2V7QJ

The structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
43
structure length
43
Chain Sequence
VRSSAGAVRDAGGAFGKREQAEEERYFRARAKEQLAALKKHHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How the Regulatory Protein, If1, Inhibits F1- ATPase from Bovine Mitochondria.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM
total genus 15
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2007-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.500 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2v7qJ00
4TT3H 1HF9A 2V7QJ 1GMJA 4Z1MH
chains in the Genus database with same CATH superfamily
1G1IA 2HFED 3L36A 3RK3D 2ZT9B 3GHGA 3PLNA 4DJGA 2OYHB 3V2NA 2YKOA 3MGNA 1R8EA 1NH4A 2ZFCA 3Q5SA 1OZHA 2XDJA 1Q86Q 2OYHC 2KNCB 3GHGC 4DT0A 2FYUK 1BCCE 1PGQA 2J5UA 3L4FA 4DZOA 3TGUE 2KLVA 1YIJP 1PGJA 3CD6P 2C0XA 1OW8A 5BU8B 5TISH 4IFMA 1HTLC 2O1KA 1WRGA 1YQ4C 4PV1D 3FXDA 4WWIA 3L74D 2FYUE 4WY4B 1JUNA 3A0BH 1UIXA 1JMMA 3R2PA 1LTJB 3NMDA 3HTKB 4GODA 1BDCA 1RH5B 1IFDA 2FXPA 4HH2A 4GT1A 1URQB 2E5TA 1FAVA 4R4LA 1TU3F 1AV1A 1JEKA 1PP9J 2P1JA 2JO1A 3GMAA 3MTUE 4OH8B 1J1EB 4D6TJ 1JOCA 3Q5PA 2FFDA 2JJLA 1OW7A 3BCCJ 3L73J 3CWBG 1SQPK 2W83C 2RKLA 2K9JA 2O01N 5B5EH 2NPSD 3WU2H 2HR3A 3BVHA 1IZNB 1SP4A 2JR8A 1KB9D 3VMXA 3BASA 1AQTA 3GHGB 2IYOA 2ZXXA 3RBZA 3V4WA 3CCEP 5KLVG 2Q5UA 1SQBE 2R3SA 5AVQB 3L75D 5H2FH 1P84D 1RHZB 1KTMA 3CC2P 1SFCC 4GDOA 2A45I 2BCCJ 2PP6A 5M1BA 2WT7B 1HWTC 1PGPA 3RL0B 1LT9C 2C9NY 1CSBA 1KYOD 1ZP0C 1L0NG 2HYNA 3CI9A 1LTJA 1PL5A 2IZ0A 3CXHH 2AEJA 4PD4D 1FOSE 4WY4A 1PPJG 1NAYA 2E75B 2N1TD 1PFIA 1ZV8A 2H88C 5APQA 5AW0B 2XNDH 3V5BA 2OGUA 1EDKA 1H0TB 3Q5RA 1NTZK 2KP8A 1WMKA 3IR9A 1DH3A 2KLUA 2FFDB 1K04A 1JMBA 2FYZA 2WSEJ 2Q6QA 2Q1KA 2R32A 1N73A 1S9KE 3O6QB 2HLOA 2JDIH 3SWYA 3TGUD 1BE3J 1MKMA 1XTGB 3Q2YA 2G8YA 2L5GB 4C46A 2FXMA 5APSA 2E42A 2UWJE 4U3FD 3Q3DA 1FOSF 1HH0A 4C7NB 2HPCA 1K9MQ 3TF5A 2NRGA 3HD7A 2BASA 2BCCD 2M8RA 1S2EA 2QJYB 2Y9YA 2WSFJ 1JCDA 2IBZG 2YKPA 2Y0DA 2Y0CA 4M3LA 4RKUJ 3CX5I 4PJ0H 5KLVK 5AW5B 1Q7YQ 5AVZB 2RMZA 1NAFA 1SQVG 1NTMJ 1BGYJ 3RBXA 5BU5A 4OGQC 2R44A 1S5LX 2FYUG 3AEDC 1N7SA 2LXCB 3L71G 3WUVA 4OGQB 2SPZA 1FJKA 1OIPA 1URQD 2YMYA 1FJPA 1NTMD 3TGUJ 4WY4C 1H8AA 1URQA 1NTZG 1NTKE 3RK2D 3S1KA 4N78E 5CCGD 1K05A 3BCCD 1Y9BA 3TNUB 4WY4D 4EYYQ 2FYNC 2QJKC 1KMIZ 2WPVB 3Q1MA 3KHUA 1VQNP 1KV4A 3M0DC 3M9QA 5KKZC 2GUSA 5E79H 3A5TA 3E1RA 3IN6A 2WVRA 2A45H 2B87A 1VF5C 3JSVC 5KLIC 3WUTA 1YTZT 3H1JE 1NHLA 3A2AA 3F89A 4U7JA 4Y99B 5CCHC 1KYOE 2ITAA 1GL2B 3A7OA 3L73E 3OAKA 4UB6H 3RK3C 1SQQE 1MFTA 3BRVB 2H43A 2OTLP 1SQXG 4OGQD 5GTIE 2OQQA 1SQXE 2QE7H 3MUDC 1IFJA 1NU1E 2WQYC 1SQBD 3H1KJ 2C0WA 1L0LG 2M3EA 3S4RA 1RQVA 3H1HE 4ASVA 1RF1C 1YHQP 3MUDA 2N1TA 1N8RQ 1J2JB 1T2KD 4HJGH 3SFEC 1JO5A 2FYNB 2BCCE 1SLQA 2QJKB 3L37A 2O3JA 3M9HA 1T2KC 3G3ZA 1KILD 1VQ7P 3T97B 3CXHE 2A45G 4H0LD 1L0LJ 3H1LE 2AXTE 5KAFE 3USSA 5AVXB 1W2BO 1EZVG 1NVOA 2YXQB 5AW1B 2XV5A 3PRJA 4U3FE 5CBOA 5CMZA 1NTKG 1HGVA 1NTZE 1VQPP 5AW9B 4R4MA 1CI6B 1M56D 1VDFA 3II6A 4H0LB 3VMAA 3N7NA 3L71E 4I1LA 1LNQA 1W2EA 1N73B 2QA4P 2K9YA 1W5CE 2NPSB 3P7KA 4IFFA 1AQ5A 2P67A 1SQVE 1M1JB 1X22A 1JY2N 3H1KD 1Q2NA 2HODA 3L70G 4TLFA 4NPFX 2M5AB 1Q82Q 1M1JA 2IBZE 1M1JC 1SQXK 3EFFK 1RE4A 1JY2O 3H1IJ 1SQVK 4D6TG 3K5BA 1KQSO 3H32A 3L74J 4ZMDA 1MV8A 3NTNA 3HE4B 1JY3O 3P8CD 4JQ0D 5CBNA 3TDKA 1Y47A 1LP1B 3CCSP 1JNMA 1H89A 5GTIH 1QGKB 1IK7A 3CX5E 1G2CB 5APTA 1JTHB 2Z5HA 1BE3G 3CC7P 1BSHA 3QWOC 1EZVI 2KSJA 2N1TC 1PZQA 1SQQD 1S3JA 2ZXEB 3FXEA 1EQ7A 1KQLA 3PH0A 3H1JD 1USDA 1DIPA 2JWDA 3LW5H 1CI6A 1GU4A 2WTYA 4TT3H 3CPWO 1AA0A 2IZ1A 2K1AA 1X0TA 4JYCA 1M1KQ 1FZCC 3M06A 1QVFO 1FZFA 1FZBA 1QL1A 3NXSA 1BCCD 2B89A 3AE4C 3E7KA 5BVZA 1BDDA 2P10A 1FZCB 2K9JB 3BCCE 4I7ZB 2Q7CA 2WSFH 1IFIA 1USEA 2GUVA 2RN0A 5APXA 3V4QA 1NGMB 3RGUA 3I55P 5GTHE 2BEQD 4I7ZC 4JBZA 1YJNP 3MP7B 1IC2A 1JY2P 1R5LA 3H1LD 1L0NK 3H32B 2PFXA 1L4AA 3H6PA 4GKGA 4PV1B 4W80A 3AE2C 1S5LH 5KLVE 1DD4A 2E74B 1K8AQ 1EXIA 1SQPJ 3RL0g 2KOGA 1OXZA 3O8ZA 1SQBJ 1SFCA 3JCUH 4IL6H 2Q9IA 2YKQA 3D71A 2KB7P 1G2CA 3L75G 2MJZA 4UB8H 3OJAB 1ZR4A 3H1HD 1XTCC 1LP1A 1SQPD 1N7SD 3VOPA 3VP8A 3HE4A 2KZJA 1U57A 2OYIC 5AVRB 3H1HJ 5C39A 3B8EB 1HF9A 2KXPB 1T3JA 3D6ZA 3LIEA 2OYIB 3LW5J 1KILE 3MD0A 3TNUA 5KTBA 4UB6E 1OFCX 4NPDA 4O9BA 5KJ7D 4B86A 2M0BA 3L72G 4L75A 1VQ5P 1T3UA 2A06D 2PAJA 3AE5C 4GOFA 4QMAA 4WBAA 5H2FE 1FDMA 2OYHA 1LWUB 2AEMA 2O01H 2P58A 5AW4B 1S9KD 1D7MA 1R5SA 2B87B 1IO4A 1UIIA 1LWUC 4N3YB 5AVVB 2H89C 3HE5A 5CCHD 1IFPA 2QM7A 4EI2A 1J1DC 3CMEP 1JY3P 3V2PA 2XKMA 4GIFA 3TGUG 1BE3E 4DCKA 3PHLA 1N73C 1PP9G 2E74D 4WB4A 1L0NE 3P8CE 1KORA 2WPRA 1NU1K 2QSIA 4JPZB 5AW3B 4ZKUA 1L2PA 1HBWA 1A02J 4PD4E 1BGYD 3CCLP 3EFGA 3L73G 1YJWP 1KILC 2Q3EA 1P84H 2H8PD 4EDFA 3B4SA 4YXWH 1EXJA 3MIWA 3CCJP 3KDPB 1MFZA 1NTME 3L70E 4PD4H 1GW4A 2IDBA 1SQVD 3H1IE 1SQQK 1IJDB 5CJ0A 1KC8Q 1FZGA 1VF5B 5KLIB 1ZMEC 3HTKA 4EIJA 1LT9A 1N7SC 5TISE 1VQKP 2GM4A 2OARA 2FFDC 1YBKA 4IL6E 1LGHB 4HKZH 2JWAA 4XA4A 1NTKJ 1AVYA 2R3CA 2W6AA 2Y0EA 2WSEH 1GL2A 4LLHA 4H44B 5KAIH 5GTHH 1BSNA 1GL2D 1N86A 1VF5D 1OWAA 2GA1A 3HUSA 2ZT9C 1X79B 3HD7C 5KJ7A 4BRYA 5K5GB 3G9RA 3WMM0 2ZT9D 3A3YB 3SWFA 3CWBD 2NPSA 3L74G 1LJ2A 2LR2A 3M9BA 1M7LA 1L4AD 1Q81Q 5AVUB 2JP3A 3V2RA 2QVAA 4Z1MH 3A0BE 1CW5A 3GF3A 2IFNA 1OVVA 1L4AC 1RY3A 3C1LA 3AE9C 1SFCD 4RESB 3BRTB 3RL0C 2QIWA 1GZLA 1AFOA 2D2CB 5KLVD 2YIUC 3U1AA 1SQBK 4YPCA 3GG2A 2WMMA 2W27A 1OMIA 3M0AA 4N78D 5KLVJ 1DEBA 1U7JA 1HVVA 3QH9A 2IYPA 2W6JH 3T97A 5AVWB 2P2UA 3TYYA 3C8VA 1L0LD 1N7LA 1KFMA 3ABVC 2AEFA 1L0ND 1YITP 1J1EC 3AE1C 1KQFB 1T6AA 3A0HH 4H0LC 2ZVNB 2JKVA 4LC1A 2LXBA 3G6EP 1CZQA 1ZW0A 2NPSC 3HRNA 3SFDC 2ZJSE 2JEEA 3HD7B 2KIKA 3PJSK 1M57D 4I6MC 3UIAA 4W7ZA 1NWQA 3H1IG 3ZDMA 1NKZB 1PPJE 3CCMP 1NU1D 2N9BA 2RH0A 4U3FJ 4AYCA 1GL2C 3RK3B 4UB8E 1NTZJ 2CPSA 1N2DC 1OVUA 1RF0A 1L0LK 1JCCA 1VL2A 1KB9I 2KI7B 2POHA 4IFDK 4ZKPA 1FDOA 3S9OA 1SFCB 1KYOH 3AEEC 4RJTA 3L71J 3VYIA 2DW3A 1E79H 3CXHD 3RK3E 1RQUA 1KB9E 1NO4A 1FZAA 2E76B 5APYA 4IL6X 1SQVJ 1L4AB 3OW2O 2KK7A 1SVFA 2WPQA 1U7MA 3U59A 4YXDC 1L0NJ 2D2CC 1AJYA 1FDIA 1URQC 4BXLA 1LT9B 2W90A 4RO0A 2D2CD 3L74E 1MUUA 3CWBE 5KAIE 2CPBA 1DEEG 1KFNA 4GOEA 4Y99C 2KSEA 1GTWA 4K3AA 1OX3A 2ZAEB 3CX5H 3IF4A 3AEAC 1RF0C 3KZIH 5AVSB 1VPCA 3GF7A 1FBMA 2IBZD 3V2QA 1QVGO 2WZ7A 2V7QJ 1IFNA 1LWUA 1BCCJ 3ITKA 4IOIH 3VMYA 1G1JA 2CK3H 2XNXA 4H44C 3H25A 1NJIQ 3A0HE 2FYUD 1S72P 3L75E 2QEXP 3L71D 2B9BA 4H44D 3HUSB 3KZIE 5L8RJ 1GW3A 1IFMA 3W67A 4AQRD 1H88A 5B5EE 1NTMG 1QEXA 1ZRTD 1NTZD 1BCCG 2IPPA 1QL2A 2OTKE 1GDTA 1DX7A 3BCCG 1KZUB 1QLED 2XZRA 1PP9E 1PV3A 2QM8A 3AE3C 4XE5B 5E79E 2E76C 3RK2C 2FKWB 5AW7B 1YJ9P 2E75C 1EDJA 4L74A 5AVTB 2OYOA 2YIUB 5CCGA 4ZNCA 1SQBG 3NFQA 1SQPE 1ZLLA 2OYIA 3C9IA 3IFMA 3B5NC 2Q3IA 1VQ8P 1LTJC 1KN7A 1M8OB 4HB1A 2E5YA 4NPEA 2QJPB 4H13D 2N9YB 2Y9ZA 1KQGB 1SQPG 1Y8AA 1T8ZA 2PRRA 3JC22 4KJMA 3VMZA 2V7QH 3I56P 1J1DB 2AXTH 3VP9A 5KAFH 4H13C 5AW6B 4MN4C 1FC2C 1GK6A 2KS1A 3L72E 5TJHA 5KKZB 1VQ6P 1HJ0A 1JB0J 1MZ9A 3FGAD 3HUSC 3KPEA 4OVNF 4BRYB 3CCRP 1NTKK 2WITA 2YO2A 5EFWB 1VQ9P 4JYBA 2A06G 1P84E 2IX7C 3HD7D 3JCUE 2QG4A 1QX8A 4AUWA 1PPJD 3PP5A 3RL0D 2KUBA 3CMAP 1K73Q 1RE4C 1FZCA 4C7RA 2E76D 4ASWA 2E74C 3I5CA 1JTHA 3AE6C 1RF1B 2VRSA 2O1JA 3AECC 3LIDA 5AW8B 3F5HA 3H1KG 1EZVD 3AEFC 2W6BA 1PP9D 1LTTC 2A06E 2KZIA 4PD4I 1ZN5A 4I2LC 1LTGC 2ZYDA 1KILA 2FBWC 1SS1A 3B5NB 3MZWB 1LT1A 1NTKD 2M3BA 3VN0A 4A7PA 4D6TD 5CJ4A 2E75D 2N1TB 1VQMP 3CCQP 1GD2E 3IAOA 1AVOA 2WSCJ 3FWNA 3L73D 4U3FG 3CCUP 1HJBA 1GK4A 1ZXGA 3CL3D 1JM0A 1LTIC 3L70J 1S4XA 4H13B 1H0TA 1BE3D 2BCCG 3EQ2A 3MHVA 3W68A 1FZEA 1Z56A 2AXCA 3CWBJ 3L70D 2J58A 4EOTA 1YTZI 1S1CX 1KD1Q 4DOJA 1VQ4P 3SSUA 3P8MC 3L35A 4KHXA 2IBZI 1BGYE 2KNCA 5APVA 1A02F 1WT6A 2HODB 3AEBC 4YTPC 1EDIA 2WT7A 3SWKA 2FYUJ 2FY8A 4BWNA 2QRXA 3P32A 1RE3C 2I1JA 2IFMA 3N4XA 5CHXA 2H7HA 1FE6A 2I8DA 1OVRA 2R5BA 1ZR2A 3VTPC 2YNYA 3L75J 4OWFA 1JY3N 2QJYC 2G3AA 2YXRB 3AE7C 1SQQG 1ZRTE 4K35A 4D6TE 1X9VA 2FXOA 2XU6A 3FWLA 3H1JG 3D70A 1S5LE 4W7YA 2YO3A 5CCGC 1FU1A 3FX0A 2OTJP 3KYQA 4PJ0E 3RK2B 1FS0E 1X8YA 3TK1A 1OW6A 3WUUA 2W8ZA 1YQ3C 2WPSA 1ZOYC 2PGDA 3H1JJ 2ZYAA 2V4HA 3O6QA 3CLQA 3OA7A 1KYOI 5DJUB 4XFJA 3G71P 3PTZA 1GMJA 1YYCA 2KS1B 3CX5D 4JF7A 1GU5A 1EZVE 2C9LY 2K88A 1SQXD 1SQQJ 2QJPC 2HG5D 3V6IA 1EC5A 2K37A 3H1LG 2BEZF 3TSIA 2R5DA 2YMKA 1SQXJ 2HPCB 3G4SP 1NU1J 1NTMK 4N6JA 1VQLP 2P7JA 5AW2B 3H1KE 1LTSC 5CCHA 3L72D 1VQOP 4L73A 1LTBC 2NZ2A 1KB9H 2WSSH 3L72J 1NKNA 2L91A 3E1IA 2Z5IA 4PV1C 3H1HG 2MKVA 3U1CA 5AVYB 3AE8C 1RE3A 3H1ID 1RF1A 2M5AA 2Z4EA 2K3RA 3BATA 2E43A 3CC4P 1EDLA 1NU1G 4KT0J 3CCVP 1HGZA 1L0LE 3KXDA 3H1LJ 5B66E 1KILB 3B5NA 3M0DA 1Q90D 4HYTB 1N7SB 2KYVA 3M91A 5APUA 3B5ND 3R4YA 1M90Q 3D6YA 2B88A 1NOHA 1E5WA 1LTAC 2LKMA 2ZYGA 4LGDE 3KQGA 4Y28J 3WU2E 3B71A 1BGYG 1PIXA 2I1KA 5B66H 3EWKA 2J59M 5KJ7C 1DD3A 1HUCA 4CPGA 1NYHA 1IK9A 4L76A 2WSCH 4WVZA 5APWA 4C7NA 5DJTB 1P84I 2ZVOB 3CXHI 3GLMA 1PGOA 3GW6A 3AEGC 2WWWA 2O01J 3HE5B 1YI2P
chains in the Genus database with same CATH topology
2OQQA 1EXJA 2ZT9B 2WQYC 4H13D 2IDBA 1KQGB 1R8EA 1RQVA 3Q5SA 1VF5B 1ZMEC 4H13C 3SFEC 2J5UA 1HJ0A 1JB0J 3FGAD 1OW8A 3T97B 1YQ4C 4PV1D 4H0LD 4H44B 1UIXA 1VF5D 2ZT9C 2FXPA 2E76D 3G9RA 2E74C 4R4LA 2ZT9D 3AE6C 1TU3F 3AECC 2JO1A 3GMAA 4R4MA 2JP3A 4H0LB 3AEFC 4Z1MH 3Q5PA 3GF3A 1OW7A 2FBWC 2K9YA 3AE9C 2QIWA 2E75D 2D2CB 2YIUC 3IAOA 2WSCJ 1OMIA 4H13B 3C8VA 3ABVC 3AE1C 1S1CX 1KQFB 1KTMA 4H0LC 4GDOA 1IK7A 5M1BA 3AEBC 4YTPC 1ZP0C 3SFDC 1PL5A 2E75B 1DIPA 2H88C 4TT3H 2QJYC 3Q5RA 2G3AA 3AE7C 1WMKA 1ZRTE 1VL2A 1FDOA 3S9OA 3AEEC 1K04A 3AE4C 2P10A 3RK3E 1RQUA 2WSEJ 4I7ZB 2E76B 4IL6X 1OW6A 1NGMB 1YQ3C 1ZOYC 2BEQD 1MKMA 4I7ZC 3Q2YA 2G8YA 4YXDC 4PV1B 1AJYA 3O6QA 2D2CC 3Q3DA 3AE2C 1EXIA 1FDIA 1DD4A 2E74B 1GMJA 4XFJA 3RL0g 2D2CD 2QJPC 2WSFJ 2BEZF 4RKUJ 3D71A 2YMKA 4OGQC 1U57A 1S5LX 3AEAC 3GF7A 3AEDC 2NZ2A 1HF9A 3D6ZA 4OGQB 2V7QJ 3LW5J 4PV1C 1KILE 2MKVA 3H25A 3AE8C 4H44C 1K05A 3AE5C 1Y9BA 4KT0J 4H44D 5L8RJ 2FYNC 2QJKC 1KMIZ 2WPVB 3Q1MA 3D70A 1Q90D 5KKZC 3R4YA 3D6YA 2H89C 3IN6A 1VF5C 5KLIC 4Y28J 3B71A 1PV3A 3AE3C 4U7JA 1PIXA 2E76C 3EWKA 2E74D 2E75C 1DD3A 1KORA 1NYHA 2QSIA 3GLMA 3AEGC 2O01J 4OGQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TT3 H;  1HF9 A;  2V7Q J;  1GMJ A;  4Z1M H; 
#chains in the Genus database with same CATH topology
 1G1I A;  2HFE D;  3L36 A;  3RK3 D;  2ZT9 B;  3GHG A;  3PLN A;  4DJG A;  2OYH B;  3V2N A;  2YKO A;  3MGN A;  1R8E A;  1NH4 A;  2ZFC A;  3Q5S A;  1OZH A;  2XDJ A;  1Q86 Q;  2OYH C;  2KNC B;  3GHG C;  4DT0 A;  2FYU K;  1BCC E;  1PGQ A;  2J5U A;  3L4F A;  4DZO A;  3TGU E;  2KLV A;  1YIJ P;  1PGJ A;  3CD6 P;  2C0X A;  1OW8 A;  5BU8 B;  5TIS H;  4IFM A;  1HTL C;  2O1K A;  1WRG A;  1YQ4 C;  4PV1 D;  3FXD A;  4WWI A;  3L74 D;  2FYU E;  4WY4 B;  1JUN A;  3A0B H;  1UIX A;  1JMM A;  3R2P A;  1LTJ B;  3NMD A;  3HTK B;  4GOD A;  1BDC A;  1RH5 B;  1IFD A;  2FXP A;  4HH2 A;  4GT1 A;  1URQ B;  2E5T A;  1FAV A;  4R4L A;  1TU3 F;  1AV1 A;  1JEK A;  1PP9 J;  2P1J A;  2JO1 A;  3GMA A;  3MTU E;  4OH8 B;  1J1E B;  4D6T J;  1JOC A;  3Q5P A;  2FFD A;  2JJL A;  1OW7 A;  3BCC J;  3L73 J;  3CWB G;  1SQP K;  2W83 C;  2RKL A;  2K9J A;  2O01 N;  5B5E H;  2NPS D;  3WU2 H;  2HR3 A;  3BVH A;  1IZN B;  1SP4 A;  2JR8 A;  1KB9 D;  3VMX A;  3BAS A;  1AQT A;  3GHG B;  2IYO A;  2ZXX A;  3RBZ A;  3V4W A;  3CCE P;  5KLV G;  2Q5U A;  1SQB E;  2R3S A;  5AVQ B;  3L75 D;  5H2F H;  1P84 D;  1RHZ B;  1KTM A;  3CC2 P;  1SFC C;  4GDO A;  2A45 I;  2BCC J;  2PP6 A;  5M1B A;  2WT7 B;  1HWT C;  1PGP A;  3RL0 B;  1LT9 C;  2C9N Y;  1CSB A;  1KYO D;  1ZP0 C;  1L0N G;  2HYN A;  3CI9 A;  1LTJ A;  1PL5 A;  2IZ0 A;  3CXH H;  2AEJ A;  4PD4 D;  1FOS E;  4WY4 A;  1PPJ G;  1NAY A;  2E75 B;  2N1T D;  1PFI A;  1ZV8 A;  2H88 C;  5APQ A;  5AW0 B;  2XND H;  3V5B A;  2OGU A;  1EDK A;  1H0T B;  3Q5R A;  1NTZ K;  2KP8 A;  1WMK A;  3IR9 A;  1DH3 A;  2KLU A;  2FFD B;  1K04 A;  1JMB A;  2FYZ A;  2WSE J;  2Q6Q A;  2Q1K A;  2R32 A;  1N73 A;  1S9K E;  3O6Q B;  2HLO A;  2JDI H;  3SWY A;  3TGU D;  1BE3 J;  1MKM A;  1XTG B;  3Q2Y A;  2G8Y A;  2L5G B;  4C46 A;  2FXM A;  5APS A;  2E42 A;  2UWJ E;  4U3F D;  3Q3D A;  1FOS F;  1HH0 A;  4C7N B;  2HPC A;  1K9M Q;  3TF5 A;  2NRG A;  3HD7 A;  2BAS A;  2BCC D;  2M8R A;  1S2E A;  2QJY B;  2Y9Y A;  2WSF J;  1JCD A;  2IBZ G;  2YKP A;  2Y0D A;  2Y0C A;  4M3L A;  4RKU J;  3CX5 I;  4PJ0 H;  5KLV K;  5AW5 B;  1Q7Y Q;  5AVZ B;  2RMZ A;  1NAF A;  1SQV G;  1NTM J;  1BGY J;  3RBX A;  5BU5 A;  4OGQ C;  2R44 A;  1S5L X;  2FYU G;  3AED C;  1N7S A;  2LXC B;  3L71 G;  3WUV A;  4OGQ B;  2SPZ A;  1FJK A;  1OIP A;  1URQ D;  2YMY A;  1FJP A;  1NTM D;  3TGU J;  4WY4 C;  1H8A A;  1URQ A;  1NTZ G;  1NTK E;  3RK2 D;  3S1K A;  4N78 E;  5CCG D;  1K05 A;  3BCC D;  1Y9B A;  3TNU B;  4WY4 D;  4EYY Q;  2FYN C;  2QJK C;  1KMI Z;  2WPV B;  3Q1M A;  3KHU A;  1VQN P;  1KV4 A;  3M0D C;  3M9Q A;  5KKZ C;  2GUS A;  5E79 H;  3A5T A;  3E1R A;  3IN6 A;  2WVR A;  2A45 H;  2B87 A;  1VF5 C;  3JSV C;  5KLI C;  3WUT A;  1YTZ T;  3H1J E;  1NHL A;  3A2A A;  3F89 A;  4U7J A;  4Y99 B;  5CCH C;  1KYO E;  2ITA A;  1GL2 B;  3A7O A;  3L73 E;  3OAK A;  4UB6 H;  3RK3 C;  1SQQ E;  1MFT A;  3BRV B;  2H43 A;  2OTL P;  1SQX G;  4OGQ D;  5GTI E;  2OQQ A;  1SQX E;  2QE7 H;  3MUD C;  1IFJ A;  1NU1 E;  2WQY C;  1SQB D;  3H1K J;  2C0W A;  1L0L G;  2M3E A;  3S4R A;  1RQV A;  3H1H E;  4ASV A;  1RF1 C;  1YHQ P;  3MUD A;  2N1T A;  1N8R Q;  1J2J B;  1T2K D;  4HJG H;  3SFE C;  1JO5 A;  2FYN B;  2BCC E;  1SLQ A;  2QJK B;  3L37 A;  2O3J A;  3M9H A;  1T2K C;  3G3Z A;  1KIL D;  1VQ7 P;  3T97 B;  3CXH E;  2A45 G;  4H0L D;  1L0L J;  3H1L E;  2AXT E;  5KAF E;  3USS A;  5AVX B;  1W2B O;  1EZV G;  1NVO A;  2YXQ B;  5AW1 B;  2XV5 A;  3PRJ A;  4U3F E;  5CBO A;  5CMZ A;  1NTK G;  1HGV A;  1NTZ E;  1VQP P;  5AW9 B;  4R4M A;  1CI6 B;  1M56 D;  1VDF A;  3II6 A;  4H0L B;  3VMA A;  3N7N A;  3L71 E;  4I1L A;  1LNQ A;  1W2E A;  1N73 B;  2QA4 P;  2K9Y A;  1W5C E;  2NPS B;  3P7K A;  4IFF A;  1AQ5 A;  2P67 A;  1SQV E;  1M1J B;  1X22 A;  1JY2 N;  3H1K D;  1Q2N A;  2HOD A;  3L70 G;  4TLF A;  4NPF X;  2M5A B;  1Q82 Q;  1M1J A;  2IBZ E;  1M1J C;  1SQX K;  3EFF K;  1RE4 A;  1JY2 O;  3H1I J;  1SQV K;  4D6T G;  3K5B A;  1KQS O;  3H32 A;  3L74 J;  4ZMD A;  1MV8 A;  3NTN A;  3HE4 B;  1JY3 O;  3P8C D;  4JQ0 D;  5CBN A;  3TDK A;  1Y47 A;  1LP1 B;  3CCS P;  1JNM A;  1H89 A;  5GTI H;  1QGK B;  1IK7 A;  3CX5 E;  1G2C B;  5APT A;  1JTH B;  2Z5H A;  1BE3 G;  3CC7 P;  1BSH A;  3QWO C;  1EZV I;  2KSJ A;  2N1T C;  1PZQ A;  1SQQ D;  1S3J A;  2ZXE B;  3FXE A;  1EQ7 A;  1KQL A;  3PH0 A;  3H1J D;  1USD A;  1DIP A;  2JWD A;  3LW5 H;  1CI6 A;  1GU4 A;  2WTY A;  4TT3 H;  3CPW O;  1AA0 A;  2IZ1 A;  2K1A A;  1X0T A;  4JYC A;  1M1K Q;  1FZC C;  3M06 A;  1QVF O;  1FZF A;  1FZB A;  1QL1 A;  3NXS A;  1BCC D;  2B89 A;  3AE4 C;  3E7K A;  5BVZ A;  1BDD A;  2P10 A;  1FZC B;  2K9J B;  3BCC E;  4I7Z B;  2Q7C A;  2WSF H;  1IFI A;  1USE A;  2GUV A;  2RN0 A;  5APX A;  3V4Q A;  1NGM B;  3RGU A;  3I55 P;  5GTH E;  2BEQ D;  4I7Z C;  4JBZ A;  1YJN P;  3MP7 B;  1IC2 A;  1JY2 P;  1R5L A;  3H1L D;  1L0N K;  3H32 B;  2PFX A;  1L4A A;  3H6P A;  4GKG A;  4PV1 B;  4W80 A;  3AE2 C;  1S5L H;  5KLV E;  1DD4 A;  2E74 B;  1K8A Q;  1EXI A;  1SQP J;  3RL0 g;  2KOG A;  1OXZ A;  3O8Z A;  1SQB J;  1SFC A;  3JCU H;  4IL6 H;  2Q9I A;  2YKQ A;  3D71 A;  2KB7 P;  1G2C A;  3L75 G;  2MJZ A;  4UB8 H;  3OJA B;  1ZR4 A;  3H1H D;  1XTC C;  1LP1 A;  1SQP D;  1N7S D;  3VOP A;  3VP8 A;  3HE4 A;  2KZJ A;  1U57 A;  2OYI C;  5AVR B;  3H1H J;  5C39 A;  3B8E B;  1HF9 A;  2KXP B;  1T3J A;  3D6Z A;  3LIE A;  2OYI B;  3LW5 J;  1KIL E;  3MD0 A;  3TNU A;  5KTB A;  4UB6 E;  1OFC X;  4NPD A;  4O9B A;  5KJ7 D;  4B86 A;  2M0B A;  3L72 G;  4L75 A;  1VQ5 P;  1T3U A;  2A06 D;  2PAJ A;  3AE5 C;  4GOF A;  4QMA A;  4WBA A;  5H2F E;  1FDM A;  2OYH A;  1LWU B;  2AEM A;  2O01 H;  2P58 A;  5AW4 B;  1S9K D;  1D7M A;  1R5S A;  2B87 B;  1IO4 A;  1UII A;  1LWU C;  4N3Y B;  5AVV B;  2H89 C;  3HE5 A;  5CCH D;  1IFP A;  2QM7 A;  4EI2 A;  1J1D C;  3CME P;  1JY3 P;  3V2P A;  2XKM A;  4GIF A;  3TGU G;  1BE3 E;  4DCK A;  3PHL A;  1N73 C;  1PP9 G;  2E74 D;  4WB4 A;  1L0N E;  3P8C E;  1KOR A;  2WPR A;  1NU1 K;  2QSI A;  4JPZ B;  5AW3 B;  4ZKU A;  1L2P A;  1HBW A;  1A02 J;  4PD4 E;  1BGY D;  3CCL P;  3EFG A;  3L73 G;  1YJW P;  1KIL C;  2Q3E A;  1P84 H;  2H8P D;  4EDF A;  3B4S A;  4YXW H;  1EXJ A;  3MIW A;  3CCJ P;  3KDP B;  1MFZ A;  1NTM E;  3L70 E;  4PD4 H;  1GW4 A;  2IDB A;  1SQV D;  3H1I E;  1SQQ K;  1IJD B;  5CJ0 A;  1KC8 Q;  1FZG A;  1VF5 B;  5KLI B;  1ZME C;  3HTK A;  4EIJ A;  1LT9 A;  1N7S C;  5TIS E;  1VQK P;  2GM4 A;  2OAR A;  2FFD C;  1YBK A;  4IL6 E;  1LGH B;  4HKZ H;  2JWA A;  4XA4 A;  1NTK J;  1AVY A;  2R3C A;  2W6A A;  2Y0E A;  2WSE H;  1GL2 A;  4LLH A;  4H44 B;  5KAI H;  5GTH H;  1BSN A;  1GL2 D;  1N86 A;  1VF5 D;  1OWA A;  2GA1 A;  3HUS A;  2ZT9 C;  1X79 B;  3HD7 C;  5KJ7 A;  4BRY A;  5K5G B;  3G9R A;  3WMM 0;  2ZT9 D;  3A3Y B;  3SWF A;  3CWB D;  2NPS A;  3L74 G;  1LJ2 A;  2LR2 A;  3M9B A;  1M7L A;  1L4A D;  1Q81 Q;  5AVU B;  2JP3 A;  3V2R A;  2QVA A;  4Z1M H;  3A0B E;  1CW5 A;  3GF3 A;  2IFN A;  1OVV A;  1L4A C;  1RY3 A;  3C1L A;  3AE9 C;  1SFC D;  4RES B;  3BRT B;  3RL0 C;  2QIW A;  1GZL A;  1AFO A;  2D2C B;  5KLV D;  2YIU C;  3U1A A;  1SQB K;  4YPC A;  3GG2 A;  2WMM A;  2W27 A;  1OMI A;  3M0A A;  4N78 D;  5KLV J;  1DEB A;  1U7J A;  1HVV A;  3QH9 A;  2IYP A;  2W6J H;  3T97 A;  5AVW B;  2P2U A;  3TYY A;  3C8V A;  1L0L D;  1N7L A;  1KFM A;  3ABV C;  2AEF A;  1L0N D;  1YIT P;  1J1E C;  3AE1 C;  1KQF B;  1T6A A;  3A0H H;  4H0L C;  2ZVN B;  2JKV A;  4LC1 A;  2LXB A;  3G6E P;  1CZQ A;  1ZW0 A;  2NPS C;  3HRN A;  3SFD C;  2ZJS E;  2JEE A;  3HD7 B;  2KIK A;  3PJS K;  1M57 D;  4I6M C;  3UIA A;  4W7Z A;  1NWQ A;  3H1I G;  3ZDM A;  1NKZ B;  1PPJ E;  3CCM P;  1NU1 D;  2N9B A;  2RH0 A;  4U3F J;  4AYC A;  1GL2 C;  3RK3 B;  4UB8 E;  1NTZ J;  2CPS A;  1N2D C;  1OVU A;  1RF0 A;  1L0L K;  1JCC A;  1VL2 A;  1KB9 I;  2KI7 B;  2POH A;  4IFD K;  4ZKP A;  1FDO A;  3S9O A;  1SFC B;  1KYO H;  3AEE C;  4RJT A;  3L71 J;  3VYI A;  2DW3 A;  1E79 H;  3CXH D;  3RK3 E;  1RQU A;  1KB9 E;  1NO4 A;  1FZA A;  2E76 B;  5APY A;  4IL6 X;  1SQV J;  1L4A B;  3OW2 O;  2KK7 A;  1SVF A;  2WPQ A;  1U7M A;  3U59 A;  4YXD C;  1L0N J;  2D2C C;  1AJY A;  1FDI A;  1URQ C;  4BXL A;  1LT9 B;  2W90 A;  4RO0 A;  2D2C D;  3L74 E;  1MUU A;  3CWB E;  5KAI E;  2CPB A;  1DEE G;  1KFN A;  4GOE A;  4Y99 C;  2KSE A;  1GTW A;  4K3A A;  1OX3 A;  2ZAE B;  3CX5 H;  3IF4 A;  3AEA C;  1RF0 C;  3KZI H;  5AVS B;  1VPC A;  3GF7 A;  1FBM A;  2IBZ D;  3V2Q A;  1QVG O;  2WZ7 A;  2V7Q J;  1IFN A;  1LWU A;  1BCC J;  3ITK A;  4IOI H;  3VMY A;  1G1J A;  2CK3 H;  2XNX A;  4H44 C;  3H25 A;  1NJI Q;  3A0H E;  2FYU D;  1S72 P;  3L75 E;  2QEX P;  3L71 D;  2B9B A;  4H44 D;  3HUS B;  3KZI E;  5L8R J;  1GW3 A;  1IFM A;  3W67 A;  4AQR D;  1H88 A;  5B5E E;  1NTM G;  1QEX A;  1ZRT D;  1NTZ D;  1BCC G;  2IPP A;  1QL2 A;  2OTK E;  1GDT A;  1DX7 A;  3BCC G;  1KZU B;  1QLE D;  2XZR A;  1PP9 E;  1PV3 A;  2QM8 A;  3AE3 C;  4XE5 B;  5E79 E;  2E76 C;  3RK2 C;  2FKW B;  5AW7 B;  1YJ9 P;  2E75 C;  1EDJ A;  4L74 A;  5AVT B;  2OYO A;  2YIU B;  5CCG A;  4ZNC A;  1SQB G;  3NFQ A;  1SQP E;  1ZLL A;  2OYI A;  3C9I A;  3IFM A;  3B5N C;  2Q3I A;  1VQ8 P;  1LTJ C;  1KN7 A;  1M8O B;  4HB1 A;  2E5Y A;  4NPE A;  2QJP B;  4H13 D;  2N9Y B;  2Y9Z A;  1KQG B;  1SQP G;  1Y8A A;  1T8Z A;  2PRR A;  3JC2 2;  4KJM A;  3VMZ A;  2V7Q H;  3I56 P;  1J1D B;  2AXT H;  3VP9 A;  5KAF H;  4H13 C;  5AW6 B;  4MN4 C;  1FC2 C;  1GK6 A;  2KS1 A;  3L72 E;  5TJH A;  5KKZ B;  1VQ6 P;  1HJ0 A;  1JB0 J;  1MZ9 A;  3FGA D;  3HUS C;  3KPE A;  4OVN F;  4BRY B;  3CCR P;  1NTK K;  2WIT A;  2YO2 A;  5EFW B;  1VQ9 P;  4JYB A;  2A06 G;  1P84 E;  2IX7 C;  3HD7 D;  3JCU E;  2QG4 A;  1QX8 A;  4AUW A;  1PPJ D;  3PP5 A;  3RL0 D;  2KUB A;  3CMA P;  1K73 Q;  1RE4 C;  1FZC A;  4C7R A;  2E76 D;  4ASW A;  2E74 C;  3I5C A;  1JTH A;  3AE6 C;  1RF1 B;  2VRS A;  2O1J A;  3AEC C;  3LID A;  5AW8 B;  3F5H A;  3H1K G;  1EZV D;  3AEF C;  2W6B A;  1PP9 D;  1LTT C;  2A06 E;  2KZI A;  4PD4 I;  1ZN5 A;  4I2L C;  1LTG C;  2ZYD A;  1KIL A;  2FBW C;  1SS1 A;  3B5N B;  3MZW B;  1LT1 A;  1NTK D;  2M3B A;  3VN0 A;  4A7P A;  4D6T D;  5CJ4 A;  2E75 D;  2N1T B;  1VQM P;  3CCQ P;  1GD2 E;  3IAO A;  1AVO A;  2WSC J;  3FWN A;  3L73 D;  4U3F G;  3CCU P;  1HJB A;  1GK4 A;  1ZXG A;  3CL3 D;  1JM0 A;  1LTI C;  3L70 J;  1S4X A;  4H13 B;  1H0T A;  1BE3 D;  2BCC G;  3EQ2 A;  3MHV A;  3W68 A;  1FZE A;  1Z56 A;  2AXC A;  3CWB J;  3L70 D;  2J58 A;  4EOT A;  1YTZ I;  1S1C X;  1KD1 Q;  4DOJ A;  1VQ4 P;  3SSU A;  3P8M C;  3L35 A;  4KHX A;  2IBZ I;  1BGY E;  2KNC A;  5APV A;  1A02 F;  1WT6 A;  2HOD B;  3AEB C;  4YTP C;  1EDI A;  2WT7 A;  3SWK A;  2FYU J;  2FY8 A;  4BWN A;  2QRX A;  3P32 A;  1RE3 C;  2I1J A;  2IFM A;  3N4X A;  5CHX A;  2H7H A;  1FE6 A;  2I8D A;  1OVR A;  2R5B A;  1ZR2 A;  3VTP C;  2YNY A;  3L75 J;  4OWF A;  1JY3 N;  2QJY C;  2G3A A;  2YXR B;  3AE7 C;  1SQQ G;  1ZRT E;  4K35 A;  4D6T E;  1X9V A;  2FXO A;  2XU6 A;  3FWL A;  3H1J G;  3D70 A;  1S5L E;  4W7Y A;  2YO3 A;  5CCG C;  1FU1 A;  3FX0 A;  2OTJ P;  3KYQ A;  4PJ0 E;  3RK2 B;  1FS0 E;  1X8Y A;  3TK1 A;  1OW6 A;  3WUU A;  2W8Z A;  1YQ3 C;  2WPS A;  1ZOY C;  2PGD A;  3H1J J;  2ZYA A;  2V4H A;  3O6Q A;  3CLQ A;  3OA7 A;  1KYO I;  5DJU B;  4XFJ A;  3G71 P;  3PTZ A;  1GMJ A;  1YYC A;  2KS1 B;  3CX5 D;  4JF7 A;  1GU5 A;  1EZV E;  2C9L Y;  2K88 A;  1SQX D;  1SQQ J;  2QJP C;  2HG5 D;  3V6I A;  1EC5 A;  2K37 A;  3H1L G;  2BEZ F;  3TSI A;  2R5D A;  2YMK A;  1SQX J;  2HPC B;  3G4S P;  1NU1 J;  1NTM K;  4N6J A;  1VQL P;  2P7J A;  5AW2 B;  3H1K E;  1LTS C;  5CCH A;  3L72 D;  1VQO P;  4L73 A;  1LTB C;  2NZ2 A;  1KB9 H;  2WSS H;  3L72 J;  1NKN A;  2L91 A;  3E1I A;  2Z5I A;  4PV1 C;  3H1H G;  2MKV A;  3U1C A;  5AVY B;  3AE8 C;  1RE3 A;  3H1I D;  1RF1 A;  2M5A A;  2Z4E A;  2K3R A;  3BAT A;  2E43 A;  3CC4 P;  1EDL A;  1NU1 G;  4KT0 J;  3CCV P;  1HGZ A;  1L0L E;  3KXD A;  3H1L J;  5B66 E;  1KIL B;  3B5N A;  3M0D A;  1Q90 D;  4HYT B;  1N7S B;  2KYV A;  3M91 A;  5APU A;  3B5N D;  3R4Y A;  1M90 Q;  3D6Y A;  2B88 A;  1NOH A;  1E5W A;  1LTA C;  2LKM A;  2ZYG A;  4LGD E;  3KQG A;  4Y28 J;  3WU2 E;  3B71 A;  1BGY G;  1PIX A;  2I1K A;  5B66 H;  3EWK A;  2J59 M;  5KJ7 C;  1DD3 A;  1HUC A;  4CPG A;  1NYH A;  1IK9 A;  4L76 A;  2WSC H;  4WVZ A;  5APW A;  4C7N A;  5DJT B;  1P84 I;  2ZVO B;  3CXH I;  3GLM A;  1PGO A;  3GW6 A;  3AEG C;  2WWW A;  2O01 J;  3HE5 B;  1YI2 P; 
#chains in the Genus database with same CATH homology
 2OQQ A;  1EXJ A;  2ZT9 B;  2WQY C;  4H13 D;  2IDB A;  1KQG B;  1R8E A;  1RQV A;  3Q5S A;  1VF5 B;  1ZME C;  4H13 C;  3SFE C;  2J5U A;  1HJ0 A;  1JB0 J;  3FGA D;  1OW8 A;  3T97 B;  1YQ4 C;  4PV1 D;  4H0L D;  4H44 B;  1UIX A;  1VF5 D;  2ZT9 C;  2FXP A;  2E76 D;  3G9R A;  2E74 C;  4R4L A;  2ZT9 D;  3AE6 C;  1TU3 F;  3AEC C;  2JO1 A;  3GMA A;  4R4M A;  2JP3 A;  4H0L B;  3AEF C;  4Z1M H;  3Q5P A;  3GF3 A;  1OW7 A;  2FBW C;  2K9Y A;  3AE9 C;  2QIW A;  2E75 D;  2D2C B;  2YIU C;  3IAO A;  2WSC J;  1OMI A;  4H13 B;  3C8V A;  3ABV C;  3AE1 C;  1S1C X;  1KQF B;  1KTM A;  4H0L C;  4GDO A;  1IK7 A;  5M1B A;  3AEB C;  4YTP C;  1ZP0 C;  3SFD C;  1PL5 A;  2E75 B;  1DIP A;  2H88 C;  4TT3 H;  2QJY C;  3Q5R A;  2G3A A;  3AE7 C;  1WMK A;  1ZRT E;  1VL2 A;  1FDO A;  3S9O A;  3AEE C;  1K04 A;  3AE4 C;  2P10 A;  3RK3 E;  1RQU A;  2WSE J;  4I7Z B;  2E76 B;  4IL6 X;  1OW6 A;  1NGM B;  1YQ3 C;  1ZOY C;  2BEQ D;  1MKM A;  4I7Z C;  3Q2Y A;  2G8Y A;  4YXD C;  4PV1 B;  1AJY A;  3O6Q A;  2D2C C;  3Q3D A;  3AE2 C;  1EXI A;  1FDI A;  1DD4 A;  2E74 B;  1GMJ A;  4XFJ A;  3RL0 g;  2D2C D;  2QJP C;  2WSF J;  2BEZ F;  4RKU J;  3D71 A;  2YMK A;  4OGQ C;  1U57 A;  1S5L X;  3AEA C;  3GF7 A;  3AED C;  2NZ2 A;  1HF9 A;  3D6Z A;  4OGQ B;  2V7Q J;  3LW5 J;  4PV1 C;  1KIL E;  2MKV A;  3H25 A;  3AE8 C;  4H44 C;  1K05 A;  3AE5 C;  1Y9B A;  4KT0 J;  4H44 D;  5L8R J;  2FYN C;  2QJK C;  1KMI Z;  2WPV B;  3Q1M A;  3D70 A;  1Q90 D;  5KKZ C;  3R4Y A;  3D6Y A;  2H89 C;  3IN6 A;  1VF5 C;  5KLI C;  4Y28 J;  3B71 A;  1PV3 A;  3AE3 C;  4U7J A;  1PIX A;  2E76 C;  3EWK A;  2E74 D;  2E75 C;  1DD3 A;  1KOR A;  1NYH A;  2QSI A;  3GLM A;  3AEG C;  2O01 J;  4OGQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...