TXSA 1OX3A 2C0WA 5APQA 2XV5A 3P30A 1DGSA 3MUDA 1KYOE 3JD2A 3ZRXA 5AG2A 1M56D 1SZXA 3AE3C 3CPWU 2NRGA 3H1HG 2KG7A 3WU2Z 1HBWA 1ZTEA 2VS0A 3I5DA 2ZNIA 2OIEA 2K9JA 3KZIE 1AP5A 1SQXD 5J2UB 1S76D 3CMAP 1L0ND 3P32A 1KZUB 2HODA 5L3DA 3CYOA 5A2QN 1RE3C 3G6EP 2ZR3A 4LF5O 5AVZB 1I94B 2VQEB 5JJNB 1U7MA 2DW4A 2RKLA 2NPSB 3CCMV 4YY3O 4PDVA 2CTRA 3BCCJ 5IDJA 2VWJA 3W7TA 4JZ2A 3WUTA 4ZNCA 4DR7B 1PGPA 3KCXA 4GOFA 1N7LA 3A0RA 4JI8B 1VQ4V 3EFGA 3NMDA 4EYYQ 3AECC 3B5NC 4XA4A 1PIXA 2YUAA 2WPSA 3Q5PA 3A0BZ 1H2NA 3L74H 3FYEB 3V4QA 2CE4A 1FOSE 4I7ZB 4JGSA 1WRGA 1MSDA 3CD6P 2R5BA 1M90W 3AEEC 3K5BA 1M1KW 1PKXA 5C39A 1XNQO 4X1KA 5KLIC 4HAMA 4JI1O 4B7KA 2IFMA 2UUAB 3WUVA 5KA6A 2PTMA 2FYUD 2FFDC 1GK6A 1JNMA 1LTTC 2JJLA 1K3EA 1VQKV 4C7NB 2WPRA 4OGQD 4JI3B 1BSHA 2XNXA 1YITV 4JTCB 1NTZH 2QTOA 3WB1A 1FFXB 3E89A 4L8JA 2OWOA 1VL2A 5L3EA 1DD4A 1Q43A 2RMKB 4LFBO 3L73H 2P7JA 2QSAA 5AW4B 3VMAA 1RM1C 4JI6O 2VQFB 3GF3A 1KUQA 3PTZA 2JIZG 1NTMK 1N73B 2CK3H 3X2QC 5J2UA 1S4XA 2H94A 4DV6O 4D6TH 4FLVA 3H1IJ 3CJHB 4MVSA 3B77A 4AQRD 2W6AA 5AVWB 3LDEA 1KYOI 3T1CA 3SDLA 1BGYH 4K8ZA 2NPSA 3HKEB 2P5OA 1L1FA 4X88A 5FPRA 3M8AA 2M3BA 3H1JG 3ZEDA 1HR0B 2QJPB 3KPEA 2F93B 5BR8B 1GL2C 4HH2A 1BE3H 2X6CA 3RL0g 5AW8B 4DV1B 3RYCB 3CC4P 2JS5A 4J9YB 1XILA 1L4AB 1SQPG 4RJTA 5HFLA 1ZL8B 3KHUA 2H8PC 4UCTA 2IBZG 4DV4B 3OAKA 1N33O 4R8CA 3SGIA 3B2EE 1PGOA 4DT0A 2IM9A 3BY6A 5LGUA 2A45I 2YMYA 2QM8A 1Q3EA 3L35A 3E83A 1G1XB 1RQVA 4CH5A 2M5AB 1UFIA 2IJHA 3TXQA 3JCUE 3QO8A 4IL6X 4UV8A 1KBHA 1ORQC 3QTCA 1SQBG 5LMNB 2W8ZA 4C7NA 4LH6A 2JP3A 3HD7D 1FU1A 1MFTA 4JYCA 3L72G 1FFXA 3H1JE 2QA4P 1PZQA 4GZRB 3CEIA 1Q81W 1T8ZA 1V9PA 5KAFE 1XL6A 1H88A 3FX7A 4FLWA 1SQPE 4LF4B 5IJ9B 4RUEA 3WB0A 4TT3G 4FIPC 1LP1B 1N73A 5DJUB 3G9RA 2F43G 2OYIB 3CJHA 5E79E 2UU9O 2FXMA 4JV5O 2KOGA 3AG7A 1JCHA 3P3PA 3HKEA 1K9MW 1NT2B 4J42A 2YKPA 3VMZA 1VQPV 2KSJA 5CBOA 2GV9A 3C1LA 3W67A 4Y99C 3RYCA 1U97A 3D6YA 3E8HA 4B08A 5F2VO 2E5LB 1EZVI 1L4AA 1SFCD 1KQLA 1SQBE 3L74J 4MVUA 1YEWA 3CX5F 4OX9B 1EQ7A 4PV1D 1GN4A 3L9DA 2ZJSE 1HNWO 1ZL8A 1FAVA 3PH0A 5KAIZ 5LOVB 4GKKO 3L72E 3H1LD 2EIKC 1SQQG 5DEDA 2XU6A 4WWIA 4UCUA 4FLUA 4BAYA 1YCIA 2M5AA 3CWBD 3Q5RA 4W7ZA 3FX0A 3ZBHA 1NTZJ 1UIIA 3CRRA 3CCLP 4IFFA 3D6ZA 5CBFA 1CSBA 1ZX3A 1KYOD 1R8EA 1HF9A 3U1CA 2LP7A 3L73J 1MA1A 4GX2A 4KL1A 2BCCD 5KLVE 4YHHO 1BCCD 3HKDB 5LP6C 4RO0A 3CL3D 1IDSA 4P9OA 3KZIH 4D6TJ 3BRCA 1IBMB 1NH2B 1WJZA 3CC2P 2CGNA 2XAFA 3ICXA 5IJ9A 1BGYJ 2HYNA 1GM9A 1LP1A 2JVDA 3SFDC 2EZPA 2OYIA 1XHZA 1L2PA 2K88A 4C46A 4X1YB 1BE3J 2AXTH 3JD1A 2XNDH 1GN3A 1NTMD 4PDMA 4R4MA 2XAJA 4OWFA 2W6BA 3L36A 2W90A 2Q7GA 3CCJP 2YO2A 4X64O 1HNXB 4FLYA 1FJPA 2LXBA 1VQ5P 3UCSC 3N2KB 1FS0G 5LOVA 1K73W 1URQD 2VRSA 3E1RA 4MVMA 4IFDK 1RF0A 5JH7B 1TUBB 5KLVK 3H1HH 2UXCO 3K9SA 2EX3A 2WLIB 3P3NA 5CB4B 4DR2O 1OCCB 1GTOA 2F4VO 3LUTB 1S5LX 2O3JA 5DECA 4LNUB 1OVRA 1E79G 3SYPA 1H8EG 4OGQC 3P8CE 5AVSB 4MTOA 3B71A 4DXWA 1R5LA 5CJ4A 3BA8A 4IGGA 4BIUA 4B86A 2ZE8A 2E74C 2D3OW 3HKDA 2DYSB 3L4FA 1EZVD 3A0BH 2Z5UA 3PJSK 1OCZC 4BIZA 1CI6B 1PP9G 1QL2A 2WLMA 2Q5UA 1EN5A 5IY5C 2YI8A 3ZN0A 1JR9A 2DWDC 2P4VA 5B66Z 2UXBO 5AVUB 4JQ0D 2Q69A 3MD0A 4X1YA 2IDBA 4H44B 2Q9IA 1I0HA 4FFKA 3CSXA 2A79B 2UUCO 3SWFA 1LTSC 1NVPB 1AI6A 4UV9A 3GHGC 1IK9A 5APUA 3TGUD 1VQ9P 2XAQA 2KKWA 5JVDB 3MTUE 4MTFA 4ZOLA 2QJKB 3ZS8C 3N2KA 4E4EA 1HWTC 2EZOA 2YXQB 3AG1C 1BZKA 5JH7A 1TUBA 2PP6A 1H2KA 2ZVOB 1TU3F 1YHQP 3JCUH 3EQ2A 1ZOYC 2WLIA 2N74A 1S2EA 1OZ0A 1PP9E 5CB4A 1SA0B 3K0DA 1QEXA 4NXMO 2BASA 2IZ1A 5B1BC 4ASVA 2KYVA 1JY2N 1F23A 3VQWA 1Y74B 4LNUA 1QLED 5D5QA 1MKMA 3H1JH 2L91A 2AEFA 2YMKA 3FWLA 2M6YA 1JY3N 1M57D 1QR9A 3HD7C 1IFNA 3OE7G 1X22A 5KAFH 1GD2E 2Q8VA 4KHPB 1SQPH 1KD1Q 2ARHA 4N21A 4DUYB 3AE8C 3H1KD 2YI9A 2IBZH 2EJRA 1CI6A 2QE7H 3IAYA 1T5EA 2C9NY 1B3QA 4DV0O 1NR7A 1R3JC 2Y9YA 3VP8A 2D2CD 3HB3B 5E79H 4NXMB 1JB0J 1PNMA 3T1HO 1Z2GA 4IL6E 2HHHO 2Q67A 1HTLC 3RT3C 5ITZA 3UIAA 3P7KA 5DN6G 4GX5A 3W7XA 1K05A 2ZE6A 1E1RG 1SQBH 4UB6Z 1AJNA 2LW7A 2AZ0A 5AW9B 3JAMN 4FZ1A 4GIFA 3HUSC 3H1HJ 3L72H 4JBZA 4DZOA 1JMKC 4PA6A 5JVDA 4DR6O 4X62B 1KQGB 5APXA 1KV4A 4IFMA 2HVKC 3RW0A 2EBOA 1WB8A 2B1GA 3K5LA 1TA8A 4MW8A 1FXKC 1PV0A 4CBCA 1LTJC 1L8DA 3MDSA 2FTKA 1VQ6V 1ZAUA 4TT3H 3VTPC 4YIPA 1KILB 4ICGA 1SETA 1N0NA 4RKUJ 1LR1A 1Y6XA 1SA0A 5KJ7A 3BAAA 1WLEA 3M9BA 4QPJA 1VQ8P 5KLVD 3K58A 1AP6A 3TDKA 3STLC 1SQXG 3RGUA 1Y74A 4JAVA 1OHHG 4NTXA 4PA4A 1L0NG 1W2BO 3M9HA 1R1BA 3N7NA 4B3TO 3B09A 4Z2WA 4FZ0A 4DR6B 4H13D 1KQSO 1AVYA 4CH3A 2HLDG 1QHTA 1LWUC 5CJ0A 3AE4C 2XOKG 3JASB 4UCOA 1IBKO 1PL5A 4XDJA 4QJFB 3BASA 4UUJC 2ATKC 1EDIA 1XL4A 4Z1VA 3HKCB 1BMFG 1NKZB 1K8AQ 3IFXA 2XZRA 5KUKA 5B3SC 3LSSA 2FXPA 2IU0A 2PYJA 5H6QA 1KB9H 4FMTA 2AEMA 4YXWG 1SQXE 4I55B 4L75A 5AVXB 1XREA 5CBGA 1P84H 4J41A 2FYUG 1N2DC 3Q1MA 3CMEP 4NTWA 3BVHA 1URQC 1ZXGA 4RESB 4EKWA 2L6LA 4W4LA 1KILA 4K0KO 3OD4A 3QG5A 1A02F 3H1JJ 2XDJA 4G28B 2IPPA 3P8CD 5B5EE 1V55B 2WLKA 3A5TA 5FLXN 1S72V 3RK3D 3KXDA 3C3TA 4ZI7B 3I55V 4PA9A 1SERA 1SQPJ 1OCRC 1SZTA 2GUZA 3R4YA 1QGKB 3T4ZA 2QG4A 2DQ3A 2N1TC 2ZDIA 1N7SD 5TISZ 3LIDA 4HJGH 3JASA 2FYNC 3U11A 3SPCA 1VF7A 3BRTB 4P30A 5BVZA 1JCDA 1PV3A 3MP7B 1ENVA 1UJWB 1FDMA 1IFDA 2JWDA 2GDSA 1S5LE 3HKCA 2YSUB 3CXHF 1SQBJ 3CCRV 1NO4A 2OT5A 2E76B 1QVGO 2Y4TA 3L72J 1ZLZA 1ZN5A 3ASNC 1T3UA 1IXMA 1I5YA 1E79H 3ZMZA 2K9YA 4FM1A 4I55A 3SJBC 2QJYB 3F89A 2HFED 1YIJV 2LQTA 3ZDMA 1IFIA 4EI2A 4JI7B 2WVRA 4GT1A 4MVRA 1P7BA 4LF9B 1Q2NA 4B3RB 2QKAA 3GW6A 4EIJA 1PP9H 3TSIA 2OTLP 5LGTA 3RK2D 1PL4A 2DQ0A 3THOA 1GK9A 4B3MO 1NH4A 2EILB 2DE0X 2YKQA 3JD4A 3GG2A 2ZE7A 1H2SB 3V4WA 3CMAV 4ZKPA 1N36O 2DW3A 3JD0A 2YIUC 1QLEC 2QTSA 4ZI7A 2B1IA 2OYQA 3S1KA 3C9IA 1ZMEC 3K03A 1MZ9A 2ZINA 4LLHA 3B5NB 2Q0OC 3V6IA 1SQQJ 2ZXEB 2CUGA 1ZUQA 3B4SA 1HGVA 2R9IA 2HVJC 4DUZB 3AEDC 1SRYA 4NKGB 5IWAO 1Y4MA 2AW9A 1XI1A 4IL6H 1NU1K 1PPJD 5L3CA 5B1AC 5IJ0B 2PI5A 3S9OA 2D2CC 3CX5E 4B3MB 3ZHVA 4RQEA 2RH0A 1N86A 4DR5B 4CS3A 3H1LG 2ITCC 2ZIOA 2ZM6O 3IGAC 2R32A 1AVMA 2YC0A 1D5NA 1GW3A 3CD6V 3S4RA 4J80A 3VYIA 3I55P 2NNUA 4LWSB 4X65O 3L75E 2DJVA 1SQVK 3M7MX 3CWBG 4NB5A 3E1IA 1SS3A 1OCOC 2ZYGA 2NPSD 4MSWC 1GDTA 2PGGA 1M1JC 2KIKA 2IW5A 4KUMA 5E1AC 1WNSA 2BCCG 2IYPA 2WTYA 3RVYA 3II6A 1LUWA 2GM4A 3OTOB 1RE3A 1BCCG 1B04A 1USEA 2BE3A 1JX9A 2DWEC 4L87A 4RO2A 3KZIZ 1IC2A 2XASA 2PF4E 3W7SA 4FJCC 4HYTB 1VQMP 3ZHSA 1E1QG 3S3XA 3MHSC 4GKGA 3VMXA 4MVQA 3H1LE 1FZEA 2W0XA 3KG2A 2XNDG 2G3AA 2WPVB 1I94O 5EC1C 2VQEO 2QWNB 3B5NA 3ABUA 3FB8C 3Q4HB 4Y28J 1VMGA 3CWBE 1NTMG 5CCHA 2UXDO 5AW3B 1R3KC 3B8MA 3CC4V 1L0LK 4DR7O 4JI8O 4PD4F 3CRAA 5IJ0A 1D5AA 3FXDA 2BCCE 3QWOC 1QNMA 2E42A 1XOUA 1BCCE 1DX7A 3CPWO 1XNRB 1YSCA 2RCVA 1RSOB 3JD3A 4AYCA 1SQXH 1U96A 4LWSA 3CI9A 1L0NH 5K5GB 5L3GA 3VQYA 3A2AA 1GN2A 3D71A 3CX5I 2JR8A 4WBAA 2UUAO 2X6AA 4LF8B 1PP9J 1USDA 2UXDB 4I5SA 2C9LY 2NR5A 2O01H 4JI3O 1W5CE 1Q8IA 2QA4V 2FB5A 1NTME 2M0BA 2OCCB 1L4AD 1LT9B 2Y69C 5B5EH 1EZVG 2RMZA 4I4TB 2VQFO 3OW2O 1S3JA 4QE7A 4L76A 4EDFA 3D3QA 3RK3C 2ILMA 1GU4A 3L70D 4PJ0E 3CCEP 3OJAB 2DYRB 4YXWH 5H5NA 3Q4HA 1OXZA 1O9HA 2ZYAA 4Z1MG 2EIKB 4PDLA 2FYUH 2DMXA 1HR0O 4QIWF 5BR8O 3M0DA 3BRVB 3TGUG 4DV1O 2LGWA 1EDJA 5KHKA 1S5LH 1NTKE 4I1LA 1WPBA 2V7QG 3MUDC 1WPXA 3PRJA 3A2FA 3EFFK 3WG7C 3F7YC 4I50B 3H9VA 4WFHA 3T2MA 4DV4O 1QLNA 3CLQA 1X59A 2WSFH 3CCQP 3QNEA 4H33A 4DR1B 4FFBB 3JCUZ 2MW2B 1EZVE 1NU1D 1RSOA 3W7UA 1S0VA 1R6TA 3ABLC 5LP6B 1RY3A 1R73A 1AR5A 3W7WA 3CCLV 2WLNA 5TISH 1W0KG 4OVNF 1LTGC 3CB2A 3ABMC 5LMNO 3OFNG 1BQZA 3APQA 4U3JB 1SQVD 3FXEA 1Q7YQ 3RN4A 1AA0A 1LT9A 2JDIG 5KAFZ 3TGUE 2ZCEA 2QE7G 2AGAA 2FMLA 3K57A 3H1KG 4I4TA 3RK2C 3CC2V 3MIWA 4JI4B 1NTKK 2E5TA 2LO1A 3ZX6A 4LF4O 1J1DC 2Z5IA 5E79Z 5LBQA 3G6BA 1FE6A 3E22B 3WMM0 4FLXA 1AVOA 1CXZB 1FZFA 5KKZB 1IK7A 2W27A 5LXTB 5GW7A 4I6MC 1KILE 4D7SA 1O9GA 3CX5D 4TOIA 3CCJV 5BY1A 1FDOA 2YXHA 4KJMA 2WSSG 1U7JA 1DLBA 2E5LO 1TAEA 5AVRB 2YS8A 2HG5C 1VQ5V 1H2LA 4OX9O 5EYPB 3IAOA 1K4CC 2P67A 1HNZB 3O8ZA 1QR8A 1Q82Q 1AR1B 2CTPA 1ZW0A 3L75D 1SQXJ 1EXIA 5AVYB 2KLUA 4I50A 1NH2D 1L0NJ 1EBOA 5B1OA 3SYQA 2JJ2G 3RBZA 1L0LD 4FFBA 4HNAB 2A9HA 1P4RA 2ETNA 3H1KE 4H0LB 2R70A 4LFAO 1ZV8A 2C2AA 5H2FE 3ZHRA 1H2GA 4DW1A 5GTHE 1OW8A 2E74B 4JYYA 5LP6A 2O01J 4JYAO 2A7WA 2YKOA 5KLVG 2F95B 1JTHB 3VQVA 1OCZB 4UXNA 3MHHC 4TWKA 1LTIC 2JEXA 2IX7C 4KP4A 1JMBA 5IY5B 4U3JA 2O57A 1LNQA 1N8RW 1KC8Q 3IFMA 3V2QA 4FLZA 1RHZB 1IJDB 1NS1A 2BTQB 1G2CB 4WY4D 4LBEC 4YTPC 3K04A 4HBNA 4JI5B 1IBMO 1YTFB 1DH3A 3H1LH 4DV7B 1GKFA 4LFAB 3GHGB 2LGQA 3SPJA 5H6RA 2E75D 2QKSA 1B6QA 2YDEA 3E22A 4YIOA 2FYUJ 4JYAB 4N3YB 2B89A 4NVPA 5IYDO 3CWBH 3OTFA 2DOSA 2EIMC 3Q3DA 4TV9B 5AW0B 5H9CA 5K1PA 4O4HB 3RBXA 4RQFA 3AG1B 3CE2A 5LXTA 1FD9A 1JQ0A 4EFBA 2Q9LA 1KYOH 2M3EA 1FC2C 2QM7A 2ZAEB 5JCOA 2ZT9B 1VQ9V 2LR2A 4MTXA 1HNXO 2BCCH 2EINB 3BABA 1JCCA 2WSFJ 3FB7C 1M56C 5EYPA 3ABKB 1BCCH 2YEVB 5B1BB 3U0ZA 4AQYB 1COWG 1WP8A 1MFZA 3STZC 2Q4PA 1JOCA 1YBKA 3RYHB 1H38A 1YHQV 3VBBA 4HNAA 3ZCCA 3AK3A 2A45H 3CCVP 4N78D 2YNYA 1WMKA 4K35A 5CA0B 1K5SA 2EIJB 4I0XB 1N34B 3R66A 3L71D 1JTHA 4H44D 4MT8A 2K1EA 1NTMH 3OT7A 1NVPD 4M3LA 2QJPC 4DR4B 1E5WA 4TSFG 2QSIA 3E35A 4U7JA 1K33A 2CH7B 2IH1C 2Y4UA 2VWKA 3FWNA 4LFCB 4WY4B 2RNBA 1Q86Q 2BTQA 1P7GA 3OUFA 4O4LB 1G2CA 2R44A 3UO2A 2PUSA 3GHGA 2E75B 4KT0J 1IXBA 1KFMA 4PJ0H 1HWYA 2I1KA 4I9QA 3P8MC 3HUSB 2JRIA 2ITDC 4K8XA 2CPSA 2GBOA 5KJ7D 1DIPA 3CXHE 5DJTB 5LL6Y 2Q0AA 2UXNA 4O4HA 1NTKD 3JSNA 3APOA 3F5HA 2ZKOA 3FKSG 4JTAB 4YJ3B 3RK3E 2F1MA 2KB7P 1IBLB 3BPZA 1WT6A 4AI8A 1VIBA 2YEVA 3LDCA 1J5EB 1AQ5A 4U3FD 1JPXA 1EZVH 3E7KA 1H8HG 3RYHA 1UPGA 3G3ZA 2AHZA 3ZMUA 4N23A 1AJQA 2OYIC 4D7TA 2HPCB 1VQ8V 1G4YB 5CA0A 3PHLA 1F51A 4I0XA 3V2NA 1HP8A 1XMOB 4GLXA 2JK5C 2UUBB 2HJFC 4Z1MH 3AG2B 4O2AB 4WBNB 3CCSP 1FOSF 1JJOA 3H6PA 4HZ3A 3RL0B 1BSNA 2B5UA 1EZJA 3RWRD 4G27B 3TGUH 3CRQA 1PNLA 1DEBA 3H1LJ 3N2GB 1Q6UA 1URFA 2JJ1G 4KHPO 4WY4A 2NLJC 3LSQA 2V7QH 1SC5B 4O4LA 4DUYO 3E2EA 3Q5SA 1RF0C 3CWBJ 4IL6Z 3HRNA 2XUMA 1G8MA 5FNVB 1PPJG 5APWA 2LFSA 1KILD 1VF5B 4BWNA 2NZ2A 2QRXA 4JF7A 1VQOP 2J58A 3RYFB 4RUFA 3AG4B 1CZQA 3AEBC 3KQGA 2BCCJ 2HKOA 4X66B 1FZBA 1BCCJ 1EDKA 2WT7B 1AJYA 2JKVA 4YJ2B 2A06D 4JI0O 4YJ3A 2N05A 2XHBA 3FB5C 3K5NA 1W2EA 5EK0A 1Q6IA 2JDIH 3CMEV 4X62O 2QGNA 3CXHI 1RPRA 1JFFB 3H1KH 4J7ZA 2ZXWB 4KXRA 3CC7P 5H2FH 2EULA 3JAWB 1OCRB 5GTHH 3DC5A 1BT8A 2F66C 2L5GB 2PI4A 4OH8B 2EJ7A 4JAAA 1NAYA 1NTMJ 2P2UA 4DCKA 2ZYDA 1PPJE 4EOTA 2HPCA 1FBMA 1FXVA 2N1TB 2ADPA 2P1JA 1AR4A 1N4CA 2FYNB 2Z4EA 2FKWB 5CHXA 1H89A 2R72A 3PN1A 4JI0B 4O2AA 4WBNA 3CS5A 1SFCC 2QEXP 1JY2O 1NYHA 2QJ1A 3AE9C 4PV1C 2POHA 2WSSH 3N2GA 1VARA 1FFTB 1GO3F 5AW7B 1JY3O 1N32B 3M0AA 3C90A 4HYOA 2Y9ZA 4GKJB 4RAIA 5FNVA 1NR1A 4LP8A 5L8RJ 4ZKIA 1QBZA 1T6AA 4I2LC 1KP3A 3QO7A 5AW5B 1H0TB 1OCCC 3RYFA 3K59A 4U7NA 3ZMTA 2YIBA 5KLVH 1V54B 2XAGA 4FVMA 2WT7A 4NPFX 2P6JA 1YDXA 1YF2A 4YJ2A 1NBMG 4EB6B 3CCUP 1HW7A 1MUUA 1QVFU 1US6A 3TJTA 1MNGA 1KFNA 2QDOA 1JFFA 2X0LA 5JJJB 3G4SP 1NWQA 3C8VA 2IJKA 4IHJB 2OTLV 2WITA 3JAWA 1Y66A 2JEEA 1HJ0A 5B5EZ 1KQSU 1XBLA 2OTJP 4CZZA 1KC8W 2O1JA 1XEQA 4IIJB 1M93A 5KHGA 2N1TA 3AEGC 3TGUJ 2E76D 4FK5C 1IVSA 2V7QJ 1NOHA 2B9ZA 3L70G 2W83C 1BSMA 4X9QA 5AW6B 1YVWA 3E8FA 1GZLA 1CPYA 3CRCA 1RF1C 2P06A 5BMVB 2UWJE 4TQFA 2OIGA 1J1EC 2PGDA 5JQGB 3CXHD 1S5LZ 5AW1B 2WSEH 1MV8A 3OEEG 3KCYA 1RE4C 1OCOB 1R6NA 2MK3A 1H0TA 4PA3A 3G71P 4LF6B 5B1NA 1DF4A 4R4LA 3HTKB 1NU1G 4ABMA 1VF6A 4PELA 3JYCA 5CA3A 3H1KJ 3B5ND 5LMUO 4PD4I 4EB6A 1BHBA 5A9GA 4CPGA 2WA4A 3L70E 1FYJA 5APSA 3AG3B 1JEKA 1KORA 1T2KD 5CCHD 1AJPA 1EN4A 3JATB 4JI7O 3OMIB 1SQVG 4GDOA 4LF9O 1M7LA 2DN9A 3OGIB 4IHJA 4B3RO 1HH0A 1OVVA 4UVAA 4YPCA 1YJ9P 4A5UB 1KB9F 3K06A 2OYHB 1SF9A 1Y9BA 4IIJA 1VQMV 1Q86W 1OVUA 2WPDG 4HKZH 4UB8Z 1P84F 5TJHA 1PD3A 4DR3B 1CP9A 2Q73A 3BEHA 2YIDA 3O6QB 5LMUB 4UVBA 2RQ6A 3TK1A 1NU1E 2Y0EA 5CA1B 3CXCU 2MJZA 4X8AA 3LNMB 4G2KA 5BMVA 1QVGU 2RN9A 4DUZO 1M8OB 5JQGA 1MSWD 2WPQA 4OPAA 3TF5A 3UQ8A 5KLVJ 1NGMB 4WFAV 1D2DA 1KILC 2W0FC 1SQVE 3VQXA 3L75G 5CCGA 3DC6A 2AEJA 1K97A 4DR5O 2XAHA 3MHVA 4XE5B 1KMIZ 1BGYE 1FZCC 1L0LG 1KQFB 3HTKA 4UB8E 3BCCD 4TQDA 4B7EA 3E8GA 3J80N 5FPOA 2Z0AA 1QX8A 3HR0A 1JMMA 1M57C 3D8CA 2FY8A 3SSUA 1LTBC 2Y69B 1R5SA 1YQ4C 5EBLC 3ZHUA 3SWYA 1A02J 2ZDIC 1IX9A 1DEEG 2H89C 3JATA 1NTZK 5EBWC 5K1XA 2Z3YA 5KLIB 3OTOO 4NPEA 5J2TB 1PPJH 2BEZF 2JWAA 2I8DA 2FFDB 1AB3A 4BXLA 3ASOC 2OYHA 1YJNP 1VQ7P 2ZE5A 1GM8A 1AI7A 4WVZA 2CGOA 3OM3B 1FPOA 4C7RA 5BU5A 5DM6V 1YI2P 4BR6A 3JC22 2IU3A 3O6QA 1Z5WA 3CCEV 3T1YB 1RM1B 1L0LE 3J81N 1OZHA 4LF7B 3GLMA 2WSCH 1JUNA 4JI2O 1GMGA 5CA1A 4DV5B 2G38A 1FZGA 3D36C 3EVKA 3T4DA 2WSEJ 3X2QB 4NTYA 2GSMB 4PD4D 2FBWC 3H25A 2A0LA 3USSA 2WZ7A 3ABLB 1QU7A 4C7UA 1QQCA 3JSLA 1ROPA 3WFVA 1NHLA 3H1ID 4WFEA 2HP8A 3M99B 3TETA 1KD1W 3CCQV 1GL2B 5BZBA 1N0JA 4PI2A 3LSUA 3SPIA 1V55C 1WA8B 2WLLB 1LJ2A 1XNRO 1JOYA 4GCZA 2Q6AA 2A45G 4ZKUA 2UXXA 3PP5A 1ZLLA 3TCUA 4WCEV 4JI2B 2R3CA 4H13C 1XMQB 3A3YB 4JTDB 2M7WA 3L71G 2JGDB 4LF8O 1F4NA 1PL0A 4J11A 1TGOA 3GWOA 3SJAC 2KUBA 5EZYB 1YJWP 1PGQA 1VDFA 1I7FA 5GTIZ 5J2TA 2W6IG 2V1DA 4AHCA 2B87B 2Y0IA 4DV2B 2FFDA 4JF3A 1K73Q 3ETQA 3B40A 1K5QA 3ETDA 3BHPA 5APVA 2E76C 5BXZA 4CC5A 4B3SO 4PJ0Z 2K3RA 1VP7A 2H88C 1EDLA 3U59A 1H8AA 1TUEB 3K5OA 3VOUA 3TYYA 2YO3A 3ZN1A 3OR7C 2QJYC 1AROP 1NTKG 1VQNP 3VN0A 4N78E 5KHHA 1KU9A 3L71E 1IFMA 4CC6A 3K3WA 1BQ0A 2O01N 1YZBA 4DV3B 3KDPB 2AZ2A 4ZMDA 5GTIE 4U3FG 2YXRB 3OAAG 3A0HE 2ADQB 1GL2A 4B3SB 2QWQB 2AXTE 2EILC 1LT1A 1WA8A 2WLLA 4DR1O 2KK7A 4Y99B 5KTBA 1THZA 2OGUA 4J10A 2M8RA 3L70H 1K8AW 3MGNA 1RFYA 3CP1A 4DYLA 4CH4A 1Z5VA 5EFWB 1VQLP 3L74D 3OW2U 2JGDA 1N7SC 3OR6C 1DD3A 1ZR4A 1T2KC 5EZYA 3WU2E 5CCHC 3K08A 4EFEA 5M1BA 4DO2A 4LF5B 1KKCA 3H1HE 1KP2A 2JEUA 2R9RB 2GUSA 1ZSPA 2EIMB 2F23A 1NZ6A 4YY3B 2B87A 4QPKA 3OEHG 1EM1A 2Y0CA 2IYOA 2X7RB 3A8TA 4JI4O 1NTZD 2WSCJ 1AI4A 1K34A 4U3FE 1NKDA 4H0LD 1NU1H 3L73D 4MS2A 3WUUA 3K79A 3DTUB 5GONB 1K7DA 1M56B 2E74D 2O1KA 1MZFA 3AK1A 3AE5C 2HFEC 3T97B 2P7TC 1Q5OA 2ZQMA 2WWWA 1S9KD 1S5JA 2WQYC 3NTNA 3ABVC 3GWKC 3OMAB 1RQUA 4UFZA 4O4IB 2QR4A 2WMMA 2ZXXA 4D6TD 3A0BE 2A06G 1BHAA 3ZIAG 1SQVH 4L73A 1XNQB 1BGYD 3JCZA 4L74A 1MABG 3B8NA 4JI1B 3HE5B 1HNZO 4GYCB 3ML0A 3AEIA 1ZRTD 1DK1A 1U57A 3I56P 1YTFD 1BE3D 4UB8H 2KI7B 5AVQB 2V4DA 4GX0A 5H2FZ 2G8YA 4H37A 5GTHZ 1FDIA 3CRMA 4XDLA 4ZIBA 1LTAC 1X4TA 1DTOA 1SP4A 4LFBB 3CCVV 1K4DC 2Q1KA 4JI6B 3ZMVA 5LHGA 2V4HA 2CTQA 3AK2A 3QF7A 3IJ4A 1F4MA 2L35A 1I08A 2P4KA 3QO5A 5IYBO 4TUYB 2W6JG 1WB7A 2K9PA 3CX5H 3K5MA 4DV6B 2B88A 4K3AA 2ZT9D 3M0DC 3QH9A 4UCSA 3EWKA 4DJGA 3VOPA 3RVZA 1TVKB 4DW0A 3GVMA 2A06E 3N27A 3CCMP 3ZRVA 3ZMSA 3V2RA 3L75H 4JI5O 4E2LA 2Q3EA 3CHXA 3O65A 3WB2A 4OGQB 4DV7O 1SLQA 3U1AA 4RWUA 1L0LH 2KNCB 3A7OA 2N9BA 1KKDA 1VQ4P 1G6UA 5GONA 4BWAA 2NPSC 5LHHA 2Z5HA 4J9ZB 3T97A 1S77D 1N33B 2X6BA 1K92A 4LR3A 2LFRA 1XQ8A 2PYLA 2QWRB 4O4IA 5KX5B 1WN7A 4MW3A 2IBZE 3C3SA 1P49A 4MN4C 2OCCC 1LT9C 3HE5A 4AQYO 3MZWB 1G1JA 1D7MA 3G80A 3L70J 1VQKP 1T3JA 4I7ZC 1GW4A 1YITP 2Y0PA 1X0TA 1Y76B 2BTOA 2DYRC 3FB6C 1R3IC 1EFRG 1N34O 1EN6A 1NKNA 3CCSV 3EXAA 4TUYA 4R6ZA 4DR4O 2AXCA 3OA7A 1GK4A 5EBMC 4WF9V 1UIXA 2UU9B 4JV5B 3GF7A 3JALB 5L3FA 3BFRA 1TVKA 4LFCO 1SQPK 1K04A 5J9PC 4NR1A 1NU1J 2BEQD 2XKMA 1N73C 1W0JG 2FL4A 1WAZA 3HD7B 3SJCC 2KNCA 4KHXA 2HEPA 2ITAA 1VQOV 1HNWB 5CBNA 3IC9A 2LKMA 4GKKB 1GM7A 2KXPB 3K9AA 4DRXB 4DK0A 1NAFA 3NR7A 1SQVJ 1YYCA 2IZ0A 3L71H 5KAIE 5CN0A 5KX5A 1SQBK 3RL0D 5IYZB 3VP9A 4NXNO 1L4AC 2P10A 5GTIH 5EC2C 4BIOA 1IBLO 4O9BA 4R50A 4KFMA 1SQQE 3A0HH 3NFQA 3LW5H 4XBFA 3S3WA 2KB1A 1J5EO 4Q20A 2LJ2A 3UO3A 1YTZT 2Q7EA 3CC7V 1MOFA 4GODA 2KZIA 5BU8B 3R65A 4YHHB 1SFCB 1VF5D 2PFXA 1KYOF 2AHYA 2IBZI 4PV1B 1Y76A 2Y48A 2E43A 1KB9E 4TV9A 1IZ3A 1ZWIC 3M91A 4ZOLB 2OARA 5KKZC 1FXKB 4J7JA 3H1HD 2YIBD 5CBHA 1XMOO 1LTJB 3WU2H 1NTKH 3H32B 1P84E 2UUBO 4NXNB 2QEXV 1FJKA 5JCOC 3L75J 2ZVNB 2HLOA 2RN0A 3JALA 3R2PA 3RFRA 1L0LJ 2Y0DA 3L37A 1QL1A 4IYHA 4PI0A 1BS3A 4WB4A 3QVNA 4U3FH 1Y67A 4FM0A 2GA1A 4ZBMA 1EXJA 4W7YA 1VQPP 1SQQK 3FYIB 3HD7A 4X64B 1IZNB 5JJEB 1OMIA 1OJHA 4H0LC 1LWUB 4BRYB 1AQTA 2QM4A 2C0XA 4YXDC 2N1TD 4DRXA 4A7PA 1RP3B 1AI5A 4X66O 2UXCB 4HB1A 4JPZB 1NJIQ 3BCCG 1KTMA 1JY2P 2RDCA 1YXBA 2CH7A 5IYZA 4JPRA 1FS0E 2OYOA 3CCUV 4DR2B 5EIBD 2JO1A 2F4VB 1JY3P 5B3SB 2KSEA 5ITZB 4U7OA 2J5UA 3G4SV 1Z56A 3BATA 3ZRWB 2OTJV 1SFCA 3HUSA 1H2MA 1GU5A 5AW2B 4ASUG 2IH3C 4GOEA 1RF1B 3E86A 1URQB 1FXKA 4PA7A 1J1EB 1LGHB 5FL7G 1LTJA 3H32A 1GN6A 3W68A 3SYOA 1XDCA 4PHZA 2UXBB 2ZT9C 2A06H 4Q6GA 1FJGO 3BCCE 3SWKA 2EINC 1KB9I 1B06A 5LA6B 4F6RB 3IN6A 5B66E 2IJJA 3ABKC 4LGDE 3ZJZA 2UUCB 2FXOA 1CEZA 3H1JD 4P9PA 3OUSA 1N32O 1P84I 4X1IB 4GKJO 2LW1A 2IJIA 1Q7YW 4ASWA 2K1AA 3SPGA 3L71J 1SQPD 1LWUA 3E8BA 1M9NA 2R3SA 3H1IG 4N6JA 4BRYA 2BOCC 3G71V 1OWAA 2H7HA 2IBZD 4NYKA 2EIJC 4OPHA 1GMJA 3LW5J 3DXRB 1GH6A 5KUMA 3MAQA 1FJGB 2W6JH 4GUNA 4P2ZA 3AE2C 4IYIA 3ZRSA 2CTWA 2HR3A 3BVOA 4AILC 3IC7A 4WY4C 4LC1A 4LH7A 2PY5A 3ASNB 1SQBD 3ZHTA 1JM0A 4TV8B 1YJ9V 2H3OA 4PD4E 2E75C 3L72D 3ZRWA 5KHJA 5HFMA 4FM2A 1Y47A 1NTKJ 3SJQC 1X8YA 5CCGD 3B8EB 1Q82W 1I5XA 3F7VC 1X9VA 1RF1A 2XT9A 1URQA 2NN4A 2R5DA 1SESA 3FFQA 2WA3A 3H1IE 2GTAA 2LXCB 2XTAA 4DV0B 3TNUB 1YQ3C 1W59A 1MZEA 5CMZA 4X20B 3T1HB 4U3FJ 2QWPB 2HHHB 1GAXA 1RPOA 1RE4A 5KMGB 2Q6QA 3N4XA 3U10A 1OV9A 2DYSC 2FKXA 5LA6A 4F6RA 3BA9A 4FLTA 1QVFO 1MG1A 1FZCB 2KSDA 1QLEB 1W2BU 2OQQA 2YIUB 1HGZA 3JARB 5AVVB 3HKBB 3KYQA 1HJBA 4X1IA 1M57B 1OIPA 1SQFA 1VEWA 2IFNA 2GUZB 3ZHQA 3PLNA 2P22C 4UB6E 4BW9A 1PFIA 5L3BA 5LYJB 1EC5A 3SR2C 2MKVA 5KAIH 2Q5ZA 4H44C 4CS4A 3EHBB 4LF6O 3IF4A 1Y8AA 5LHIA 1AV1A 1SQQD 1M90Q 1RH5B 1FXHA 1M1KQ 1PM9A 2Q68A 3DXRA 5B1AB 3AG2C 3LNNA 2D2CB 2P90A 1SQQH 2ZR2A 3RL0C 3RGBA 2OCHA 3UKMA 2H43A 1F7YA 3SYCA 2KZJA 3L74G 3ASOB 2QJKC 1R6KA 2GHYA 3OGCC 3F5WC 4O2BB 1KB9D 2B9BA 2N04A 4TV8A 4EEQA 5C8YB 4B3TB 3CXHH 1IO4A 2RJZA 3AE1C 1P84D 4OXSA 1M1JB 1VF5C 1KECA 2YXLA 1Q90D 4MVOA 3ETEA 2KQXA 2YXYA 3UT5B 1L0NE 2PAJA 1JVMA 1YTZI 5KJ7C 1YJNV 4I9WA 1VQ7V 2QWOB 3OMNB 3SYAA 1IBKB 3NXSA 1NTZG 3AG4C 1BDCA 5C93A 4GX1A 1IFJA 4UCRA 3DSQA 4DR3O 1YI2V 2QIWA 4F6EA 3TNUA 2GTSA 3L73G 2KP8A 2KS1B 1AILA 4X20A 2N9YB 4WFFA 3LDDA 2CAZC 5KMGA 2GUVA 1NQTA 4J7KA 3Q2YA 4AUWA 2ZIMA 4JYBA 2CK3G 4F4LA 4IOIH 2BSKB 1FZCA 4D6TG 1HUCA 1VPCA 3L74E 3JARA 2ZXWC 1XUQA 1M5IA 1ZR2A 3HKBA 1SKVA 1BGYG 4H13B 3FGAD 4MTGA 5LYJA 3UM7A 1BE3G 4WFGA 4ZHQB 3AE7C 2K37A 5D5PA 1IURA 3HE4B 1KN7A 1SQXK 1L0NK 2FYUE 3SFEC 1NTZE 1VQ6P 2CDYA 4K0KB 2R9AA 4JZGA 2QVAA 1DF5A 1XHXA 1R3LC 5EIBC 1LUVA 3L73E 1SQGA 1JA8A 2CPBA 1S1CX 1FKAO 1PGJA 1YJWV 1BL8A 5APTA 2JGUA 4O2BA 3AEFC 3ITKA 3AE6C 1S9KE 3LIEA 1GRJA 5C8YA 1Q81Q 4D6TE 1SS1A 3K0GA 2KLVA 3M9QA 1M1JA 3SPHA 2PZSA 2SPZA 2YIAA 3UT5A 3IR9A 4JAUA 1GL2D 3D36A 4WFBV
chains in the Genus database with same CATH topology
2FYNC 1DD3A 2OQQA 1K05A 1ZRTE 1KTMA 4I7ZC 2JP3A 1AJYA 1PV3A 5M1BA 2G3AA 2WPVB 3O6QA 3GLMA 2JO1A 1KQGB 1WMKA 4Y28J 2MKVA 1S5LX 4H44D 4H44C 2J5UA 2E76B 2WSEJ 4R4LA 2FBWC 3H25A 2WSCJ 2QJPC 2QSIA 4H0LD 3G9RA 4OGQC 4U7JA 4TT3H 2D2CB 3D70A 2K9YA 3B71A 4RKUJ 1UIXA 3AECC 2E74D 3GF7A 3AE5C 2E74C 1PIXA 3T97B 1IK7A 2QJKC 1K04A 3Q5PA 1KILE 1KORA 2WQYC 2BEQD 3ABVC 1RQUA 4I7ZB 4GDOA 4KT0J 2E75B 3AEEC 1FDOA 3D6YA 2ZT9C 3GMAA 3AE1C 4H13D 4H13C 1NYHA 4PV1D 3AE9C 4PV1C 3IAOA 1VF5C 5KLIC 3D71A 1Q90D 1DIPA 3IN6A 1EXIA 1Y9BA 3AE4C 2IDBA 1OW6A 1U57A 4H44B 1PL5A 2G8YA 4OGQD 2QIWA 2YIUC 1FDIA 1ZMEC 4H0LB 1VL2A 5L8RJ 2P10A 3RK3E 1DD4A 1OW8A 3Q5RA 2E74B 2O01J 3GF3A 3Q2YA 3D6ZA 1R8EA 1HF9A 3AEDC 2FXPA 2E76C 1GMJA 1OW7A 1TU3F 3LW5J 2ZT9D 1ZOYC 2H88C 1VF5D 3EWKA 4H13B 4PV1B 3AE2C 2D2CC 3S9OA 1NGMB 3FGAD 2QJYC 3Q1MA 5KKZC 4YTPC 3AE7C 3AEAC 1KMIZ 1ZP0C 1MKMA 4OGQB 1KQFB 3C8VA 3RL0g 4Z1MH 2YMKA 3SFEC 2E75D 3SFDC 2E75C 1HJ0A 1YQ4C 3Q3DA 3AE8C 1S1CX 3AEGC 4XFJA 2E76D 1EXJA 3Q5SA 4R4MA 2H89C 3AEFC 3AE6C 1RQVA 2ZT9B 1YQ3C 2V7QJ 2D2CD 1VF5B 3R4YA 1JB0J 1OMIA 2WSFJ 4H0LC 2NZ2A 2BEZF 3AE3C 4IL6X 4YXDC 3AEBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYN C;  2QJK C;  2E74 B;  1ZRT E;  2O01 J;  4I7Z B;  2WPV B;  4KT0 J;  2E75 B;  3LW5 J;  4Y28 J;  5KLI C;  1S5L X;  1Q90 D;  2E76 B;  2WSE J;  2ZT9 B;  4H13 B;  4PV1 B;  2WSC J;  4H44 B;  1VF5 B;  2QJP C;  1JB0 J;  2QSI A;  2WSF J;  2QJY C;  5KKZ C;  2D2C B;  2K9Y A;  2QIW A;  2YIU C;  4RKU J;  4IL6 X;  4H0L B;  5L8R J;  4OGQ B;  3C8V A; 
#chains in the Genus database with same CATH topology
 4CS2 A;  3JAK B;  3I5C A;  1PP9 D;  2Q7H A;  3KKY A;  1ZRT E;  1V54 C;  2WLH A;  2FYZ A;  5TIS E;  1BE3 E;  1VF6 C;  3BCC H;  2J59 M;  2KS1 A;  2HJD A;  2H8P D;  3T1Y O;  5B66 H;  1MMM A;  4LF7 O;  1K9M Q;  5CMU A;  1G1I A;  4DV5 O;  2I1J A;  3M06 A;  1VQN V;  3FAV B;  2FYU K;  3V2P A;  4R7C A;  4UVC A;  3ABT A;  2PRR A;  3RK3 B;  2BSK A;  3RYI B;  1N8R Q;  3D70 A;  2JS3 A;  1NJI W;  2WLJ A;  5IE9 A;  3G6E V;  4UCV A;  2OTK E;  4BW5 A;  2QKC A;  3G67 A;  1FZA A;  1IFP A;  4QGP A;  4X89 A;  2ZFC A;  2ZD9 A;  1N7S B;  4O4J B;  4ZHQ A;  1X79 B;  1NI8 A;  2Q7C A;  1S5H C;  3HPL C;  1HDJ A;  3HE4 A;  2WAM A;  5AVT B;  3GMA A;  2HG5 D;  4W4K A;  1M4U A;  4LCU C;  3WG7 B;  3JSV C;  4JAS A;  1VQL V;  1XMQ O;  2E5Y A;  4NPD A;  2KG7 B;  1OW6 A;  1XTG B;  1SVF A;  1HVV A;  2K9J B;  4TLF A;  1AFO A;  1N36 B;  1S72 P;  4PD4 H;  2HOD B;  1FAF A;  2ZNJ A;  5KHI A;  2VRZ A;  2P58 A;  1PNK A;  1JO5 A;  4DK1 A;  1QCE A;  1NVO A;  3O9O A;  2ODM A;  4DV2 O;  2Q3I A;  5CCG C;  1J2J B;  4XDK A;  3ABM B;  3H1I H;  1JJ2 U;  1GTW A;  4W80 A;  4QMA A;  3DGE A;  5JWP A;  5IWA B;  5KA5 A;  3JAK A;  2BOB C;  4PDR A;  1OW7 A;  4QNH B;  1XTC C;  3D3I A;  2A3Q A;  3J7A U;  4CH6 A;  1J95 A;  3RK2 B;  3VMY A;  1Q6H A;  4MVZ A;  3AEA C;  2ZM6 B;  1J1D B;  3CCR P;  3FAV A;  1ZP0 C;  4DOJ A;  1BDD A;  3AG3 C;  2E3C A;  1A32 A;  4X65 B;  3FD9 A;  3RYI A;  3H01 A;  4UB6 H;  4IT5 A;  4QE9 A;  4X1K B;  3A0H Z;  5LGN A;  4FPP A;  1CW5 A;  3F5T A;  4DV3 O;  2YIC A;  5APY A;  2AXT Z;  1YIJ P;  3I56 V;  3V5B A;  1WP7 A;  3GB7 C;  4XFJ A;  2OYH C;  5IT9 N;  4O4J A;  5IYC O;  1N7S A;  1OFC X;  3ETG A;  3TXS A;  1OX3 A;  2C0W A;  5APQ A;  2XV5 A;  3P30 A;  1DGS A;  3MUD A;  1KYO E;  3JD2 A;  3ZRX A;  5AG2 A;  1M56 D;  1SZX A;  3AE3 C;  3CPW U;  2NRG A;  3H1H G;  2KG7 A;  3WU2 Z;  1HBW A;  1ZTE A;  2VS0 A;  3I5D A;  2ZNI A;  2OIE A;  2K9J A;  3KZI E;  1AP5 A;  1SQX D;  5J2U B;  1S76 D;  3CMA P;  1L0N D;  3P32 A;  1KZU B;  2HOD A;  5L3D A;  3CYO A;  5A2Q N;  1RE3 C;  3G6E P;  2ZR3 A;  4LF5 O;  5AVZ B;  1I94 B;  2VQE B;  5JJN B;  1U7M A;  2DW4 A;  2RKL A;  2NPS B;  3CCM V;  4YY3 O;  4PDV A;  2CTR A;  3BCC J;  5IDJ A;  2VWJ A;  3W7T A;  4JZ2 A;  3WUT A;  4ZNC A;  4DR7 B;  1PGP A;  3KCX A;  4GOF A;  1N7L A;  3A0R A;  4JI8 B;  1VQ4 V;  3EFG A;  3NMD A;  4EYY Q;  3AEC C;  3B5N C;  4XA4 A;  1PIX A;  2YUA A;  2WPS A;  3Q5P A;  3A0B Z;  1H2N A;  3L74 H;  3FYE B;  3V4Q A;  2CE4 A;  1FOS E;  4I7Z B;  4JGS A;  1WRG A;  1MSD A;  3CD6 P;  2R5B A;  1M90 W;  3AEE C;  3K5B A;  1M1K W;  1PKX A;  5C39 A;  1XNQ O;  4X1K A;  5KLI C;  4HAM A;  4JI1 O;  4B7K A;  2IFM A;  2UUA B;  3WUV A;  5KA6 A;  2PTM A;  2FYU D;  2FFD C;  1GK6 A;  1JNM A;  1LTT C;  2JJL A;  1K3E A;  1VQK V;  4C7N B;  2WPR A;  4OGQ D;  4JI3 B;  1BSH A;  2XNX A;  1YIT V;  4JTC B;  1NTZ H;  2QTO A;  3WB1 A;  1FFX B;  3E89 A;  4L8J A;  2OWO A;  1VL2 A;  5L3E A;  1DD4 A;  1Q43 A;  2RMK B;  4LFB O;  3L73 H;  2P7J A;  2QSA A;  5AW4 B;  3VMA A;  1RM1 C;  4JI6 O;  2VQF B;  3GF3 A;  1KUQ A;  3PTZ A;  2JIZ G;  1NTM K;  1N73 B;  2CK3 H;  3X2Q C;  5J2U A;  1S4X A;  2H94 A;  4DV6 O;  4D6T H;  4FLV A;  3H1I J;  3CJH B;  4MVS A;  3B77 A;  4AQR D;  2W6A A;  5AVW B;  3LDE A;  1KYO I;  3T1C A;  3SDL A;  1BGY H;  4K8Z A;  2NPS A;  3HKE B;  2P5O A;  1L1F A;  4X88 A;  5FPR A;  3M8A A;  2M3B A;  3H1J G;  3ZED A;  1HR0 B;  2QJP B;  3KPE A;  2F93 B;  5BR8 B;  1GL2 C;  4HH2 A;  1BE3 H;  2X6C A;  3RL0 g;  5AW8 B;  4DV1 B;  3RYC B;  3CC4 P;  2JS5 A;  4J9Y B;  1XIL A;  1L4A B;  1SQP G;  4RJT A;  5HFL A;  1ZL8 B;  3KHU A;  2H8P C;  4UCT A;  2IBZ G;  4DV4 B;  3OAK A;  1N33 O;  4R8C A;  3SGI A;  3B2E E;  1PGO A;  4DT0 A;  2IM9 A;  3BY6 A;  5LGU A;  2A45 I;  2YMY A;  2QM8 A;  1Q3E A;  3L35 A;  3E83 A;  1G1X B;  1RQV A;  4CH5 A;  2M5A B;  1UFI A;  2IJH A;  3TXQ A;  3JCU E;  3QO8 A;  4IL6 X;  4UV8 A;  1KBH A;  1ORQ C;  3QTC A;  1SQB G;  5LMN B;  2W8Z A;  4C7N A;  4LH6 A;  2JP3 A;  3HD7 D;  1FU1 A;  1MFT A;  4JYC A;  3L72 G;  1FFX A;  3H1J E;  2QA4 P;  1PZQ A;  4GZR B;  3CEI A;  1Q81 W;  1T8Z A;  1V9P A;  5KAF E;  1XL6 A;  1H88 A;  3FX7 A;  4FLW A;  1SQP E;  4LF4 B;  5IJ9 B;  4RUE A;  3WB0 A;  4TT3 G;  4FIP C;  1LP1 B;  1N73 A;  5DJU B;  3G9R A;  2F43 G;  2OYI B;  3CJH A;  5E79 E;  2UU9 O;  2FXM A;  4JV5 O;  2KOG A;  3AG7 A;  1JCH A;  3P3P A;  3HKE A;  1K9M W;  1NT2 B;  4J42 A;  2YKP A;  3VMZ A;  1VQP V;  2KSJ A;  5CBO A;  2GV9 A;  3C1L A;  3W67 A;  4Y99 C;  3RYC A;  1U97 A;  3D6Y A;  3E8H A;  4B08 A;  5F2V O;  2E5L B;  1EZV I;  1L4A A;  1SFC D;  1KQL A;  1SQB E;  3L74 J;  4MVU A;  1YEW A;  3CX5 F;  4OX9 B;  1EQ7 A;  4PV1 D;  1GN4 A;  3L9D A;  2ZJS E;  1HNW O;  1ZL8 A;  1FAV A;  3PH0 A;  5KAI Z;  5LOV B;  4GKK O;  3L72 E;  3H1L D;  2EIK C;  1SQQ G;  5DED A;  2XU6 A;  4WWI A;  4UCU A;  4FLU A;  4BAY A;  1YCI A;  2M5A A;  3CWB D;  3Q5R A;  4W7Z A;  3FX0 A;  3ZBH A;  1NTZ J;  1UII A;  3CRR A;  3CCL P;  4IFF A;  3D6Z A;  5CBF A;  1CSB A;  1ZX3 A;  1KYO D;  1R8E A;  1HF9 A;  3U1C A;  2LP7 A;  3L73 J;  1MA1 A;  4GX2 A;  4KL1 A;  2BCC D;  5KLV E;  4YHH O;  1BCC D;  3HKD B;  5LP6 C;  4RO0 A;  3CL3 D;  1IDS A;  4P9O A;  3KZI H;  4D6T J;  3BRC A;  1IBM B;  1NH2 B;  1WJZ A;  3CC2 P;  2CGN A;  2XAF A;  3ICX A;  5IJ9 A;  1BGY J;  2HYN A;  1GM9 A;  1LP1 A;  2JVD A;  3SFD C;  2EZP A;  2OYI A;  1XHZ A;  1L2P A;  2K88 A;  4C46 A;  4X1Y B;  1BE3 J;  2AXT H;  3JD1 A;  2XND H;  1GN3 A;  1NTM D;  4PDM A;  4R4M A;  2XAJ A;  4OWF A;  2W6B A;  3L36 A;  2W90 A;  2Q7G A;  3CCJ P;  2YO2 A;  4X64 O;  1HNX B;  4FLY A;  1FJP A;  2LXB A;  1VQ5 P;  3UCS C;  3N2K B;  1FS0 G;  5LOV A;  1K73 W;  1URQ D;  2VRS A;  3E1R A;  4MVM A;  4IFD K;  1RF0 A;  5JH7 B;  1TUB B;  5KLV K;  3H1H H;  2UXC O;  3K9S A;  2EX3 A;  2WLI B;  3P3N A;  5CB4 B;  4DR2 O;  1OCC B;  1GTO A;  2F4V O;  3LUT B;  1S5L X;  2O3J A;  5DEC A;  4LNU B;  1OVR A;  1E79 G;  3SYP A;  1H8E G;  4OGQ C;  3P8C E;  5AVS B;  4MTO A;  3B71 A;  4DXW A;  1R5L A;  5CJ4 A;  3BA8 A;  4IGG A;  4BIU A;  4B86 A;  2ZE8 A;  2E74 C;  2D3O W;  3HKD A;  2DYS B;  3L4F A;  1EZV D;  3A0B H;  2Z5U A;  3PJS K;  1OCZ C;  4BIZ A;  1CI6 B;  1PP9 G;  1QL2 A;  2WLM A;  2Q5U A;  1EN5 A;  5IY5 C;  2YI8 A;  3ZN0 A;  1JR9 A;  2DWD C;  2P4V A;  5B66 Z;  2UXB O;  5AVU B;  4JQ0 D;  2Q69 A;  3MD0 A;  4X1Y A;  2IDB A;  4H44 B;  2Q9I A;  1I0H A;  4FFK A;  3CSX A;  2A79 B;  2UUC O;  3SWF A;  1LTS C;  1NVP B;  1AI6 A;  4UV9 A;  3GHG C;  1IK9 A;  5APU A;  3TGU D;  1VQ9 P;  2XAQ A;  2KKW A;  5JVD B;  3MTU E;  4MTF A;  4ZOL A;  2QJK B;  3ZS8 C;  3N2K A;  4E4E A;  1HWT C;  2EZO A;  2YXQ B;  3AG1 C;  1BZK A;  5JH7 A;  1TUB A;  2PP6 A;  1H2K A;  2ZVO B;  1TU3 F;  1YHQ P;  3JCU H;  3EQ2 A;  1ZOY C;  2WLI A;  2N74 A;  1S2E A;  1OZ0 A;  1PP9 E;  5CB4 A;  1SA0 B;  3K0D A;  1QEX A;  4NXM O;  2BAS A;  2IZ1 A;  5B1B C;  4ASV A;  2KYV A;  1JY2 N;  1F23 A;  3VQW A;  1Y74 B;  4LNU A;  1QLE D;  5D5Q A;  1MKM A;  3H1J H;  2L91 A;  2AEF A;  2YMK A;  3FWL A;  2M6Y A;  1JY3 N;  1M57 D;  1QR9 A;  3HD7 C;  1IFN A;  3OE7 G;  1X22 A;  5KAF H;  1GD2 E;  2Q8V A;  4KHP B;  1SQP H;  1KD1 Q;  2ARH A;  4N21 A;  4DUY B;  3AE8 C;  3H1K D;  2YI9 A;  2IBZ H;  2EJR A;  1CI6 A;  2QE7 H;  3IAY A;  1T5E A;  2C9N Y;  1B3Q A;  4DV0 O;  1NR7 A;  1R3J C;  2Y9Y A;  3VP8 A;  2D2C D;  3HB3 B;  5E79 H;  4NXM B;  1JB0 J;  1PNM A;  3T1H O;  1Z2G A;  4IL6 E;  2HHH O;  2Q67 A;  1HTL C;  3RT3 C;  5ITZ A;  3UIA A;  3P7K A;  5DN6 G;  4GX5 A;  3W7X A;  1K05 A;  2ZE6 A;  1E1R G;  1SQB H;  4UB6 Z;  1AJN A;  2LW7 A;  2AZ0 A;  5AW9 B;  3JAM N;  4FZ1 A;  4GIF A;  3HUS C;  3H1H J;  3L72 H;  4JBZ A;  4DZO A;  1JMK C;  4PA6 A;  5JVD A;  4DR6 O;  4X62 B;  1KQG B;  5APX A;  1KV4 A;  4IFM A;  2HVK C;  3RW0 A;  2EBO A;  1WB8 A;  2B1G A;  3K5L A;  1TA8 A;  4MW8 A;  1FXK C;  1PV0 A;  4CBC A;  1LTJ C;  1L8D A;  3MDS A;  2FTK A;  1VQ6 V;  1ZAU A;  4TT3 H;  3VTP C;  4YIP A;  1KIL B;  4ICG A;  1SET A;  1N0N A;  4RKU J;  1LR1 A;  1Y6X A;  1SA0 A;  5KJ7 A;  3BAA A;  1WLE A;  3M9B A;  4QPJ A;  1VQ8 P;  5KLV D;  3K58 A;  1AP6 A;  3TDK A;  3STL C;  1SQX G;  3RGU A;  1Y74 A;  4JAV A;  1OHH G;  4NTX A;  4PA4 A;  1L0N G;  1W2B O;  3M9H A;  1R1B A;  3N7N A;  4B3T O;  3B09 A;  4Z2W A;  4FZ0 A;  4DR6 B;  4H13 D;  1KQS O;  1AVY A;  4CH3 A;  2HLD G;  1QHT A;  1LWU C;  5CJ0 A;  3AE4 C;  2XOK G;  3JAS B;  4UCO A;  1IBK O;  1PL5 A;  4XDJ A;  4QJF B;  3BAS A;  4UUJ C;  2ATK C;  1EDI A;  1XL4 A;  4Z1V A;  3HKC B;  1BMF G;  1NKZ B;  1K8A Q;  3IFX A;  2XZR A;  5KUK A;  5B3S C;  3LSS A;  2FXP A;  2IU0 A;  2PYJ A;  5H6Q A;  1KB9 H;  4FMT A;  2AEM A;  4YXW G;  1SQX E;  4I55 B;  4L75 A;  5AVX B;  1XRE A;  5CBG A;  1P84 H;  4J41 A;  2FYU G;  1N2D C;  3Q1M A;  3CME P;  4NTW A;  3BVH A;  1URQ C;  1ZXG A;  4RES B;  4EKW A;  2L6L A;  4W4L A;  1KIL A;  4K0K O;  3OD4 A;  3QG5 A;  1A02 F;  3H1J J;  2XDJ A;  4G28 B;  2IPP A;  3P8C D;  5B5E E;  1V55 B;  2WLK A;  3A5T A;  5FLX N;  1S72 V;  3RK3 D;  3KXD A;  3C3T A;  4ZI7 B;  3I55 V;  4PA9 A;  1SER A;  1SQP J;  1OCR C;  1SZT A;  2GUZ A;  3R4Y A;  1QGK B;  3T4Z A;  2QG4 A;  2DQ3 A;  2N1T C;  2ZDI A;  1N7S D;  5TIS Z;  3LID A;  4HJG H;  3JAS A;  2FYN C;  3U11 A;  3SPC A;  1VF7 A;  3BRT B;  4P30 A;  5BVZ A;  1JCD A;  1PV3 A;  3MP7 B;  1ENV A;  1UJW B;  1FDM A;  1IFD A;  2JWD A;  2GDS A;  1S5L E;  3HKC A;  2YSU B;  3CXH F;  1SQB J;  3CCR V;  1NO4 A;  2OT5 A;  2E76 B;  1QVG O;  2Y4T A;  3L72 J;  1ZLZ A;  1ZN5 A;  3ASN C;  1T3U A;  1IXM A;  1I5Y A;  1E79 H;  3ZMZ A;  2K9Y A;  4FM1 A;  4I55 A;  3SJB C;  2QJY B;  3F89 A;  2HFE D;  1YIJ V;  2LQT A;  3ZDM A;  1IFI A;  4EI2 A;  4JI7 B;  2WVR A;  4GT1 A;  4MVR A;  1P7B A;  4LF9 B;  1Q2N A;  4B3R B;  2QKA A;  3GW6 A;  4EIJ A;  1PP9 H;  3TSI A;  2OTL P;  5LGT A;  3RK2 D;  1PL4 A;  2DQ0 A;  3THO A;  1GK9 A;  4B3M O;  1NH4 A;  2EIL B;  2DE0 X;  2YKQ A;  3JD4 A;  3GG2 A;  2ZE7 A;  1H2S B;  3V4W A;  3CMA V;  4ZKP A;  1N36 O;  2DW3 A;  3JD0 A;  2YIU C;  1QLE C;  2QTS A;  4ZI7 A;  2B1I A;  2OYQ A;  3S1K A;  3C9I A;  1ZME C;  3K03 A;  1MZ9 A;  2ZIN A;  4LLH A;  3B5N B;  2Q0O C;  3V6I A;  1SQQ J;  2ZXE B;  2CUG A;  1ZUQ A;  3B4S A;  1HGV A;  2R9I A;  2HVJ C;  4DUZ B;  3AED C;  1SRY A;  4NKG B;  5IWA O;  1Y4M A;  2AW9 A;  1XI1 A;  4IL6 H;  1NU1 K;  1PPJ D;  5L3C A;  5B1A C;  5IJ0 B;  2PI5 A;  3S9O A;  2D2C C;  3CX5 E;  4B3M B;  3ZHV A;  4RQE A;  2RH0 A;  1N86 A;  4DR5 B;  4CS3 A;  3H1L G;  2ITC C;  2ZIO A;  2ZM6 O;  3IGA C;  2R32 A;  1AVM A;  2YC0 A;  1D5N A;  1GW3 A;  3CD6 V;  3S4R A;  4J80 A;  3VYI A;  3I55 P;  2NNU A;  4LWS B;  4X65 O;  3L75 E;  2DJV A;  1SQV K;  3M7M X;  3CWB G;  4NB5 A;  3E1I A;  1SS3 A;  1OCO C;  2ZYG A;  2NPS D;  4MSW C;  1GDT A;  2PGG A;  1M1J C;  2KIK A;  2IW5 A;  4KUM A;  5E1A C;  1WNS A;  2BCC G;  2IYP A;  2WTY A;  3RVY A;  3II6 A;  1LUW A;  2GM4 A;  3OTO B;  1RE3 A;  1BCC G;  1B04 A;  1USE A;  2BE3 A;  1JX9 A;  2DWE C;  4L87 A;  4RO2 A;  3KZI Z;  1IC2 A;  2XAS A;  2PF4 E;  3W7S A;  4FJC C;  4HYT B;  1VQM P;  3ZHS A;  1E1Q G;  3S3X A;  3MHS C;  4GKG A;  3VMX A;  4MVQ A;  3H1L E;  1FZE A;  2W0X A;  3KG2 A;  2XND G;  2G3A A;  2WPV B;  1I94 O;  5EC1 C;  2VQE O;  2QWN B;  3B5N A;  3ABU A;  3FB8 C;  3Q4H B;  4Y28 J;  1VMG A;  3CWB E;  1NTM G;  5CCH A;  2UXD O;  5AW3 B;  1R3K C;  3B8M A;  3CC4 V;  1L0L K;  4DR7 O;  4JI8 O;  4PD4 F;  3CRA A;  5IJ0 A;  1D5A A;  3FXD A;  2BCC E;  3QWO C;  1QNM A;  2E42 A;  1XOU A;  1BCC E;  1DX7 A;  3CPW O;  1XNR B;  1YSC A;  2RCV A;  1RSO B;  3JD3 A;  4AYC A;  1SQX H;  1U96 A;  4LWS A;  3CI9 A;  1L0N H;  5K5G B;  5L3G A;  3VQY A;  3A2A A;  1GN2 A;  3D71 A;  3CX5 I;  2JR8 A;  4WBA A;  2UUA O;  2X6A A;  4LF8 B;  1PP9 J;  1USD A;  2UXD B;  4I5S A;  2C9L Y;  2NR5 A;  2O01 H;  4JI3 O;  1W5C E;  1Q8I A;  2QA4 V;  2FB5 A;  1NTM E;  2M0B A;  2OCC B;  1L4A D;  1LT9 B;  2Y69 C;  5B5E H;  1EZV G;  2RMZ A;  4I4T B;  2VQF O;  3OW2 O;  1S3J A;  4QE7 A;  4L76 A;  4EDF A;  3D3Q A;  3RK3 C;  2ILM A;  1GU4 A;  3L70 D;  4PJ0 E;  3CCE P;  3OJA B;  2DYR B;  4YXW H;  5H5N A;  3Q4H A;  1OXZ A;  1O9H A;  2ZYA A;  4Z1M G;  2EIK B;  4PDL A;  2FYU H;  2DMX A;  1HR0 O;  4QIW F;  5BR8 O;  3M0D A;  3BRV B;  3TGU G;  4DV1 O;  2LGW A;  1EDJ A;  5KHK A;  1S5L H;  1NTK E;  4I1L A;  1WPB A;  2V7Q G;  3MUD C;  1WPX A;  3PRJ A;  3A2F A;  3EFF K;  3WG7 C;  3F7Y C;  4I50 B;  3H9V A;  4WFH A;  3T2M A;  4DV4 O;  1QLN A;  3CLQ A;  1X59 A;  2WSF H;  3CCQ P;  3QNE A;  4H33 A;  4DR1 B;  4FFB B;  3JCU Z;  2MW2 B;  1EZV E;  1NU1 D;  1RSO A;  3W7U A;  1S0V A;  1R6T A;  3ABL C;  5LP6 B;  1RY3 A;  1R73 A;  1AR5 A;  3W7W A;  3CCL V;  2WLN A;  5TIS H;  1W0K G;  4OVN F;  1LTG C;  3CB2 A;  3ABM C;  5LMN O;  3OFN G;  1BQZ A;  3APQ A;  4U3J B;  1SQV D;  3FXE A;  1Q7Y Q;  3RN4 A;  1AA0 A;  1LT9 A;  2JDI G;  5KAF Z;  3TGU E;  2ZCE A;  2QE7 G;  2AGA A;  2FML A;  3K57 A;  3H1K G;  4I4T A;  3RK2 C;  3CC2 V;  3MIW A;  4JI4 B;  1NTK K;  2E5T A;  2LO1 A;  3ZX6 A;  4LF4 O;  1J1D C;  2Z5I A;  5E79 Z;  5LBQ A;  3G6B A;  1FE6 A;  3E22 B;  3WMM 0;  4FLX A;  1AVO A;  1CXZ B;  1FZF A;  5KKZ B;  1IK7 A;  2W27 A;  5LXT B;  5GW7 A;  4I6M C;  1KIL E;  4D7S A;  1O9G A;  3CX5 D;  4TOI A;  3CCJ V;  5BY1 A;  1FDO A;  2YXH A;  4KJM A;  2WSS G;  1U7J A;  1DLB A;  2E5L O;  1TAE A;  5AVR B;  2YS8 A;  2HG5 C;  1VQ5 V;  1H2L A;  4OX9 O;  5EYP B;  3IAO A;  1K4C C;  2P67 A;  1HNZ B;  3O8Z A;  1QR8 A;  1Q82 Q;  1AR1 B;  2CTP A;  1ZW0 A;  3L75 D;  1SQX J;  1EXI A;  5AVY B;  2KLU A;  4I50 A;  1NH2 D;  1L0N J;  1EBO A;  5B1O A;  3SYQ A;  2JJ2 G;  3RBZ A;  1L0L D;  4FFB A;  4HNA B;  2A9H A;  1P4R A;  2ETN A;  3H1K E;  4H0L B;  2R70 A;  4LFA O;  1ZV8 A;  2C2A A;  5H2F E;  3ZHR A;  1H2G A;  4DW1 A;  5GTH E;  1OW8 A;  2E74 B;  4JYY A;  5LP6 A;  2O01 J;  4JYA O;  2A7W A;  2YKO A;  5KLV G;  2F95 B;  1JTH B;  3VQV A;  1OCZ B;  4UXN A;  3MHH C;  4TWK A;  1LTI C;  2JEX A;  2IX7 C;  4KP4 A;  1JMB A;  5IY5 B;  4U3J A;  2O57 A;  1LNQ A;  1N8R W;  1KC8 Q;  3IFM A;  3V2Q A;  4FLZ A;  1RHZ B;  1IJD B;  1NS1 A;  2BTQ B;  1G2C B;  4WY4 D;  4LBE C;  4YTP C;  3K04 A;  4HBN A;  4JI5 B;  1IBM O;  1YTF B;  1DH3 A;  3H1L H;  4DV7 B;  1GKF A;  4LFA B;  3GHG B;  2LGQ A;  3SPJ A;  5H6R A;  2E75 D;  2QKS A;  1B6Q A;  2YDE A;  3E22 A;  4YIO A;  2FYU J;  4JYA B;  4N3Y B;  2B89 A;  4NVP A;  5IYD O;  3CWB H;  3OTF A;  2DOS A;  2EIM C;  3Q3D A;  4TV9 B;  5AW0 B;  5H9C A;  5K1P A;  4O4H B;  3RBX A;  4RQF A;  3AG1 B;  3CE2 A;  5LXT A;  1FD9 A;  1JQ0 A;  4EFB A;  2Q9L A;  1KYO H;  2M3E A;  1FC2 C;  2QM7 A;  2ZAE B;  5JCO A;  2ZT9 B;  1VQ9 V;  2LR2 A;  4MTX A;  1HNX O;  2BCC H;  2EIN B;  3BAB A;  1JCC A;  2WSF J;  3FB7 C;  1M56 C;  5EYP A;  3ABK B;  1BCC H;  2YEV B;  5B1B B;  3U0Z A;  4AQY B;  1COW G;  1WP8 A;  1MFZ A;  3STZ C;  2Q4P A;  1JOC A;  1YBK A;  3RYH B;  1H38 A;  1YHQ V;  3VBB A;  4HNA A;  3ZCC A;  3AK3 A;  2A45 H;  3CCV P;  4N78 D;  2YNY A;  1WMK A;  4K35 A;  5CA0 B;  1K5S A;  2EIJ B;  4I0X B;  1N34 B;  3R66 A;  3L71 D;  1JTH A;  4H44 D;  4MT8 A;  2K1E A;  1NTM H;  3OT7 A;  1NVP D;  4M3L A;  2QJP C;  4DR4 B;  1E5W A;  4TSF G;  2QSI A;  3E35 A;  4U7J A;  1K33 A;  2CH7 B;  2IH1 C;  2Y4U A;  2VWK A;  3FWN A;  4LFC B;  4WY4 B;  2RNB A;  1Q86 Q;  2BTQ A;  1P7G A;  3OUF A;  4O4L B;  1G2C A;  2R44 A;  3UO2 A;  2PUS A;  3GHG A;  2E75 B;  4KT0 J;  1IXB A;  1KFM A;  4PJ0 H;  1HWY A;  2I1K A;  4I9Q A;  3P8M C;  3HUS B;  2JRI A;  2ITD C;  4K8X A;  2CPS A;  2GBO A;  5KJ7 D;  1DIP A;  3CXH E;  5DJT B;  5LL6 Y;  2Q0A A;  2UXN A;  4O4H A;  1NTK D;  3JSN A;  3APO A;  3F5H A;  2ZKO A;  3FKS G;  4JTA B;  4YJ3 B;  3RK3 E;  2F1M A;  2KB7 P;  1IBL B;  3BPZ A;  1WT6 A;  4AI8 A;  1VIB A;  2YEV A;  3LDC A;  1J5E B;  1AQ5 A;  4U3F D;  1JPX A;  1EZV H;  3E7K A;  1H8H G;  3RYH A;  1UPG A;  3G3Z A;  2AHZ A;  3ZMU A;  4N23 A;  1AJQ A;  2OYI C;  4D7T A;  2HPC B;  1VQ8 V;  1G4Y B;  5CA0 A;  3PHL A;  1F51 A;  4I0X A;  3V2N A;  1HP8 A;  1XMO B;  4GLX A;  2JK5 C;  2UUB B;  2HJF C;  4Z1M H;  3AG2 B;  4O2A B;  4WBN B;  3CCS P;  1FOS F;  1JJO A;  3H6P A;  4HZ3 A;  3RL0 B;  1BSN A;  2B5U A;  1EZJ A;  3RWR D;  4G27 B;  3TGU H;  3CRQ A;  1PNL A;  1DEB A;  3H1L J;  3N2G B;  1Q6U A;  1URF A;  2JJ1 G;  4KHP O;  4WY4 A;  2NLJ C;  3LSQ A;  2V7Q H;  1SC5 B;  4O4L A;  4DUY O;  3E2E A;  3Q5S A;  1RF0 C;  3CWB J;  4IL6 Z;  3HRN A;  2XUM A;  1G8M A;  5FNV B;  1PPJ G;  5APW A;  2LFS A;  1KIL D;  1VF5 B;  4BWN A;  2NZ2 A;  2QRX A;  4JF7 A;  1VQO P;  2J58 A;  3RYF B;  4RUF A;  3AG4 B;  1CZQ A;  3AEB C;  3KQG A;  2BCC J;  2HKO A;  4X66 B;  1FZB A;  1BCC J;  1EDK A;  2WT7 B;  1AJY A;  2JKV A;  4YJ2 B;  2A06 D;  4JI0 O;  4YJ3 A;  2N05 A;  2XHB A;  3FB5 C;  3K5N A;  1W2E A;  5EK0 A;  1Q6I A;  2JDI H;  3CME V;  4X62 O;  2QGN A;  3CXH I;  1RPR A;  1JFF B;  3H1K H;  4J7Z A;  2ZXW B;  4KXR A;  3CC7 P;  5H2F H;  2EUL A;  3JAW B;  1OCR B;  5GTH H;  3DC5 A;  1BT8 A;  2F66 C;  2L5G B;  2PI4 A;  4OH8 B;  2EJ7 A;  4JAA A;  1NAY A;  1NTM J;  2P2U A;  4DCK A;  2ZYD A;  1PPJ E;  4EOT A;  2HPC A;  1FBM A;  1FXV A;  2N1T B;  2ADP A;  2P1J A;  1AR4 A;  1N4C A;  2FYN B;  2Z4E A;  2FKW B;  5CHX A;  1H89 A;  2R72 A;  3PN1 A;  4JI0 B;  4O2A A;  4WBN A;  3CS5 A;  1SFC C;  2QEX P;  1JY2 O;  1NYH A;  2QJ1 A;  3AE9 C;  4PV1 C;  2POH A;  2WSS H;  3N2G A;  1VAR A;  1FFT B;  1GO3 F;  5AW7 B;  1JY3 O;  1N32 B;  3M0A A;  3C90 A;  4HYO A;  2Y9Z A;  4GKJ B;  4RAI A;  5FNV A;  1NR1 A;  4LP8 A;  5L8R J;  4ZKI A;  1QBZ A;  1T6A A;  4I2L C;  1KP3 A;  3QO7 A;  5AW5 B;  1H0T B;  1OCC C;  3RYF A;  3K59 A;  4U7N A;  3ZMT A;  2YIB A;  5KLV H;  1V54 B;  2XAG A;  4FVM A;  2WT7 A;  4NPF X;  2P6J A;  1YDX A;  1YF2 A;  4YJ2 A;  1NBM G;  4EB6 B;  3CCU P;  1HW7 A;  1MUU A;  1QVF U;  1US6 A;  3TJT A;  1MNG A;  1KFN A;  2QDO A;  1JFF A;  2X0L A;  5JJJ B;  3G4S P;  1NWQ A;  3C8V A;  2IJK A;  4IHJ B;  2OTL V;  2WIT A;  3JAW A;  1Y66 A;  2JEE A;  1HJ0 A;  5B5E Z;  1KQS U;  1XBL A;  2OTJ P;  4CZZ A;  1KC8 W;  2O1J A;  1XEQ A;  4IIJ B;  1M93 A;  5KHG A;  2N1T A;  3AEG C;  3TGU J;  2E76 D;  4FK5 C;  1IVS A;  2V7Q J;  1NOH A;  2B9Z A;  3L70 G;  2W83 C;  1BSM A;  4X9Q A;  5AW6 B;  1YVW A;  3E8F A;  1GZL A;  1CPY A;  3CRC A;  1RF1 C;  2P06 A;  5BMV B;  2UWJ E;  4TQF A;  2OIG A;  1J1E C;  2PGD A;  5JQG B;  3CXH D;  1S5L Z;  5AW1 B;  2WSE H;  1MV8 A;  3OEE G;  3KCY A;  1RE4 C;  1OCO B;  1R6N A;  2MK3 A;  1H0T A;  4PA3 A;  3G71 P;  4LF6 B;  5B1N A;  1DF4 A;  4R4L A;  3HTK B;  1NU1 G;  4ABM A;  1VF6 A;  4PEL A;  3JYC A;  5CA3 A;  3H1K J;  3B5N D;  5LMU O;  4PD4 I;  4EB6 A;  1BHB A;  5A9G A;  4CPG A;  2WA4 A;  3L70 E;  1FYJ A;  5APS A;  3AG3 B;  1JEK A;  1KOR A;  1T2K D;  5CCH D;  1AJP A;  1EN4 A;  3JAT B;  4JI7 O;  3OMI B;  1SQV G;  4GDO A;  4LF9 O;  1M7L A;  2DN9 A;  3OGI B;  4IHJ A;  4B3R O;  1HH0 A;  1OVV A;  4UVA A;  4YPC A;  1YJ9 P;  4A5U B;  1KB9 F;  3K06 A;  2OYH B;  1SF9 A;  1Y9B A;  4IIJ A;  1VQM V;  1Q86 W;  1OVU A;  2WPD G;  4HKZ H;  4UB8 Z;  1P84 F;  5TJH A;  1PD3 A;  4DR3 B;  1CP9 A;  2Q73 A;  3BEH A;  2YID A;  3O6Q B;  5LMU B;  4UVB A;  2RQ6 A;  3TK1 A;  1NU1 E;  2Y0E A;  5CA1 B;  3CXC U;  2MJZ A;  4X8A A;  3LNM B;  4G2K A;  5BMV A;  1QVG U;  2RN9 A;  4DUZ O;  1M8O B;  5JQG A;  1MSW D;  2WPQ A;  4OPA A;  3TF5 A;  3UQ8 A;  5KLV J;  1NGM B;  4WFA V;  1D2D A;  1KIL C;  2W0F C;  1SQV E;  3VQX A;  3L75 G;  5CCG A;  3DC6 A;  2AEJ A;  1K97 A;  4DR5 O;  2XAH A;  3MHV A;  4XE5 B;  1KMI Z;  1BGY E;  1FZC C;  1L0L G;  1KQF B;  3HTK A;  4UB8 E;  3BCC D;  4TQD A;  4B7E A;  3E8G A;  3J80 N;  5FPO A;  2Z0A A;  1QX8 A;  3HR0 A;  1JMM A;  1M57 C;  3D8C A;  2FY8 A;  3SSU A;  1LTB C;  2Y69 B;  1R5S A;  1YQ4 C;  5EBL C;  3ZHU A;  3SWY A;  1A02 J;  2ZDI C;  1IX9 A;  1DEE G;  2H89 C;  3JAT A;  1NTZ K;  5EBW C;  5K1X A;  2Z3Y A;  5KLI B;  3OTO O;  4NPE A;  5J2T B;  1PPJ H;  2BEZ F;  2JWA A;  2I8D A;  2FFD B;  1AB3 A;  4BXL A;  3ASO C;  2OYH A;  1YJN P;  1VQ7 P;  2ZE5 A;  1GM8 A;  1AI7 A;  4WVZ A;  2CGO A;  3OM3 B;  1FPO A;  4C7R A;  5BU5 A;  5DM6 V;  1YI2 P;  4BR6 A;  3JC2 2;  2IU3 A;  3O6Q A;  1Z5W A;  3CCE V;  3T1Y B;  1RM1 B;  1L0L E;  3J81 N;  1OZH A;  4LF7 B;  3GLM A;  2WSC H;  1JUN A;  4JI2 O;  1GMG A;  5CA1 A;  4DV5 B;  2G38 A;  1FZG A;  3D36 C;  3EVK A;  3T4D A;  2WSE J;  3X2Q B;  4NTY A;  2GSM B;  4PD4 D;  2FBW C;  3H25 A;  2A0L A;  3USS A;  2WZ7 A;  3ABL B;  1QU7 A;  4C7U A;  1QQC A;  3JSL A;  1ROP A;  3WFV A;  1NHL A;  3H1I D;  4WFE A;  2HP8 A;  3M99 B;  3TET A;  1KD1 W;  3CCQ V;  1GL2 B;  5BZB A;  1N0J A;  4PI2 A;  3LSU A;  3SPI A;  1V55 C;  1WA8 B;  2WLL B;  1LJ2 A;  1XNR O;  1JOY A;  4GCZ A;  2Q6A A;  2A45 G;  4ZKU A;  2UXX A;  3PP5 A;  1ZLL A;  3TCU A;  4WCE V;  4JI2 B;  2R3C A;  4H13 C;  1XMQ B;  3A3Y B;  4JTD B;  2M7W A;  3L71 G;  2JGD B;  4LF8 O;  1F4N A;  1PL0 A;  4J11 A;  1TGO A;  3GWO A;  3SJA C;  2KUB A;  5EZY B;  1YJW P;  1PGQ A;  1VDF A;  1I7F A;  5GTI Z;  5J2T A;  2W6I G;  2V1D A;  4AHC A;  2B87 B;  2Y0I A;  4DV2 B;  2FFD A;  4JF3 A;  1K73 Q;  3ETQ A;  3B40 A;  1K5Q A;  3ETD A;  3BHP A;  5APV A;  2E76 C;  5BXZ A;  4CC5 A;  4B3S O;  4PJ0 Z;  2K3R A;  1VP7 A;  2H88 C;  1EDL A;  3U59 A;  1H8A A;  1TUE B;  3K5O A;  3VOU A;  3TYY A;  2YO3 A;  3ZN1 A;  3OR7 C;  2QJY C;  1ARO P;  1NTK G;  1VQN P;  3VN0 A;  4N78 E;  5KHH A;  1KU9 A;  3L71 E;  1IFM A;  4CC6 A;  3K3W A;  1BQ0 A;  2O01 N;  1YZB A;  4DV3 B;  3KDP B;  2AZ2 A;  4ZMD A;  5GTI E;  4U3F G;  2YXR B;  3OAA G;  3A0H E;  2ADQ B;  1GL2 A;  4B3S B;  2QWQ B;  2AXT E;  2EIL C;  1LT1 A;  1WA8 A;  2WLL A;  4DR1 O;  2KK7 A;  4Y99 B;  5KTB A;  1THZ A;  2OGU A;  4J10 A;  2M8R A;  3L70 H;  1K8A W;  3MGN A;  1RFY A;  3CP1 A;  4DYL A;  4CH4 A;  1Z5V A;  5EFW B;  1VQL P;  3L74 D;  3OW2 U;  2JGD A;  1N7S C;  3OR6 C;  1DD3 A;  1ZR4 A;  1T2K C;  5EZY A;  3WU2 E;  5CCH C;  3K08 A;  4EFE A;  5M1B A;  4DO2 A;  4LF5 B;  1KKC A;  3H1H E;  1KP2 A;  2JEU A;  2R9R B;  2GUS A;  1ZSP A;  2EIM B;  2F23 A;  1NZ6 A;  4YY3 B;  2B87 A;  4QPK A;  3OEH G;  1EM1 A;  2Y0C A;  2IYO A;  2X7R B;  3A8T A;  4JI4 O;  1NTZ D;  2WSC J;  1AI4 A;  1K34 A;  4U3F E;  1NKD A;  4H0L D;  1NU1 H;  3L73 D;  4MS2 A;  3WUU A;  3K79 A;  3DTU B;  5GON B;  1K7D A;  1M56 B;  2E74 D;  2O1K A;  1MZF A;  3AK1 A;  3AE5 C;  2HFE C;  3T97 B;  2P7T C;  1Q5O A;  2ZQM A;  2WWW A;  1S9K D;  1S5J A;  2WQY C;  3NTN A;  3ABV C;  3GWK C;  3OMA B;  1RQU A;  4UFZ A;  4O4I B;  2QR4 A;  2WMM A;  2ZXX A;  4D6T D;  3A0B E;  2A06 G;  1BHA A;  3ZIA G;  1SQV H;  4L73 A;  1XNQ B;  1BGY D;  3JCZ A;  4L74 A;  1MAB G;  3B8N A;  4JI1 B;  3HE5 B;  1HNZ O;  4GYC B;  3ML0 A;  3AEI A;  1ZRT D;  1DK1 A;  1U57 A;  3I56 P;  1YTF D;  1BE3 D;  4UB8 H;  2KI7 B;  5AVQ B;  2V4D A;  4GX0 A;  5H2F Z;  2G8Y A;  4H37 A;  5GTH Z;  1FDI A;  3CRM A;  4XDL A;  4ZIB A;  1LTA C;  1X4T A;  1DTO A;  1SP4 A;  4LFB B;  3CCV V;  1K4D C;  2Q1K A;  4JI6 B;  3ZMV A;  5LHG A;  2V4H A;  2CTQ A;  3AK2 A;  3QF7 A;  3IJ4 A;  1F4M A;  2L35 A;  1I08 A;  2P4K A;  3QO5 A;  5IYB O;  4TUY B;  2W6J G;  1WB7 A;  2K9P A;  3CX5 H;  3K5M A;  4DV6 B;  2B88 A;  4K3A A;  2ZT9 D;  3M0D C;  3QH9 A;  4UCS A;  3EWK A;  4DJG A;  3VOP A;  3RVZ A;  1TVK B;  4DW0 A;  3GVM A;  2A06 E;  3N27 A;  3CCM P;  3ZRV A;  3ZMS A;  3V2R A;  3L75 H;  4JI5 O;  4E2L A;  2Q3E A;  3CHX A;  3O65 A;  3WB2 A;  4OGQ B;  4DV7 O;  1SLQ A;  3U1A A;  4RWU A;  1L0L H;  2KNC B;  3A7O A;  2N9B A;  1KKD A;  1VQ4 P;  1G6U A;  5GON A;  4BWA A;  2NPS C;  5LHH A;  2Z5H A;  4J9Z B;  3T97 A;  1S77 D;  1N33 B;  2X6B A;  1K92 A;  4LR3 A;  2LFR A;  1XQ8 A;  2PYL A;  2QWR B;  4O4I A;  5KX5 B;  1WN7 A;  4MW3 A;  2IBZ E;  3C3S A;  1P49 A;  4MN4 C;  2OCC C;  1LT9 C;  3HE5 A;  4AQY O;  3MZW B;  1G1J A;  1D7M A;  3G80 A;  3L70 J;  1VQK P;  1T3J A;  4I7Z C;  1GW4 A;  1YIT P;  2Y0P A;  1X0T A;  1Y76 B;  2BTO A;  2DYR C;  3FB6 C;  1R3I C;  1EFR G;  1N34 O;  1EN6 A;  1NKN A;  3CCS V;  3EXA A;  4TUY A;  4R6Z A;  4DR4 O;  2AXC A;  3OA7 A;  1GK4 A;  5EBM C;  4WF9 V;  1UIX A;  2UU9 B;  4JV5 B;  3GF7 A;  3JAL B;  5L3F A;  3BFR A;  1TVK A;  4LFC O;  1SQP K;  1K04 A;  5J9P C;  4NR1 A;  1NU1 J;  2BEQ D;  2XKM A;  1N73 C;  1W0J G;  2FL4 A;  1WAZ A;  3HD7 B;  3SJC C;  2KNC A;  4KHX A;  2HEP A;  2ITA A;  1VQO V;  1HNW B;  5CBN A;  3IC9 A;  2LKM A;  4GKK B;  1GM7 A;  2KXP B;  3K9A A;  4DRX B;  4DK0 A;  1NAF A;  3NR7 A;  1SQV J;  1YYC A;  2IZ0 A;  3L71 H;  5KAI E;  5CN0 A;  5KX5 A;  1SQB K;  3RL0 D;  5IYZ B;  3VP9 A;  4NXN O;  1L4A C;  2P10 A;  5GTI H;  5EC2 C;  4BIO A;  1IBL O;  4O9B A;  4R50 A;  4KFM A;  1SQQ E;  3A0H H;  3NFQ A;  3LW5 H;  4XBF A;  3S3W A;  2KB1 A;  1J5E O;  4Q20 A;  2LJ2 A;  3UO3 A;  1YTZ T;  2Q7E A;  3CC7 V;  1MOF A;  4GOD A;  2KZI A;  5BU8 B;  3R65 A;  4YHH B;  1SFC B;  1VF5 D;  2PFX A;  1KYO F;  2AHY A;  2IBZ I;  4PV1 B;  1Y76 A;  2Y48 A;  2E43 A;  1KB9 E;  4TV9 A;  1IZ3 A;  1ZWI C;  3M91 A;  4ZOL B;  2OAR A;  5KKZ C;  1FXK B;  4J7J A;  3H1H D;  2YIB D;  5CBH A;  1XMO O;  1LTJ B;  3WU2 H;  1NTK H;  3H32 B;  1P84 E;  2UUB O;  4NXN B;  2QEX V;  1FJK A;  5JCO C;  3L75 J;  2ZVN B;  2HLO A;  2RN0 A;  3JAL A;  3R2P A;  3RFR A;  1L0L J;  2Y0D A;  3L37 A;  1QL1 A;  4IYH A;  4PI0 A;  1BS3 A;  4WB4 A;  3QVN A;  4U3F H;  1Y67 A;  4FM0 A;  2GA1 A;  4ZBM A;  1EXJ A;  4W7Y A;  1VQP P;  1SQQ K;  3FYI B;  3HD7 A;  4X64 B;  1IZN B;  5JJE B;  1OMI A;  1OJH A;  4H0L C;  1LWU B;  4BRY B;  1AQT A;  2QM4 A;  2C0X A;  4YXD C;  2N1T D;  4DRX A;  4A7P A;  1RP3 B;  1AI5 A;  4X66 O;  2UXC B;  4HB1 A;  4JPZ B;  1NJI Q;  3BCC G;  1KTM A;  1JY2 P;  2RDC A;  1YXB A;  2CH7 A;  5IYZ A;  4JPR A;  1FS0 E;  2OYO A;  3CCU V;  4DR2 B;  5EIB D;  2JO1 A;  2F4V B;  1JY3 P;  5B3S B;  2KSE A;  5ITZ B;  4U7O A;  2J5U A;  3G4S V;  1Z56 A;  3BAT A;  3ZRW B;  2OTJ V;  1SFC A;  3HUS A;  1H2M A;  1GU5 A;  5AW2 B;  4ASU G;  2IH3 C;  4GOE A;  1RF1 B;  3E86 A;  1URQ B;  1FXK A;  4PA7 A;  1J1E B;  1LGH B;  5FL7 G;  1LTJ A;  3H32 A;  1GN6 A;  3W68 A;  3SYO A;  1XDC A;  4PHZ A;  2UXB B;  2ZT9 C;  2A06 H;  4Q6G A;  1FJG O;  3BCC E;  3SWK A;  2EIN C;  1KB9 I;  1B06 A;  5LA6 B;  4F6R B;  3IN6 A;  5B66 E;  2IJJ A;  3ABK C;  4LGD E;  3ZJZ A;  2UUC B;  2FXO A;  1CEZ A;  3H1J D;  4P9P A;  3OUS A;  1N32 O;  1P84 I;  4X1I B;  4GKJ O;  2LW1 A;  2IJI A;  1Q7Y W;  4ASW A;  2K1A A;  3SPG A;  3L71 J;  1SQP D;  1LWU A;  3E8B A;  1M9N A;  2R3S A;  3H1I G;  4N6J A;  4BRY A;  2BOC C;  3G71 V;  1OWA A;  2H7H A;  2IBZ D;  4NYK A;  2EIJ C;  4OPH A;  1GMJ A;  3LW5 J;  3DXR B;  1GH6 A;  5KUM A;  3MAQ A;  1FJG B;  2W6J H;  4GUN A;  4P2Z A;  3AE2 C;  4IYI A;  3ZRS A;  2CTW A;  2HR3 A;  3BVO A;  4AIL C;  3IC7 A;  4WY4 C;  4LC1 A;  4LH7 A;  2PY5 A;  3ASN B;  1SQB D;  3ZHT A;  1JM0 A;  4TV8 B;  1YJ9 V;  2H3O A;  4PD4 E;  2E75 C;  3L72 D;  3ZRW A;  5KHJ A;  5HFM A;  4FM2 A;  1Y47 A;  1NTK J;  3SJQ C;  1X8Y A;  5CCG D;  3B8E B;  1Q82 W;  1I5X A;  3F7V C;  1X9V A;  1RF1 A;  2XT9 A;  1URQ A;  2NN4 A;  2R5D A;  1SES A;  3FFQ A;  2WA3 A;  3H1I E;  2GTA A;  2LXC B;  2XTA A;  4DV0 B;  3TNU B;  1YQ3 C;  1W59 A;  1MZE A;  5CMZ A;  4X20 B;  3T1H B;  4U3F J;  2QWP B;  2HHH B;  1GAX A;  1RPO A;  1RE4 A;  5KMG B;  2Q6Q A;  3N4X A;  3U10 A;  1OV9 A;  2DYS C;  2FKX A;  5LA6 A;  4F6R A;  3BA9 A;  4FLT A;  1QVF O;  1MG1 A;  1FZC B;  2KSD A;  1QLE B;  1W2B U;  2OQQ A;  2YIU B;  1HGZ A;  3JAR B;  5AVV B;  3HKB B;  3KYQ A;  1HJB A;  4X1I A;  1M57 B;  1OIP A;  1SQF A;  1VEW A;  2IFN A;  2GUZ B;  3ZHQ A;  3PLN A;  2P22 C;  4UB6 E;  4BW9 A;  1PFI A;  5L3B A;  5LYJ B;  1EC5 A;  3SR2 C;  2MKV A;  5KAI H;  2Q5Z A;  4H44 C;  4CS4 A;  3EHB B;  4LF6 O;  3IF4 A;  1Y8A A;  5LHI A;  1AV1 A;  1SQQ D;  1M90 Q;  1RH5 B;  1FXH A;  1M1K Q;  1PM9 A;  2Q68 A;  3DXR A;  5B1A B;  3AG2 C;  3LNN A;  2D2C B;  2P90 A;  1SQQ H;  2ZR2 A;  3RL0 C;  3RGB A;  2OCH A;  3UKM A;  2H43 A;  1F7Y A;  3SYC A;  2KZJ A;  3L74 G;  3ASO B;  2QJK C;  1R6K A;  2GHY A;  3OGC C;  3F5W C;  4O2B B;  1KB9 D;  2B9B A;  2N04 A;  4TV8 A;  4EEQ A;  5C8Y B;  4B3T B;  3CXH H;  1IO4 A;  2RJZ A;  3AE1 C;  1P84 D;  4OXS A;  1M1J B;  1VF5 C;  1KEC A;  2YXL A;  1Q90 D;  4MVO A;  3ETE A;  2KQX A;  2YXY A;  3UT5 B;  1L0N E;  2PAJ A;  1JVM A;  1YTZ I;  5KJ7 C;  1YJN V;  4I9W A;  1VQ7 V;  2QWO B;  3OMN B;  3SYA A;  1IBK B;  3NXS A;  1NTZ G;  3AG4 C;  1BDC A;  5C93 A;  4GX1 A;  1IFJ A;  4UCR A;  3DSQ A;  4DR3 O;  1YI2 V;  2QIW A;  4F6E A;  3TNU A;  2GTS A;  3L73 G;  2KP8 A;  2KS1 B;  1AIL A;  4X20 A;  2N9Y B;  4WFF A;  3LDD A;  2CAZ C;  5KMG A;  2GUV A;  1NQT A;  4J7K A;  3Q2Y A;  4AUW A;  2ZIM A;  4JYB A;  2CK3 G;  4F4L A;  4IOI H;  2BSK B;  1FZC A;  4D6T G;  1HUC A;  1VPC A;  3L74 E;  3JAR A;  2ZXW C;  1XUQ A;  1M5I A;  1ZR2 A;  3HKB A;  1SKV A;  1BGY G;  4H13 B;  3FGA D;  4MTG A;  5LYJ A;  3UM7 A;  1BE3 G;  4WFG A;  4ZHQ B;  3AE7 C;  2K37 A;  5D5P A;  1IUR A;  3HE4 B;  1KN7 A;  1SQX K;  1L0N K;  2FYU E;  3SFE C;  1NTZ E;  1VQ6 P;  2CDY A;  4K0K B;  2R9A A;  4JZG A;  2QVA A;  1DF5 A;  1XHX A;  1R3L C;  5EIB C;  1LUV A;  3L73 E;  1SQG A;  1JA8 A;  2CPB A;  1S1C X;  1FKA O;  1PGJ A;  1YJW V;  1BL8 A;  5APT A;  2JGU A;  4O2B A;  3AEF C;  3ITK A;  3AE6 C;  1S9K E;  3LIE A;  1GRJ A;  5C8Y A;  1Q81 Q;  4D6T E;  1SS1 A;  3K0G A;  2KLV A;  3M9Q A;  1M1J A;  3SPH A;  2PZS A;  2SPZ A;  2YIA A;  3UT5 A;  3IR9 A;  4JAU A;  1GL2 D;  3D36 A;  4WFB V; 
#chains in the Genus database with same CATH homology
 2FYN C;  1DD3 A;  2OQQ A;  1K05 A;  1ZRT E;  1KTM A;  4I7Z C;  2JP3 A;  1AJY A;  1PV3 A;  5M1B A;  2G3A A;  2WPV B;  3O6Q A;  3GLM A;  2JO1 A;  1KQG B;  1WMK A;  4Y28 J;  2MKV A;  1S5L X;  4H44 D;  4H44 C;  2J5U A;  2E76 B;  2WSE J;  4R4L A;  2FBW C;  3H25 A;  2WSC J;  2QJP C;  2QSI A;  4H0L D;  3G9R A;  4OGQ C;  4U7J A;  4TT3 H;  2D2C B;  3D70 A;  2K9Y A;  3B71 A;  4RKU J;  1UIX A;  3AEC C;  2E74 D;  3GF7 A;  3AE5 C;  2E74 C;  1PIX A;  3T97 B;  1IK7 A;  2QJK C;  1K04 A;  3Q5P A;  1KIL E;  1KOR A;  2WQY C;  2BEQ D;  3ABV C;  1RQU A;  4I7Z B;  4GDO A;  4KT0 J;  2E75 B;  3AEE C;  1FDO A;  3D6Y A;  2ZT9 C;  3GMA A;  3AE1 C;  4H13 D;  4H13 C;  1NYH A;  4PV1 D;  3AE9 C;  4PV1 C;  3IAO A;  1VF5 C;  5KLI C;  3D71 A;  1Q90 D;  1DIP A;  3IN6 A;  1EXI A;  1Y9B A;  3AE4 C;  2IDB A;  1OW6 A;  1U57 A;  4H44 B;  1PL5 A;  2G8Y A;  4OGQ D;  2QIW A;  2YIU C;  1FDI A;  1ZME C;  4H0L B;  1VL2 A;  5L8R J;  2P10 A;  3RK3 E;  1DD4 A;  1OW8 A;  3Q5R A;  2E74 B;  2O01 J;  3GF3 A;  3Q2Y A;  3D6Z A;  1R8E A;  1HF9 A;  3AED C;  2FXP A;  2E76 C;  1GMJ A;  1OW7 A;  1TU3 F;  3LW5 J;  2ZT9 D;  1ZOY C;  2H88 C;  1VF5 D;  3EWK A;  4H13 B;  4PV1 B;  3AE2 C;  2D2C C;  3S9O A;  1NGM B;  3FGA D;  2QJY C;  3Q1M A;  5KKZ C;  4YTP C;  3AE7 C;  3AEA C;  1KMI Z;  1ZP0 C;  1MKM A;  4OGQ B;  1KQF B;  3C8V A;  3RL0 g;  4Z1M H;  2YMK A;  3SFE C;  2E75 D;  3SFD C;  2E75 C;  1HJ0 A;  1YQ4 C;  3Q3D A;  3AE8 C;  1S1C X;  3AEG C;  4XFJ A;  2E76 D;  1EXJ A;  3Q5S A;  4R4M A;  2H89 C;  3AEF C;  3AE6 C;  1RQV A;  2ZT9 B;  1YQ3 C;  2V7Q J;  2D2C D;  1VF5 B;  3R4Y A;  1JB0 J;  1OMI A;  2WSF J;  4H0L C;  2NZ2 A;  2BEZ F;  3AE3 C;  4IL6 X;  4YXD C;  3AEB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...