2V7QJ

The structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
43
structure length
43
Chain Sequence
VRSSAGAVRDAGGAFGKREQAEEERYFRARAKEQLAALKKHHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM
publication title How the Regulatory Protein, If1, Inhibits F1- ATPase from Bovine Mitochondria.
pubmed doi rcsb
source organism Bos taurus
total genus 15
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2007-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.500 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2v7qJ00
1HF9A 4TT3H 2V7QJ 1GMJA 4Z1MH
chains in the Genus database with same CATH superfamily
1KFMA 1MV8A 3I5CA 1Q2NA 3H1IG 4IFDK 3CMAP 1YBKA 1RE3C 1KYOE 2A06E 2OYIC 1IFNA 1NU1D 2WPSA 2HG5D 2OTLP 1VF5C 1NH4A 4B86A 1QL2A 2LXBA 1N73A 5KKZB 1HWTC 3V5BA 2E43A 3KPEA 1ZW0A 1FDIA 1EDLA 1FZEA 1N86A 2E5TA 1SQBK 2Q3EA 1QLED 1U7JA 2QJPB 2WSFH 1SFCB 4WY4C 2IBZI 4Z1MH 1J1DB 1LWUB 4L74A 1GDTA 2K1AA 5CCGA 1EZVE 3O6QB 3H6PA 1EQ7A 3WU2H 3B71A 1JMBA 3CWBD 3RGUA 1VQ7P 2IBZG 2GUVA 1T2KD 3RK3E 2XKMA 1L0LD 1SQVG 1BE3G 4EIJA 2FYZA 3BVHA 1PPJG 5KLIC 1JY2P 1CSBA 1FZBA 2M5AA 1K9MQ 2MKVA 5KLVE 2QVAA 1XTCC 2WSEH 2QIWA 2ZYAA 2WSSH 2KZJA 3EWKA 2WZ7A 1RE4A 4H13D 2JO1A 3VMAA 4Y99B 3KDPB 1A02J 2GM4A 1FOSE 3PLNA 2L91A 3H1IJ 1IK7A 3HTKA 1KYOI 1GL2D 3PP5A 3TDKA 2M8RA 1FJPA 2NRGA 2HODA 1JM0A 2OQQA 2E75D 5CBNA 2A06G 2K9JA 1FE6A 1Y8AA 1GL2A 1JY2O 1OVUA 1MUUA 2N1TD 2QEXP 1JY2N 3L72E 1NO4A 2GUSA 1NTME 2H88C 1SLQA 2RH0A 1M7LA 2HPCB 3A0HE 1GU5A 1ZRTE 5DJTB 1D7MA 4H0LD 1OMIA 2QM8A 1Q82Q 2H7HA 4IL6E 2N1TA 1G1JA 1USDA 3N4XA 1L4AB 1H88A 1EZVI 1N2DC 5AW7B 1L0NG 4LC1A 2K37A 2YKPA 1NU1E 1EZVG 1RF0A 2YXRB 1VQKP 2E42A 2WT7B 1N7SD 2E74C 4BXLA 2C0WA 1SQVJ 1OFCX 1BE3J 3LW5J 2Z5HA 2OYHC 1X8YA 2C9LY 3CX5D 1BDDA 2KIKA 1N7SA 3L71G 2QM7A 1W2EA 5KLVG 2YXQB 1AVYA 2LKMA 2CK3H 5KJ7D 3SWKA 3H1ID 2V4HA 3E7KA 3AE2C 3UIAA 3CWBE 3GHGC 3V2NA 1VQ5P 2W6JH 3RBXA 3HE5A 5B66H 1Q90D 1VQMP 1NGMB 1KQGB 1L0LE 2L5GB 1VF5B 1AQTA 1IK9A 1QL1A 1LT9B 1JB0J 3AE6C 2QJKB 1GZLA 4C7NA 1VQOP 2C0XA 3MZWB 4O9BA 3SWYA 3GF7A 1HVVA 3CMEP 1T3UA 3L72G 2IYOA 1RH5B 1NTMG 2D2CD 1HGVA 1AJYA 1IC2A 2PFXA 4OGQD 1E5WA 2KSEA 2Q1KA 1RQUA 3FGAD 1L0NJ 3I56P 3CCUP 3AEAC 2HYNA 1SQXK 1M8OB 1LGHB 1BCCG 2J5UA 3B4SA 2E5YA 3KYQA 1PPJD 3GF3A 2AXCA 3HD7B 5AVQB 2P67A 4D6TD 2ZT9D 2MJZA 2XV5A 2W27A 3L71J 2YO2A 5DJUB 2QJPC 2WSCH 5KLVJ 2QRXA 1SFCC 1LTJB 1HJBA 3A0BE 1KD1Q 4C46A 1NTKG 1Y9BA 1KQLA 1LWUC 4BRYB 5BVZA 1NHLA 3RK2B 5AW2B 5GTHE 2NPSD 1X9VA 4JBZA 4IL6H 2J58A 1SQPK 1NTZD 1QVFO 3AEEC 3GMAA 2Z4EA 2JR8A 2KUBA 3D6ZA 1L0LG 1PP9G 3W67A 2NPSA 4TT3H 3CX5E 2O1KA 5TISE 1YTZT 3V2QA 3H25A 5C39A 1ZV8A 3L72J 3MUDA 1NTMJ 3B5NA 1OWAA 3H1IE 2ZAEB 4Y99C 1NKNA 4AUWA 1Z56A 1L0ND 2RKLA 2W6BA 4I2LC 5AVSB 1UIXA 2YO3A 3CC4P 1SQQK 1OXZA 1BCCJ 3KHUA 1KC8Q 1H0TA 3MGNA 3IR9A 1NU1J 3MTUE 1GTWA 3L4FA 1M90Q 1URQD 4WVZA 1S5LX 2WPQA 3RK3B 2W6AA 4Y28J 3AE8C 1J1EC 3L71D 4L75A 1URQB 3R4YA 3AEDC 1ZN5A 1DEBA 1JO5A 1L4AC 1NTKJ 1LTAC 3U1CA 4U3FG 3BASA 1WT6A 4PD4D 2FXPA 5CCHD 4YPCA 4K35A 1NOHA 3C9IA 2QE7H 2ZXXA 2E76D 3A7OA 3VN0A 4XA4A 1PPJE 2Y9YA 2WTYA 3TNUA 3CX5I 1AVOA 2FYNB 2YIUB 4D6TE 1KB9D 1L0LJ 1PP9J 5CCHA 3B8EB 4GOFA 3Q3DA 5K5GB 1L2PA 2IPPA 2FYUK 2O3JA 1KILD 1HF9A 5GTIE 1VQ8P 3H32B 2PGDA 4AQRD 1K73Q 2WITA 5KAIE 4OH8B 1FAVA 1FZCB 1X22A 4HH2A 3P7KA 1KILA 2A45G 3V2PA 1SVFA 1LTGC 2WVRA 1OW6A 4KHXA 1DEEG 2IX7C 1BCCD 3C1LA 1AFOA 5APWA 1NTZE 1N73B 1MFZA 3JC22 3NMDA 1LT9C 1NKZB 2KLVA 3CCVP 3GW6A 3VMZA 4JYCA 2QJKC 1JY3P 5GTHH 3C8VA 1M1JA 5CCGD 2WMMA 4UB6E 3M0DC 1NTKD 1GW3A 1KV4A 1DIPA 3SSUA 5KTBA 1JCDA 2Q9IA 1L0NE 1JTHB 4U3FJ 4MN4C 3RL0D 5AVWB 1ZOYC 5TJHA 2KB7P 3HUSA 5AVZB 3KQGA 4DZOA 2W90A 2UWJE 1PP9D 2M5AB 4UB8E 1SQXD 1JY3O 3HD7C 1LNQA 4NPDA 3CPWO 3L71E 1JY3N 4D6TG 3MD0A 1FZFA 3MIWA 1ZLLA 2O01N 3CCEP 2ZT9C 2PP6A 1LTJC 3BCCG 1FU1A 3CXHD 1RY3A 1K04A 1RF1B 1R5LA 3CCRP 2Q7CA 4PD4E 4H13B 3HE4A 4RO0A 5AVUB 2P1JA 3RK2C 1FDOA 2HODB 2AXTE 1N8RQ 4ZKPA 2K9JB 2BEZF 2O01J 1GL2B 3BRTB 5AW3B 1W5CE 1KB9E 1NTZG 3CCMP 1SP4A 2E75B 2RN0A 1KILE 5CJ0A 1PV3A 5E79H 1S9KD 1J1EB 3KZIH 2JDIH 3LW5H 2M0BA 3D70A 2N1TB 4N6JA 2FFDA 5APSA 1DD4A 3MHVA 5KLVK 4PJ0E 1WRGA 4U3FD 2ZFCA 1YTZI 4H0LB 3U1AA 2R5BA 1U7MA 3D6YA 1MKMA 1BCCE 2GA1A 3VP9A 1GD2E 1LTBC 3R2PA 1M56D 3WUVA 5CJ4A 5AVRB 1DH3A 5AW0B 2XNDH 5BU8B 1YJ9P 1CZQA 1IFDA 1L4AA 2IYPA 3H1LD 5APXA 3RK3C 1N7SB 1VQLP 5AVVB 4JQ0D 1KYOH 4D6TJ 1URQC 1YQ3C 3L35A 1X0TA 1YITP 1T3JA 1KQFB 4JYBA 1NTKE 2H89C 3NFQA 3BCCJ 5APVA 2HR3A 3TGUG 2KS1A 1NTMK 4PD4I 2CPBA 2WT7A 5B5EE 3HE5B 3CLQA 3V2RA 3VYIA 3M9BA 3CC7P 2FXOA 2BASA 1WMKA 2ZJSE 1FZAA 3G9RA 2HFED 1KB9I 4WBAA 1YI2P 1PP9E 3GLMA 2Y0CA 1T6AA 3WMM0 1EXJA 1SQXE 3SWFA 4C7NB 1NTZJ 2FYNC 2YIUC 1NU1K 1NWQA 1S1CX 1T8ZA 3K5BA 4ASVA 3ZDMA 1RE3A 1HBWA 1FZCC 3CXHE 2P58A 2OYIA 2FYUD 3G3ZA 3AEGC 5BU5A 1BSNA 3CI9A 4PV1D 2JKVA 1BGYD 2D2CB 4WY4D 1G2CA 3H1HD 4OGQB 5AW4B 4PV1B 1NAFA 1KMIZ 2CPSA 5CHXA 2YMKA 1N73C 1PGQA 1S72P 2WPRA 4WY4A 1BDCA 1YYCA 1VQ4P 3II6A 1IJDB 1LTIC 4WB4A 1S9KE 3CCLP 1OVRA 1XTGB 3BCCD 2YKQA 2ZT9B 1RQVA 3TGUJ 1CI6A 4U3FE 3AECC 3E1IA 5CCGC 2AEMA 3OAKA 1SQBD 2KNCA 1YJWP 4EYYQ 3AE1C 2R32A 3A0HH 1AV1A 1EDKA 4GT1A 5AW5B 2XNXA 1VPCA 4H44D 1J2JB 3G4SP 3FXDA 1PL5A 2NPSB 2QSIA 1SQQE 3LIDA 1USEA 1T2KC 2PRRA 1ZMEC 2I8DA 4EDFA 3EQ2A 3H1LE 1HTLC 3Q1MA 3Q5RA 3B5ND 2DW3A 1SQXG 3JSVC 3L74G 2YMYA 4HYTB 3CXHI 1RE4C 1EXIA 1JMMA 3B5NB 3RL0g 1OW7A 2ITAA 4QMAA 4HB1A 3A3YB 1RF1C 4DOJA 2Q3IA 1R8EA 3I55P 4LLHA 2V7QJ 2KOGA 1VDFA 3TF5A 4H13C 1KQSO 1VQPP 3CD6P 3T97A 4GIFA 2R3SA 3WU2E 4GDOA 1FDMA 1H0TB 1GL2C 1PGPA 1SS1A 3L73G 2KXPB 2E75C 2E74D 1SQPG 1YJNP 2N1TC 3TGUD 2QA4P 5AW1B 2M3BA 1EC5A 2FYUE 2FY8A 3S4RA 1IO4A 2H8PD 1BGYE 4H0LC 3H1HE 1JEKA 2OYHA 1RF0C 4RKUJ 3GG2A 5H2FE 3L36A 1N7LA 1HUCA 1LTTC 1K8AQ 2G3AA 2Y9ZA 1PFIA 4R4LA 2E76B 2ZXEB 4IOIH 1LP1B 2BCCG 2IZ1A 1SQQG 1N7SC 1SQXJ 3L74J 2WQYC 3BCCE 1E79H 3H1LG 3GHGA 1P84D 2Y0EA 2H43A 1IFPA 2W8ZA 2A45I 2OGUA 2YNYA 3N7NA 4IL6X 1M1KQ 1CW5A 1KILB 5AW9B 4GKGA 1SQBE 1Q7YQ 2K9YA 2FBWC 4GOEA 1S2EA 2B87A 3W68A 4EOTA 4A7PA 3AEBC 1NVOA 5KJ7C 4I1LA 3IAOA 2PAJA 2N9BA 3H1KG 3OA7A 3A0BH 2B9BA 2QG4A 2J59M 1VQNP 2QJYC 3CL3D 1QGKB 4C7RA 1DX7A 4JF7A 2JJLA 4ASWA 3L73J 1HH0A 2LXCB 1M1JB 1SQVK 1YIJP 5APTA 1LTSC 3L70D 3P8CD 1SQPJ 2WPVB 1UIIA 3M91A 3G71P 4KT0J 1GMJA 2K3RA 3FXEA 3CX5H 2FYUG 2OTJP 2WWWA 1VQ9P 1PIXA 2D2CC 5TISH 2NZ2A 3TK1A 1SFCD 2JWAA 5AW8B 3HUSB 4OGQC 3P32A 3FX0A 4PV1C 1BGYG 3VP8A 3OJAB 3M06A 3H1HG 3RL0B 5B66E 2A45H 1FZGA 3IF4A 1JCCA 1SFCA 2G8YA 4L73A 3L74D 1NTZK 1JTHA 2ZYGA 1LWUA 2BCCJ 2O01H 1SQQJ 1QEXA 3O6QA 3TGUE 3H1LJ 5APYA 3V4WA 4N3YB 4DT0A 4R4MA 1PGOA 2IFNA 1JUNA 1S3JA 3JCUE 3IN6A 2P10A 4RJTA 3HE4B 1NAYA 4CPGA 1S5LE 3H1JG 3HTKB 2WSFJ 1M57D 1SQBG 3L75D 1ZXGA 4DCKA 3TYYA 3VMYA 1L0NK 2KI7B 3H1KJ 4L76A 1G1IA 3AE3C 1ZP0C 2NPSC 3L73D 3NTNA 1RF1A 4H44C 2KK7A 1SQPD 1IFJA 5H2FH 1P84E 3QWOC 2FFDB 3MUDC 4W7YA 3BATA 1S4XA 3B5NC 1IZNB 2P7JA 1LJ2A 2R44A 2IDBA 3VMXA 4M3LA 2WSEJ 1GU4A 4HKZH 2XZRA 1RHZB 2FYUJ 2JP3A 3V6IA 4I7ZB 5M1BA 3NXSA 4EI2A 5GTIH 1L4AD 1U57A 1BGYJ 3H1HJ 5AVXB 5KAIH 4XE5B 1KZUB 2HPCA 1NYHA 2Y0DA 2ZVNB 5KAFE 3PH0A 1Q86Q 2BCCD 4RESB 2OYOA 1SQQD 1FOSF 1JOCA 1PZQA 3M9HA 3L70E 3P8CE 2W83C 1ZR4A 4BWNA 3Q2YA 1QX8A 2KS1B 3PRJA 2ZYDA 1NJIQ 1X79B 4JPZB 4K3AA 3H1JJ 2LR2A 2BEQD 3CCSP 1SQBJ 2OARA 3H1KD 5AVTB 4UB6H 1K05A 3CCQP 1DD3A 4ZKUA 4XFJA 1KTMA 4N78D 5CCHC 2QJYB 2R3CA 4TLFA 3L74E 1HJ0A 2E76C 1P84I 4WWIA 3U59A 2FKWB 1YQ4C 1FS0E 3EFFK 1VF5D 5KJ7A 2OYIB 3P8MC 3LIEA 1KILC 2KSJA 4UB8H 1G2CB 2AEFA 1W2BO 3PJSK 1NTKK 3L75E 1LT9A 2XDJA 3CCJP 1QVGO 2Q6QA 3Q5SA 1PGJA 3USSA 1MFTA 3JCUH 4OWFA 4IFFA 4WY4B 3BRVB 3L73E 3VTPC 3M0DA 5CBOA 1FC2C 1S5LH 2I1KA 1Y47A 5AW6B 2HLOA 1R5SA 3L37A 5APQA 3WUTA 1MZ9A 4PD4H 2C9NY 3AEFC 2N9YB 1SQPE 2IBZD 1M1JC 1TU3F 1LT1A 1L0LK 2P2UA 3HRNA 2AXTH 4AYCA 1CI6B 1AA0A 3L70G 3HD7D 1SQVD 1BE3D 1NU1G 1KB9H 2KNCB 2YKOA 3H1JD 3M0AA 5KKZC 3ABVC 3IFMA 5KLIB 1P84H 3FWNA 4GODA 1OZHA 3HD7A 1HGZA 3HUSC 1EDIA 3VOPA 3Q5PA 1IFMA 2I1JA 2POHA 2V7QH 3F89A 3RL0C 1AQ5A 3PTZA 4NPFX 3O8ZA 3WUUA 4PJ0H 3AE9C 3RK2D 1J1DC 2FXMA 1LTJA 2BCCE 2B89A 4YXWH 1KFNA 2KLUA 5EFWB 2JEEA 4H44B 2JWDA 3CC2P 2ZVOB 3G6EP 4YTPC 4BRYA 3CWBG 1KYOD 2A06D 5APUA 5KAFH 1GK4A 4NPEA 1GK6A 4KJMA 3T97B 2WSCJ 1OW8A 3MP7B 1JNMA 2Q5UA 3H1KE 4U7JA 2IZ0A 3L75G 3V4QA 3SFEC 4N78E 4DJGA 5L8RJ 5B5EH 1GW4A 3S9OA 4ZMDA 1KN7A 3F5HA 2K88A 1EZVD 2FFDC 4HJGH 4OVNF 3FWLA 3L70J 1VL2A 3A5TA 1EDJA 2XU6A 3RK3D 3EFGA 2E74B 2O1JA 3ITKA 5CMZA 3S1KA 2RMZA 1OX3A 3AE7C 1Q81Q 4I6MC 5AVYB 2OYHB 1KORA 1VQ6P 4I7ZC 5KLVD 2B88A 4W7ZA 1OIPA 2AEJA 3CXHH 1URQA 3E1RA 1A02F 3AE5C 3TNUB 3PHLA 3OW2O 2R5DA 2IBZE 3M9QA 2KP8A 2IFMA 1YHQP 1OVVA 1H89A 3GHGB 1FBMA 4W80A 2OTKE 1H8AA 1ZR2A 2KZIA 5E79E 3KZIE 1SQVE 1BE3E 4IFMA 3CWBJ 2SPZA 3H1JE 2M3EA 4LGDE 3RBZA 3TSIA 2B87B 2KYVA 4YXDC 3QH9A 1IFIA 2VRSA 1LP1A 3L72D 1BSHA 1NTMD 3KXDA 4ZNCA 3L75J 1ZRTD 1FJKA 3H32A 3SFDC 3D71A 3AE4C 2Z5IA 3A2AA 1FZCA
chains in the Genus database with same CATH topology
3FGAD 1VL2A 4KT0J 1ZMEC 3LW5J 2QIWA 1GMJA 4RKUJ 3AEAC 3EWKA 1HF9A 3Q1MA 3Q5RA 2E74B 3D6YA 1MKMA 4H13D 2JO1A 1HJ0A 2J5UA 1PIXA 2D2CC 3Q5PA 2NZ2A 3AEGC 3AE7C 2E76C 4OGQC 2G3AA 2IDBA 1KORA 4PV1D 1EXIA 1YQ4C 4PV1C 2WSEJ 1UIXA 4I7ZC 2D2CB 4R4LA 1VF5D 3RL0g 3GF3A 1OW7A 3AE9C 1VF5C 2E76B 1IK7A 4OGQB 2ZT9D 2JP3A 4PV1B 2ZT9C 4I7ZB 1KMIZ 5M1BA 2WQYC 4H44B 1R8EA 1OW6A 2YMKA 4XFJA 2V7QJ 1U57A 3AE5C 4YTPC 1K04A 2G8YA 4H13C 3AE2C 1FDIA 2QJPC 1YQ3C 2OQQA 4IL6X 1S5LX 2E75D 1KQFB 4Y28J 4GDOA 4H13B 2H89C 1NYHA 3O6QA 3AE8C 1Y9BA 3Q5SA 4R4MA 1FDOA 1Q90D 2K9YA 1NGMB 1KQGB 3R4YA 2FBWC 3AEDC 4Z1MH 3IN6A 2H88C 3AEBC 1VF5B 2QJKC 3T97B 2WSCJ 1OW8A 2P10A 2BEZF 1ZRTE 1JB0J 2ZT9B 3C8VA 2O01J 4H0LD 1OMIA 3AE6C 1RQVA 3IAOA 3Q2YA 2WSFJ 1WMKA 2E75C 3B71A 4U7JA 3AECC 3G9RA 2QJYC 3AEFC 2E74D 3AEEC 3GMAA 1TU3F 3SFEC 2FXPA 4YXDC 1DIPA 3RK3E 2E75B 1KILE 1PV3A 3AE1C 3GF7A 5L8RJ 3GLMA 3D6ZA 4TT3H 2D2CD 1EXJA 3D70A 1AJYA 2E76D 2FYNC 2YIUC 3S9OA 3AE3C 2BEQD 4OGQD 1ZP0C 4H0LC 1ZOYC 5KLIC 2WPVB 1DD4A 3SFDC 2MKVA 4H44D 3H25A 3D71A 1S1CX 4H44C 1K05A 3ABVC 5KKZC 1DD3A 1PL5A 3AE4C 3Q3DA 2QSIA 4H0LB 2E74C 1KTMA 1RQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HF9 A;  4TT3 H;  2V7Q J;  1GMJ A;  4Z1M H; 
#chains in the Genus database with same CATH topology
 1KFM A;  1MV8 A;  3I5C A;  1Q2N A;  3H1I G;  4IFD K;  3CMA P;  1YBK A;  1RE3 C;  1KYO E;  2A06 E;  2OYI C;  1IFN A;  1NU1 D;  2WPS A;  2HG5 D;  2OTL P;  1VF5 C;  1NH4 A;  4B86 A;  1QL2 A;  2LXB A;  1N73 A;  5KKZ B;  1HWT C;  3V5B A;  2E43 A;  3KPE A;  1ZW0 A;  1FDI A;  1EDL A;  1FZE A;  1N86 A;  2E5T A;  1SQB K;  2Q3E A;  1QLE D;  1U7J A;  2QJP B;  2WSF H;  1SFC B;  4WY4 C;  2IBZ I;  4Z1M H;  1J1D B;  1LWU B;  4L74 A;  1GDT A;  2K1A A;  5CCG A;  1EZV E;  3O6Q B;  3H6P A;  1EQ7 A;  3WU2 H;  3B71 A;  1JMB A;  3CWB D;  3RGU A;  1VQ7 P;  2IBZ G;  2GUV A;  1T2K D;  3RK3 E;  2XKM A;  1L0L D;  1SQV G;  1BE3 G;  4EIJ A;  2FYZ A;  3BVH A;  1PPJ G;  5KLI C;  1JY2 P;  1CSB A;  1FZB A;  2M5A A;  1K9M Q;  2MKV A;  5KLV E;  2QVA A;  1XTC C;  2WSE H;  2QIW A;  2ZYA A;  2WSS H;  2KZJ A;  3EWK A;  2WZ7 A;  1RE4 A;  4H13 D;  2JO1 A;  3VMA A;  4Y99 B;  3KDP B;  1A02 J;  2GM4 A;  1FOS E;  3PLN A;  2L91 A;  3H1I J;  1IK7 A;  3HTK A;  1KYO I;  1GL2 D;  3PP5 A;  3TDK A;  2M8R A;  1FJP A;  2NRG A;  2HOD A;  1JM0 A;  2OQQ A;  2E75 D;  5CBN A;  2A06 G;  2K9J A;  1FE6 A;  1Y8A A;  1GL2 A;  1JY2 O;  1OVU A;  1MUU A;  2N1T D;  2QEX P;  1JY2 N;  3L72 E;  1NO4 A;  2GUS A;  1NTM E;  2H88 C;  1SLQ A;  2RH0 A;  1M7L A;  2HPC B;  3A0H E;  1GU5 A;  1ZRT E;  5DJT B;  1D7M A;  4H0L D;  1OMI A;  2QM8 A;  1Q82 Q;  2H7H A;  4IL6 E;  2N1T A;  1G1J A;  1USD A;  3N4X A;  1L4A B;  1H88 A;  1EZV I;  1N2D C;  5AW7 B;  1L0N G;  4LC1 A;  2K37 A;  2YKP A;  1NU1 E;  1EZV G;  1RF0 A;  2YXR B;  1VQK P;  2E42 A;  2WT7 B;  1N7S D;  2E74 C;  4BXL A;  2C0W A;  1SQV J;  1OFC X;  1BE3 J;  3LW5 J;  2Z5H A;  2OYH C;  1X8Y A;  2C9L Y;  3CX5 D;  1BDD A;  2KIK A;  1N7S A;  3L71 G;  2QM7 A;  1W2E A;  5KLV G;  2YXQ B;  1AVY A;  2LKM A;  2CK3 H;  5KJ7 D;  3SWK A;  3H1I D;  2V4H A;  3E7K A;  3AE2 C;  3UIA A;  3CWB E;  3GHG C;  3V2N A;  1VQ5 P;  2W6J H;  3RBX A;  3HE5 A;  5B66 H;  1Q90 D;  1VQM P;  1NGM B;  1KQG B;  1L0L E;  2L5G B;  1VF5 B;  1AQT A;  1IK9 A;  1QL1 A;  1LT9 B;  1JB0 J;  3AE6 C;  2QJK B;  1GZL A;  4C7N A;  1VQO P;  2C0X A;  3MZW B;  4O9B A;  3SWY A;  3GF7 A;  1HVV A;  3CME P;  1T3U A;  3L72 G;  2IYO A;  1RH5 B;  1NTM G;  2D2C D;  1HGV A;  1AJY A;  1IC2 A;  2PFX A;  4OGQ D;  1E5W A;  2KSE A;  2Q1K A;  1RQU A;  3FGA D;  1L0N J;  3I56 P;  3CCU P;  3AEA C;  2HYN A;  1SQX K;  1M8O B;  1LGH B;  1BCC G;  2J5U A;  3B4S A;  2E5Y A;  3KYQ A;  1PPJ D;  3GF3 A;  2AXC A;  3HD7 B;  5AVQ B;  2P67 A;  4D6T D;  2ZT9 D;  2MJZ A;  2XV5 A;  2W27 A;  3L71 J;  2YO2 A;  5DJU B;  2QJP C;  2WSC H;  5KLV J;  2QRX A;  1SFC C;  1LTJ B;  1HJB A;  3A0B E;  1KD1 Q;  4C46 A;  1NTK G;  1Y9B A;  1KQL A;  1LWU C;  4BRY B;  5BVZ A;  1NHL A;  3RK2 B;  5AW2 B;  5GTH E;  2NPS D;  1X9V A;  4JBZ A;  4IL6 H;  2J58 A;  1SQP K;  1NTZ D;  1QVF O;  3AEE C;  3GMA A;  2Z4E A;  2JR8 A;  2KUB A;  3D6Z A;  1L0L G;  1PP9 G;  3W67 A;  2NPS A;  4TT3 H;  3CX5 E;  2O1K A;  5TIS E;  1YTZ T;  3V2Q A;  3H25 A;  5C39 A;  1ZV8 A;  3L72 J;  3MUD A;  1NTM J;  3B5N A;  1OWA A;  3H1I E;  2ZAE B;  4Y99 C;  1NKN A;  4AUW A;  1Z56 A;  1L0N D;  2RKL A;  2W6B A;  4I2L C;  5AVS B;  1UIX A;  2YO3 A;  3CC4 P;  1SQQ K;  1OXZ A;  1BCC J;  3KHU A;  1KC8 Q;  1H0T A;  3MGN A;  3IR9 A;  1NU1 J;  3MTU E;  1GTW A;  3L4F A;  1M90 Q;  1URQ D;  4WVZ A;  1S5L X;  2WPQ A;  3RK3 B;  2W6A A;  4Y28 J;  3AE8 C;  1J1E C;  3L71 D;  4L75 A;  1URQ B;  3R4Y A;  3AED C;  1ZN5 A;  1DEB A;  1JO5 A;  1L4A C;  1NTK J;  1LTA C;  3U1C A;  4U3F G;  3BAS A;  1WT6 A;  4PD4 D;  2FXP A;  5CCH D;  4YPC A;  4K35 A;  1NOH A;  3C9I A;  2QE7 H;  2ZXX A;  2E76 D;  3A7O A;  3VN0 A;  4XA4 A;  1PPJ E;  2Y9Y A;  2WTY A;  3TNU A;  3CX5 I;  1AVO A;  2FYN B;  2YIU B;  4D6T E;  1KB9 D;  1L0L J;  1PP9 J;  5CCH A;  3B8E B;  4GOF A;  3Q3D A;  5K5G B;  1L2P A;  2IPP A;  2FYU K;  2O3J A;  1KIL D;  1HF9 A;  5GTI E;  1VQ8 P;  3H32 B;  2PGD A;  4AQR D;  1K73 Q;  2WIT A;  5KAI E;  4OH8 B;  1FAV A;  1FZC B;  1X22 A;  4HH2 A;  3P7K A;  1KIL A;  2A45 G;  3V2P A;  1SVF A;  1LTG C;  2WVR A;  1OW6 A;  4KHX A;  1DEE G;  2IX7 C;  1BCC D;  3C1L A;  1AFO A;  5APW A;  1NTZ E;  1N73 B;  1MFZ A;  3JC2 2;  3NMD A;  1LT9 C;  1NKZ B;  2KLV A;  3CCV P;  3GW6 A;  3VMZ A;  4JYC A;  2QJK C;  1JY3 P;  5GTH H;  3C8V A;  1M1J A;  5CCG D;  2WMM A;  4UB6 E;  3M0D C;  1NTK D;  1GW3 A;  1KV4 A;  1DIP A;  3SSU A;  5KTB A;  1JCD A;  2Q9I A;  1L0N E;  1JTH B;  4U3F J;  4MN4 C;  3RL0 D;  5AVW B;  1ZOY C;  5TJH A;  2KB7 P;  3HUS A;  5AVZ B;  3KQG A;  4DZO A;  2W90 A;  2UWJ E;  1PP9 D;  2M5A B;  4UB8 E;  1SQX D;  1JY3 O;  3HD7 C;  1LNQ A;  4NPD A;  3CPW O;  3L71 E;  1JY3 N;  4D6T G;  3MD0 A;  1FZF A;  3MIW A;  1ZLL A;  2O01 N;  3CCE P;  2ZT9 C;  2PP6 A;  1LTJ C;  3BCC G;  1FU1 A;  3CXH D;  1RY3 A;  1K04 A;  1RF1 B;  1R5L A;  3CCR P;  2Q7C A;  4PD4 E;  4H13 B;  3HE4 A;  4RO0 A;  5AVU B;  2P1J A;  3RK2 C;  1FDO A;  2HOD B;  2AXT E;  1N8R Q;  4ZKP A;  2K9J B;  2BEZ F;  2O01 J;  1GL2 B;  3BRT B;  5AW3 B;  1W5C E;  1KB9 E;  1NTZ G;  3CCM P;  1SP4 A;  2E75 B;  2RN0 A;  1KIL E;  5CJ0 A;  1PV3 A;  5E79 H;  1S9K D;  1J1E B;  3KZI H;  2JDI H;  3LW5 H;  2M0B A;  3D70 A;  2N1T B;  4N6J A;  2FFD A;  5APS A;  1DD4 A;  3MHV A;  5KLV K;  4PJ0 E;  1WRG A;  4U3F D;  2ZFC A;  1YTZ I;  4H0L B;  3U1A A;  2R5B A;  1U7M A;  3D6Y A;  1MKM A;  1BCC E;  2GA1 A;  3VP9 A;  1GD2 E;  1LTB C;  3R2P A;  1M56 D;  3WUV A;  5CJ4 A;  5AVR B;  1DH3 A;  5AW0 B;  2XND H;  5BU8 B;  1YJ9 P;  1CZQ A;  1IFD A;  1L4A A;  2IYP A;  3H1L D;  5APX A;  3RK3 C;  1N7S B;  1VQL P;  5AVV B;  4JQ0 D;  1KYO H;  4D6T J;  1URQ C;  1YQ3 C;  3L35 A;  1X0T A;  1YIT P;  1T3J A;  1KQF B;  4JYB A;  1NTK E;  2H89 C;  3NFQ A;  3BCC J;  5APV A;  2HR3 A;  3TGU G;  2KS1 A;  1NTM K;  4PD4 I;  2CPB A;  2WT7 A;  5B5E E;  3HE5 B;  3CLQ A;  3V2R A;  3VYI A;  3M9B A;  3CC7 P;  2FXO A;  2BAS A;  1WMK A;  2ZJS E;  1FZA A;  3G9R A;  2HFE D;  1KB9 I;  4WBA A;  1YI2 P;  1PP9 E;  3GLM A;  2Y0C A;  1T6A A;  3WMM 0;  1EXJ A;  1SQX E;  3SWF A;  4C7N B;  1NTZ J;  2FYN C;  2YIU C;  1NU1 K;  1NWQ A;  1S1C X;  1T8Z A;  3K5B A;  4ASV A;  3ZDM A;  1RE3 A;  1HBW A;  1FZC C;  3CXH E;  2P58 A;  2OYI A;  2FYU D;  3G3Z A;  3AEG C;  5BU5 A;  1BSN A;  3CI9 A;  4PV1 D;  2JKV A;  1BGY D;  2D2C B;  4WY4 D;  1G2C A;  3H1H D;  4OGQ B;  5AW4 B;  4PV1 B;  1NAF A;  1KMI Z;  2CPS A;  5CHX A;  2YMK A;  1N73 C;  1PGQ A;  1S72 P;  2WPR A;  4WY4 A;  1BDC A;  1YYC A;  1VQ4 P;  3II6 A;  1IJD B;  1LTI C;  4WB4 A;  1S9K E;  3CCL P;  1OVR A;  1XTG B;  3BCC D;  2YKQ A;  2ZT9 B;  1RQV A;  3TGU J;  1CI6 A;  4U3F E;  3AEC C;  3E1I A;  5CCG C;  2AEM A;  3OAK A;  1SQB D;  2KNC A;  1YJW P;  4EYY Q;  3AE1 C;  2R32 A;  3A0H H;  1AV1 A;  1EDK A;  4GT1 A;  5AW5 B;  2XNX A;  1VPC A;  4H44 D;  1J2J B;  3G4S P;  3FXD A;  1PL5 A;  2NPS B;  2QSI A;  1SQQ E;  3LID A;  1USE A;  1T2K C;  2PRR A;  1ZME C;  2I8D A;  4EDF A;  3EQ2 A;  3H1L E;  1HTL C;  3Q1M A;  3Q5R A;  3B5N D;  2DW3 A;  1SQX G;  3JSV C;  3L74 G;  2YMY A;  4HYT B;  3CXH I;  1RE4 C;  1EXI A;  1JMM A;  3B5N B;  3RL0 g;  1OW7 A;  2ITA A;  4QMA A;  4HB1 A;  3A3Y B;  1RF1 C;  4DOJ A;  2Q3I A;  1R8E A;  3I55 P;  4LLH A;  2V7Q J;  2KOG A;  1VDF A;  3TF5 A;  4H13 C;  1KQS O;  1VQP P;  3CD6 P;  3T97 A;  4GIF A;  2R3S A;  3WU2 E;  4GDO A;  1FDM A;  1H0T B;  1GL2 C;  1PGP A;  1SS1 A;  3L73 G;  2KXP B;  2E75 C;  2E74 D;  1SQP G;  1YJN P;  2N1T C;  3TGU D;  2QA4 P;  5AW1 B;  2M3B A;  1EC5 A;  2FYU E;  2FY8 A;  3S4R A;  1IO4 A;  2H8P D;  1BGY E;  4H0L C;  3H1H E;  1JEK A;  2OYH A;  1RF0 C;  4RKU J;  3GG2 A;  5H2F E;  3L36 A;  1N7L A;  1HUC A;  1LTT C;  1K8A Q;  2G3A A;  2Y9Z A;  1PFI A;  4R4L A;  2E76 B;  2ZXE B;  4IOI H;  1LP1 B;  2BCC G;  2IZ1 A;  1SQQ G;  1N7S C;  1SQX J;  3L74 J;  2WQY C;  3BCC E;  1E79 H;  3H1L G;  3GHG A;  1P84 D;  2Y0E A;  2H43 A;  1IFP A;  2W8Z A;  2A45 I;  2OGU A;  2YNY A;  3N7N A;  4IL6 X;  1M1K Q;  1CW5 A;  1KIL B;  5AW9 B;  4GKG A;  1SQB E;  1Q7Y Q;  2K9Y A;  2FBW C;  4GOE A;  1S2E A;  2B87 A;  3W68 A;  4EOT A;  4A7P A;  3AEB C;  1NVO A;  5KJ7 C;  4I1L A;  3IAO A;  2PAJ A;  2N9B A;  3H1K G;  3OA7 A;  3A0B H;  2B9B A;  2QG4 A;  2J59 M;  1VQN P;  2QJY C;  3CL3 D;  1QGK B;  4C7R A;  1DX7 A;  4JF7 A;  2JJL A;  4ASW A;  3L73 J;  1HH0 A;  2LXC B;  1M1J B;  1SQV K;  1YIJ P;  5APT A;  1LTS C;  3L70 D;  3P8C D;  1SQP J;  2WPV B;  1UII A;  3M91 A;  3G71 P;  4KT0 J;  1GMJ A;  2K3R A;  3FXE A;  3CX5 H;  2FYU G;  2OTJ P;  2WWW A;  1VQ9 P;  1PIX A;  2D2C C;  5TIS H;  2NZ2 A;  3TK1 A;  1SFC D;  2JWA A;  5AW8 B;  3HUS B;  4OGQ C;  3P32 A;  3FX0 A;  4PV1 C;  1BGY G;  3VP8 A;  3OJA B;  3M06 A;  3H1H G;  3RL0 B;  5B66 E;  2A45 H;  1FZG A;  3IF4 A;  1JCC A;  1SFC A;  2G8Y A;  4L73 A;  3L74 D;  1NTZ K;  1JTH A;  2ZYG A;  1LWU A;  2BCC J;  2O01 H;  1SQQ J;  1QEX A;  3O6Q A;  3TGU E;  3H1L J;  5APY A;  3V4W A;  4N3Y B;  4DT0 A;  4R4M A;  1PGO A;  2IFN A;  1JUN A;  1S3J A;  3JCU E;  3IN6 A;  2P10 A;  4RJT A;  3HE4 B;  1NAY A;  4CPG A;  1S5L E;  3H1J G;  3HTK B;  2WSF J;  1M57 D;  1SQB G;  3L75 D;  1ZXG A;  4DCK A;  3TYY A;  3VMY A;  1L0N K;  2KI7 B;  3H1K J;  4L76 A;  1G1I A;  3AE3 C;  1ZP0 C;  2NPS C;  3L73 D;  3NTN A;  1RF1 A;  4H44 C;  2KK7 A;  1SQP D;  1IFJ A;  5H2F H;  1P84 E;  3QWO C;  2FFD B;  3MUD C;  4W7Y A;  3BAT A;  1S4X A;  3B5N C;  1IZN B;  2P7J A;  1LJ2 A;  2R44 A;  2IDB A;  3VMX A;  4M3L A;  2WSE J;  1GU4 A;  4HKZ H;  2XZR A;  1RHZ B;  2FYU J;  2JP3 A;  3V6I A;  4I7Z B;  5M1B A;  3NXS A;  4EI2 A;  5GTI H;  1L4A D;  1U57 A;  1BGY J;  3H1H J;  5AVX B;  5KAI H;  4XE5 B;  1KZU B;  2HPC A;  1NYH A;  2Y0D A;  2ZVN B;  5KAF E;  3PH0 A;  1Q86 Q;  2BCC D;  4RES B;  2OYO A;  1SQQ D;  1FOS F;  1JOC A;  1PZQ A;  3M9H A;  3L70 E;  3P8C E;  2W83 C;  1ZR4 A;  4BWN A;  3Q2Y A;  1QX8 A;  2KS1 B;  3PRJ A;  2ZYD A;  1NJI Q;  1X79 B;  4JPZ B;  4K3A A;  3H1J J;  2LR2 A;  2BEQ D;  3CCS P;  1SQB J;  2OAR A;  3H1K D;  5AVT B;  4UB6 H;  1K05 A;  3CCQ P;  1DD3 A;  4ZKU A;  4XFJ A;  1KTM A;  4N78 D;  5CCH C;  2QJY B;  2R3C A;  4TLF A;  3L74 E;  1HJ0 A;  2E76 C;  1P84 I;  4WWI A;  3U59 A;  2FKW B;  1YQ4 C;  1FS0 E;  3EFF K;  1VF5 D;  5KJ7 A;  2OYI B;  3P8M C;  3LIE A;  1KIL C;  2KSJ A;  4UB8 H;  1G2C B;  2AEF A;  1W2B O;  3PJS K;  1NTK K;  3L75 E;  1LT9 A;  2XDJ A;  3CCJ P;  1QVG O;  2Q6Q A;  3Q5S A;  1PGJ A;  3USS A;  1MFT A;  3JCU H;  4OWF A;  4IFF A;  4WY4 B;  3BRV B;  3L73 E;  3VTP C;  3M0D A;  5CBO A;  1FC2 C;  1S5L H;  2I1K A;  1Y47 A;  5AW6 B;  2HLO A;  1R5S A;  3L37 A;  5APQ A;  3WUT A;  1MZ9 A;  4PD4 H;  2C9N Y;  3AEF C;  2N9Y B;  1SQP E;  2IBZ D;  1M1J C;  1TU3 F;  1LT1 A;  1L0L K;  2P2U A;  3HRN A;  2AXT H;  4AYC A;  1CI6 B;  1AA0 A;  3L70 G;  3HD7 D;  1SQV D;  1BE3 D;  1NU1 G;  1KB9 H;  2KNC B;  2YKO A;  3H1J D;  3M0A A;  5KKZ C;  3ABV C;  3IFM A;  5KLI B;  1P84 H;  3FWN A;  4GOD A;  1OZH A;  3HD7 A;  1HGZ A;  3HUS C;  1EDI A;  3VOP A;  3Q5P A;  1IFM A;  2I1J A;  2POH A;  2V7Q H;  3F89 A;  3RL0 C;  1AQ5 A;  3PTZ A;  4NPF X;  3O8Z A;  3WUU A;  4PJ0 H;  3AE9 C;  3RK2 D;  1J1D C;  2FXM A;  1LTJ A;  2BCC E;  2B89 A;  4YXW H;  1KFN A;  2KLU A;  5EFW B;  2JEE A;  4H44 B;  2JWD A;  3CC2 P;  2ZVO B;  3G6E P;  4YTP C;  4BRY A;  3CWB G;  1KYO D;  2A06 D;  5APU A;  5KAF H;  1GK4 A;  4NPE A;  1GK6 A;  4KJM A;  3T97 B;  2WSC J;  1OW8 A;  3MP7 B;  1JNM A;  2Q5U A;  3H1K E;  4U7J A;  2IZ0 A;  3L75 G;  3V4Q A;  3SFE C;  4N78 E;  4DJG A;  5L8R J;  5B5E H;  1GW4 A;  3S9O A;  4ZMD A;  1KN7 A;  3F5H A;  2K88 A;  1EZV D;  2FFD C;  4HJG H;  4OVN F;  3FWL A;  3L70 J;  1VL2 A;  3A5T A;  1EDJ A;  2XU6 A;  3RK3 D;  3EFG A;  2E74 B;  2O1J A;  3ITK A;  5CMZ A;  3S1K A;  2RMZ A;  1OX3 A;  3AE7 C;  1Q81 Q;  4I6M C;  5AVY B;  2OYH B;  1KOR A;  1VQ6 P;  4I7Z C;  5KLV D;  2B88 A;  4W7Z A;  1OIP A;  2AEJ A;  3CXH H;  1URQ A;  3E1R A;  1A02 F;  3AE5 C;  3TNU B;  3PHL A;  3OW2 O;  2R5D A;  2IBZ E;  3M9Q A;  2KP8 A;  2IFM A;  1YHQ P;  1OVV A;  1H89 A;  3GHG B;  1FBM A;  4W80 A;  2OTK E;  1H8A A;  1ZR2 A;  2KZI A;  5E79 E;  3KZI E;  1SQV E;  1BE3 E;  4IFM A;  3CWB J;  2SPZ A;  3H1J E;  2M3E A;  4LGD E;  3RBZ A;  3TSI A;  2B87 B;  2KYV A;  4YXD C;  3QH9 A;  1IFI A;  2VRS A;  1LP1 A;  3L72 D;  1BSH A;  1NTM D;  3KXD A;  4ZNC A;  3L75 J;  1ZRT D;  1FJK A;  3H32 A;  3SFD C;  3D71 A;  3AE4 C;  2Z5I A;  3A2A A;  1FZC A; 
#chains in the Genus database with same CATH homology
 3FGA D;  1VL2 A;  4KT0 J;  1ZME C;  3LW5 J;  2QIW A;  1GMJ A;  4RKU J;  3AEA C;  3EWK A;  1HF9 A;  3Q1M A;  3Q5R A;  2E74 B;  3D6Y A;  1MKM A;  4H13 D;  2JO1 A;  1HJ0 A;  2J5U A;  1PIX A;  2D2C C;  3Q5P A;  2NZ2 A;  3AEG C;  3AE7 C;  2E76 C;  4OGQ C;  2G3A A;  2IDB A;  1KOR A;  4PV1 D;  1EXI A;  1YQ4 C;  4PV1 C;  2WSE J;  1UIX A;  4I7Z C;  2D2C B;  4R4L A;  1VF5 D;  3RL0 g;  3GF3 A;  1OW7 A;  3AE9 C;  1VF5 C;  2E76 B;  1IK7 A;  4OGQ B;  2ZT9 D;  2JP3 A;  4PV1 B;  2ZT9 C;  4I7Z B;  1KMI Z;  5M1B A;  2WQY C;  4H44 B;  1R8E A;  1OW6 A;  2YMK A;  4XFJ A;  2V7Q J;  1U57 A;  3AE5 C;  4YTP C;  1K04 A;  2G8Y A;  4H13 C;  3AE2 C;  1FDI A;  2QJP C;  1YQ3 C;  2OQQ A;  4IL6 X;  1S5L X;  2E75 D;  1KQF B;  4Y28 J;  4GDO A;  4H13 B;  2H89 C;  1NYH A;  3O6Q A;  3AE8 C;  1Y9B A;  3Q5S A;  4R4M A;  1FDO A;  1Q90 D;  2K9Y A;  1NGM B;  1KQG B;  3R4Y A;  2FBW C;  3AED C;  4Z1M H;  3IN6 A;  2H88 C;  3AEB C;  1VF5 B;  2QJK C;  3T97 B;  2WSC J;  1OW8 A;  2P10 A;  2BEZ F;  1ZRT E;  1JB0 J;  2ZT9 B;  3C8V A;  2O01 J;  4H0L D;  1OMI A;  3AE6 C;  1RQV A;  3IAO A;  3Q2Y A;  2WSF J;  1WMK A;  2E75 C;  3B71 A;  4U7J A;  3AEC C;  3G9R A;  2QJY C;  3AEF C;  2E74 D;  3AEE C;  3GMA A;  1TU3 F;  3SFE C;  2FXP A;  4YXD C;  1DIP A;  3RK3 E;  2E75 B;  1KIL E;  1PV3 A;  3AE1 C;  3GF7 A;  5L8R J;  3GLM A;  3D6Z A;  4TT3 H;  2D2C D;  1EXJ A;  3D70 A;  1AJY A;  2E76 D;  2FYN C;  2YIU C;  3S9O A;  3AE3 C;  2BEQ D;  4OGQ D;  1ZP0 C;  4H0L C;  1ZOY C;  5KLI C;  2WPV B;  1DD4 A;  3SFD C;  2MKV A;  4H44 D;  3H25 A;  3D71 A;  1S1C X;  4H44 C;  1K05 A;  3ABV C;  5KKZ C;  1DD3 A;  1PL5 A;  3AE4 C;  3Q3D A;  2QSI A;  4H0L B;  2E74 C;  1KTM A;  1RQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...