4PJ0H

Structure of t.elongatus photosystem ii, rows of dimers crystal packing
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
pubmed doi rcsb
molecule tags Oxidoreductase, electron transport
molecule keywords Photosystem Q(B) protein 1
total genus 14
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 4pj0H01
5B5EH 3A0HH 2AXTH 4PJ0H 5GTHH 5KAFH 5B66H 1S5LH 4IL6H 4UB8H 5H2FH 5KAIH 3JCUH 5GTIH 3A0BH 5E79H 5TISH 3WU2H 3KZIH 4UB6H
chains in the Genus database with same CATH superfamily
2O3JA 1VQ6P 1AJYA 3KQGA 2LR2A 4IFDK 2O1KA 1VQOP 2IFNA 3L71D 1NO4A 1JMBA 3HUSC 5CCGD 3PP5A 5TISH 3NFQA 4PJ0E 3GW6A 3WUTA 3CCLP 2E5TA 4D6TD 2PRRA 5KKZC 1SQBD 2ZAEB 4IFFA 1L2PA 2WSCJ 3OJAB 4EYYQ 5KAIH 1YIJP 2M5AA 1UIXA 1KYOI 2W83C 2XV5A 5KJ7A 3AE4C 1XTGB 1LGHB 3ABVC 1L0NG 3Q1MA 1VQMP 1GK6A 2FFDB 4H44B 3M0DA 3RBXA 2IPPA 2LXCB 3AE5C 4U3FJ 1SQXJ 1L0LD 1SQXG 1IC2A 2JDIH 2QJYC 2JR8A 1S5LH 1SQBJ 4I6MC 1Q81Q 2WSEJ 2R44A 1KORA 1CZQA 3SSUA 3D6YA 4C7RA 1KQGB 3M0DC 1ZW0A 2QJKB 2WSCH 1JEKA 3CCEP 3JCUH 1NKNA 3L4FA 3A3YB 1LTIC 2OYIA 5AVYB 1BGYD 3HE5A 4AYCA 4OH8B 5K5GB 1GU5A 1EXIA 2VRSA 3H1HD 1HUCA 3CXHE 3H1IE 2OYIC 1CI6B 3H1LJ 4EIJA 2Q5UA 3CCQP 1OW8A 2IBZI 1U57A 2JEEA 2Y9YA 3CWBG 3C9IA 5AW0B 3G4SP 3RK3E 1JB0J 2WSFH 2H8PD 3S1KA 3VP9A 2OYHB 1GL2C 3VYIA 1L0ND 1NH4A 3M91A 1RF1B 2D2CB 3LIDA 2QM8A 1L0LG 1KB9E 5AW3B 1URQB 1VQ7P 1P84H 2AXTE 1DEBA 2HG5D 3N4XA 1URQC 3MD0A 3A7OA 5APQA 2BASA 2KOGA 1FZEA 1GK4A 3H1JD 2R3SA 3L72J 5AW9B 3UIAA 1PGOA 2OTJP 3H25A 1JO5A 3AE7C 1S4XA 2QA4P 1SQQE 2AXCA 1LWUC 3TYYA 2JJLA 3IF4A 3B71A 5TISE 2B88A 5TJHA 1OXZA 1SLQA 2PAJA 2RH0A 3AE3C 3AE2C 3L36A 4JPZB 5CBOA 5CCGA 1LTGC 1K8AQ 2A45H 1LTJC 1ZRTE 2BCCD 1DD3A 1FAVA 5GTHH 2OARA 1BCCJ 4WWIA 4LGDE 2W6AA 2Z5HA 2IBZE 1BSHA 1EDKA 3HE5B 1NOHA 3BATA 1LTJA 2YMYA 2WSSH 2FKWB 2WPSA 2QRXA 1VQ4P 2B9BA 4R4MA 2PP6A 5KJ7D 2K9JB 2C0WA 3HUSB 2A06E 1L4AD 2KZIA 2QVAA 3I5CA 2P7JA 2GUVA 3JSVC 3L74J 2OQQA 3AECC 4I7ZC 2KUBA 1NTZJ 4GODA 4KT0J 4EDFA 1NJIQ 2QIWA 5AVZB 3MUDA 3H32B 1HVVA 3GLMA 4EOTA 3RL0D 5B66E 1OW7A 5KLIC 1EZVD 1NTKE 3CCMP 1LNQA 3AEBC 1IK7A 2RMZA 2MKVA 3G3ZA 3LIEA 1YHQP 1IJDB 4OGQB 1JMMA 1LT9B 1Q90D 3BASA 2W6JH 3H1LD 3C1LA 3LW5J 1LT9C 2WSEH 4YTPC 1W2BO 2OYIB 1LWUA 3V2RA 1SS1A 1SQPG 3BRTB 1VQ5P 4WBAA 1IFMA 1LTTC 4NPEA 1CI6A 1M8OB 1S72P 2WPVB 3GG2A 4Y28J 1OMIA 1GL2B 2R32A 3FX0A 3V2PA 1KYOE 2JWAA 1PGJA 3PRJA 5APSA 3CCUP 4GT1A 5CJ0A 1ZLLA 3PJSK 1LTAC 2C9LY 3GMAA 3M0AA 4D6TJ 3N7NA 1Q82Q 2LKMA 1NTZK 1VPCA 2FYZA 3A0HE 4HH2A 4JBZA 3H1HJ 4LLHA 1JNMA 4N6JA 2IZ0A 5AW8B 3GHGC 4H13C 2XZRA 1YJWP 3Q5RA 2A06D 3HE4B 3M9HA 3MUDC 3GF7A 1FZFA 3BCCG 1RF1C 1GL2D 1GTWA 1FZBA 3H6PA 3ZDMA 2KNCA 3IN6A 2K88A 3HD7D 1G2CB 1IFJA 2E74C 3GF3A 2A45G 2Q9IA 3BCCD 1NTMK 1HJ0A 2KS1A 2OGUA 2QJKC 2ZXXA 3L70G 4NPFX 2YIUB 2AEFA 5AVUB 3M9BA 3Q2YA 4BRYA 3E1IA 3BVHA 4H44C 1ZOYC 1ZP0C 1YI2P 1GW4A 1VL2A 2KLVA 2WQYC 4R4LA 5CMZA 1AV1A 3VTPC 1U7MA 1R5LA 1JY2N 1CW5A 5AW1B 1YQ4C 3FXEA 1PL5A 3L73G 1JY2P 3MTUE 2XU6A 4D6TG 1VQLP 4OWFA 3O8ZA 3RL0C 2KLUA 2POHA 3HUSA 1RH5B 1EC5A 4C46A 5GTIH 1VQKP 1DIPA 1BDCA 1SQVD 3L75J 1KMIZ 3V4QA 1W2EA 1OX3A 1H89A 1BE3J 1N7SD 2NPSD 4HYTB 1ZRTD 2BCCE 2I8DA 3H1JG 1KILB 3I55P 3TGUE 3G9RA 4EI2A 1IO4A 1NAYA 3TDKA 5EFWB 4WB4A 5CCHD 2HODB 5KLVD 5KLIB 1FZAA 1EDLA 2YKQA 1G1JA 1QGKB 1NTMD 3E1RA 3HTKA 3H32A 3JC22 3CD6P 3P32A 1YTZT 3V5BA 1LWUB 3S4RA 1JY2O 1SQBG 2QM7A 4Y99C 3SFEC 1OWAA 3L73E 3CCRP 1BCCG 1KQLA 4ZKUA 2BCCJ 4PV1D 3A0HH 1Z56A 1FJKA 4HKZH 4DZOA 1Q7YQ 1KN7A 1SQQD 4LC1A 4BRYB 3QH9A 1WMKA 3L70J 2N1TA 4GOFA 4ZKPA 1R8EA 2C9NY 1QLED 1FBMA 3MIWA 2JWDA 5AVSB 1KV4A 1GZLA 1KB9I 3USSA 2FYUJ 1SQQG 1YBKA 3H1KJ 1MUUA 2KIKA 3R4YA 3G71P 3L74G 2RN0A 4RKUJ 1H0TA 3I56P 1GL2A 1JM0A 3T97A 3L73J 4I7ZB 2ZYGA 1HGVA 2UWJE 3RK3C 2OTLP 1EZVG 1BGYG 1FU1A 1RE4C 4CPGA 1DD4A 1K9MQ 5APWA 1FE6A 5BU5A 2KNCB 2CPSA 1SFCA 2P1JA 3RBZA 1L0NK 2N9BA 1RE4A 1X0TA 2V7QH 2J58A 3O6QA 1YJNP 1SP4A 1YJ9P 2E43A 1KTMA 3TGUJ 3CWBD 3AE1C 3TK1A 2W6BA 5KJ7C 2A06G 1R5SA 2H89C 4YXDC 1BE3E 3HTKB 2GUSA 1VQPP 1K73Q 2BCCG 1X8YA 1MV8A 3WU2E 4WVZA 2YIUC 2FYNC 4MN4C 1H8AA 1G2CA 2RKLA 4GOEA 1VF5C 1PPJD 4D6TE 2Z4EA 1N73B 1KB9D 3KZIE 1N7SB 2V7QJ 3SWKA 1T6AA 1SQPE 2YKOA 2P58A 1T2KD 2LXBA 1NKZB 3FWLA 2FXOA 3HRNA 4JQ0D 1MFZA 2O01H 1KILC 5B5EH 3RK2B 3K5BA 4RJTA 3RK3D 2GM4A 1SQXE 1NU1J 2FYUD 1AA0A 2Y0DA 4U3FD 1S9KD 3CC2P 4W80A 5AVVB 1NTKJ 1JY3O 4ZMDA 1KYOD 1KILA 5AVWB 1CSBA 2OYHC 1SQQJ 3H1KG 5KLVK 5CBNA 3L70E 2HODA 4N3YB 3ITKA 3W67A 1BE3G 2ZFCA 2R3CA 3CX5E 2OYHA 1W5CE 1WT6A 1EQ7A 2O01J 2V4HA 2YMKA 3L71J 3B8EB 3TNUA 2IZ1A 1IFDA 3VP8A 3CMAP 1HBWA 1URQA 3GHGB 1S2EA 2E75D 2N1TD 4H13B 3C8VA 4ZNCA 5BVZA 1AFOA 4C7NB 5KAFH 2HPCA 3AEDC 4Z1MH 2IBZG 4K3AA 4N78E 4W7YA 1GD2E 3KHUA 2XDJA 3IFMA 1N2DC 1EDJA 2QJYB 4DT0A 1X22A 2IBZD 2GA1A 1MKMA 2E76B 1J1DC 2K9YA 2ZYAA 3CX5I 3VMYA 1N73A 4YXWH 4PD4E 3CC4P 1KILD 1S1CX 1KFNA 1KB9H 1SQPJ 2IYOA 1RY3A 2XNDH 1FC2C 3KXDA 3SWYA 1SFCD 4HB1A 2ZJSE 1N73C 3H1IJ 2WZ7A 3B5ND 1DEEG 1QVFO 3KDPB 3RL0g 1EDIA 5KKZB 4QMAA 1Q2NA 1IFIA 1S5LX 2FYUK 2Y0CA 4O9BA 3H1ID 1M57D 1NAFA 3RL0B 3U1CA 1SQVE 3IAOA 1RF1A 2CK3H 2WSFJ 3IR9A 1LJ2A 1VQ8P 1NTKD 1OW6A 1QL2A 3KZIH 4M3LA 4UB6H 1H88A 1GDTA 1NU1D 3P8MC 3A5TA 1WRGA 4OVNF 4H44D 2AEJA 1MZ9A 1SFCB 5B5EE 3VMZA 4JYBA 4WY4A 4H13D 3L74E 3L71E 3EQ2A 4H0LC 1LP1A 2Q6QA 2FYNB 1MFTA 1SQPK 2Q3IA 1M1JB 3AEEC 2E76D 2QE7H 4C7NA 1PGPA 3HD7B 2H43A 1M1JC 2M3BA 3L75E 1LT9A 1T3UA 4DOJA 3D70A 2YNYA 3VMAA 5KAIE 2QJPC 3II6A 4B86A 1SQVK 1BCCE 2K9JA 2QJPB 3VOPA 1M1KQ 3WUVA 5B66H 4AQRD 4K35A 1JY3P 4XA4A 2HYNA 2PFXA 2ZT9C 1FZCA 2R5BA 1ZV8A 3P8CD 3FWNA 5DJUB 3G6EP 1KILE 3A2AA 1L0NE 1KFMA 3RK3B 3L37A 1LTBC 1URQD 2WPRA 2DW3A 3BRVB 4JYCA 5BU8B 1DH3A 3CC7P 3JCUE 2KB7P 1PP9J 3AE6C 2KSJA 3L73D 2G8YA 2J5UA 3PHLA 2JO1A 3H1JE 3EFGA 4DCKA 2KXPB 2XNXA 3GHGA 1PIXA 4WY4D 1ZR2A 3CXHD 1PP9D 1PGQA 3CLQA 2KI7B 3KPEA 2HPCB 4PV1C 3HE4A 1NTKK 1NVOA 2NPSA 1FOSE 2SPZA 1KQFB 1KYOH 1NWQA 1JTHB 1L4AA 1J2JB 1NU1K 1RHZB 4TLFA 3CCJP 1A02F 1YQ3C 3TNUB 4L73A 2P2UA 2OYOA 2NPSC 1T8ZA 1L4AC 1D7MA 3P7KA 1K04A 1LP1B 1VF5D 3L74D 1K05A 2QG4A 3LW5H 4KHXA 1VQNP 2FYUG 3CL3D 2Q1KA 4YPCA 3AEFC 2WTYA 1A02J 1VQ9P 4KJMA 3QWOC 2L5GB 4L76A 3RK2C 1P84E 1YITP 4GKGA 1EXJA 1AQ5A 1HH0A 3A0BH 1UIIA 1FDMA 2YO3A 1NTMJ 3H1KD 2IFMA 3V2QA 3NTNA 3NXSA 1BCCD 1RF0C 4XFJA 2IDBA 2ZXEB 3MZWB 3Q5SA 2KZJA 2B87A 3WUUA 3Q3DA 2CPBA 1FJPA 3BCCE 1TU3F 3CXHI 4PD4I 1L0LE 5C39A 1LTSC 2XKMA 4U7JA 4DJGA 2BEZF 2W27A 2ZT9B 3NMDA 1JOCA 1XTCC 1IFPA 2WMMA 2M3EA 5APXA 1FDOA 3L70D 3R2PA 3MHVA 2D2CC 4RO0A 5GTHE 2JKVA 1VDFA 1SQPD 3B5NB 2H88C 3E7KA 3EFFK 2KP8A 3H1JJ 2QSIA 1S3JA 1SQBK 1YTZI 1BGYE 1GW3A 3MGNA 2WT7B 5GTIE 4GIFA 4H0LB 1E79H 3F5HA 3EWKA 1Y8AA 2Y9ZA 2W90A 3HD7C 2E74B 4ASVA 1RE3A 5AW6B 1J1EC 3V2NA 3FGAD 1EZVI 4U3FG 1KQSO 4H0LD 1USEA 2H7HA 3CWBE 1SQQK 3HD7A 1FZCB 4L74A 1HJBA 3S9OA 2E75C 2N1TC 3OW2O 5KTBA 2J59M 2E75B 2N1TB 2I1KA 3H1IG 3L72E 2K3RA 1USDA 2A45I 4PD4D 5AW4B 3W68A 1M90Q 1PPJG 2ZVOB 1ZMEC 5APYA 2E42A 1NTKG 3L75D 2WITA 1E5WA 1SQBE 1JUNA 1QEXA 1NU1G 2L91A 1OIPA 3T97B 2B87B 2FXPA 1KD1Q 3PH0A 1T2KC 3SWFA 2FFDC 3OAKA 5APTA 3VN0A 4ASWA 3AEGC 2ITAA 3BCCJ 5H2FE 1L0LJ 1FS0E 1SFCC 4A7PA 3L71G 4TT3H 3VMXA 1HWTC 3U59A 1HTLC 1P84I 2M0BA 2JP3A 3AEAC 3A0BE 3O6QB 3L35A 5APVA 2WWWA 3RK2D 2I1JA 2HR3A 1NU1E 2M8RA 1YYCA 3RGUA 5M1BA 1FZGA 4NPDA 2YKPA 4IFMA 1EZVE 1VF5B 2NPSB 2Q7CA 1RQUA 1DX7A 4I1LA 1JTHA 1L4AB 2W8ZA 2Z5IA 2ZVNB 3B4SA 3OA7A 3V6IA 3V4WA 5CCHA 4UB8E 1IFNA 1RE3C 4Y99B 3TF5A 2ZYDA 3H1HE 3CCSP 1N86A 2O01N 2YXQB 1N7SA 1Q86Q 3CPWO 1NGMB 2E74D 3TSIA 1NYHA 1J1EB 5CCGC 5E79E 1AVYA 5KLVG 1PFIA 1FOSF 1NTZD 2IYPA 4L75A 1HF9A 4IL6E 2KK7A 2K1AA 1PP9G 3H1HG 3CWBJ 3WU2H 1IZNB 2M5AB 1OVUA 1P84D 3F89A 1QX8A 3B5NA 4IL6X 1NTZG 2NZ2A 5AW5B 4PV1B 3D6ZA 1ZR4A 1KC8Q 2YO2A 2FFDA 2WT7A 5AW2B 1KZUB 1OFCX 2WVRA 3CMEP 2C0XA 1PZQA 4I2LC 2MJZA 4OGQD 2NRGA 4JF7A 2KS1B 3TGUG 1Y47A 2D2CD 1GU4A 1IK9A 3L72G 4BXLA 1S9KE 5AW7B 1AVOA 1OZHA 2O1JA 3M06A 4PJ0H 3MP7B 1G1IA 2Q3EA 1OVRA 1HGZA 1NTMG 3AE8C 3TGUD 5CCHC 1BDDA 1M7LA 1QVGO 5KLVE 3AE9C 1FZCC 1JY3N 1NTME 3CX5H 4IOIH 2P67A 5CHXA 1X9VA 5AVXB 1PPJE 3H1LG 5H2FH 1N7SC 2QEXP 4AUWA 1ZN5A 1SQXK 2FBWC 5APUA 4RESB 3CCVP 3H1LE 5DJTB 1S5LE 1Y9BA 2FXMA 2HLOA 1N8RQ 5KAFE 1FDIA 2HFED 4W7ZA 1M56D 2KSEA 3U1AA 4U3FE 5AVRB 4GDOA 3SFDC 3L75G 5KLVJ 1OVVA 1NTZE 3M9QA 3PTZA 4UB8H 3B5NC 3WMM0 2G3AA 2KYVA 3L72D 1LT1A 3P8CE 4PD4H 3CXHH 1T3JA 2B89A 4BWNA 3KYQA 2K37A 3D71A 2WPQA 3CX5D 2PGDA 3H1KE 3CI9A 4XE5B 2FY8A 1SQVJ 2Y0EA 2R5DA 4WY4C 5E79H 1N7LA 1AQTA 1L0NJ 1NHLA 1RQVA 2E5YA 2IX7C 2N9YB 1JCCA 1PV3A 4HJGH 4WY4B 4IL6H 5AVTB 1BSNA 1SQVG 1L0LK 1M1JA 1U7JA 4OGQC 3Q5PA 1PP9E 1QL1A 2BEQD 2YXRB 1SQXD 2FYUE 4N78D 5CJ4A 1X79B 3FXDA 2P10A 2AXTH 1RF0A 1LTJB 1H0TB 1SVFA 1GMJA 2OTKE 4UB6E 2ZT9D 3PLNA 2AEMA 1BE3D 1J1DB 1JCDA 1ZXGA 2E76C 5L8RJ 1BGYJ 5AVQB
chains in the Genus database with same CATH topology
5B5EH 3A0HH 2AXTH 4PJ0H 5GTHH 5KAFH 5B66H 1S5LH 4IL6H 4UB8H 5H2FH 5KAIH 3JCUH 5GTIH 3A0BH 5E79H 5TISH 3WU2H 3KZIH 4UB6H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5E H;  3A0H H;  2AXT H;  4PJ0 H;  5GTH H;  5KAF H;  5B66 H;  1S5L H;  4IL6 H;  4UB8 H;  5H2F H;  5KAI H;  3JCU H;  5GTI H;  3A0B H;  5E79 H;  5TIS H;  3WU2 H;  3KZI H;  4UB6 H; 
#chains in the Genus database with same CATH topology
 2O3J A;  1VQ6 P;  1AJY A;  3KQG A;  2LR2 A;  4IFD K;  2O1K A;  1VQO P;  2IFN A;  3L71 D;  1NO4 A;  1JMB A;  3HUS C;  5CCG D;  3PP5 A;  5TIS H;  3NFQ A;  4PJ0 E;  3GW6 A;  3WUT A;  3CCL P;  2E5T A;  4D6T D;  2PRR A;  5KKZ C;  1SQB D;  2ZAE B;  4IFF A;  1L2P A;  2WSC J;  3OJA B;  4EYY Q;  5KAI H;  1YIJ P;  2M5A A;  1UIX A;  1KYO I;  2W83 C;  2XV5 A;  5KJ7 A;  3AE4 C;  1XTG B;  1LGH B;  3ABV C;  1L0N G;  3Q1M A;  1VQM P;  1GK6 A;  2FFD B;  4H44 B;  3M0D A;  3RBX A;  2IPP A;  2LXC B;  3AE5 C;  4U3F J;  1SQX J;  1L0L D;  1SQX G;  1IC2 A;  2JDI H;  2QJY C;  2JR8 A;  1S5L H;  1SQB J;  4I6M C;  1Q81 Q;  2WSE J;  2R44 A;  1KOR A;  1CZQ A;  3SSU A;  3D6Y A;  4C7R A;  1KQG B;  3M0D C;  1ZW0 A;  2QJK B;  2WSC H;  1JEK A;  3CCE P;  3JCU H;  1NKN A;  3L4F A;  3A3Y B;  1LTI C;  2OYI A;  5AVY B;  1BGY D;  3HE5 A;  4AYC A;  4OH8 B;  5K5G B;  1GU5 A;  1EXI A;  2VRS A;  3H1H D;  1HUC A;  3CXH E;  3H1I E;  2OYI C;  1CI6 B;  3H1L J;  4EIJ A;  2Q5U A;  3CCQ P;  1OW8 A;  2IBZ I;  1U57 A;  2JEE A;  2Y9Y A;  3CWB G;  3C9I A;  5AW0 B;  3G4S P;  3RK3 E;  1JB0 J;  2WSF H;  2H8P D;  3S1K A;  3VP9 A;  2OYH B;  1GL2 C;  3VYI A;  1L0N D;  1NH4 A;  3M91 A;  1RF1 B;  2D2C B;  3LID A;  2QM8 A;  1L0L G;  1KB9 E;  5AW3 B;  1URQ B;  1VQ7 P;  1P84 H;  2AXT E;  1DEB A;  2HG5 D;  3N4X A;  1URQ C;  3MD0 A;  3A7O A;  5APQ A;  2BAS A;  2KOG A;  1FZE A;  1GK4 A;  3H1J D;  2R3S A;  3L72 J;  5AW9 B;  3UIA A;  1PGO A;  2OTJ P;  3H25 A;  1JO5 A;  3AE7 C;  1S4X A;  2QA4 P;  1SQQ E;  2AXC A;  1LWU C;  3TYY A;  2JJL A;  3IF4 A;  3B71 A;  5TIS E;  2B88 A;  5TJH A;  1OXZ A;  1SLQ A;  2PAJ A;  2RH0 A;  3AE3 C;  3AE2 C;  3L36 A;  4JPZ B;  5CBO A;  5CCG A;  1LTG C;  1K8A Q;  2A45 H;  1LTJ C;  1ZRT E;  2BCC D;  1DD3 A;  1FAV A;  5GTH H;  2OAR A;  1BCC J;  4WWI A;  4LGD E;  2W6A A;  2Z5H A;  2IBZ E;  1BSH A;  1EDK A;  3HE5 B;  1NOH A;  3BAT A;  1LTJ A;  2YMY A;  2WSS H;  2FKW B;  2WPS A;  2QRX A;  1VQ4 P;  2B9B A;  4R4M A;  2PP6 A;  5KJ7 D;  2K9J B;  2C0W A;  3HUS B;  2A06 E;  1L4A D;  2KZI A;  2QVA A;  3I5C A;  2P7J A;  2GUV A;  3JSV C;  3L74 J;  2OQQ A;  3AEC C;  4I7Z C;  2KUB A;  1NTZ J;  4GOD A;  4KT0 J;  4EDF A;  1NJI Q;  2QIW A;  5AVZ B;  3MUD A;  3H32 B;  1HVV A;  3GLM A;  4EOT A;  3RL0 D;  5B66 E;  1OW7 A;  5KLI C;  1EZV D;  1NTK E;  3CCM P;  1LNQ A;  3AEB C;  1IK7 A;  2RMZ A;  2MKV A;  3G3Z A;  3LIE A;  1YHQ P;  1IJD B;  4OGQ B;  1JMM A;  1LT9 B;  1Q90 D;  3BAS A;  2W6J H;  3H1L D;  3C1L A;  3LW5 J;  1LT9 C;  2WSE H;  4YTP C;  1W2B O;  2OYI B;  1LWU A;  3V2R A;  1SS1 A;  1SQP G;  3BRT B;  1VQ5 P;  4WBA A;  1IFM A;  1LTT C;  4NPE A;  1CI6 A;  1M8O B;  1S72 P;  2WPV B;  3GG2 A;  4Y28 J;  1OMI A;  1GL2 B;  2R32 A;  3FX0 A;  3V2P A;  1KYO E;  2JWA A;  1PGJ A;  3PRJ A;  5APS A;  3CCU P;  4GT1 A;  5CJ0 A;  1ZLL A;  3PJS K;  1LTA C;  2C9L Y;  3GMA A;  3M0A A;  4D6T J;  3N7N A;  1Q82 Q;  2LKM A;  1NTZ K;  1VPC A;  2FYZ A;  3A0H E;  4HH2 A;  4JBZ A;  3H1H J;  4LLH A;  1JNM A;  4N6J A;  2IZ0 A;  5AW8 B;  3GHG C;  4H13 C;  2XZR A;  1YJW P;  3Q5R A;  2A06 D;  3HE4 B;  3M9H A;  3MUD C;  3GF7 A;  1FZF A;  3BCC G;  1RF1 C;  1GL2 D;  1GTW A;  1FZB A;  3H6P A;  3ZDM A;  2KNC A;  3IN6 A;  2K88 A;  3HD7 D;  1G2C B;  1IFJ A;  2E74 C;  3GF3 A;  2A45 G;  2Q9I A;  3BCC D;  1NTM K;  1HJ0 A;  2KS1 A;  2OGU A;  2QJK C;  2ZXX A;  3L70 G;  4NPF X;  2YIU B;  2AEF A;  5AVU B;  3M9B A;  3Q2Y A;  4BRY A;  3E1I A;  3BVH A;  4H44 C;  1ZOY C;  1ZP0 C;  1YI2 P;  1GW4 A;  1VL2 A;  2KLV A;  2WQY C;  4R4L A;  5CMZ A;  1AV1 A;  3VTP C;  1U7M A;  1R5L A;  1JY2 N;  1CW5 A;  5AW1 B;  1YQ4 C;  3FXE A;  1PL5 A;  3L73 G;  1JY2 P;  3MTU E;  2XU6 A;  4D6T G;  1VQL P;  4OWF A;  3O8Z A;  3RL0 C;  2KLU A;  2POH A;  3HUS A;  1RH5 B;  1EC5 A;  4C46 A;  5GTI H;  1VQK P;  1DIP A;  1BDC A;  1SQV D;  3L75 J;  1KMI Z;  3V4Q A;  1W2E A;  1OX3 A;  1H89 A;  1BE3 J;  1N7S D;  2NPS D;  4HYT B;  1ZRT D;  2BCC E;  2I8D A;  3H1J G;  1KIL B;  3I55 P;  3TGU E;  3G9R A;  4EI2 A;  1IO4 A;  1NAY A;  3TDK A;  5EFW B;  4WB4 A;  5CCH D;  2HOD B;  5KLV D;  5KLI B;  1FZA A;  1EDL A;  2YKQ A;  1G1J A;  1QGK B;  1NTM D;  3E1R A;  3HTK A;  3H32 A;  3JC2 2;  3CD6 P;  3P32 A;  1YTZ T;  3V5B A;  1LWU B;  3S4R A;  1JY2 O;  1SQB G;  2QM7 A;  4Y99 C;  3SFE C;  1OWA A;  3L73 E;  3CCR P;  1BCC G;  1KQL A;  4ZKU A;  2BCC J;  4PV1 D;  3A0H H;  1Z56 A;  1FJK A;  4HKZ H;  4DZO A;  1Q7Y Q;  1KN7 A;  1SQQ D;  4LC1 A;  4BRY B;  3QH9 A;  1WMK A;  3L70 J;  2N1T A;  4GOF A;  4ZKP A;  1R8E A;  2C9N Y;  1QLE D;  1FBM A;  3MIW A;  2JWD A;  5AVS B;  1KV4 A;  1GZL A;  1KB9 I;  3USS A;  2FYU J;  1SQQ G;  1YBK A;  3H1K J;  1MUU A;  2KIK A;  3R4Y A;  3G71 P;  3L74 G;  2RN0 A;  4RKU J;  1H0T A;  3I56 P;  1GL2 A;  1JM0 A;  3T97 A;  3L73 J;  4I7Z B;  2ZYG A;  1HGV A;  2UWJ E;  3RK3 C;  2OTL P;  1EZV G;  1BGY G;  1FU1 A;  1RE4 C;  4CPG A;  1DD4 A;  1K9M Q;  5APW A;  1FE6 A;  5BU5 A;  2KNC B;  2CPS A;  1SFC A;  2P1J A;  3RBZ A;  1L0N K;  2N9B A;  1RE4 A;  1X0T A;  2V7Q H;  2J58 A;  3O6Q A;  1YJN P;  1SP4 A;  1YJ9 P;  2E43 A;  1KTM A;  3TGU J;  3CWB D;  3AE1 C;  3TK1 A;  2W6B A;  5KJ7 C;  2A06 G;  1R5S A;  2H89 C;  4YXD C;  1BE3 E;  3HTK B;  2GUS A;  1VQP P;  1K73 Q;  2BCC G;  1X8Y A;  1MV8 A;  3WU2 E;  4WVZ A;  2YIU C;  2FYN C;  4MN4 C;  1H8A A;  1G2C A;  2RKL A;  4GOE A;  1VF5 C;  1PPJ D;  4D6T E;  2Z4E A;  1N73 B;  1KB9 D;  3KZI E;  1N7S B;  2V7Q J;  3SWK A;  1T6A A;  1SQP E;  2YKO A;  2P58 A;  1T2K D;  2LXB A;  1NKZ B;  3FWL A;  2FXO A;  3HRN A;  4JQ0 D;  1MFZ A;  2O01 H;  1KIL C;  5B5E H;  3RK2 B;  3K5B A;  4RJT A;  3RK3 D;  2GM4 A;  1SQX E;  1NU1 J;  2FYU D;  1AA0 A;  2Y0D A;  4U3F D;  1S9K D;  3CC2 P;  4W80 A;  5AVV B;  1NTK J;  1JY3 O;  4ZMD A;  1KYO D;  1KIL A;  5AVW B;  1CSB A;  2OYH C;  1SQQ J;  3H1K G;  5KLV K;  5CBN A;  3L70 E;  2HOD A;  4N3Y B;  3ITK A;  3W67 A;  1BE3 G;  2ZFC A;  2R3C A;  3CX5 E;  2OYH A;  1W5C E;  1WT6 A;  1EQ7 A;  2O01 J;  2V4H A;  2YMK A;  3L71 J;  3B8E B;  3TNU A;  2IZ1 A;  1IFD A;  3VP8 A;  3CMA P;  1HBW A;  1URQ A;  3GHG B;  1S2E A;  2E75 D;  2N1T D;  4H13 B;  3C8V A;  4ZNC A;  5BVZ A;  1AFO A;  4C7N B;  5KAF H;  2HPC A;  3AED C;  4Z1M H;  2IBZ G;  4K3A A;  4N78 E;  4W7Y A;  1GD2 E;  3KHU A;  2XDJ A;  3IFM A;  1N2D C;  1EDJ A;  2QJY B;  4DT0 A;  1X22 A;  2IBZ D;  2GA1 A;  1MKM A;  2E76 B;  1J1D C;  2K9Y A;  2ZYA A;  3CX5 I;  3VMY A;  1N73 A;  4YXW H;  4PD4 E;  3CC4 P;  1KIL D;  1S1C X;  1KFN A;  1KB9 H;  1SQP J;  2IYO A;  1RY3 A;  2XND H;  1FC2 C;  3KXD A;  3SWY A;  1SFC D;  4HB1 A;  2ZJS E;  1N73 C;  3H1I J;  2WZ7 A;  3B5N D;  1DEE G;  1QVF O;  3KDP B;  3RL0 g;  1EDI A;  5KKZ B;  4QMA A;  1Q2N A;  1IFI A;  1S5L X;  2FYU K;  2Y0C A;  4O9B A;  3H1I D;  1M57 D;  1NAF A;  3RL0 B;  3U1C A;  1SQV E;  3IAO A;  1RF1 A;  2CK3 H;  2WSF J;  3IR9 A;  1LJ2 A;  1VQ8 P;  1NTK D;  1OW6 A;  1QL2 A;  3KZI H;  4M3L A;  4UB6 H;  1H88 A;  1GDT A;  1NU1 D;  3P8M C;  3A5T A;  1WRG A;  4OVN F;  4H44 D;  2AEJ A;  1MZ9 A;  1SFC B;  5B5E E;  3VMZ A;  4JYB A;  4WY4 A;  4H13 D;  3L74 E;  3L71 E;  3EQ2 A;  4H0L C;  1LP1 A;  2Q6Q A;  2FYN B;  1MFT A;  1SQP K;  2Q3I A;  1M1J B;  3AEE C;  2E76 D;  2QE7 H;  4C7N A;  1PGP A;  3HD7 B;  2H43 A;  1M1J C;  2M3B A;  3L75 E;  1LT9 A;  1T3U A;  4DOJ A;  3D70 A;  2YNY A;  3VMA A;  5KAI E;  2QJP C;  3II6 A;  4B86 A;  1SQV K;  1BCC E;  2K9J A;  2QJP B;  3VOP A;  1M1K Q;  3WUV A;  5B66 H;  4AQR D;  4K35 A;  1JY3 P;  4XA4 A;  2HYN A;  2PFX A;  2ZT9 C;  1FZC A;  2R5B A;  1ZV8 A;  3P8C D;  3FWN A;  5DJU B;  3G6E P;  1KIL E;  3A2A A;  1L0N E;  1KFM A;  3RK3 B;  3L37 A;  1LTB C;  1URQ D;  2WPR A;  2DW3 A;  3BRV B;  4JYC A;  5BU8 B;  1DH3 A;  3CC7 P;  3JCU E;  2KB7 P;  1PP9 J;  3AE6 C;  2KSJ A;  3L73 D;  2G8Y A;  2J5U A;  3PHL A;  2JO1 A;  3H1J E;  3EFG A;  4DCK A;  2KXP B;  2XNX A;  3GHG A;  1PIX A;  4WY4 D;  1ZR2 A;  3CXH D;  1PP9 D;  1PGQ A;  3CLQ A;  2KI7 B;  3KPE A;  2HPC B;  4PV1 C;  3HE4 A;  1NTK K;  1NVO A;  2NPS A;  1FOS E;  2SPZ A;  1KQF B;  1KYO H;  1NWQ A;  1JTH B;  1L4A A;  1J2J B;  1NU1 K;  1RHZ B;  4TLF A;  3CCJ P;  1A02 F;  1YQ3 C;  3TNU B;  4L73 A;  2P2U A;  2OYO A;  2NPS C;  1T8Z A;  1L4A C;  1D7M A;  3P7K A;  1K04 A;  1LP1 B;  1VF5 D;  3L74 D;  1K05 A;  2QG4 A;  3LW5 H;  4KHX A;  1VQN P;  2FYU G;  3CL3 D;  2Q1K A;  4YPC A;  3AEF C;  2WTY A;  1A02 J;  1VQ9 P;  4KJM A;  3QWO C;  2L5G B;  4L76 A;  3RK2 C;  1P84 E;  1YIT P;  4GKG A;  1EXJ A;  1AQ5 A;  1HH0 A;  3A0B H;  1UII A;  1FDM A;  2YO3 A;  1NTM J;  3H1K D;  2IFM A;  3V2Q A;  3NTN A;  3NXS A;  1BCC D;  1RF0 C;  4XFJ A;  2IDB A;  2ZXE B;  3MZW B;  3Q5S A;  2KZJ A;  2B87 A;  3WUU A;  3Q3D A;  2CPB A;  1FJP A;  3BCC E;  1TU3 F;  3CXH I;  4PD4 I;  1L0L E;  5C39 A;  1LTS C;  2XKM A;  4U7J A;  4DJG A;  2BEZ F;  2W27 A;  2ZT9 B;  3NMD A;  1JOC A;  1XTC C;  1IFP A;  2WMM A;  2M3E A;  5APX A;  1FDO A;  3L70 D;  3R2P A;  3MHV A;  2D2C C;  4RO0 A;  5GTH E;  2JKV A;  1VDF A;  1SQP D;  3B5N B;  2H88 C;  3E7K A;  3EFF K;  2KP8 A;  3H1J J;  2QSI A;  1S3J A;  1SQB K;  1YTZ I;  1BGY E;  1GW3 A;  3MGN A;  2WT7 B;  5GTI E;  4GIF A;  4H0L B;  1E79 H;  3F5H A;  3EWK A;  1Y8A A;  2Y9Z A;  2W90 A;  3HD7 C;  2E74 B;  4ASV A;  1RE3 A;  5AW6 B;  1J1E C;  3V2N A;  3FGA D;  1EZV I;  4U3F G;  1KQS O;  4H0L D;  1USE A;  2H7H A;  3CWB E;  1SQQ K;  3HD7 A;  1FZC B;  4L74 A;  1HJB A;  3S9O A;  2E75 C;  2N1T C;  3OW2 O;  5KTB A;  2J59 M;  2E75 B;  2N1T B;  2I1K A;  3H1I G;  3L72 E;  2K3R A;  1USD A;  2A45 I;  4PD4 D;  5AW4 B;  3W68 A;  1M90 Q;  1PPJ G;  2ZVO B;  1ZME C;  5APY A;  2E42 A;  1NTK G;  3L75 D;  2WIT A;  1E5W A;  1SQB E;  1JUN A;  1QEX A;  1NU1 G;  2L91 A;  1OIP A;  3T97 B;  2B87 B;  2FXP A;  1KD1 Q;  3PH0 A;  1T2K C;  3SWF A;  2FFD C;  3OAK A;  5APT A;  3VN0 A;  4ASW A;  3AEG C;  2ITA A;  3BCC J;  5H2F E;  1L0L J;  1FS0 E;  1SFC C;  4A7P A;  3L71 G;  4TT3 H;  3VMX A;  1HWT C;  3U59 A;  1HTL C;  1P84 I;  2M0B A;  2JP3 A;  3AEA C;  3A0B E;  3O6Q B;  3L35 A;  5APV A;  2WWW A;  3RK2 D;  2I1J A;  2HR3 A;  1NU1 E;  2M8R A;  1YYC A;  3RGU A;  5M1B A;  1FZG A;  4NPD A;  2YKP A;  4IFM A;  1EZV E;  1VF5 B;  2NPS B;  2Q7C A;  1RQU A;  1DX7 A;  4I1L A;  1JTH A;  1L4A B;  2W8Z A;  2Z5I A;  2ZVN B;  3B4S A;  3OA7 A;  3V6I A;  3V4W A;  5CCH A;  4UB8 E;  1IFN A;  1RE3 C;  4Y99 B;  3TF5 A;  2ZYD A;  3H1H E;  3CCS P;  1N86 A;  2O01 N;  2YXQ B;  1N7S A;  1Q86 Q;  3CPW O;  1NGM B;  2E74 D;  3TSI A;  1NYH A;  1J1E B;  5CCG C;  5E79 E;  1AVY A;  5KLV G;  1PFI A;  1FOS F;  1NTZ D;  2IYP A;  4L75 A;  1HF9 A;  4IL6 E;  2KK7 A;  2K1A A;  1PP9 G;  3H1H G;  3CWB J;  3WU2 H;  1IZN B;  2M5A B;  1OVU A;  1P84 D;  3F89 A;  1QX8 A;  3B5N A;  4IL6 X;  1NTZ G;  2NZ2 A;  5AW5 B;  4PV1 B;  3D6Z A;  1ZR4 A;  1KC8 Q;  2YO2 A;  2FFD A;  2WT7 A;  5AW2 B;  1KZU B;  1OFC X;  2WVR A;  3CME P;  2C0X A;  1PZQ A;  4I2L C;  2MJZ A;  4OGQ D;  2NRG A;  4JF7 A;  2KS1 B;  3TGU G;  1Y47 A;  2D2C D;  1GU4 A;  1IK9 A;  3L72 G;  4BXL A;  1S9K E;  5AW7 B;  1AVO A;  1OZH A;  2O1J A;  3M06 A;  4PJ0 H;  3MP7 B;  1G1I A;  2Q3E A;  1OVR A;  1HGZ A;  1NTM G;  3AE8 C;  3TGU D;  5CCH C;  1BDD A;  1M7L A;  1QVG O;  5KLV E;  3AE9 C;  1FZC C;  1JY3 N;  1NTM E;  3CX5 H;  4IOI H;  2P67 A;  5CHX A;  1X9V A;  5AVX B;  1PPJ E;  3H1L G;  5H2F H;  1N7S C;  2QEX P;  4AUW A;  1ZN5 A;  1SQX K;  2FBW C;  5APU A;  4RES B;  3CCV P;  3H1L E;  5DJT B;  1S5L E;  1Y9B A;  2FXM A;  2HLO A;  1N8R Q;  5KAF E;  1FDI A;  2HFE D;  4W7Z A;  1M56 D;  2KSE A;  3U1A A;  4U3F E;  5AVR B;  4GDO A;  3SFD C;  3L75 G;  5KLV J;  1OVV A;  1NTZ E;  3M9Q A;  3PTZ A;  4UB8 H;  3B5N C;  3WMM 0;  2G3A A;  2KYV A;  3L72 D;  1LT1 A;  3P8C E;  4PD4 H;  3CXH H;  1T3J A;  2B89 A;  4BWN A;  3KYQ A;  2K37 A;  3D71 A;  2WPQ A;  3CX5 D;  2PGD A;  3H1K E;  3CI9 A;  4XE5 B;  2FY8 A;  1SQV J;  2Y0E A;  2R5D A;  4WY4 C;  5E79 H;  1N7L A;  1AQT A;  1L0N J;  1NHL A;  1RQV A;  2E5Y A;  2IX7 C;  2N9Y B;  1JCC A;  1PV3 A;  4HJG H;  4WY4 B;  4IL6 H;  5AVT B;  1BSN A;  1SQV G;  1L0L K;  1M1J A;  1U7J A;  4OGQ C;  3Q5P A;  1PP9 E;  1QL1 A;  2BEQ D;  2YXR B;  1SQX D;  2FYU E;  4N78 D;  5CJ4 A;  1X79 B;  3FXD A;  2P10 A;  2AXT H;  1RF0 A;  1LTJ B;  1H0T B;  1SVF A;  1GMJ A;  2OTK E;  4UB6 E;  2ZT9 D;  3PLN A;  2AEM A;  1BE3 D;  1J1D B;  1JCD A;  1ZXG A;  2E76 C;  5L8R J;  1BGY J;  5AVQ B; 
#chains in the Genus database with same CATH homology
 5B5E H;  3A0H H;  2AXT H;  4PJ0 H;  5GTH H;  5KAF H;  5B66 H;  1S5L H;  4IL6 H;  4UB8 H;  5H2F H;  5KAI H;  3JCU H;  5GTI H;  3A0B H;  5E79 H;  5TIS H;  3WU2 H;  3KZI H;  4UB6 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...