2V7QJ

The structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
43
structure length
43
Chain Sequence
VRSSAGAVRDAGGAFGKREQAEEERYFRARAKEQLAALKKHHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM
publication title How the Regulatory Protein, If1, Inhibits F1- ATPase from Bovine Mitochondria.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 15
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2007-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.500 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2v7qJ00
1GMJA 2V7QJ 4TT3H 4Z1MH 1HF9A
chains in the Genus database with same CATH superfamily
1PGPA 3HUSB 3BCCJ 1PGOA 1SFCA 3NXSA 3L71G 3H1JJ 2A06G 2IBZE 1AA0A 5KKZC 5GTHH 4PV1C 2AXTE 3RL0g 1YJ9P 1Q7YQ 5AVTB 3USSA 1SFCB 4H44C 2O01H 3BATA 3JC22 5K5GB 5H2FE 5CCHD 1EC5A 1N7SC 1IFIA 2V7QJ 1LWUA 1M90Q 3AEGC 3CCQP 3RL0B 5TISH 1G2CA 4EYYQ 2N1TC 2FFDC 3JCUE 1LWUB 1LTJB 2I1JA 3L74G 2ZYDA 1ZMEC 1G2CB 1GL2A 3CCEP 1KQFB 2IYPA 1FZFA 1Y8AA 2Q3EA 3C9IA 1GL2B 2NZ2A 1HUCA 1W2EA 1U7MA 2LR2A 1BCCD 5L8RJ 3D70A 2WITA 1BDCA 3H6PA 1JCDA 3GLMA 1MKMA 1H88A 2M0BA 3IAOA 4N78D 1RF1B 3AE7C 4JBZA 3VYIA 3PHLA 3V2PA 2P10A 3RBXA 2NPSC 1NTZK 1Q86Q 2W27A 2K3RA 1HF9A 2PFXA 1VQOP 1FS0E 5BU8B 2LXBA 1AQTA 3F89A 1VF5B 2WMMA 1QVGO 2KUBA 3AEFC 5AVSB 2OYIA 2E75C 3L75D 1JM0A 3CWBD 4JPZB 3H1LJ 1X22A 1KILC 2L5GB 2RH0A 2OYIB 3AECC 3H1KD 1LT9A 3PRJA 1T3JA 3L70D 5CCHA 2Q6QA 1LT9B 1NTMJ 4OGQC 2OYHB 1SS1A 1OX3A 2OTKE 1WRGA 3H1IE 3M0DC 4L74A 3RK3C 2KIKA 1SQPJ 2IBZI 2IBZD 1NTZG 5H2FH 1NYHA 2HG5D 1KORA 3G3ZA 1VQNP 3GHGA 2WPQA 2CK3H 2ZYAA 3WUUA 1ZN5A 1BGYE 3H32A 1KV4A 4W7ZA 2WQYC 1NTKJ 1KFMA 3GHGB 1M1JC 1VQPP 3GF7A 3RBZA 1RF0C 5AW2B 1U57A 4AUWA 4CPGA 1FAVA 1Q90D 1ZRTD 2B87B 4Y99C 2FY8A 2C9LY 3JSVC 3SFEC 3L35A 1JMMA 3CXHE 1AQ5A 2WPVB 3MUDA 5KLIB 2FKWB 5KAFH 1Y9BA 4PD4H 3OJAB 3AE5C 1RHZB 1R8EA 3CCJP 2QM8A 1OXZA 1HGZA 2JO1A 1S5LE 1GMJA 4UB8E 2POHA 1H8AA 2H43A 2E43A 4U3FG 4WWIA 4QMAA 4IL6H 3M91A 2R32A 1KB9H 2ZT9D 1GD2E 1BSHA 1KD1Q 3KQGA 4K3AA 4TLFA 2M5AA 1IZNB 1MZ9A 1PZQA 2XZRA 2SPZA 2N9YB 1OVVA 1KILE 2M5AB 5APXA 1BSNA 2HYNA 1ZR2A 4HJGH 4IFDK 2J59M 3I55P 2HPCA 3SWFA 1PPJG 5AW1B 5AW0B 2D2CC 1P84H 2FYUK 4DCKA 1YTZT 2ZJSE 3ZDMA 1L0NE 1R5LA 2RN0A 2O01N 3RK3E 2HPCB 1SQXJ 1SQQG 2BCCG 1SQQJ 3VMYA 1PIXA 2KZJA 1VQMP 2ZXXA 3H1ID 2M3EA 1EZVE 4YXDC 1KYOE 4NPDA 3Q3DA 1N7SD 2QJYB 3CLQA 1NAYA 3AEAC 2YKPA 1YJNP 1BGYD 3QH9A 2Z5IA 2N1TD 1DD3A 1FZEA 2KI7B 2YMYA 3IR9A 5TJHA 3WUTA 2FBWC 2E74D 4Y28J 2FYUG 2ZYGA 1YITP 2FYUJ 2DW3A 2ZXEB 3CCLP 1MV8A 3TGUG 1SQBK 1AVYA 2KYVA 3HTKA 1GU4A 1SQVK 3CXHI 1PP9E 3CXHD 4D6TE 2KNCB 3MZWB 2HLOA 3HTKB 3M9QA 2BASA 3SWKA 2YO2A 5APVA 3H1HE 5E79H 3KYQA 3CI9A 1RY3A 1OWAA 4YPCA 1FZAA 1X9VA 1FZCC 1NVOA 3S1KA 1VQ4P 3RK2C 4M3LA 1IFPA 4GDOA 2QRXA 2NPSD 3L73D 3SFDC 2XNDH 1FBMA 3E7KA 4UB6E 1SQVG 5BVZA 2A45I 4AYCA 5KLVD 3V5BA 1J1EB 1KILD 2Z4EA 1OVRA 1FU1A 3MD0A 4IFMA 5AW4B 1NU1G 1GZLA 1MFTA 1EDIA 5KKZB 1NU1J 4PV1B 1N7SA 4H44B 1GU5A 1BCCE 4OGQD 4RO0A 5AW8B 3L4FA 3RK3D 2XDJA 1N7SB 2N1TA 2FFDA 1N7LA 3VMAA 2KS1A 3AE8C 1HGVA 2K9YA 3BRTB 3C8VA 1OIPA 3L36A 2W6AA 2K9JA 2LXCB 2BEQD 1G1JA 3AEBC 2N1TB 3L72G 1CZQA 1EZVI 2I8DA 1EZVD 2KS1B 1J2JB 3L72J 3KZIE 1Q82Q 1N2DC 5APTA 1KYOI 2YIUC 1KYOD 2K9JB 2VRSA 3L75J 3CWBJ 1EDJA 3HD7C 2KK7A 2Y0DA 5AVVB 1IFJA 1LGHB 1RH5B 3AE2C 5CHXA 2IX7C 1QL1A 3H1KE 2WWWA 3A0HH 1URQC 2WPRA 3L70J 2QJKB 3O6QA 1HH0A 4JYBA 5AVRB 3V4WA 3P8MC 2GUSA 1PP9D 2NPSA 3BCCG 1LTBC 3O6QB 1FC2C 4D6TD 1L4AC 3H1JG 4GT1A 1NKNA 1KZUB 3CC4P 3I56P 3B5NC 2NPSB 2QE7H 2E5TA 3H1HD 1BE3E 4L73A 1KILA 5GTIH 1RE4C 2YKQA 4GIFA 1AJYA 2E75B 5AVYB 5CCGC 3M9HA 2XU6A 1KC8Q 3L71E 4PJ0E 4W7YA 1M56D 4KHXA 3WUVA 2A06E 3CCMP 1DH3A 2K88A 1JY3N 3AE6C 3VMZA 1ZRTE 1L0LK 1Q81Q 1H89A 4DZOA 4BRYA 2HODA 1LP1A 3M0DA 1H0TA 1NO4A 2E74C 2ZFCA 3CCVP 3P8CD 1LTTC 1ZW0A 1IFDA 2BEZF 1YHQP 4BRYB 5B5EH 2D2CD 3RK3B 2J5UA 1M8OB 1SQBD 5B66H 1IFMA 3FGAD 1K9MQ 1M1JA 2O1JA 1VQ9P 3A7OA 4BXLA 3CL3D 5DJUB 3L74E 1RF0A 1VQLP 2GA1A 3Q5PA 2WSCJ 2H88C 1NTMK 4HB1A 1M1JB 4TT3H 4YTPC 2FYNC 1LJ2A 1X8YA 3D6ZA 4LLHA 3W68A 1NWQA 1SQPK 1L0LG 2B89A 1S72P 3CMEP 1L0LJ 2FXMA 4Y99B 1Z56A 1PL5A 1MFZA 3SSUA 4B86A 1QEXA 1NGMB 3VOPA 3QWOC 3HUSC 2KSEA 2AEFA 3WMM0 2NRGA 2KOGA 5BU5A 3S9OA 1NTKK 3H1LG 1S4XA 3BVHA 3CX5E 1GW4A 4ASWA 1G1IA 2K1AA 4H13C 2ZAEB 1EXIA 3CC7P 1FDOA 5AVZB 1AVOA 2XV5A 1NTMG 2ZVNB 5APQA 2CPSA 2KZIA 2I1KA 1K05A 3H1IJ 1VPCA 2AXTH 1UIIA 1N73C 1SQPG 1CW5A 3LW5J 3PP5A 5C39A 2R3SA 1IK7A 1LTJC 1CSBA 3RK2D 1KFNA 1KQGB 1BE3D 4I6MC 1BGYJ 1SP4A 4NPEA 1UIXA 1NTKG 2W6JH 1OW8A 2OYOA 4GODA 3FXDA 3JCUH 1LNQA 1JY3P 3L71D 2YMKA 2O3JA 3AE4C 2J58A 2A06D 3H32B 1NTZE 2D2CB 3GW6A 1LTSC 4WVZA 5KAIE 1X0TA 5AVWB 1M7LA 1QLED 3II6A 4HH2A 4I1LA 2P2UA 4C7NA 3Q2YA 1JTHA 3IFMA 2QSIA 3V2RA 1HJBA 1JY2N 2WSCH 3P7KA 1FE6A 2H89C 3Q5SA 3L74D 3D71A 1K73Q 1PGJA 4C7NB 3VTPC 2B9BA 1SQXK 1JTHB 2MKVA 1W5CE 4OWFA 1GW3A 2QJPB 3OA7A 1SQQK 3L73E 4GOEA 4H0LD 3HD7D 4U3FE 1M57D 5KLVE 4EIJA 2OYHC 2QA4P 3D6YA 5AW5B 1OW7A 1URQD 1SVFA 2IZ0A 3CX5I 3CX5D 1FZCA 3TK1A 4JYCA 5CMZA 4HYTB 3N4XA 1HWTC 1L0NG 3CCRP 1L0NJ 1FOSE 2M3BA 2R44A 1FZCB 1Q2NA 1L4AD 1SQXG 5APSA 3SWYA 2PAJA 1NJIQ 1DX7A 3B5ND 3LW5H 2N9BA 3OW2O 1PPJE 1RQUA 5CCGD 4Z1MH 3A3YB 5DJTB 3U1AA 2WZ7A 1NOHA 3M06A 2OQQA 1YJWP 1ZP0C 1EDLA 2P67A 2YNYA 1ZR4A 1USDA 2BCCE 3AE3C 4YXWH 2R3CA 4XFJA 1SQPD 3CXHH 2IFNA 1YIJP 1NTZD 1PP9J 3GG2A 2C0XA 3MGNA 4D6TJ 3R4YA 1HBWA 1S5LH 3IF4A 3EFFK 4UB8H 2YXRB 5CJ0A 3H1HJ 3G71P 3HD7A 2ZT9B 1NU1K 1JY2P 2YIUB 3NMDA 3TGUE 3U1CA 1CI6A 4I7ZC 1URQA 3LIDA 1OZHA 1S2EA 4O9BA 1KMIZ 2A45H 1URQB 3S4RA 3KHUA 1L4AA 5GTHE 2Q7CA 2E5YA 1FJKA 4U3FD 5KJ7C 3P8CE 2Y0EA 3B5NA 4W80A 1L4AB 3VP9A 4H13D 4XA4A 2OGUA 2WSEJ 1NAFA 1MUUA 5CJ4A 3N7NA 1RE4A 2Y0CA 3B5NB 2PRRA 1BCCJ 5CCGA 2QJYC 5TISE 1SQBE 2AXCA 1IJDB 1RE3C 2QVAA 4BWNA 3CCUP 1SQVE 5AW9B 1OMIA 1KN7A 4WBAA 1GDTA 4U7JA 2V4HA 3RGUA 1VQ8P 1KYOH 3FWLA 1QGKB 4LC1A 4LGDE 4I2LC 2FFDB 1IO4A 1PPJD 2Z5HA 1HTLC 3AE9C 2E74B 3L75G 3CWBG 4H0LC 4DOJA 3H1KG 4AQRD 1SQQD 3TDKA 2BCCD 3H1KJ 2KP8A 3KPEA 3KDPB 3L72E 3AEDC 3L70G 1ZXGA 3CC2P 1HJ0A 1A02F 2HR3A 2FXPA 2YXQB 4WY4C 3VP8A 3A5TA 1VQKP 1D7MA 4RESB 4IFFA 2JJLA 3V2QA 3ITKA 3T97A 2IBZG 5APYA 4EI2A 1E79H 2FYNB 3ABVC 4RJTA 3HUSA 1HVVA 4K35A 1BE3J 1T8ZA 2MJZA 1SLQA 2FYZA 2FYUD 2JDIH 1FDMA 1VQ6P 3A0BE 3G4SP 2IPPA 5KTBA 3TGUD 1S1CX 2JEEA 2XKMA 1JNMA 1GTWA 1VL2A 3BCCE 4C7RA 2E76C 3L71J 1XTGB 1BDDA 3H1JE 1KILB 5AW3B 4UB6H 4H13B 1N8RQ 3I5CA 1VQ7P 1N73A 3CCSP 3G6EP 4OGQB 4R4LA 2WSEH 1LTJA 2HODB 1LP1B 1PV3A 1VDFA 2HFED 1IC2A 1N73B 1H0TB 2JWAA 4ASVA 1K04A 4A7PA 3HE5A 1TU3F 2R5DA 3V6IA 2KLUA 2H8PD 2OARA 2G3AA 3L74J 5CBNA 1FZGA 1SQVD 4IL6X 3HE5B 2WPSA 5KAFE 4PD4E 1AV1A 3KZIH 3TYYA 4ZMDA 5CBOA 1J1DC 3PH0A 4RKUJ 2QJKC 1NU1D 1RF1A 1RQVA 2YKOA 3M9BA 1FZBA 3NTNA 2Q1KA 4IL6E 3E1RA 1USEA 1VQ5P 1KB9E 2KXPB 3O8ZA 1QX8A 1SFCC 1T2KC 1L0LE 3L72D 3BASA 4GOFA 1YQ4C 2UWJE 2WT7A 1U7JA 3H1IG 3GF3A 3WU2E 3H1LE 2RMZA 3LIEA 1OFCX 3RL0C 3EWKA 3A0BH 2WT7B 4OVNF 2OYHA 3U59A 2RKLA 1LWUC 2Y9YA 1BGYG 1IFNA 2IYOA 4WB4A 1JY2O 1P84E 2WSFJ 2G8YA 3VN0A 3H25A 4PJ0H 1NTME 1DEBA 4OH8B 4R4MA 2C9NY 2P58A 2P7JA 1LTAC 3BCCD 3FXEA 1GL2C 3H1JD 1NTZJ 1SQPE 4DJGA 2JKVA 5KJ7D 1S3JA 3IN6A 3NFQA 5KLVK 4L75A 2V7QH 3Q1MA 1PGQA 1DEEG 2B87A 4N3YB 1NTKE 1S5LX 1NKZB 1RF1C 1YYCA 3CMAP 3HE4A 1L2PA 1K8AQ 3TF5A 1VF5C 2ITAA 1L0NK 1EQ7A 2PGDA 3HE4B 2Q3IA 3TSIA 1DIPA 4JQ0D 3L73G 2R5BA 2YO3A 3L73J 4PD4I 4PD4D 2OYIC 2A45G 4EOTA 2WVRA 5KLVG 4KT0J 4U3FJ 5KLVJ 5E79E 5AW6B 5AVQB 1LT9C 1YQ3C 1QL2A 3CX5H 4C46A 1LT1A 2WSSH 2Y9ZA 2L91A 5CCHC 3E1IA 1KB9I 1KB9D 4WY4D 3CD6P 1W2BO 1LTGC 2H7HA 3PLNA 1L0LD 3PJSK 4DT0A 3WU2H 4I7ZB 1JMBA 2IFMA 2IDBA 3GHGC 3RK2B 1PFIA 1FDIA 4KJMA 1NH4A 2XNXA 1OVUA 1EZVG 3H1LD 2ZVOB 1JCCA 5KJ7A 2KLVA 1OW6A 3R2PA 1WMKA 2C0WA 2QG4A 2IZ1A 2W90A 2WSFH 3W67A 1ZOYC 2E76D 1LTIC 4JF7A 4N6JA 4ZKUA 5KLIC 3P32A 1P84I 1P84D 1KTMA 4PV1D 1NTMD 3AE1C 1SQXE 3OAKA 2BCCJ 1A02J 4H44D 1RE3A 5EFWB 1SQQE 2Q5UA 3MUDC 2OTLP 1Y47A 1S9KE 3V2NA 3MIWA 4ZKPA 3HRNA 5KAIH 1PP9G 4D6TG 2JR8A 3M0AA 2WTYA 2QJPC 5M1BA 1NTKD 2K37A 1E5WA 1YTZI 1YI2P 3G9RA 3H1HG 4L76A 2QEXP 5APUA 2KNCA 1KQSO 1GK4A 1T6AA 2E42A 3TGUJ 2FYUE 2AEJA 3PTZA 3A0HE 3MP7B 4H0LB 1FJPA 2M8RA 1JUNA 3HD7B 1YBKA 1NHLA 5AVXB 4NPFX 4EDFA 4WY4A 2KB7P 2PP6A 2JP3A 1DD4A 1CI6B 3B8EB 1X79B 3A2AA 3B4SA 1ZV8A 4GKGA 1JB0J 4WY4B 2O01J 1R5SA 3V4QA 2CPBA 5GTIE 2B88A 4HKZH 1IK9A 3L37A 1ZLLA 3B71A 1SFCD 1T2KD 3FWNA 1SQBG 2W83C 1BCCG 2P1JA 2E75D 1SQBJ 3Q5RA 3K5BA 1XTCC 3VMXA 1SQVJ 3EQ2A 2Q9IA 2GUVA 3MHVA 1JEKA 1M1KQ 5AVUB 3EFGA 3RL0D 2W6BA 2E76B 3BRVB 2AEMA 1FOSF 2O1KA 2W8ZA 5B5EE 2JWDA 1NU1E 3KXDA 1QVFO 2KSJA 1L0ND 5B66E 1GL2D 4N78E 1AFOA 3TNUA 1SQXD 3MTUE 2ZT9C 1EDKA 3UIAA 2FXOA 1S9KD 3TNUB 2OTJP 5AW7B 1JY3O 2QM7A 4MN4C 4IOIH 1JO5A 3CPWO 3L75E 3CWBE 2GM4A 3F5HA 1EXJA 1GK6A 3GMAA 1J1DB 1VF5D 3FX0A 1JOCA 1T3UA 2QIWA 3AEEC 1BE3G 4XE5B 3L70E 1WT6A 4ZNCA 3T97B 2LKMA 3C1LA 1J1EC 5APWA 1KQLA 1N86A
chains in the Genus database with same CATH topology
3D6YA 3AE2C 1OW7A 1Q90D 3RK3E 4GDOA 3GF3A 2P10A 3FGAD 1UIXA 3SFEC 2ZT9B 1OW8A 4OGQB 2WPVB 3AE9C 4R4LA 1HF9A 2E76B 3O6QA 2E74B 3SFDC 3Q5PA 3EWKA 5KKZC 4H0LC 4KT0J 1Y9BA 2WSCJ 4PV1C 2H88C 1VF5B 3RL0g 1PIXA 1PV3A 3AEFC 2YMKA 2QJPC 4H44C 3AE5C 5M1BA 4I7ZC 3AE4C 1YQ3C 1R8EA 4TT3H 2E75C 4YTPC 1K04A 2FYNC 4YXDC 2D2CB 1TU3F 2JO1A 2WSFJ 3G9RA 3D6ZA 3Q3DA 1GMJA 2G8YA 3H25A 2G3AA 3AEDC 4R4MA 3AECC 1KMIZ 2V7QJ 3AEAC 1HJ0A 1PL5A 2FXPA 4IL6X 3AEGC 1NGMB 1DD3A 4H0LB 4PV1B 2ZT9D 4H44B 3S9OA 3IN6A 4I7ZB 1RQUA 2FBWC 4OGQD 4RKUJ 2ZT9C 2E74D 4OGQC 1AJYA 4Z1MH 2E75B 2QJKC 4Y28J 3ABVC 1ZMEC 2IDBA 3Q2YA 2JP3A 1DD4A 1FDIA 3Q1MA 2OQQA 2QSIA 1RQVA 4H13D 1ZP0C 1KQFB 2WSEJ 4H13C 3AE8C 1EXIA 2K9YA 3C8VA 1S5LX 2H89C 1FDOA 3Q5SA 3AE3C 1JB0J 1NYHA 3AE6C 3D71A 1KORA 1OW6A 1KILE 2O01J 2MKVA 1WMKA 1ZRTE 2NZ2A 2QJYC 4XFJA 2BEQD 1S1CX 3AEBC 1EXJA 1ZOYC 2E76D 3GMAA 1VL2A 1K05A 2E76C 5KLIC 2E74C 1OMIA 2YIUC 1VF5D 5L8RJ 3B71A 1VF5C 2QIWA 2WQYC 3AEEC 4H0LD 1KTMA 4PV1D 3D70A 4U7JA 3AE1C 2BEZF 3LW5J 4H44D 3GF7A 2D2CD 3R4YA 3GLMA 2J5UA 1MKMA 4H13B 3T97B 2D2CC 2E75D 3Q5RA 1U57A 1YQ4C 1IK7A 1DIPA 3IAOA 1KQGB 3AE7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GMJ A;  2V7Q J;  4TT3 H;  4Z1M H;  1HF9 A; 
#chains in the Genus database with same CATH topology
 1PGP A;  3HUS B;  3BCC J;  1PGO A;  1SFC A;  3NXS A;  3L71 G;  3H1J J;  2A06 G;  2IBZ E;  1AA0 A;  5KKZ C;  5GTH H;  4PV1 C;  2AXT E;  3RL0 g;  1YJ9 P;  1Q7Y Q;  5AVT B;  3USS A;  1SFC B;  4H44 C;  2O01 H;  3BAT A;  3JC2 2;  5K5G B;  5H2F E;  5CCH D;  1EC5 A;  1N7S C;  1IFI A;  2V7Q J;  1LWU A;  1M90 Q;  3AEG C;  3CCQ P;  3RL0 B;  5TIS H;  1G2C A;  4EYY Q;  2N1T C;  2FFD C;  3JCU E;  1LWU B;  1LTJ B;  2I1J A;  3L74 G;  2ZYD A;  1ZME C;  1G2C B;  1GL2 A;  3CCE P;  1KQF B;  2IYP A;  1FZF A;  1Y8A A;  2Q3E A;  3C9I A;  1GL2 B;  2NZ2 A;  1HUC A;  1W2E A;  1U7M A;  2LR2 A;  1BCC D;  5L8R J;  3D70 A;  2WIT A;  1BDC A;  3H6P A;  1JCD A;  3GLM A;  1MKM A;  1H88 A;  2M0B A;  3IAO A;  4N78 D;  1RF1 B;  3AE7 C;  4JBZ A;  3VYI A;  3PHL A;  3V2P A;  2P10 A;  3RBX A;  2NPS C;  1NTZ K;  1Q86 Q;  2W27 A;  2K3R A;  1HF9 A;  2PFX A;  1VQO P;  1FS0 E;  5BU8 B;  2LXB A;  1AQT A;  3F89 A;  1VF5 B;  2WMM A;  1QVG O;  2KUB A;  3AEF C;  5AVS B;  2OYI A;  2E75 C;  3L75 D;  1JM0 A;  3CWB D;  4JPZ B;  3H1L J;  1X22 A;  1KIL C;  2L5G B;  2RH0 A;  2OYI B;  3AEC C;  3H1K D;  1LT9 A;  3PRJ A;  1T3J A;  3L70 D;  5CCH A;  2Q6Q A;  1LT9 B;  1NTM J;  4OGQ C;  2OYH B;  1SS1 A;  1OX3 A;  2OTK E;  1WRG A;  3H1I E;  3M0D C;  4L74 A;  3RK3 C;  2KIK A;  1SQP J;  2IBZ I;  2IBZ D;  1NTZ G;  5H2F H;  1NYH A;  2HG5 D;  1KOR A;  3G3Z A;  1VQN P;  3GHG A;  2WPQ A;  2CK3 H;  2ZYA A;  3WUU A;  1ZN5 A;  1BGY E;  3H32 A;  1KV4 A;  4W7Z A;  2WQY C;  1NTK J;  1KFM A;  3GHG B;  1M1J C;  1VQP P;  3GF7 A;  3RBZ A;  1RF0 C;  5AW2 B;  1U57 A;  4AUW A;  4CPG A;  1FAV A;  1Q90 D;  1ZRT D;  2B87 B;  4Y99 C;  2FY8 A;  2C9L Y;  3JSV C;  3SFE C;  3L35 A;  1JMM A;  3CXH E;  1AQ5 A;  2WPV B;  3MUD A;  5KLI B;  2FKW B;  5KAF H;  1Y9B A;  4PD4 H;  3OJA B;  3AE5 C;  1RHZ B;  1R8E A;  3CCJ P;  2QM8 A;  1OXZ A;  1HGZ A;  2JO1 A;  1S5L E;  1GMJ A;  4UB8 E;  2POH A;  1H8A A;  2H43 A;  2E43 A;  4U3F G;  4WWI A;  4QMA A;  4IL6 H;  3M91 A;  2R32 A;  1KB9 H;  2ZT9 D;  1GD2 E;  1BSH A;  1KD1 Q;  3KQG A;  4K3A A;  4TLF A;  2M5A A;  1IZN B;  1MZ9 A;  1PZQ A;  2XZR A;  2SPZ A;  2N9Y B;  1OVV A;  1KIL E;  2M5A B;  5APX A;  1BSN A;  2HYN A;  1ZR2 A;  4HJG H;  4IFD K;  2J59 M;  3I55 P;  2HPC A;  3SWF A;  1PPJ G;  5AW1 B;  5AW0 B;  2D2C C;  1P84 H;  2FYU K;  4DCK A;  1YTZ T;  2ZJS E;  3ZDM A;  1L0N E;  1R5L A;  2RN0 A;  2O01 N;  3RK3 E;  2HPC B;  1SQX J;  1SQQ G;  2BCC G;  1SQQ J;  3VMY A;  1PIX A;  2KZJ A;  1VQM P;  2ZXX A;  3H1I D;  2M3E A;  1EZV E;  4YXD C;  1KYO E;  4NPD A;  3Q3D A;  1N7S D;  2QJY B;  3CLQ A;  1NAY A;  3AEA C;  2YKP A;  1YJN P;  1BGY D;  3QH9 A;  2Z5I A;  2N1T D;  1DD3 A;  1FZE A;  2KI7 B;  2YMY A;  3IR9 A;  5TJH A;  3WUT A;  2FBW C;  2E74 D;  4Y28 J;  2FYU G;  2ZYG A;  1YIT P;  2FYU J;  2DW3 A;  2ZXE B;  3CCL P;  1MV8 A;  3TGU G;  1SQB K;  1AVY A;  2KYV A;  3HTK A;  1GU4 A;  1SQV K;  3CXH I;  1PP9 E;  3CXH D;  4D6T E;  2KNC B;  3MZW B;  2HLO A;  3HTK B;  3M9Q A;  2BAS A;  3SWK A;  2YO2 A;  5APV A;  3H1H E;  5E79 H;  3KYQ A;  3CI9 A;  1RY3 A;  1OWA A;  4YPC A;  1FZA A;  1X9V A;  1FZC C;  1NVO A;  3S1K A;  1VQ4 P;  3RK2 C;  4M3L A;  1IFP A;  4GDO A;  2QRX A;  2NPS D;  3L73 D;  3SFD C;  2XND H;  1FBM A;  3E7K A;  4UB6 E;  1SQV G;  5BVZ A;  2A45 I;  4AYC A;  5KLV D;  3V5B A;  1J1E B;  1KIL D;  2Z4E A;  1OVR A;  1FU1 A;  3MD0 A;  4IFM A;  5AW4 B;  1NU1 G;  1GZL A;  1MFT A;  1EDI A;  5KKZ B;  1NU1 J;  4PV1 B;  1N7S A;  4H44 B;  1GU5 A;  1BCC E;  4OGQ D;  4RO0 A;  5AW8 B;  3L4F A;  3RK3 D;  2XDJ A;  1N7S B;  2N1T A;  2FFD A;  1N7L A;  3VMA A;  2KS1 A;  3AE8 C;  1HGV A;  2K9Y A;  3BRT B;  3C8V A;  1OIP A;  3L36 A;  2W6A A;  2K9J A;  2LXC B;  2BEQ D;  1G1J A;  3AEB C;  2N1T B;  3L72 G;  1CZQ A;  1EZV I;  2I8D A;  1EZV D;  2KS1 B;  1J2J B;  3L72 J;  3KZI E;  1Q82 Q;  1N2D C;  5APT A;  1KYO I;  2YIU C;  1KYO D;  2K9J B;  2VRS A;  3L75 J;  3CWB J;  1EDJ A;  3HD7 C;  2KK7 A;  2Y0D A;  5AVV B;  1IFJ A;  1LGH B;  1RH5 B;  3AE2 C;  5CHX A;  2IX7 C;  1QL1 A;  3H1K E;  2WWW A;  3A0H H;  1URQ C;  2WPR A;  3L70 J;  2QJK B;  3O6Q A;  1HH0 A;  4JYB A;  5AVR B;  3V4W A;  3P8M C;  2GUS A;  1PP9 D;  2NPS A;  3BCC G;  1LTB C;  3O6Q B;  1FC2 C;  4D6T D;  1L4A C;  3H1J G;  4GT1 A;  1NKN A;  1KZU B;  3CC4 P;  3I56 P;  3B5N C;  2NPS B;  2QE7 H;  2E5T A;  3H1H D;  1BE3 E;  4L73 A;  1KIL A;  5GTI H;  1RE4 C;  2YKQ A;  4GIF A;  1AJY A;  2E75 B;  5AVY B;  5CCG C;  3M9H A;  2XU6 A;  1KC8 Q;  3L71 E;  4PJ0 E;  4W7Y A;  1M56 D;  4KHX A;  3WUV A;  2A06 E;  3CCM P;  1DH3 A;  2K88 A;  1JY3 N;  3AE6 C;  3VMZ A;  1ZRT E;  1L0L K;  1Q81 Q;  1H89 A;  4DZO A;  4BRY A;  2HOD A;  1LP1 A;  3M0D A;  1H0T A;  1NO4 A;  2E74 C;  2ZFC A;  3CCV P;  3P8C D;  1LTT C;  1ZW0 A;  1IFD A;  2BEZ F;  1YHQ P;  4BRY B;  5B5E H;  2D2C D;  3RK3 B;  2J5U A;  1M8O B;  1SQB D;  5B66 H;  1IFM A;  3FGA D;  1K9M Q;  1M1J A;  2O1J A;  1VQ9 P;  3A7O A;  4BXL A;  3CL3 D;  5DJU B;  3L74 E;  1RF0 A;  1VQL P;  2GA1 A;  3Q5P A;  2WSC J;  2H88 C;  1NTM K;  4HB1 A;  1M1J B;  4TT3 H;  4YTP C;  2FYN C;  1LJ2 A;  1X8Y A;  3D6Z A;  4LLH A;  3W68 A;  1NWQ A;  1SQP K;  1L0L G;  2B89 A;  1S72 P;  3CME P;  1L0L J;  2FXM A;  4Y99 B;  1Z56 A;  1PL5 A;  1MFZ A;  3SSU A;  4B86 A;  1QEX A;  1NGM B;  3VOP A;  3QWO C;  3HUS C;  2KSE A;  2AEF A;  3WMM 0;  2NRG A;  2KOG A;  5BU5 A;  3S9O A;  1NTK K;  3H1L G;  1S4X A;  3BVH A;  3CX5 E;  1GW4 A;  4ASW A;  1G1I A;  2K1A A;  4H13 C;  2ZAE B;  1EXI A;  3CC7 P;  1FDO A;  5AVZ B;  1AVO A;  2XV5 A;  1NTM G;  2ZVN B;  5APQ A;  2CPS A;  2KZI A;  2I1K A;  1K05 A;  3H1I J;  1VPC A;  2AXT H;  1UII A;  1N73 C;  1SQP G;  1CW5 A;  3LW5 J;  3PP5 A;  5C39 A;  2R3S A;  1IK7 A;  1LTJ C;  1CSB A;  3RK2 D;  1KFN A;  1KQG B;  1BE3 D;  4I6M C;  1BGY J;  1SP4 A;  4NPE A;  1UIX A;  1NTK G;  2W6J H;  1OW8 A;  2OYO A;  4GOD A;  3FXD A;  3JCU H;  1LNQ A;  1JY3 P;  3L71 D;  2YMK A;  2O3J A;  3AE4 C;  2J58 A;  2A06 D;  3H32 B;  1NTZ E;  2D2C B;  3GW6 A;  1LTS C;  4WVZ A;  5KAI E;  1X0T A;  5AVW B;  1M7L A;  1QLE D;  3II6 A;  4HH2 A;  4I1L A;  2P2U A;  4C7N A;  3Q2Y A;  1JTH A;  3IFM A;  2QSI A;  3V2R A;  1HJB A;  1JY2 N;  2WSC H;  3P7K A;  1FE6 A;  2H89 C;  3Q5S A;  3L74 D;  3D71 A;  1K73 Q;  1PGJ A;  4C7N B;  3VTP C;  2B9B A;  1SQX K;  1JTH B;  2MKV A;  1W5C E;  4OWF A;  1GW3 A;  2QJP B;  3OA7 A;  1SQQ K;  3L73 E;  4GOE A;  4H0L D;  3HD7 D;  4U3F E;  1M57 D;  5KLV E;  4EIJ A;  2OYH C;  2QA4 P;  3D6Y A;  5AW5 B;  1OW7 A;  1URQ D;  1SVF A;  2IZ0 A;  3CX5 I;  3CX5 D;  1FZC A;  3TK1 A;  4JYC A;  5CMZ A;  4HYT B;  3N4X A;  1HWT C;  1L0N G;  3CCR P;  1L0N J;  1FOS E;  2M3B A;  2R44 A;  1FZC B;  1Q2N A;  1L4A D;  1SQX G;  5APS A;  3SWY A;  2PAJ A;  1NJI Q;  1DX7 A;  3B5N D;  3LW5 H;  2N9B A;  3OW2 O;  1PPJ E;  1RQU A;  5CCG D;  4Z1M H;  3A3Y B;  5DJT B;  3U1A A;  2WZ7 A;  1NOH A;  3M06 A;  2OQQ A;  1YJW P;  1ZP0 C;  1EDL A;  2P67 A;  2YNY A;  1ZR4 A;  1USD A;  2BCC E;  3AE3 C;  4YXW H;  2R3C A;  4XFJ A;  1SQP D;  3CXH H;  2IFN A;  1YIJ P;  1NTZ D;  1PP9 J;  3GG2 A;  2C0X A;  3MGN A;  4D6T J;  3R4Y A;  1HBW A;  1S5L H;  3IF4 A;  3EFF K;  4UB8 H;  2YXR B;  5CJ0 A;  3H1H J;  3G71 P;  3HD7 A;  2ZT9 B;  1NU1 K;  1JY2 P;  2YIU B;  3NMD A;  3TGU E;  3U1C A;  1CI6 A;  4I7Z C;  1URQ A;  3LID A;  1OZH A;  1S2E A;  4O9B A;  1KMI Z;  2A45 H;  1URQ B;  3S4R A;  3KHU A;  1L4A A;  5GTH E;  2Q7C A;  2E5Y A;  1FJK A;  4U3F D;  5KJ7 C;  3P8C E;  2Y0E A;  3B5N A;  4W80 A;  1L4A B;  3VP9 A;  4H13 D;  4XA4 A;  2OGU A;  2WSE J;  1NAF A;  1MUU A;  5CJ4 A;  3N7N A;  1RE4 A;  2Y0C A;  3B5N B;  2PRR A;  1BCC J;  5CCG A;  2QJY C;  5TIS E;  1SQB E;  2AXC A;  1IJD B;  1RE3 C;  2QVA A;  4BWN A;  3CCU P;  1SQV E;  5AW9 B;  1OMI A;  1KN7 A;  4WBA A;  1GDT A;  4U7J A;  2V4H A;  3RGU A;  1VQ8 P;  1KYO H;  3FWL A;  1QGK B;  4LC1 A;  4LGD E;  4I2L C;  2FFD B;  1IO4 A;  1PPJ D;  2Z5H A;  1HTL C;  3AE9 C;  2E74 B;  3L75 G;  3CWB G;  4H0L C;  4DOJ A;  3H1K G;  4AQR D;  1SQQ D;  3TDK A;  2BCC D;  3H1K J;  2KP8 A;  3KPE A;  3KDP B;  3L72 E;  3AED C;  3L70 G;  1ZXG A;  3CC2 P;  1HJ0 A;  1A02 F;  2HR3 A;  2FXP A;  2YXQ B;  4WY4 C;  3VP8 A;  3A5T A;  1VQK P;  1D7M A;  4RES B;  4IFF A;  2JJL A;  3V2Q A;  3ITK A;  3T97 A;  2IBZ G;  5APY A;  4EI2 A;  1E79 H;  2FYN B;  3ABV C;  4RJT A;  3HUS A;  1HVV A;  4K35 A;  1BE3 J;  1T8Z A;  2MJZ A;  1SLQ A;  2FYZ A;  2FYU D;  2JDI H;  1FDM A;  1VQ6 P;  3A0B E;  3G4S P;  2IPP A;  5KTB A;  3TGU D;  1S1C X;  2JEE A;  2XKM A;  1JNM A;  1GTW A;  1VL2 A;  3BCC E;  4C7R A;  2E76 C;  3L71 J;  1XTG B;  1BDD A;  3H1J E;  1KIL B;  5AW3 B;  4UB6 H;  4H13 B;  1N8R Q;  3I5C A;  1VQ7 P;  1N73 A;  3CCS P;  3G6E P;  4OGQ B;  4R4L A;  2WSE H;  1LTJ A;  2HOD B;  1LP1 B;  1PV3 A;  1VDF A;  2HFE D;  1IC2 A;  1N73 B;  1H0T B;  2JWA A;  4ASV A;  1K04 A;  4A7P A;  3HE5 A;  1TU3 F;  2R5D A;  3V6I A;  2KLU A;  2H8P D;  2OAR A;  2G3A A;  3L74 J;  5CBN A;  1FZG A;  1SQV D;  4IL6 X;  3HE5 B;  2WPS A;  5KAF E;  4PD4 E;  1AV1 A;  3KZI H;  3TYY A;  4ZMD A;  5CBO A;  1J1D C;  3PH0 A;  4RKU J;  2QJK C;  1NU1 D;  1RF1 A;  1RQV A;  2YKO A;  3M9B A;  1FZB A;  3NTN A;  2Q1K A;  4IL6 E;  3E1R A;  1USE A;  1VQ5 P;  1KB9 E;  2KXP B;  3O8Z A;  1QX8 A;  1SFC C;  1T2K C;  1L0L E;  3L72 D;  3BAS A;  4GOF A;  1YQ4 C;  2UWJ E;  2WT7 A;  1U7J A;  3H1I G;  3GF3 A;  3WU2 E;  3H1L E;  2RMZ A;  3LIE A;  1OFC X;  3RL0 C;  3EWK A;  3A0B H;  2WT7 B;  4OVN F;  2OYH A;  3U59 A;  2RKL A;  1LWU C;  2Y9Y A;  1BGY G;  1IFN A;  2IYO A;  4WB4 A;  1JY2 O;  1P84 E;  2WSF J;  2G8Y A;  3VN0 A;  3H25 A;  4PJ0 H;  1NTM E;  1DEB A;  4OH8 B;  4R4M A;  2C9N Y;  2P58 A;  2P7J A;  1LTA C;  3BCC D;  3FXE A;  1GL2 C;  3H1J D;  1NTZ J;  1SQP E;  4DJG A;  2JKV A;  5KJ7 D;  1S3J A;  3IN6 A;  3NFQ A;  5KLV K;  4L75 A;  2V7Q H;  3Q1M A;  1PGQ A;  1DEE G;  2B87 A;  4N3Y B;  1NTK E;  1S5L X;  1NKZ B;  1RF1 C;  1YYC A;  3CMA P;  3HE4 A;  1L2P A;  1K8A Q;  3TF5 A;  1VF5 C;  2ITA A;  1L0N K;  1EQ7 A;  2PGD A;  3HE4 B;  2Q3I A;  3TSI A;  1DIP A;  4JQ0 D;  3L73 G;  2R5B A;  2YO3 A;  3L73 J;  4PD4 I;  4PD4 D;  2OYI C;  2A45 G;  4EOT A;  2WVR A;  5KLV G;  4KT0 J;  4U3F J;  5KLV J;  5E79 E;  5AW6 B;  5AVQ B;  1LT9 C;  1YQ3 C;  1QL2 A;  3CX5 H;  4C46 A;  1LT1 A;  2WSS H;  2Y9Z A;  2L91 A;  5CCH C;  3E1I A;  1KB9 I;  1KB9 D;  4WY4 D;  3CD6 P;  1W2B O;  1LTG C;  2H7H A;  3PLN A;  1L0L D;  3PJS K;  4DT0 A;  3WU2 H;  4I7Z B;  1JMB A;  2IFM A;  2IDB A;  3GHG C;  3RK2 B;  1PFI A;  1FDI A;  4KJM A;  1NH4 A;  2XNX A;  1OVU A;  1EZV G;  3H1L D;  2ZVO B;  1JCC A;  5KJ7 A;  2KLV A;  1OW6 A;  3R2P A;  1WMK A;  2C0W A;  2QG4 A;  2IZ1 A;  2W90 A;  2WSF H;  3W67 A;  1ZOY C;  2E76 D;  1LTI C;  4JF7 A;  4N6J A;  4ZKU A;  5KLI C;  3P32 A;  1P84 I;  1P84 D;  1KTM A;  4PV1 D;  1NTM D;  3AE1 C;  1SQX E;  3OAK A;  2BCC J;  1A02 J;  4H44 D;  1RE3 A;  5EFW B;  1SQQ E;  2Q5U A;  3MUD C;  2OTL P;  1Y47 A;  1S9K E;  3V2N A;  3MIW A;  4ZKP A;  3HRN A;  5KAI H;  1PP9 G;  4D6T G;  2JR8 A;  3M0A A;  2WTY A;  2QJP C;  5M1B A;  1NTK D;  2K37 A;  1E5W A;  1YTZ I;  1YI2 P;  3G9R A;  3H1H G;  4L76 A;  2QEX P;  5APU A;  2KNC A;  1KQS O;  1GK4 A;  1T6A A;  2E42 A;  3TGU J;  2FYU E;  2AEJ A;  3PTZ A;  3A0H E;  3MP7 B;  4H0L B;  1FJP A;  2M8R A;  1JUN A;  3HD7 B;  1YBK A;  1NHL A;  5AVX B;  4NPF X;  4EDF A;  4WY4 A;  2KB7 P;  2PP6 A;  2JP3 A;  1DD4 A;  1CI6 B;  3B8E B;  1X79 B;  3A2A A;  3B4S A;  1ZV8 A;  4GKG A;  1JB0 J;  4WY4 B;  2O01 J;  1R5S A;  3V4Q A;  2CPB A;  5GTI E;  2B88 A;  4HKZ H;  1IK9 A;  3L37 A;  1ZLL A;  3B71 A;  1SFC D;  1T2K D;  3FWN A;  1SQB G;  2W83 C;  1BCC G;  2P1J A;  2E75 D;  1SQB J;  3Q5R A;  3K5B A;  1XTC C;  3VMX A;  1SQV J;  3EQ2 A;  2Q9I A;  2GUV A;  3MHV A;  1JEK A;  1M1K Q;  5AVU B;  3EFG A;  3RL0 D;  2W6B A;  2E76 B;  3BRV B;  2AEM A;  1FOS F;  2O1K A;  2W8Z A;  5B5E E;  2JWD A;  1NU1 E;  3KXD A;  1QVF O;  2KSJ A;  1L0N D;  5B66 E;  1GL2 D;  4N78 E;  1AFO A;  3TNU A;  1SQX D;  3MTU E;  2ZT9 C;  1EDK A;  3UIA A;  2FXO A;  1S9K D;  3TNU B;  2OTJ P;  5AW7 B;  1JY3 O;  2QM7 A;  4MN4 C;  4IOI H;  1JO5 A;  3CPW O;  3L75 E;  3CWB E;  2GM4 A;  3F5H A;  1EXJ A;  1GK6 A;  3GMA A;  1J1D B;  1VF5 D;  3FX0 A;  1JOC A;  1T3U A;  2QIW A;  3AEE C;  1BE3 G;  4XE5 B;  3L70 E;  1WT6 A;  4ZNC A;  3T97 B;  2LKM A;  3C1L A;  1J1E C;  5APW A;  1KQL A;  1N86 A; 
#chains in the Genus database with same CATH homology
 3D6Y A;  3AE2 C;  1OW7 A;  1Q90 D;  3RK3 E;  4GDO A;  3GF3 A;  2P10 A;  3FGA D;  1UIX A;  3SFE C;  2ZT9 B;  1OW8 A;  4OGQ B;  2WPV B;  3AE9 C;  4R4L A;  1HF9 A;  2E76 B;  3O6Q A;  2E74 B;  3SFD C;  3Q5P A;  3EWK A;  5KKZ C;  4H0L C;  4KT0 J;  1Y9B A;  2WSC J;  4PV1 C;  2H88 C;  1VF5 B;  3RL0 g;  1PIX A;  1PV3 A;  3AEF C;  2YMK A;  2QJP C;  4H44 C;  3AE5 C;  5M1B A;  4I7Z C;  3AE4 C;  1YQ3 C;  1R8E A;  4TT3 H;  2E75 C;  4YTP C;  1K04 A;  2FYN C;  4YXD C;  2D2C B;  1TU3 F;  2JO1 A;  2WSF J;  3G9R A;  3D6Z A;  3Q3D A;  1GMJ A;  2G8Y A;  3H25 A;  2G3A A;  3AED C;  4R4M A;  3AEC C;  1KMI Z;  2V7Q J;  3AEA C;  1HJ0 A;  1PL5 A;  2FXP A;  4IL6 X;  3AEG C;  1NGM B;  1DD3 A;  4H0L B;  4PV1 B;  2ZT9 D;  4H44 B;  3S9O A;  3IN6 A;  4I7Z B;  1RQU A;  2FBW C;  4OGQ D;  4RKU J;  2ZT9 C;  2E74 D;  4OGQ C;  1AJY A;  4Z1M H;  2E75 B;  2QJK C;  4Y28 J;  3ABV C;  1ZME C;  2IDB A;  3Q2Y A;  2JP3 A;  1DD4 A;  1FDI A;  3Q1M A;  2OQQ A;  2QSI A;  1RQV A;  4H13 D;  1ZP0 C;  1KQF B;  2WSE J;  4H13 C;  3AE8 C;  1EXI A;  2K9Y A;  3C8V A;  1S5L X;  2H89 C;  1FDO A;  3Q5S A;  3AE3 C;  1JB0 J;  1NYH A;  3AE6 C;  3D71 A;  1KOR A;  1OW6 A;  1KIL E;  2O01 J;  2MKV A;  1WMK A;  1ZRT E;  2NZ2 A;  2QJY C;  4XFJ A;  2BEQ D;  1S1C X;  3AEB C;  1EXJ A;  1ZOY C;  2E76 D;  3GMA A;  1VL2 A;  1K05 A;  2E76 C;  5KLI C;  2E74 C;  1OMI A;  2YIU C;  1VF5 D;  5L8R J;  3B71 A;  1VF5 C;  2QIW A;  2WQY C;  3AEE C;  4H0L D;  1KTM A;  4PV1 D;  3D70 A;  4U7J A;  3AE1 C;  2BEZ F;  3LW5 J;  4H44 D;  3GF7 A;  2D2C D;  3R4Y A;  3GLM A;  2J5U A;  1MKM A;  4H13 B;  3T97 B;  2D2C C;  2E75 D;  3Q5R A;  1U57 A;  1YQ4 C;  1IK7 A;  1DIP A;  3IAO A;  1KQG B;  3AE7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...