2V7QJ

The structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
43
structure length
43
Chain Sequence
VRSSAGAVRDAGGAFGKREQAEEERYFRARAKEQLAALKKHHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM
publication title How the Regulatory Protein, If1, Inhibits F1- ATPase from Bovine Mitochondria.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 15
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2007-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.500 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2v7qJ00
4TT3H 2V7QJ 1HF9A 1GMJA 4Z1MH
chains in the Genus database with same CATH superfamily
1EDIA 5AW2B 1LTSC 4H0LC 3SWYA 3CC7P 3CC2P 1CI6A 2KB7P 3AECC 1OIPA 2B9BA 3MP7B 1KILE 4H44B 2RMZA 5GTIE 4N78D 1A02F 1GK6A 2D2CC 5KTBA 1JO5A 1LWUA 3VOPA 3AEFC 1NGMB 1JCCA 1H89A 1MZ9A 2RN0A 2IZ1A 3H1LG 1YQ3C 4GKGA 1SQPK 3IFMA 3C8VA 2Q6QA 1QX8A 2W6BA 1OW6A 1PFIA 1RF0C 1DIPA 1FDOA 2N9BA 5CCGC 1N8RQ 3PTZA 3H1KD 4WBAA 1L0LK 1QL1A 2QE7H 3B4SA 1PPJD 4U3FJ 3IR9A 3PHLA 1SP4A 3L70D 2ZJSE 1KYOH 2Y9ZA 4RESB 2Q5UA 4H0LB 3L75G 1VDFA 2YKPA 2OTLP 4U3FE 2YO3A 2KOGA 4Y99C 3TSIA 1VQNP 4WY4D 4Y28J 3EWKA 2D2CB 3GW6A 3P8MC 1HUCA 1VF5D 5KKZC 1LT9C 2A45G 1U57A 2HR3A 3TF5A 1KYOE 3VP8A 4AUWA 1LTJC 2Q7CA 2WPRA 2O1JA 3BRVB 2R3SA 1DD3A 4EYYQ 1BGYD 1N86A 3M9QA 1SQBD 5CHXA 2FFDA 5AVSB 1AVOA 1SVFA 3P32A 4W7YA 1S5LH 2WPSA 3G3ZA 1GL2A 5BU8B 2Q3IA 1N7SC 2E43A 1P84H 4PJ0H 1Q7YQ 3L70G 1FDMA 3Q5SA 3EFFK 2IBZI 2CPBA 1BSHA 3HE4A 4B86A 3GHGC 2WSSH 1HJ0A 3JC22 2K37A 4EOTA 4UB6H 3SFEC 3E7KA 1S1CX 1BE3D 2I1KA 2YKQA 3MTUE 3FXDA 2AEFA 3L36A 1ZLLA 5KKZB 1LTAC 1LT9B 1S5LE 3VYIA 3AE3C 2C9NY 3HD7D 1M1JA 3N7NA 1LTJB 3VMZA 1P84E 4PJ0E 1QEXA 1AA0A 3MHVA 2YO2A 4ZNCA 4LLHA 1PP9G 1QVGO 2WITA 3WU2H 3H32A 2WPVB 1FS0E 3FGAD 2ZXEB 2LXBA 4UB6E 1BGYG 1L4AB 1TU3F 2HG5D 1SQBG 3MGNA 1W5CE 3SWFA 1NYHA 1QLED 1JMBA 1NJIQ 1FZGA 3BATA 1NTKD 3JCUH 1M1KQ 5CMZA 4CPGA 1URQD 2PRRA 1EZVI 1ZXGA 1FC2C 3GHGB 4D6TD 4IL6X 2K3RA 3WU2E 2JWDA 1HGZA 3D70A 1NTZK 5H2FH 1RQVA 2QA4P 1VPCA 2HFED 5KJ7A 1FZCC 4DZOA 1L0LE 1J1EC 3QH9A 2IDBA 2C0WA 3JCUE 1BE3G 2K9JB 2PFXA 1OFCX 2KUBA 1D7MA 1CSBA 2NPSA 2H8PD 3KQGA 3MD0A 1NU1J 2I1JA 1T3UA 1FZEA 3H1LJ 1R5LA 3TNUB 2AXCA 3U1AA 2IFMA 4EDFA 5H2FE 3RL0D 2KNCA 1MV8A 2OYHC 1H0TB 5APYA 1LJ2A 2JDIH 2RH0A 2MJZA 2FY8A 1S9KD 2JP3A 1NKZB 1UIXA 3H1LE 2KSEA 2JEEA 1BCCD 1NTKG 3K5BA 2R44A 4H13C 1RE4A 2YIUC 1IFNA 2BEQD 5AVTB 3A3YB 4WY4A 1L0ND 2XKMA 1J1EB 3CCMP 4NPEA 4HJGH 2A45H 4GT1A 2QJYB 2B87A 3L75E 1OX3A 1NHLA 2K88A 1PGOA 2FXPA 3OJAB 1SQVD 3WMM0 2OYHB 2GUVA 3RBZA 3O8ZA 1EDLA 1VQKP 2ZVOB 3AEBC 1NAYA 3CLQA 3KYQA 3HUSB 3V4QA 4N78E 1X79B 5EFWB 1E79H 4K3AA 2WT7A 1KYOI 4H13B 2IFNA 5CCHA 2BASA 2KLUA 2V7QJ 2E42A 3H1KJ 2QJPC 2O3JA 3VP9A 1BCCG 4M3LA 1KILC 1W2EA 3M9HA 3RK3B 3L70J 1RE3C 1PGJA 3EFGA 3SFDC 4RKUJ 4JF7A 2GM4A 5CBNA 2PGDA 2Q9IA 3PLNA 3L70E 1FZAA 1EDJA 1OVRA 2P7JA 2E76D 2ZT9D 2K1AA 3RK3E 3GF3A 1FAVA 1Q82Q 2FYUD 3LW5H 2Q3EA 1YJWP 1LTTC 3EQ2A 1JMMA 4W7ZA 2R3CA 1JB0J 3B5NA 1SQVG 1U7MA 4WVZA 1GMJA 1MKMA 3CL3D 4IFFA 2VRSA 1EDKA 3LW5J 3V4WA 1BGYJ 4I2LC 1SQBJ 5GTIH 1P84I 2KI7B 3PP5A 1LTBC 2QJPB 3IF4A 4IFDK 3O6QB 1KILB 2W6AA 3T97B 4TLFA 3KXDA 2IZ0A 1BGYE 3CC4P 2G8YA 1MFZA 3L74J 1NTMD 1SFCC 1KV4A 1PGQA 1SQBE 2G3AA 2H7HA 3HTKA 1BDDA 3TDKA 3AEDC 2WSFH 5KAFH 2QIWA 2E5TA 2E74D 3P8CD 3KDPB 3R4YA 2ZYDA 2XDJA 3Q3DA 1IO4A 5KJ7D 1K73Q 3BCCD 1T8ZA 2WSFJ 1BE3J 1LT1A 1NAFA 5AVYB 3HD7B 1RY3A 1KN7A 4XA4A 1NU1G 2C9LY 1SQXD 3CXHD 3HE5B 2P67A 2L5GB 3NXSA 4HYTB 2NPSD 1RF0A 1BE3E 2R5DA 4Z1MH 5KAFE 5CCGA 2HPCB 3JSVC 1IFMA 3LIEA 1YJNP 2GA1A 2OTJP 3IAOA 3CCVP 1G2CB 1WMKA 2Q1KA 1HBWA 3AEGC 4QMAA 1X8YA 1SFCB 2LXCB 5AVZB 1NTKJ 1YHQP 3V2RA 2WTYA 5AW9B 3N4XA 1IJDB 2JWAA 3CCRP 2KK7A 4C7RA 3GLMA 1AVYA 4D6TJ 2M8RA 4IL6H 3RK2C 1NTKE 3RGUA 1LGHB 3H1JD 1LT9A 5L8RJ 4EIJA 1NU1K 1CI6B 1LTJA 4D6TE 3BCCG 3H1ID 2KS1B 5AW8B 2E75C 3H1HD 1SQXG 1SQQD 1HTLC 4KJMA 1LWUB 1T2KD 1BSNA 4IL6E 1Y9BA 2AEMA 1KQFB 3RL0B 4BWNA 1L4AC 2IYPA 2B89A 3FXEA 1S4XA 1N7SA 2I8DA 3ITKA 3L74D 3H1KG 3CX5D 3AEEC 2MKVA 1YJ9P 1PPJG 5TISH 1JY3N 2R32A 1NH4A 1JY2N 1S72P 1S3JA 1VQ8P 3GHGA 5CCHD 3USSA 1U7JA 5APVA 1BCCJ 3WUVA 3A5TA 4PV1D 3OW2O 3M06A 3RK2B 5KLIB 2A45I 1GL2C 3HRNA 1KQGB 1S9KE 2OYIC 2ITAA 2QRXA 4YXWH 1L0NJ 1HJBA 1BCCE 2K9JA 3RL0g 1L2PA 1NOHA 4OGQD 1EXIA 4H44D 3CCJP 5TISE 2M3BA 1VQ5P 2E75B 3GF7A 2N1TC 2P10A 3SSUA 4N6JA 4OH8B 1Y47A 1IC2A 1T3JA 2XNDH 3H1IG 3WUTA 3L35A 1M1JC 4PD4D 2Y0DA 2WSCH 1SQVJ 3TGUD 3B5ND 4GODA 1MUUA 1CZQA 4O9BA 1XTGB 1LNQA 5AW0B 1RQUA 2H88C 1HGVA 1RF1A 4YPCA 2FYZA 3V5BA 2YKOA 2KP8A 2WSCJ 4XFJA 3L74G 1SQVE 1NWQA 5APTA 1Q86Q 1KC8Q 1GL2B 4GOEA 4I6MC 2O01N 2XNXA 1FZCA 2OYIB 1ZP0C 4AQRD 4NPDA 4H0LD 5AVWB 5AW7B 3HE4B 2R5BA 2K9YA 2W83C 1AQ5A 3RBXA 2N1TB 1ZRTD 4DJGA 1KQSO 1KTMA 2D2CD 4KT0J 1FJPA 2QJYC 3NMDA 2HYNA 1YYCA 5CJ0A 1N2DC 3AE1C 1M1JB 2OYHA 2WWWA 1SQBK 3BRTB 2FYUJ 1JTHB 2OTKE 3L4FA 4BXLA 2XZRA 3A0HH 1CW5A 1NU1E 3B71A 4R4LA 5CCGD 5KLVD 1IFDA 3HUSC 1ZV8A 4MN4C 5AW5B 2HODA 3AEAC 1S5LX 3AE2C 2W6JH 1VQMP 5AW4B 1GW4A 1KB9D 2Z5IA 3PRJA 5DJUB 3TYYA 3AE8C 3Q5RA 4D6TG 3MIWA 2LR2A 4ASWA 3RK3C 1FOSE 3E1RA 4TT3H 1NTMJ 1Z56A 4C46A 3C9IA 3A0HE 3V2PA 4DCKA 4RJTA 4WY4C 2H43A 1A02J 1N7LA 3CXHH 4C7NA 1VF5C 3BCCJ 2IPPA 1PL5A 1GZLA 1IK7A 5AVUB 2FBWC 3AE9C 4BRYB 1SQXJ 1FE6A 1K8AQ 1Y8AA 2V7QH 2NPSB 3M0DC 2FXMA 2M3EA 1GTWA 1N73C 3BCCE 1NTKK 2Y9YA 2QVAA 1SQPD 5BU5A 2ZFCA 2KNCB 4OVNF 5KLVG 2FYNC 1OMIA 1SQXE 3CXHE 2H89C 2BEZF 1M57D 1KILA 1N7SD 2ZAEB 1RE3A 1L0LD 4ZKPA 1KFMA 2M5AB 3CMEP 1VQOP 2J58A 1HH0A 4JYBA 1FU1A 1HF9A 3CWBD 1YITP 1K05A 1QL2A 3L37A 4R4MA 4YXDC 1OZHA 3H1KE 1L0NG 1PPJE 2Y0EA 5CJ4A 1VQPP 4WY4B 1XTCC 2FKWB 3I55P 3ZDMA 2KZJA 4N3YB 4WB4A 1VF5B 3MUDC 3L71D 5DJTB 3H1JJ 3CPWO 2PP6A 3HD7C 1USEA 5B5EH 2SPZA 4WWIA 3H1IJ 1GDTA 1JM0A 1ZN5A 2HPCA 1N73B 3S1KA 1K04A 3A0BH 3NTNA 1OXZA 3H1HJ 5K5GB 1NO4A 4GDOA 1SQQJ 2FYNB 3CX5H 4AYCA 2YXRB 3H1IE 4L73A 2KXPB 1SQPG 3TK1A 1SFCA 2FXOA 4UB8H 3PH0A 1VQLP 2YMKA 4HKZH 4GOFA 5AVVB 1VQ7P 1R5SA 5B5EE 1SQQE 2WT7B 1QGKB 1URQC 2KYVA 3L72D 1L0NK 3CI9A 1FOSF 4DOJA 1LP1B 1JCDA 2ZVNB 2QM8A 2XV5A 3A0BE 2ZYGA 1AJYA 5APQA 3CWBG 3GG2A 2UWJE 2PAJA 3L74E 2POHA 3KPEA 3CX5E 3S4RA 1EXJA 4HB1A 3OAKA 5E79H 1J1DC 1H88A 2IBZD 3G6EP 3B8EB 4UB8E 3W67A 1KMIZ 4OGQB 3AE5C 5GTHH 2GUSA 3C1LA 3U59A 4L75A 1SQVK 2KS1A 3L71G 2YXQB 2W27A 2FYUG 5AVQB 1W2BO 3CCUP 4PD4H 5AVRB 4JQ0D 3V2NA 1LWUC 3FWLA 1X0TA 5AW3B 3SWKA 3CD6P 2Y0CA 3RL0C 3B5NB 1LTGC 5E79E 1VQ6P 1LTIC 1Q81Q 1ZMEC 3TGUJ 3BVHA 4OWFA 5KAIH 5GTHE 1URQB 2JJLA 4H13D 3VMYA 1NKNA 2RKLA 4PD4E 1IFPA 1NTMG 3TGUE 1E5WA 3L73D 3L72G 1YQ4C 3RK3D 5KLIC 2AEJA 3M9BA 3IN6A 1J1DB 4NPFX 1EZVD 3HTKB 2LKMA 2WQYC 1ZR4A 1NTZD 5AW1B 1AQTA 5KAIE 2FYUK 2IBZG 2N9YB 1X9VA 2A06D 2QSIA 1X22A 1KFNA 2IX7C 1PP9D 1VQ9P 2P58A 1L4AA 2W8ZA 5C39A 3G9RA 2BCCD 1EC5A 1ZRTE 1IK9A 3GMAA 5AVXB 3FX0A 1KB9H 1QVFO 3D71A 1WT6A 3R2PA 5KLVJ 3AE6C 1RHZB 4JYCA 4YTPC 2FFDC 1NTMK 3CCSP 1KILD 3P7KA 2AXTH 2P1JA 4IOIH 1BDCA 1KORA 5APWA 1M8OB 4LC1A 2OYIA 2DW3A 5KLVE 3V6IA 2IYOA 1PZQA 2Z4EA 3L73G 3Q5PA 4Y99B 3CXHI 1YTZI 1T6AA 1KB9E 1EZVG 2N1TA 3H1JG 3ABVC 1FZFA 1JUNA 1DH3A 3MZWB 1SLQA 1SQXK 2OYOA 1NTZG 1DEBA 4I1LA 1L0NE 2E76C 3KZIH 3M91A 2ZT9C 2AXTE 1DEEG 4I7ZC 3TNUA 1R8EA 3H1HG 2A06G 1H0TA 2WPQA 1G1JA 1IFJA 1IZNB 1SQQG 2O01H 1JTHA 3WUUA 3CCEP 1YIJP 1OW8A 1JY3P 1ZR2A 3W68A 1M90Q 1JY2P 3E1IA 3VMAA 5AW6B 5M1BA 3V2QA 4L74A 1NVOA 2WVRA 1DD4A 1HVVA 2O1KA 4U3FD 2BCCG 2FFDB 2O01J 1VQ4P 4ASVA 1HWTC 2WMMA 1MFTA 3II6A 1SQPJ 3KZIE 1N7SB 1H8AA 2KIKA 1SFCD 3CCQP 3G71P 1RF1C 1L0LJ 4L76A 1KYOD 1SQPE 5APXA 3VN0A 2WSEH 3CWBJ 5BVZA 1EQ7A 1KQLA 2E74C 2HLOA 1UIIA 2E76B 2ZT9B 5KJ7C 1GW3A 4LGDE 4I7ZB 1FJKA 4EI2A 3H25A 1PV3A 2WSEJ 2ZXXA 3CWBE 1SQQK 3L71J 2J5UA 2QG4A 4BRYA 4JBZA 4DT0A 3NFQA 2OQQA 3CX5I 3UIAA 3HUSA 2JKVA 2NPSC 3TGUG 3Q1MA 3PJSK 3H32B 3VMXA 3L71E 1GD2E 3G4SP 2C0XA 2FYUE 1USDA 5B66H 1S2EA 4U3FG 2J59M 2M5AA 1RF1B 1KD1Q 4XE5B 1PGPA 3OA7A 3CMAP 3D6ZA 1AV1A 1P84D 3RK2D 3L72J 2KZIA 2E74B 1RE4C 1FZCB 3L75J 1JY3O 2JR8A 1OVVA 2QJKC 5B66E 1JY2O 1RH5B 4A7PA 1GK4A 1NTME 3L72E 4PD4I 4GIFA 2ZYAA 2E75D 3P8CE 3M0DA 1OW7A 3I56P 3CCLP 4ZMDA 1N73A 4K35A 2Z5HA 4JPZB 1KZUB 3U1CA 1L4AD 1YBKA 1WRGA 2IBZE 1YI2P 1T2KC 1Q90D 2CK3H 1FZBA 2YMYA 1OWAA 3Q2YA 2P2UA 3O6QA 1JOCA 2E5YA 3T97A 2JO1A 2L91A 1JNMA 3I5CA 2HODB 2CPSA 2KLVA 3S9OA 1LP1A 1ZOYC 2YIUB 4W80A 1JEKA 4HH2A 1GL2D 5CCHC 1ZW0A 2XU6A 4PV1C 1G1IA 1FBMA 1SS1A 3KHUA 4IFMA 2NRGA 2QJKB 3L73J 1K9MQ 3MUDA 5APSA 5CBOA 2M0BA 1OVUA 1Q2NA 1YTZT 3HD7A 3M0AA 1IFIA 3HE5A 2V4HA 2N1TD 4OGQC 1NTZJ 3BASA 4H44C 1NU1D 1PIXA 3L73E 2B87B 1VL2A 1DX7A 1M56D 4RO0A 1GU5A 2YNYA 3H1LD 3F89A 4C7NB 3AE4C 1EZVE 3H1JE 3A7OA 2B88A 1AFOA 2OGUA 2WZ7A 3QWOC 5KLVK 5TJHA 1KB9I 1NTZE 1PP9J 1G2CA 2W90A 3B5NC 3H1HE 2BCCJ 1URQA 2A06E 4U7JA 3FWNA 1M7LA 3A2AA 4ZKUA 2QM7A 5APUA 2NZ2A 1PP9E 2KSJA 2OARA 4KHXA 3LIDA 1GU4A 3F5HA 3H6PA 2QEXP 1L0LG 1FDIA 3AE7C 3D6YA 3VTPC 4PV1B 3L75D 1J2JB 2BCCE
chains in the Genus database with same CATH topology
3AE3C 5M1BA 1VF5B 3S9OA 1ZP0C 3LW5J 1ZOYC 4H0LD 1DD4A 4Y28J 3AEGC 3G9RA 4PV1D 2O01J 3AEBC 4H0LC 3EWKA 1ZRTE 2K9YA 2D2CB 3AECC 3GMAA 4PV1C 1VF5D 5KKZC 1KQGB 3D6ZA 3D71A 3T97B 1KILE 1U57A 1VF5C 4H44B 3GLMA 1KTMA 3AE6C 1K04A 1PL5A 2D2CD 4H13B 4KT0J 2G8YA 4YTPC 1IK7A 2E74B 2FBWC 2QJYC 2WPVB 1ZMEC 3AE9C 2G3AA 3FGAD 4GDOA 2V7QJ 3RL0g 2D2CC 2JP3A 4OGQD 3AEDC 1EXIA 1DD3A 2QJPC 4H44D 3AEFC 1TU3F 1UIXA 1NGMB 2QIWA 3AE1C 2QJKC 4OGQC 4H13D 1KORA 2E75B 1NYHA 2E74D 2P10A 3GF7A 4H44C 1PIXA 5L8RJ 3R4YA 4H13C 1VL2A 2E74C 1YQ3C 2YIUC 3Q3DA 2YMKA 2BEQD 3C8VA 3Q5PA 3AE4C 2E75D 2FYNC 1OMIA 2E76B 1OW6A 1YQ4C 2ZT9B 2H89C 3SFDC 2BEZF 4RKUJ 2WSFJ 3B71A 4R4LA 5KLIC 1OW7A 1DIPA 4I7ZB 2E75C 3H25A 1PV3A 2WSEJ 1FDOA 3ABVC 4IL6X 3AEAC 3IN6A 1S5LX 3AE2C 2E76D 2J5UA 2WQYC 2ZT9D 1AJYA 3RK3E 1RQUA 1Y9BA 3GF3A 3Q5SA 3D70A 2E76C 1HF9A 1K05A 1RQVA 2ZT9C 1Q90D 1KQFB 2H88C 2OQQA 4R4MA 3AE8C 4I7ZC 4U7JA 4YXDC 4Z1MH 1EXJA 2WSCJ 3Q2YA 4XFJA 2IDBA 1R8EA 1HJ0A 3Q5RA 3O6QA 2NZ2A 3Q1MA 1FDIA 4H0LB 3SFEC 3AEEC 1JB0J 1S1CX 3AE7C 3D6YA 2MKVA 1KMIZ 2JO1A 2QSIA 3AE5C 4OGQB 4TT3H 1OW8A 4PV1B 2FXPA 1GMJA 1MKMA 3IAOA 1WMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TT3 H;  2V7Q J;  1HF9 A;  1GMJ A;  4Z1M H; 
#chains in the Genus database with same CATH topology
 1EDI A;  5AW2 B;  1LTS C;  4H0L C;  3SWY A;  3CC7 P;  3CC2 P;  1CI6 A;  2KB7 P;  3AEC C;  1OIP A;  2B9B A;  3MP7 B;  1KIL E;  4H44 B;  2RMZ A;  5GTI E;  4N78 D;  1A02 F;  1GK6 A;  2D2C C;  5KTB A;  1JO5 A;  1LWU A;  3VOP A;  3AEF C;  1NGM B;  1JCC A;  1H89 A;  1MZ9 A;  2RN0 A;  2IZ1 A;  3H1L G;  1YQ3 C;  4GKG A;  1SQP K;  3IFM A;  3C8V A;  2Q6Q A;  1QX8 A;  2W6B A;  1OW6 A;  1PFI A;  1RF0 C;  1DIP A;  1FDO A;  2N9B A;  5CCG C;  1N8R Q;  3PTZ A;  3H1K D;  4WBA A;  1L0L K;  1QL1 A;  2QE7 H;  3B4S A;  1PPJ D;  4U3F J;  3IR9 A;  3PHL A;  1SP4 A;  3L70 D;  2ZJS E;  1KYO H;  2Y9Z A;  4RES B;  2Q5U A;  4H0L B;  3L75 G;  1VDF A;  2YKP A;  2OTL P;  4U3F E;  2YO3 A;  2KOG A;  4Y99 C;  3TSI A;  1VQN P;  4WY4 D;  4Y28 J;  3EWK A;  2D2C B;  3GW6 A;  3P8M C;  1HUC A;  1VF5 D;  5KKZ C;  1LT9 C;  2A45 G;  1U57 A;  2HR3 A;  3TF5 A;  1KYO E;  3VP8 A;  4AUW A;  1LTJ C;  2Q7C A;  2WPR A;  2O1J A;  3BRV B;  2R3S A;  1DD3 A;  4EYY Q;  1BGY D;  1N86 A;  3M9Q A;  1SQB D;  5CHX A;  2FFD A;  5AVS B;  1AVO A;  1SVF A;  3P32 A;  4W7Y A;  1S5L H;  2WPS A;  3G3Z A;  1GL2 A;  5BU8 B;  2Q3I A;  1N7S C;  2E43 A;  1P84 H;  4PJ0 H;  1Q7Y Q;  3L70 G;  1FDM A;  3Q5S A;  3EFF K;  2IBZ I;  2CPB A;  1BSH A;  3HE4 A;  4B86 A;  3GHG C;  2WSS H;  1HJ0 A;  3JC2 2;  2K37 A;  4EOT A;  4UB6 H;  3SFE C;  3E7K A;  1S1C X;  1BE3 D;  2I1K A;  2YKQ A;  3MTU E;  3FXD A;  2AEF A;  3L36 A;  1ZLL A;  5KKZ B;  1LTA C;  1LT9 B;  1S5L E;  3VYI A;  3AE3 C;  2C9N Y;  3HD7 D;  1M1J A;  3N7N A;  1LTJ B;  3VMZ A;  1P84 E;  4PJ0 E;  1QEX A;  1AA0 A;  3MHV A;  2YO2 A;  4ZNC A;  4LLH A;  1PP9 G;  1QVG O;  2WIT A;  3WU2 H;  3H32 A;  2WPV B;  1FS0 E;  3FGA D;  2ZXE B;  2LXB A;  4UB6 E;  1BGY G;  1L4A B;  1TU3 F;  2HG5 D;  1SQB G;  3MGN A;  1W5C E;  3SWF A;  1NYH A;  1QLE D;  1JMB A;  1NJI Q;  1FZG A;  3BAT A;  1NTK D;  3JCU H;  1M1K Q;  5CMZ A;  4CPG A;  1URQ D;  2PRR A;  1EZV I;  1ZXG A;  1FC2 C;  3GHG B;  4D6T D;  4IL6 X;  2K3R A;  3WU2 E;  2JWD A;  1HGZ A;  3D70 A;  1NTZ K;  5H2F H;  1RQV A;  2QA4 P;  1VPC A;  2HFE D;  5KJ7 A;  1FZC C;  4DZO A;  1L0L E;  1J1E C;  3QH9 A;  2IDB A;  2C0W A;  3JCU E;  1BE3 G;  2K9J B;  2PFX A;  1OFC X;  2KUB A;  1D7M A;  1CSB A;  2NPS A;  2H8P D;  3KQG A;  3MD0 A;  1NU1 J;  2I1J A;  1T3U A;  1FZE A;  3H1L J;  1R5L A;  3TNU B;  2AXC A;  3U1A A;  2IFM A;  4EDF A;  5H2F E;  3RL0 D;  2KNC A;  1MV8 A;  2OYH C;  1H0T B;  5APY A;  1LJ2 A;  2JDI H;  2RH0 A;  2MJZ A;  2FY8 A;  1S9K D;  2JP3 A;  1NKZ B;  1UIX A;  3H1L E;  2KSE A;  2JEE A;  1BCC D;  1NTK G;  3K5B A;  2R44 A;  4H13 C;  1RE4 A;  2YIU C;  1IFN A;  2BEQ D;  5AVT B;  3A3Y B;  4WY4 A;  1L0N D;  2XKM A;  1J1E B;  3CCM P;  4NPE A;  4HJG H;  2A45 H;  4GT1 A;  2QJY B;  2B87 A;  3L75 E;  1OX3 A;  1NHL A;  2K88 A;  1PGO A;  2FXP A;  3OJA B;  1SQV D;  3WMM 0;  2OYH B;  2GUV A;  3RBZ A;  3O8Z A;  1EDL A;  1VQK P;  2ZVO B;  3AEB C;  1NAY A;  3CLQ A;  3KYQ A;  3HUS B;  3V4Q A;  4N78 E;  1X79 B;  5EFW B;  1E79 H;  4K3A A;  2WT7 A;  1KYO I;  4H13 B;  2IFN A;  5CCH A;  2BAS A;  2KLU A;  2V7Q J;  2E42 A;  3H1K J;  2QJP C;  2O3J A;  3VP9 A;  1BCC G;  4M3L A;  1KIL C;  1W2E A;  3M9H A;  3RK3 B;  3L70 J;  1RE3 C;  1PGJ A;  3EFG A;  3SFD C;  4RKU J;  4JF7 A;  2GM4 A;  5CBN A;  2PGD A;  2Q9I A;  3PLN A;  3L70 E;  1FZA A;  1EDJ A;  1OVR A;  2P7J A;  2E76 D;  2ZT9 D;  2K1A A;  3RK3 E;  3GF3 A;  1FAV A;  1Q82 Q;  2FYU D;  3LW5 H;  2Q3E A;  1YJW P;  1LTT C;  3EQ2 A;  1JMM A;  4W7Z A;  2R3C A;  1JB0 J;  3B5N A;  1SQV G;  1U7M A;  4WVZ A;  1GMJ A;  1MKM A;  3CL3 D;  4IFF A;  2VRS A;  1EDK A;  3LW5 J;  3V4W A;  1BGY J;  4I2L C;  1SQB J;  5GTI H;  1P84 I;  2KI7 B;  3PP5 A;  1LTB C;  2QJP B;  3IF4 A;  4IFD K;  3O6Q B;  1KIL B;  2W6A A;  3T97 B;  4TLF A;  3KXD A;  2IZ0 A;  1BGY E;  3CC4 P;  2G8Y A;  1MFZ A;  3L74 J;  1NTM D;  1SFC C;  1KV4 A;  1PGQ A;  1SQB E;  2G3A A;  2H7H A;  3HTK A;  1BDD A;  3TDK A;  3AED C;  2WSF H;  5KAF H;  2QIW A;  2E5T A;  2E74 D;  3P8C D;  3KDP B;  3R4Y A;  2ZYD A;  2XDJ A;  3Q3D A;  1IO4 A;  5KJ7 D;  1K73 Q;  3BCC D;  1T8Z A;  2WSF J;  1BE3 J;  1LT1 A;  1NAF A;  5AVY B;  3HD7 B;  1RY3 A;  1KN7 A;  4XA4 A;  1NU1 G;  2C9L Y;  1SQX D;  3CXH D;  3HE5 B;  2P67 A;  2L5G B;  3NXS A;  4HYT B;  2NPS D;  1RF0 A;  1BE3 E;  2R5D A;  4Z1M H;  5KAF E;  5CCG A;  2HPC B;  3JSV C;  1IFM A;  3LIE A;  1YJN P;  2GA1 A;  2OTJ P;  3IAO A;  3CCV P;  1G2C B;  1WMK A;  2Q1K A;  1HBW A;  3AEG C;  4QMA A;  1X8Y A;  1SFC B;  2LXC B;  5AVZ B;  1NTK J;  1YHQ P;  3V2R A;  2WTY A;  5AW9 B;  3N4X A;  1IJD B;  2JWA A;  3CCR P;  2KK7 A;  4C7R A;  3GLM A;  1AVY A;  4D6T J;  2M8R A;  4IL6 H;  3RK2 C;  1NTK E;  3RGU A;  1LGH B;  3H1J D;  1LT9 A;  5L8R J;  4EIJ A;  1NU1 K;  1CI6 B;  1LTJ A;  4D6T E;  3BCC G;  3H1I D;  2KS1 B;  5AW8 B;  2E75 C;  3H1H D;  1SQX G;  1SQQ D;  1HTL C;  4KJM A;  1LWU B;  1T2K D;  1BSN A;  4IL6 E;  1Y9B A;  2AEM A;  1KQF B;  3RL0 B;  4BWN A;  1L4A C;  2IYP A;  2B89 A;  3FXE A;  1S4X A;  1N7S A;  2I8D A;  3ITK A;  3L74 D;  3H1K G;  3CX5 D;  3AEE C;  2MKV A;  1YJ9 P;  1PPJ G;  5TIS H;  1JY3 N;  2R32 A;  1NH4 A;  1JY2 N;  1S72 P;  1S3J A;  1VQ8 P;  3GHG A;  5CCH D;  3USS A;  1U7J A;  5APV A;  1BCC J;  3WUV A;  3A5T A;  4PV1 D;  3OW2 O;  3M06 A;  3RK2 B;  5KLI B;  2A45 I;  1GL2 C;  3HRN A;  1KQG B;  1S9K E;  2OYI C;  2ITA A;  2QRX A;  4YXW H;  1L0N J;  1HJB A;  1BCC E;  2K9J A;  3RL0 g;  1L2P A;  1NOH A;  4OGQ D;  1EXI A;  4H44 D;  3CCJ P;  5TIS E;  2M3B A;  1VQ5 P;  2E75 B;  3GF7 A;  2N1T C;  2P10 A;  3SSU A;  4N6J A;  4OH8 B;  1Y47 A;  1IC2 A;  1T3J A;  2XND H;  3H1I G;  3WUT A;  3L35 A;  1M1J C;  4PD4 D;  2Y0D A;  2WSC H;  1SQV J;  3TGU D;  3B5N D;  4GOD A;  1MUU A;  1CZQ A;  4O9B A;  1XTG B;  1LNQ A;  5AW0 B;  1RQU A;  2H88 C;  1HGV A;  1RF1 A;  4YPC A;  2FYZ A;  3V5B A;  2YKO A;  2KP8 A;  2WSC J;  4XFJ A;  3L74 G;  1SQV E;  1NWQ A;  5APT A;  1Q86 Q;  1KC8 Q;  1GL2 B;  4GOE A;  4I6M C;  2O01 N;  2XNX A;  1FZC A;  2OYI B;  1ZP0 C;  4AQR D;  4NPD A;  4H0L D;  5AVW B;  5AW7 B;  3HE4 B;  2R5B A;  2K9Y A;  2W83 C;  1AQ5 A;  3RBX A;  2N1T B;  1ZRT D;  4DJG A;  1KQS O;  1KTM A;  2D2C D;  4KT0 J;  1FJP A;  2QJY C;  3NMD A;  2HYN A;  1YYC A;  5CJ0 A;  1N2D C;  3AE1 C;  1M1J B;  2OYH A;  2WWW A;  1SQB K;  3BRT B;  2FYU J;  1JTH B;  2OTK E;  3L4F A;  4BXL A;  2XZR A;  3A0H H;  1CW5 A;  1NU1 E;  3B71 A;  4R4L A;  5CCG D;  5KLV D;  1IFD A;  3HUS C;  1ZV8 A;  4MN4 C;  5AW5 B;  2HOD A;  3AEA C;  1S5L X;  3AE2 C;  2W6J H;  1VQM P;  5AW4 B;  1GW4 A;  1KB9 D;  2Z5I A;  3PRJ A;  5DJU B;  3TYY A;  3AE8 C;  3Q5R A;  4D6T G;  3MIW A;  2LR2 A;  4ASW A;  3RK3 C;  1FOS E;  3E1R A;  4TT3 H;  1NTM J;  1Z56 A;  4C46 A;  3C9I A;  3A0H E;  3V2P A;  4DCK A;  4RJT A;  4WY4 C;  2H43 A;  1A02 J;  1N7L A;  3CXH H;  4C7N A;  1VF5 C;  3BCC J;  2IPP A;  1PL5 A;  1GZL A;  1IK7 A;  5AVU B;  2FBW C;  3AE9 C;  4BRY B;  1SQX J;  1FE6 A;  1K8A Q;  1Y8A A;  2V7Q H;  2NPS B;  3M0D C;  2FXM A;  2M3E A;  1GTW A;  1N73 C;  3BCC E;  1NTK K;  2Y9Y A;  2QVA A;  1SQP D;  5BU5 A;  2ZFC A;  2KNC B;  4OVN F;  5KLV G;  2FYN C;  1OMI A;  1SQX E;  3CXH E;  2H89 C;  2BEZ F;  1M57 D;  1KIL A;  1N7S D;  2ZAE B;  1RE3 A;  1L0L D;  4ZKP A;  1KFM A;  2M5A B;  3CME P;  1VQO P;  2J58 A;  1HH0 A;  4JYB A;  1FU1 A;  1HF9 A;  3CWB D;  1YIT P;  1K05 A;  1QL2 A;  3L37 A;  4R4M A;  4YXD C;  1OZH A;  3H1K E;  1L0N G;  1PPJ E;  2Y0E A;  5CJ4 A;  1VQP P;  4WY4 B;  1XTC C;  2FKW B;  3I55 P;  3ZDM A;  2KZJ A;  4N3Y B;  4WB4 A;  1VF5 B;  3MUD C;  3L71 D;  5DJT B;  3H1J J;  3CPW O;  2PP6 A;  3HD7 C;  1USE A;  5B5E H;  2SPZ A;  4WWI A;  3H1I J;  1GDT A;  1JM0 A;  1ZN5 A;  2HPC A;  1N73 B;  3S1K A;  1K04 A;  3A0B H;  3NTN A;  1OXZ A;  3H1H J;  5K5G B;  1NO4 A;  4GDO A;  1SQQ J;  2FYN B;  3CX5 H;  4AYC A;  2YXR B;  3H1I E;  4L73 A;  2KXP B;  1SQP G;  3TK1 A;  1SFC A;  2FXO A;  4UB8 H;  3PH0 A;  1VQL P;  2YMK A;  4HKZ H;  4GOF A;  5AVV B;  1VQ7 P;  1R5S A;  5B5E E;  1SQQ E;  2WT7 B;  1QGK B;  1URQ C;  2KYV A;  3L72 D;  1L0N K;  3CI9 A;  1FOS F;  4DOJ A;  1LP1 B;  1JCD A;  2ZVN B;  2QM8 A;  2XV5 A;  3A0B E;  2ZYG A;  1AJY A;  5APQ A;  3CWB G;  3GG2 A;  2UWJ E;  2PAJ A;  3L74 E;  2POH A;  3KPE A;  3CX5 E;  3S4R A;  1EXJ A;  4HB1 A;  3OAK A;  5E79 H;  1J1D C;  1H88 A;  2IBZ D;  3G6E P;  3B8E B;  4UB8 E;  3W67 A;  1KMI Z;  4OGQ B;  3AE5 C;  5GTH H;  2GUS A;  3C1L A;  3U59 A;  4L75 A;  1SQV K;  2KS1 A;  3L71 G;  2YXQ B;  2W27 A;  2FYU G;  5AVQ B;  1W2B O;  3CCU P;  4PD4 H;  5AVR B;  4JQ0 D;  3V2N A;  1LWU C;  3FWL A;  1X0T A;  5AW3 B;  3SWK A;  3CD6 P;  2Y0C A;  3RL0 C;  3B5N B;  1LTG C;  5E79 E;  1VQ6 P;  1LTI C;  1Q81 Q;  1ZME C;  3TGU J;  3BVH A;  4OWF A;  5KAI H;  5GTH E;  1URQ B;  2JJL A;  4H13 D;  3VMY A;  1NKN A;  2RKL A;  4PD4 E;  1IFP A;  1NTM G;  3TGU E;  1E5W A;  3L73 D;  3L72 G;  1YQ4 C;  3RK3 D;  5KLI C;  2AEJ A;  3M9B A;  3IN6 A;  1J1D B;  4NPF X;  1EZV D;  3HTK B;  2LKM A;  2WQY C;  1ZR4 A;  1NTZ D;  5AW1 B;  1AQT A;  5KAI E;  2FYU K;  2IBZ G;  2N9Y B;  1X9V A;  2A06 D;  2QSI A;  1X22 A;  1KFN A;  2IX7 C;  1PP9 D;  1VQ9 P;  2P58 A;  1L4A A;  2W8Z A;  5C39 A;  3G9R A;  2BCC D;  1EC5 A;  1ZRT E;  1IK9 A;  3GMA A;  5AVX B;  3FX0 A;  1KB9 H;  1QVF O;  3D71 A;  1WT6 A;  3R2P A;  5KLV J;  3AE6 C;  1RHZ B;  4JYC A;  4YTP C;  2FFD C;  1NTM K;  3CCS P;  1KIL D;  3P7K A;  2AXT H;  2P1J A;  4IOI H;  1BDC A;  1KOR A;  5APW A;  1M8O B;  4LC1 A;  2OYI A;  2DW3 A;  5KLV E;  3V6I A;  2IYO A;  1PZQ A;  2Z4E A;  3L73 G;  3Q5P A;  4Y99 B;  3CXH I;  1YTZ I;  1T6A A;  1KB9 E;  1EZV G;  2N1T A;  3H1J G;  3ABV C;  1FZF A;  1JUN A;  1DH3 A;  3MZW B;  1SLQ A;  1SQX K;  2OYO A;  1NTZ G;  1DEB A;  4I1L A;  1L0N E;  2E76 C;  3KZI H;  3M91 A;  2ZT9 C;  2AXT E;  1DEE G;  4I7Z C;  3TNU A;  1R8E A;  3H1H G;  2A06 G;  1H0T A;  2WPQ A;  1G1J A;  1IFJ A;  1IZN B;  1SQQ G;  2O01 H;  1JTH A;  3WUU A;  3CCE P;  1YIJ P;  1OW8 A;  1JY3 P;  1ZR2 A;  3W68 A;  1M90 Q;  1JY2 P;  3E1I A;  3VMA A;  5AW6 B;  5M1B A;  3V2Q A;  4L74 A;  1NVO A;  2WVR A;  1DD4 A;  1HVV A;  2O1K A;  4U3F D;  2BCC G;  2FFD B;  2O01 J;  1VQ4 P;  4ASV A;  1HWT C;  2WMM A;  1MFT A;  3II6 A;  1SQP J;  3KZI E;  1N7S B;  1H8A A;  2KIK A;  1SFC D;  3CCQ P;  3G71 P;  1RF1 C;  1L0L J;  4L76 A;  1KYO D;  1SQP E;  5APX A;  3VN0 A;  2WSE H;  3CWB J;  5BVZ A;  1EQ7 A;  1KQL A;  2E74 C;  2HLO A;  1UII A;  2E76 B;  2ZT9 B;  5KJ7 C;  1GW3 A;  4LGD E;  4I7Z B;  1FJK A;  4EI2 A;  3H25 A;  1PV3 A;  2WSE J;  2ZXX A;  3CWB E;  1SQQ K;  3L71 J;  2J5U A;  2QG4 A;  4BRY A;  4JBZ A;  4DT0 A;  3NFQ A;  2OQQ A;  3CX5 I;  3UIA A;  3HUS A;  2JKV A;  2NPS C;  3TGU G;  3Q1M A;  3PJS K;  3H32 B;  3VMX A;  3L71 E;  1GD2 E;  3G4S P;  2C0X A;  2FYU E;  1USD A;  5B66 H;  1S2E A;  4U3F G;  2J59 M;  2M5A A;  1RF1 B;  1KD1 Q;  4XE5 B;  1PGP A;  3OA7 A;  3CMA P;  3D6Z A;  1AV1 A;  1P84 D;  3RK2 D;  3L72 J;  2KZI A;  2E74 B;  1RE4 C;  1FZC B;  3L75 J;  1JY3 O;  2JR8 A;  1OVV A;  2QJK C;  5B66 E;  1JY2 O;  1RH5 B;  4A7P A;  1GK4 A;  1NTM E;  3L72 E;  4PD4 I;  4GIF A;  2ZYA A;  2E75 D;  3P8C E;  3M0D A;  1OW7 A;  3I56 P;  3CCL P;  4ZMD A;  1N73 A;  4K35 A;  2Z5H A;  4JPZ B;  1KZU B;  3U1C A;  1L4A D;  1YBK A;  1WRG A;  2IBZ E;  1YI2 P;  1T2K C;  1Q90 D;  2CK3 H;  1FZB A;  2YMY A;  1OWA A;  3Q2Y A;  2P2U A;  3O6Q A;  1JOC A;  2E5Y A;  3T97 A;  2JO1 A;  2L91 A;  1JNM A;  3I5C A;  2HOD B;  2CPS A;  2KLV A;  3S9O A;  1LP1 A;  1ZOY C;  2YIU B;  4W80 A;  1JEK A;  4HH2 A;  1GL2 D;  5CCH C;  1ZW0 A;  2XU6 A;  4PV1 C;  1G1I A;  1FBM A;  1SS1 A;  3KHU A;  4IFM A;  2NRG A;  2QJK B;  3L73 J;  1K9M Q;  3MUD A;  5APS A;  5CBO A;  2M0B A;  1OVU A;  1Q2N A;  1YTZ T;  3HD7 A;  3M0A A;  1IFI A;  3HE5 A;  2V4H A;  2N1T D;  4OGQ C;  1NTZ J;  3BAS A;  4H44 C;  1NU1 D;  1PIX A;  3L73 E;  2B87 B;  1VL2 A;  1DX7 A;  1M56 D;  4RO0 A;  1GU5 A;  2YNY A;  3H1L D;  3F89 A;  4C7N B;  3AE4 C;  1EZV E;  3H1J E;  3A7O A;  2B88 A;  1AFO A;  2OGU A;  2WZ7 A;  3QWO C;  5KLV K;  5TJH A;  1KB9 I;  1NTZ E;  1PP9 J;  1G2C A;  2W90 A;  3B5N C;  3H1H E;  2BCC J;  1URQ A;  2A06 E;  4U7J A;  3FWN A;  1M7L A;  3A2A A;  4ZKU A;  2QM7 A;  5APU A;  2NZ2 A;  1PP9 E;  2KSJ A;  2OAR A;  4KHX A;  3LID A;  1GU4 A;  3F5H A;  3H6P A;  2QEX P;  1L0L G;  1FDI A;  3AE7 C;  3D6Y A;  3VTP C;  4PV1 B;  3L75 D;  1J2J B;  2BCC E; 
#chains in the Genus database with same CATH homology
 3AE3 C;  5M1B A;  1VF5 B;  3S9O A;  1ZP0 C;  3LW5 J;  1ZOY C;  4H0L D;  1DD4 A;  4Y28 J;  3AEG C;  3G9R A;  4PV1 D;  2O01 J;  3AEB C;  4H0L C;  3EWK A;  1ZRT E;  2K9Y A;  2D2C B;  3AEC C;  3GMA A;  4PV1 C;  1VF5 D;  5KKZ C;  1KQG B;  3D6Z A;  3D71 A;  3T97 B;  1KIL E;  1U57 A;  1VF5 C;  4H44 B;  3GLM A;  1KTM A;  3AE6 C;  1K04 A;  1PL5 A;  2D2C D;  4H13 B;  4KT0 J;  2G8Y A;  4YTP C;  1IK7 A;  2E74 B;  2FBW C;  2QJY C;  2WPV B;  1ZME C;  3AE9 C;  2G3A A;  3FGA D;  4GDO A;  2V7Q J;  3RL0 g;  2D2C C;  2JP3 A;  4OGQ D;  3AED C;  1EXI A;  1DD3 A;  2QJP C;  4H44 D;  3AEF C;  1TU3 F;  1UIX A;  1NGM B;  2QIW A;  3AE1 C;  2QJK C;  4OGQ C;  4H13 D;  1KOR A;  2E75 B;  1NYH A;  2E74 D;  2P10 A;  3GF7 A;  4H44 C;  1PIX A;  5L8R J;  3R4Y A;  4H13 C;  1VL2 A;  2E74 C;  1YQ3 C;  2YIU C;  3Q3D A;  2YMK A;  2BEQ D;  3C8V A;  3Q5P A;  3AE4 C;  2E75 D;  2FYN C;  1OMI A;  2E76 B;  1OW6 A;  1YQ4 C;  2ZT9 B;  2H89 C;  3SFD C;  2BEZ F;  4RKU J;  2WSF J;  3B71 A;  4R4L A;  5KLI C;  1OW7 A;  1DIP A;  4I7Z B;  2E75 C;  3H25 A;  1PV3 A;  2WSE J;  1FDO A;  3ABV C;  4IL6 X;  3AEA C;  3IN6 A;  1S5L X;  3AE2 C;  2E76 D;  2J5U A;  2WQY C;  2ZT9 D;  1AJY A;  3RK3 E;  1RQU A;  1Y9B A;  3GF3 A;  3Q5S A;  3D70 A;  2E76 C;  1HF9 A;  1K05 A;  1RQV A;  2ZT9 C;  1Q90 D;  1KQF B;  2H88 C;  2OQQ A;  4R4M A;  3AE8 C;  4I7Z C;  4U7J A;  4YXD C;  4Z1M H;  1EXJ A;  2WSC J;  3Q2Y A;  4XFJ A;  2IDB A;  1R8E A;  1HJ0 A;  3Q5R A;  3O6Q A;  2NZ2 A;  3Q1M A;  1FDI A;  4H0L B;  3SFE C;  3AEE C;  1JB0 J;  1S1C X;  3AE7 C;  3D6Y A;  2MKV A;  1KMI Z;  2JO1 A;  2QSI A;  3AE5 C;  4OGQ B;  4TT3 H;  1OW8 A;  4PV1 B;  2FXP A;  1GMJ A;  1MKM A;  3IAO A;  1WMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...