4PJ0H

Structure of t.elongatus photosystem ii, rows of dimers crystal packing
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, electron transport
molecule keywords Photosystem Q(B) protein 1
publication title Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
pubmed doi rcsb
total genus 14
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 4pj0H01
5E79H 4IL6H 5GTHH 5H2FH 1S5LH 5B66H 4UB6H 5TISH 3KZIH 3WU2H 4PJ0H 5GTIH 5B5EH 3JCUH 2AXTH 3A0BH 3A0HH 4UB8H 5KAIH 5KAFH
chains in the Genus database with same CATH superfamily
3MZWB 2HR3A 1SQVE 2BCCD 2HLOA 2ZT9C 2LXCB 3D6ZA 5KLVD 1RF0C 3FGAD 4R4MA 2NPSB 2OYHC 1L0LJ 1VQMP 1OIPA 1MKMA 1BSNA 4DZOA 2R3SA 2Y9ZA 1YQ3C 2E5YA 3L74J 1WT6A 2BEQD 1H89A 1NTMG 1NYHA 3Q3DA 2P1JA 1JY3O 4JPZB 4GIFA 4OGQB 1EDIA 3LIDA 1IK9A 4WY4D 3BCCD 3CD6P 3AE4C 4GOFA 4IL6H 1VQ7P 2A45I 1PGQA 1L4AD 4WY4C 1CI6B 3H32A 4C7RA 2G8YA 1LJ2A 3WUUA 3RBZA 3A0HH 2YO2A 4OH8B 2YKPA 4W7ZA 2YXRB 1L4AC 2UWJE 5H2FH 1MFTA 1QX8A 2OYIC 3V4WA 1BDCA 1M1JC 1NU1D 1OZHA 2KLUA 3KZIE 1R5LA 3TYYA 1ZP0C 1BSHA 2RMZA 2OARA 1W2BO 1RF0A 1HH0A 4GODA 1L0LD 5KLVE 1EDJA 5M1BA 3I55P 1QEXA 2YIUC 4JYCA 5CBOA 3L74D 4LGDE 2E74B 4H44B 4L73A 1VPCA 1NOHA 1LTAC 3Q5SA 1PPJD 1KYOD 3OA7A 1FDOA 3C1LA 3RK3E 3HUSC 3GG2A 2PGDA 5AVSB 2FFDB 3H1JE 4H13D 3V2NA 2WQYC 1FAVA 1SQBJ 4WY4A 4UB8H 2KIKA 1Y47A 3MTUE 4IL6X 2WZ7A 2XKMA 2OTJP 1FBMA 3GLMA 4H13C 3VP8A 1OVVA 2FYUG 2OYIA 4IFFA 5AW6B 2AXTE 1H88A 1S2EA 1M7LA 3AE5C 1ZN5A 1NU1E 5KAIE 3SWKA 2IZ1A 3NFQA 4LLHA 4I7ZC 1J2JB 2KK7A 1JB0J 2RKLA 2KNCB 1LTIC 1MUUA 1FJPA 2JO1A 2Q3EA 3AE1C 3NXSA 1FOSF 1LTBC 3L70J 2OTLP 2D2CB 3L4FA 2RH0A 2K9JA 1LNQA 2WWWA 1BE3G 1QL2A 1IZNB 3VMYA 1YHQP 3HUSA 1KYOE 2ZYGA 5CJ4A 2WMMA 1NTKJ 5AVUB 3KPEA 5E79E 2FYNB 5KKZB 3HRNA 1SQBD 3VMZA 2RN0A 4Y28J 1U57A 3CCQP 1JCDA 3WU2E 5AW2B 1Q86Q 1SQXG 1LWUC 1NKNA 2WT7B 3MHVA 1RY3A 2A06D 2QM7A 2L5GB 1X0TA 2Q9IA 3H1IE 2IYOA 3EFGA 1W2EA 3L71J 3M06A 3C8VA 1J1DC 2W6AA 1LT1A 4DOJA 2YNYA 2O1JA 3OW2O 1SQPG 2H88C 3Q1MA 2V7QJ 3PTZA 1GD2E 3L70D 3II6A 5KLIC 1NTMK 1IO4A 1IFIA 1HBWA 5B5EH 5GTIE 1ZR2A 5AVRB 2WITA 1PV3A 1QVFO 4K3AA 3MGNA 3D70A 2R5BA 3H1LG 3BVHA 1ZMEC 3CX5E 3JC22 2QSIA 2GM4A 3I56P 1NTKD 4LC1A 3M0DC 2M8RA 3AEFC 2KP8A 2JWDA 3W68A 1K8AQ 4AYCA 2Q1KA 3GHGB 2A45G 1X79B 2QE7H 1L0NG 3HE5A 4HKZH 2WTYA 3V2RA 1NWQA 1LTTC 2OTKE 4NPDA 2I1KA 3V6IA 3D6YA 3TDKA 2W27A 4PJ0E 4DT0A 1Q82Q 2ZYDA 2KZIA 1KB9E 4EI2A 2P7JA 3L71D 3H6PA 2E76D 1LTJC 3H1KE 1LTSC 4GOEA 3MIWA 2FYZA 3G6EP 3SFDC 1BCCE 2E76C 4W80A 1FZGA 1KYOI 1A02F 1AVOA 1YITP 3CCUP 3F89A 3VMXA 1IFDA 2FXOA 2KB7P 2YMKA 1CI6A 3M0DA 2QJKC 1QVGO 3H1HJ 4PV1B 2E75B 3ABVC 4PD4E 3RL0B 3B71A 5CCHD 3MUDC 1SFCD 3RK2B 3VP9A 2JEEA 2Y0DA 3U1AA 4AUWA 1LGHB 3I5CA 1KQGB 3LIEA 1VQKP 1JOCA 1HGZA 1SQVG 1JY2O 2FYUK 5CCHC 2AXCA 3HD7B 2FY8A 1SFCC 5CCGD 1DD4A 2O3JA 3JSVC 4JBZA 4XE5B 1NAYA 1E79H 2V4HA 3FWNA 1RF1C 1KILB 4I6MC 1LTJA 5AVTB 3PLNA 3CC2P 4KHXA 3IAOA 1ZR4A 1X22A 1YYCA 2WSCJ 2QA4P 4RKUJ 1OVRA 1EZVE 3HE4B 3L37A 1XTCC 1Z56A 1S1CX 1HTLC 2XNXA 2QEXP 2QJYB 2A45H 4YPCA 2YXQB 1T6AA 3WMM0 2HG5D 1OVUA 4DCKA 1J1EB 2HYNA 1X9VA 5AW0B 3CWBG 3H1JJ 3H1HD 1PZQA 4U3FG 1HF9A 2E43A 3CCVP 4Y99C 1NVOA 5APXA 5BVZA 1PL5A 1SQQJ 2B89A 1IFNA 1T3UA 2V7QH 5AVYB 2BASA 3RGUA 4UB6H 5CCHA 5GTHE 1SFCA 3CPWO 5BU5A 2BCCG 3MP7B 3ZDMA 1N7SB 3CC7P 1RF1A 3PHLA 1VQOP 1EC5A 5CCGA 2C0XA 1KORA 1GMJA 3KQGA 1S5LX 2W6JH 4RJTA 1SQPK 5AVXB 3RBXA 2HPCB 1R8EA 2YO3A 4AQRD 1JCCA 2H89C 3ITKA 3L75G 1Q90D 5L8RJ 1MFZA 1M8OB 3IFMA 3KHUA 5AW9B 1Q7YQ 1YI2P 3P32A 4IL6E 1HGVA 4PD4I 3BCCG 2XU6A 3L72E 1OFCX 1OXZA 2IZ0A 1LT9C 1IFPA 2Q7CA 4M3LA 3RK3D 2C0WA 2FKWB 4L75A 1GDTA 1H0TB 3H1JD 3A0HE 3O6QB 3TGUE 3U59A 3H1HE 4JQ0D 1VQ8P 1L0NK 5AVVB 2WSFH 4EDFA 3RK3C 1S3JA 1SQQD 3VMAA 2J5UA 1X8YA 4RO0A 5APVA 4HYTB 1AFOA 2SPZA 4KJMA 1FU1A 3NMDA 3H1IJ 2N9BA 4D6TE 3IR9A 2L91A 1L0LG 2HFED 2H43A 3GF7A 1VQPP 3L74G 5APQA 3CLQA 3IN6A 2Z5HA 1KQLA 3B5ND 1AJYA 1UIXA 2N1TB 1RQVA 3M0AA 3IF4A 4U7JA 1Q2NA 1G1IA 1PPJG 1RQUA 3AE9C 3AEAC 2JR8A 3RK2D 3B5NC 2QRXA 4UB8E 1LT9A 1YTZT 3FXDA 1VQLP 4O9BA 3PH0A 2IBZG 3A3YB 1VF5D 3GHGA 1GL2D 3KZIH 1GTWA 1P84D 1SVFA 1KQSO 4WVZA 1FZCB 1KQFB 2B9BA 2JWAA 1VF5C 1VQ5P 1GL2C 3TNUB 1URQD 2KI7B 1SQQE 3V5BA 1SQVK 1QL1A 4H0LB 3L73J 4QMAA 4IFMA 2ZVNB 1URQC 2J58A 3CCRP 2I8DA 1LP1B 2R44A 3H1ID 3CCSP 1LTGC 1QGKB 1JY2P 3M9HA 2MKVA 3H1KJ 1K04A 2KS1B 1JMBA 2C9LY 4NPFX 4TLFA 1SQXJ 2PRRA 2JP3A 1BCCJ 3VOPA 2W6BA 3A0BE 1NTZJ 1AV1A 4C7NA 2WSEJ 1N73C 2IFNA 3B4SA 3B5NA 1VQ6P 1KTMA 1KFNA 1FE6A 3CCLP 1IK7A 1IC2A 2IFMA 3CX5D 1VL2A 1SQBG 2YMYA 2QJPB 5AW4B 1QLED 1P84E 1NKZB 1YTZI 3P8MC 2M5AA 4WBAA 3S1KA 1KC8Q 1GL2A 2CPSA 1UIIA 1GU5A 2H7HA 2A06G 5CMZA 1KILE 2IDBA 1K73Q 2NPSD 1FZAA 3L73D 1URQA 1KILA 4BRYA 4ZKPA 5KLVK 1JY3N 1KB9D 1NH4A 1FJKA 3TSIA 3V4QA 5B66E 2NPSC 3T97A 1KYOH 3H1KD 4ASWA 5B5EE 1L2PA 3L70G 1N2DC 4OGQD 3H32B 1SQXD 2FXPA 3M9QA 1BCCD 1CSBA 2E5TA 1Y9BA 3WU2H 1N73A 1NTZD 1EXIA 4WB4A 1N8RQ 3AEDC 1S9KD 4OGQC 2FYUE 3LW5J 3WUTA 2R32A 3S9OA 1HVVA 3HTKA 2ZT9B 1RE3A 1NTKG 4GKGA 1S72P 1RE4C 1IFMA 2KSJA 2OYHB 3TK1A 1JY3P 2KLVA 4PD4D 1YJ9P 4ZMDA 1Y8AA 2B88A 2KYVA 1JNMA 1WMKA 1BGYG 1NU1K 3O8ZA 1AVYA 1BE3E 1PP9J 4KT0J 2QVAA 3L71G 3L73E 1L0LK 3FWLA 1JEKA 2O01J 3FX0A 2NPSA 2Q5UA 2E74D 2Q6QA 4H44D 1JM0A 5KAFE 4DJGA 3M91A 4WY4B 1ZOYC 1CW5A 1EZVD 1EQ7A 4JYBA 3P7KA 3NTNA 2E74C 4H44C 2ZVOB 1SQXE 1N86A 1L4AB 3A2AA 5APUA 2OYIB 1NTZE 1M1JB 1P84I 3L72J 1S9KE 2R5DA 5AW5B 1CZQA 1H0TA 4A7PA 1FZBA 1GK6A 2IPPA 1RE4A 4OVNF 3SSUA 2FFDC 2KOGA 3AEBC 2P58A 3V2QA 3TGUJ 2YKOA 1GW4A 2YIUB 1SQPE 1OW6A 3OAKA 3VTPC 3EQ2A 1DH3A 2XZRA 3CXHD 4YXWH 1IJDB 1HJ0A 2ZYAA 4L74A 1HWTC 2POHA 1PP9D 1S5LH 1ZLLA 4D6TJ 3HUSB 2M3BA 2KSEA 2D2CD 5AVQB 3CCMP 3JCUH 4YXDC 4ZKUA 1S4XA 5CCGC 1GK4A 4IFDK 2FXMA 4JF7A 2KUBA 2W83C 4PD4H 1L0NE 3U1CA 1SP4A 4YTPC 2D2CC 4H13B 2GA1A 2E42A 3V2PA 2LXBA 5AW7B 2BEZF 3CX5I 3SWYA 1EXJA 2PP6A 3L72D 2PFXA 2XNDH 3VN0A 2K9YA 2FFDA 1XTGB 1SQBK 2FYNC 1AA0A 4I7ZB 5KKZC 3TGUD 4L76A 1NO4A 1KD1Q 1HJBA 3L75J 1DEBA 2KZJA 3PP5A 1NTMJ 3CXHE 1SS1A 1KB9I 5K5GB 1G2CB 3BCCJ 1AQTA 2I1JA 1FDMA 3AECC 1ZXGA 2AEMA 4I2LC 3LW5H 1GZLA 2N9YB 2QG4A 2K1AA 1PP9E 3AE7C 4D6TD 2QIWA 5KLVG 2KNCA 2JKVA 5KTBA 5TISH 5AVZB 5APSA 3HE5B 2K3RA 2K37A 4IOIH 3FXEA 1LWUB 1M57D 2LR2A 3AE2C 2W90A 3SFEC 3TF5A 5GTHH 3OJAB 3QWOC 1NTKK 1ZRTE 2XV5A 3H1JG 1J1DB 2O01H 1PGJA 5AW3B 3B8EB 1SQQG 3GHGC 1D7MA 3L75D 5KLIB 3BRVB 5H2FE 2P2UA 3BRTB 2B87B 2WT7A 1NTMD 1USDA 4WWIA 4N3YB 4XFJA 3USSA 1NU1G 1VQNP 1EZVI 3Q5PA 2WVRA 3CWBE 2VRSA 3AE3C 1E5WA 3KDPB 4U3FE 4N78E 3AEGC 4ASVA 1KZUB 1RHZB 1EDLA 3AE6C 3SWFA 1JUNA 2NRGA 2K88A 5C39A 4PV1D 2E75D 3P8CE 1USEA 2FYUJ 3RL0D 2BCCE 4BWNA 2OYHA 5BU8B 1OMIA 1JY2N 2Y9YA 3CMEP 4GDOA 1NHLA 4PV1C 3CXHI 2E75C 5APTA 1K9MQ 1LTJB 3RL0C 2C9NY 2M3EA 5EFWB 1KN7A 3HD7D 1WRGA 3RK2C 2Q3IA 1M1KQ 3A7OA 4N6JA 2E76B 2WSCH 2ZXXA 2G3AA 3S4RA 1OW8A 3L75E 3HD7C 1KILD 1NTME 1YJNP 1BE3J 2OQQA 3BCCE 2FBWC 3H1IG 1W5CE 2IBZD 1JTHB 1GW3A 2QJKB 1KILC 5KJ7D 3MD0A 1G1JA 2HODB 3Q2YA 3G4SP 1L4AA 5KJ7C 1M1JA 2Y0EA 3CI9A 2AEJA 3L36A 1GU4A 4OWFA 1SFCB 2QJYC 2FYUD 1T2KD 1JO5A 2M0BA 3GW6A 1J1EC 1RF1B 1L0LE 1RE3C 2AXTH 4HH2A 1T2KC 3G3ZA 5KAIH 4GT1A 1SQPJ 1IFJA 3G9RA 2O01N 5DJUB 3L74E 1N7SD 2JDIH 3EFFK 4NPEA 4I1LA 2CK3H 2JJLA 3HD7A 2ZFCA 3L73G 1FC2C 3A0BH 1PPJE 3RL0g 1NJIQ 3KXDA 1BE3D 4Z1MH 1MZ9A 1N7SC 4R4LA 1FS0E 3H1LJ 1PGOA 1FOSE 2IBZE 1YIJP 3H1KG 1KV4A 1YQ4C 1A02J 1PGPA 1SLQA 2PAJA 3HE4A 3N4XA 4Y99B 1DX7A 1T8ZA 1BCCG 1L0NJ 1BGYJ 1P84H 3GMAA 5KJ7A 1NAFA 5E79H 1HUCA 1NTZG 2H8PD 2CPBA 3R4YA 1KFMA 3D71A 3VYIA 1ZW0A 1K05A 3PRJA 1PFIA 3E7KA 2Z5IA 1YJWP 1VQ9P 3PJSK 5TJHA 3CCJP 3F5HA 2WPSA 5B66H 2NZ2A 1SQQK 2ITAA 1SQPD 1G2CA 3L35A 5AW8B 1FZFA 5AVWB 5CHXA 3CL3D 1N7SA 5GTIH 1LT9B 3C9IA 5CBNA 3KYQA 3H1LD 1H8AA 1N7LA 3BASA 1OWAA 2N1TD 1SQBE 2HPCA 1EZVG 1LWUA 4HB1A 3BATA 3CX5H 3CC4P 1U7JA 3RK3B 1L0ND 1BGYD 1YBKA 2N1TC 4W7YA 2A06E 2IYPA 1SQVJ 2WPRA 1DIPA 2ZXEB 1U7MA 2WPVB 1ZV8A 2GUVA 2WSFJ 2J59M 3QH9A 3W67A 4PJ0H 2LKMA 3O6QA 1Q81Q 2Y0CA 1KB9H 4EOTA 1FZCC 5KAFH 4H0LD 3L70E 2B87A 1T3JA 1MV8A 5APYA 1FDIA 1S5LE 2IBZI 2QM8A 3AE8C 2MJZA 4C7NB 4H0LC 1PP9G 1FZEA 2K9JB 3B5NB 3JCUE 2OYOA 3M9BA 3GF3A 2O1KA 1VDFA 2R3CA 4MN4C 2WSEH 1NTKE 2WSSH 5DJTB 2W8ZA 3CWBJ 3H1LE 1OX3A 2AEFA 4U3FJ 1AQ5A 2Z4EA 2M5AB 1PIXA 4CPGA 5CJ0A 3WUVA 4ZNCA 1VF5B 2P10A 1GL2B 2N1TA 1BGYE 1JMMA 5APWA 2DW3A 3L72G 4BXLA 1SQVD 3UIAA 2P67A 2BCCJ 1URQB 4EIJA 1M56D 4BRYB 1BDDA 1ZRTD 3L71E 5KLVJ 3E1RA 4RESB 3TGUG 2ZJSE 2YKQA 4EYYQ 3H1HG 3T97B 4K35A 2IX7C 1KMIZ 2QJPC 1FZCA 1EDKA 2OGUA 2GUSA 4C46A 4UB6E 3TNUA 3Q5RA 3R2PA 3A5TA 3CCEP 4B86A 3EWKA 4XA4A 1N73B 1DEEG 1OW7A 1JTHA 2WPQA 1VQ4P 1DD3A 1LP1A 4TT3H 4D6TG 3HTKB 1TU3F 5TISE 2XDJA 3AEEC 3MUDA 2HODA 3CMAP 3CWBD 1R5SA 4HJGH 2KS1A 1NGMB 5AW1B 4U3FD 1SQXK 1RH5B 2ZAEB 4N78D 1M90Q 3N7NA 1NTZK 2KXPB 2ZT9D 3E1IA 3K5BA 3CXHH 1NU1J 3P8CD 3H25A 3G71P
chains in the Genus database with same CATH topology
5E79H 4IL6H 5GTHH 5H2FH 1S5LH 5B66H 4UB6H 5TISH 3KZIH 3WU2H 4PJ0H 5GTIH 5B5EH 3JCUH 2AXTH 3A0BH 3A0HH 4UB8H 5KAIH 5KAFH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E79 H;  4IL6 H;  5GTH H;  5H2F H;  1S5L H;  5B66 H;  4UB6 H;  5TIS H;  3KZI H;  3WU2 H;  4PJ0 H;  5GTI H;  5B5E H;  3JCU H;  2AXT H;  3A0B H;  3A0H H;  4UB8 H;  5KAI H;  5KAF H; 
#chains in the Genus database with same CATH topology
 3MZW B;  2HR3 A;  1SQV E;  2BCC D;  2HLO A;  2ZT9 C;  2LXC B;  3D6Z A;  5KLV D;  1RF0 C;  3FGA D;  4R4M A;  2NPS B;  2OYH C;  1L0L J;  1VQM P;  1OIP A;  1MKM A;  1BSN A;  4DZO A;  2R3S A;  2Y9Z A;  1YQ3 C;  2E5Y A;  3L74 J;  1WT6 A;  2BEQ D;  1H89 A;  1NTM G;  1NYH A;  3Q3D A;  2P1J A;  1JY3 O;  4JPZ B;  4GIF A;  4OGQ B;  1EDI A;  3LID A;  1IK9 A;  4WY4 D;  3BCC D;  3CD6 P;  3AE4 C;  4GOF A;  4IL6 H;  1VQ7 P;  2A45 I;  1PGQ A;  1L4A D;  4WY4 C;  1CI6 B;  3H32 A;  4C7R A;  2G8Y A;  1LJ2 A;  3WUU A;  3RBZ A;  3A0H H;  2YO2 A;  4OH8 B;  2YKP A;  4W7Z A;  2YXR B;  1L4A C;  2UWJ E;  5H2F H;  1MFT A;  1QX8 A;  2OYI C;  3V4W A;  1BDC A;  1M1J C;  1NU1 D;  1OZH A;  2KLU A;  3KZI E;  1R5L A;  3TYY A;  1ZP0 C;  1BSH A;  2RMZ A;  2OAR A;  1W2B O;  1RF0 A;  1HH0 A;  4GOD A;  1L0L D;  5KLV E;  1EDJ A;  5M1B A;  3I55 P;  1QEX A;  2YIU C;  4JYC A;  5CBO A;  3L74 D;  4LGD E;  2E74 B;  4H44 B;  4L73 A;  1VPC A;  1NOH A;  1LTA C;  3Q5S A;  1PPJ D;  1KYO D;  3OA7 A;  1FDO A;  3C1L A;  3RK3 E;  3HUS C;  3GG2 A;  2PGD A;  5AVS B;  2FFD B;  3H1J E;  4H13 D;  3V2N A;  2WQY C;  1FAV A;  1SQB J;  4WY4 A;  4UB8 H;  2KIK A;  1Y47 A;  3MTU E;  4IL6 X;  2WZ7 A;  2XKM A;  2OTJ P;  1FBM A;  3GLM A;  4H13 C;  3VP8 A;  1OVV A;  2FYU G;  2OYI A;  4IFF A;  5AW6 B;  2AXT E;  1H88 A;  1S2E A;  1M7L A;  3AE5 C;  1ZN5 A;  1NU1 E;  5KAI E;  3SWK A;  2IZ1 A;  3NFQ A;  4LLH A;  4I7Z C;  1J2J B;  2KK7 A;  1JB0 J;  2RKL A;  2KNC B;  1LTI C;  1MUU A;  1FJP A;  2JO1 A;  2Q3E A;  3AE1 C;  3NXS A;  1FOS F;  1LTB C;  3L70 J;  2OTL P;  2D2C B;  3L4F A;  2RH0 A;  2K9J A;  1LNQ A;  2WWW A;  1BE3 G;  1QL2 A;  1IZN B;  3VMY A;  1YHQ P;  3HUS A;  1KYO E;  2ZYG A;  5CJ4 A;  2WMM A;  1NTK J;  5AVU B;  3KPE A;  5E79 E;  2FYN B;  5KKZ B;  3HRN A;  1SQB D;  3VMZ A;  2RN0 A;  4Y28 J;  1U57 A;  3CCQ P;  1JCD A;  3WU2 E;  5AW2 B;  1Q86 Q;  1SQX G;  1LWU C;  1NKN A;  2WT7 B;  3MHV A;  1RY3 A;  2A06 D;  2QM7 A;  2L5G B;  1X0T A;  2Q9I A;  3H1I E;  2IYO A;  3EFG A;  1W2E A;  3L71 J;  3M06 A;  3C8V A;  1J1D C;  2W6A A;  1LT1 A;  4DOJ A;  2YNY A;  2O1J A;  3OW2 O;  1SQP G;  2H88 C;  3Q1M A;  2V7Q J;  3PTZ A;  1GD2 E;  3L70 D;  3II6 A;  5KLI C;  1NTM K;  1IO4 A;  1IFI A;  1HBW A;  5B5E H;  5GTI E;  1ZR2 A;  5AVR B;  2WIT A;  1PV3 A;  1QVF O;  4K3A A;  3MGN A;  3D70 A;  2R5B A;  3H1L G;  3BVH A;  1ZME C;  3CX5 E;  3JC2 2;  2QSI A;  2GM4 A;  3I56 P;  1NTK D;  4LC1 A;  3M0D C;  2M8R A;  3AEF C;  2KP8 A;  2JWD A;  3W68 A;  1K8A Q;  4AYC A;  2Q1K A;  3GHG B;  2A45 G;  1X79 B;  2QE7 H;  1L0N G;  3HE5 A;  4HKZ H;  2WTY A;  3V2R A;  1NWQ A;  1LTT C;  2OTK E;  4NPD A;  2I1K A;  3V6I A;  3D6Y A;  3TDK A;  2W27 A;  4PJ0 E;  4DT0 A;  1Q82 Q;  2ZYD A;  2KZI A;  1KB9 E;  4EI2 A;  2P7J A;  3L71 D;  3H6P A;  2E76 D;  1LTJ C;  3H1K E;  1LTS C;  4GOE A;  3MIW A;  2FYZ A;  3G6E P;  3SFD C;  1BCC E;  2E76 C;  4W80 A;  1FZG A;  1KYO I;  1A02 F;  1AVO A;  1YIT P;  3CCU P;  3F89 A;  3VMX A;  1IFD A;  2FXO A;  2KB7 P;  2YMK A;  1CI6 A;  3M0D A;  2QJK C;  1QVG O;  3H1H J;  4PV1 B;  2E75 B;  3ABV C;  4PD4 E;  3RL0 B;  3B71 A;  5CCH D;  3MUD C;  1SFC D;  3RK2 B;  3VP9 A;  2JEE A;  2Y0D A;  3U1A A;  4AUW A;  1LGH B;  3I5C A;  1KQG B;  3LIE A;  1VQK P;  1JOC A;  1HGZ A;  1SQV G;  1JY2 O;  2FYU K;  5CCH C;  2AXC A;  3HD7 B;  2FY8 A;  1SFC C;  5CCG D;  1DD4 A;  2O3J A;  3JSV C;  4JBZ A;  4XE5 B;  1NAY A;  1E79 H;  2V4H A;  3FWN A;  1RF1 C;  1KIL B;  4I6M C;  1LTJ A;  5AVT B;  3PLN A;  3CC2 P;  4KHX A;  3IAO A;  1ZR4 A;  1X22 A;  1YYC A;  2WSC J;  2QA4 P;  4RKU J;  1OVR A;  1EZV E;  3HE4 B;  3L37 A;  1XTC C;  1Z56 A;  1S1C X;  1HTL C;  2XNX A;  2QEX P;  2QJY B;  2A45 H;  4YPC A;  2YXQ B;  1T6A A;  3WMM 0;  2HG5 D;  1OVU A;  4DCK A;  1J1E B;  2HYN A;  1X9V A;  5AW0 B;  3CWB G;  3H1J J;  3H1H D;  1PZQ A;  4U3F G;  1HF9 A;  2E43 A;  3CCV P;  4Y99 C;  1NVO A;  5APX A;  5BVZ A;  1PL5 A;  1SQQ J;  2B89 A;  1IFN A;  1T3U A;  2V7Q H;  5AVY B;  2BAS A;  3RGU A;  4UB6 H;  5CCH A;  5GTH E;  1SFC A;  3CPW O;  5BU5 A;  2BCC G;  3MP7 B;  3ZDM A;  1N7S B;  3CC7 P;  1RF1 A;  3PHL A;  1VQO P;  1EC5 A;  5CCG A;  2C0X A;  1KOR A;  1GMJ A;  3KQG A;  1S5L X;  2W6J H;  4RJT A;  1SQP K;  5AVX B;  3RBX A;  2HPC B;  1R8E A;  2YO3 A;  4AQR D;  1JCC A;  2H89 C;  3ITK A;  3L75 G;  1Q90 D;  5L8R J;  1MFZ A;  1M8O B;  3IFM A;  3KHU A;  5AW9 B;  1Q7Y Q;  1YI2 P;  3P32 A;  4IL6 E;  1HGV A;  4PD4 I;  3BCC G;  2XU6 A;  3L72 E;  1OFC X;  1OXZ A;  2IZ0 A;  1LT9 C;  1IFP A;  2Q7C A;  4M3L A;  3RK3 D;  2C0W A;  2FKW B;  4L75 A;  1GDT A;  1H0T B;  3H1J D;  3A0H E;  3O6Q B;  3TGU E;  3U59 A;  3H1H E;  4JQ0 D;  1VQ8 P;  1L0N K;  5AVV B;  2WSF H;  4EDF A;  3RK3 C;  1S3J A;  1SQQ D;  3VMA A;  2J5U A;  1X8Y A;  4RO0 A;  5APV A;  4HYT B;  1AFO A;  2SPZ A;  4KJM A;  1FU1 A;  3NMD A;  3H1I J;  2N9B A;  4D6T E;  3IR9 A;  2L91 A;  1L0L G;  2HFE D;  2H43 A;  3GF7 A;  1VQP P;  3L74 G;  5APQ A;  3CLQ A;  3IN6 A;  2Z5H A;  1KQL A;  3B5N D;  1AJY A;  1UIX A;  2N1T B;  1RQV A;  3M0A A;  3IF4 A;  4U7J A;  1Q2N A;  1G1I A;  1PPJ G;  1RQU A;  3AE9 C;  3AEA C;  2JR8 A;  3RK2 D;  3B5N C;  2QRX A;  4UB8 E;  1LT9 A;  1YTZ T;  3FXD A;  1VQL P;  4O9B A;  3PH0 A;  2IBZ G;  3A3Y B;  1VF5 D;  3GHG A;  1GL2 D;  3KZI H;  1GTW A;  1P84 D;  1SVF A;  1KQS O;  4WVZ A;  1FZC B;  1KQF B;  2B9B A;  2JWA A;  1VF5 C;  1VQ5 P;  1GL2 C;  3TNU B;  1URQ D;  2KI7 B;  1SQQ E;  3V5B A;  1SQV K;  1QL1 A;  4H0L B;  3L73 J;  4QMA A;  4IFM A;  2ZVN B;  1URQ C;  2J58 A;  3CCR P;  2I8D A;  1LP1 B;  2R44 A;  3H1I D;  3CCS P;  1LTG C;  1QGK B;  1JY2 P;  3M9H A;  2MKV A;  3H1K J;  1K04 A;  2KS1 B;  1JMB A;  2C9L Y;  4NPF X;  4TLF A;  1SQX J;  2PRR A;  2JP3 A;  1BCC J;  3VOP A;  2W6B A;  3A0B E;  1NTZ J;  1AV1 A;  4C7N A;  2WSE J;  1N73 C;  2IFN A;  3B4S A;  3B5N A;  1VQ6 P;  1KTM A;  1KFN A;  1FE6 A;  3CCL P;  1IK7 A;  1IC2 A;  2IFM A;  3CX5 D;  1VL2 A;  1SQB G;  2YMY A;  2QJP B;  5AW4 B;  1QLE D;  1P84 E;  1NKZ B;  1YTZ I;  3P8M C;  2M5A A;  4WBA A;  3S1K A;  1KC8 Q;  1GL2 A;  2CPS A;  1UII A;  1GU5 A;  2H7H A;  2A06 G;  5CMZ A;  1KIL E;  2IDB A;  1K73 Q;  2NPS D;  1FZA A;  3L73 D;  1URQ A;  1KIL A;  4BRY A;  4ZKP A;  5KLV K;  1JY3 N;  1KB9 D;  1NH4 A;  1FJK A;  3TSI A;  3V4Q A;  5B66 E;  2NPS C;  3T97 A;  1KYO H;  3H1K D;  4ASW A;  5B5E E;  1L2P A;  3L70 G;  1N2D C;  4OGQ D;  3H32 B;  1SQX D;  2FXP A;  3M9Q A;  1BCC D;  1CSB A;  2E5T A;  1Y9B A;  3WU2 H;  1N73 A;  1NTZ D;  1EXI A;  4WB4 A;  1N8R Q;  3AED C;  1S9K D;  4OGQ C;  2FYU E;  3LW5 J;  3WUT A;  2R32 A;  3S9O A;  1HVV A;  3HTK A;  2ZT9 B;  1RE3 A;  1NTK G;  4GKG A;  1S72 P;  1RE4 C;  1IFM A;  2KSJ A;  2OYH B;  3TK1 A;  1JY3 P;  2KLV A;  4PD4 D;  1YJ9 P;  4ZMD A;  1Y8A A;  2B88 A;  2KYV A;  1JNM A;  1WMK A;  1BGY G;  1NU1 K;  3O8Z A;  1AVY A;  1BE3 E;  1PP9 J;  4KT0 J;  2QVA A;  3L71 G;  3L73 E;  1L0L K;  3FWL A;  1JEK A;  2O01 J;  3FX0 A;  2NPS A;  2Q5U A;  2E74 D;  2Q6Q A;  4H44 D;  1JM0 A;  5KAF E;  4DJG A;  3M91 A;  4WY4 B;  1ZOY C;  1CW5 A;  1EZV D;  1EQ7 A;  4JYB A;  3P7K A;  3NTN A;  2E74 C;  4H44 C;  2ZVO B;  1SQX E;  1N86 A;  1L4A B;  3A2A A;  5APU A;  2OYI B;  1NTZ E;  1M1J B;  1P84 I;  3L72 J;  1S9K E;  2R5D A;  5AW5 B;  1CZQ A;  1H0T A;  4A7P A;  1FZB A;  1GK6 A;  2IPP A;  1RE4 A;  4OVN F;  3SSU A;  2FFD C;  2KOG A;  3AEB C;  2P58 A;  3V2Q A;  3TGU J;  2YKO A;  1GW4 A;  2YIU B;  1SQP E;  1OW6 A;  3OAK A;  3VTP C;  3EQ2 A;  1DH3 A;  2XZR A;  3CXH D;  4YXW H;  1IJD B;  1HJ0 A;  2ZYA A;  4L74 A;  1HWT C;  2POH A;  1PP9 D;  1S5L H;  1ZLL A;  4D6T J;  3HUS B;  2M3B A;  2KSE A;  2D2C D;  5AVQ B;  3CCM P;  3JCU H;  4YXD C;  4ZKU A;  1S4X A;  5CCG C;  1GK4 A;  4IFD K;  2FXM A;  4JF7 A;  2KUB A;  2W83 C;  4PD4 H;  1L0N E;  3U1C A;  1SP4 A;  4YTP C;  2D2C C;  4H13 B;  2GA1 A;  2E42 A;  3V2P A;  2LXB A;  5AW7 B;  2BEZ F;  3CX5 I;  3SWY A;  1EXJ A;  2PP6 A;  3L72 D;  2PFX A;  2XND H;  3VN0 A;  2K9Y A;  2FFD A;  1XTG B;  1SQB K;  2FYN C;  1AA0 A;  4I7Z B;  5KKZ C;  3TGU D;  4L76 A;  1NO4 A;  1KD1 Q;  1HJB A;  3L75 J;  1DEB A;  2KZJ A;  3PP5 A;  1NTM J;  3CXH E;  1SS1 A;  1KB9 I;  5K5G B;  1G2C B;  3BCC J;  1AQT A;  2I1J A;  1FDM A;  3AEC C;  1ZXG A;  2AEM A;  4I2L C;  3LW5 H;  1GZL A;  2N9Y B;  2QG4 A;  2K1A A;  1PP9 E;  3AE7 C;  4D6T D;  2QIW A;  5KLV G;  2KNC A;  2JKV A;  5KTB A;  5TIS H;  5AVZ B;  5APS A;  3HE5 B;  2K3R A;  2K37 A;  4IOI H;  3FXE A;  1LWU B;  1M57 D;  2LR2 A;  3AE2 C;  2W90 A;  3SFE C;  3TF5 A;  5GTH H;  3OJA B;  3QWO C;  1NTK K;  1ZRT E;  2XV5 A;  3H1J G;  1J1D B;  2O01 H;  1PGJ A;  5AW3 B;  3B8E B;  1SQQ G;  3GHG C;  1D7M A;  3L75 D;  5KLI B;  3BRV B;  5H2F E;  2P2U A;  3BRT B;  2B87 B;  2WT7 A;  1NTM D;  1USD A;  4WWI A;  4N3Y B;  4XFJ A;  3USS A;  1NU1 G;  1VQN P;  1EZV I;  3Q5P A;  2WVR A;  3CWB E;  2VRS A;  3AE3 C;  1E5W A;  3KDP B;  4U3F E;  4N78 E;  3AEG C;  4ASV A;  1KZU B;  1RHZ B;  1EDL A;  3AE6 C;  3SWF A;  1JUN A;  2NRG A;  2K88 A;  5C39 A;  4PV1 D;  2E75 D;  3P8C E;  1USE A;  2FYU J;  3RL0 D;  2BCC E;  4BWN A;  2OYH A;  5BU8 B;  1OMI A;  1JY2 N;  2Y9Y A;  3CME P;  4GDO A;  1NHL A;  4PV1 C;  3CXH I;  2E75 C;  5APT A;  1K9M Q;  1LTJ B;  3RL0 C;  2C9N Y;  2M3E A;  5EFW B;  1KN7 A;  3HD7 D;  1WRG A;  3RK2 C;  2Q3I A;  1M1K Q;  3A7O A;  4N6J A;  2E76 B;  2WSC H;  2ZXX A;  2G3A A;  3S4R A;  1OW8 A;  3L75 E;  3HD7 C;  1KIL D;  1NTM E;  1YJN P;  1BE3 J;  2OQQ A;  3BCC E;  2FBW C;  3H1I G;  1W5C E;  2IBZ D;  1JTH B;  1GW3 A;  2QJK B;  1KIL C;  5KJ7 D;  3MD0 A;  1G1J A;  2HOD B;  3Q2Y A;  3G4S P;  1L4A A;  5KJ7 C;  1M1J A;  2Y0E A;  3CI9 A;  2AEJ A;  3L36 A;  1GU4 A;  4OWF A;  1SFC B;  2QJY C;  2FYU D;  1T2K D;  1JO5 A;  2M0B A;  3GW6 A;  1J1E C;  1RF1 B;  1L0L E;  1RE3 C;  2AXT H;  4HH2 A;  1T2K C;  3G3Z A;  5KAI H;  4GT1 A;  1SQP J;  1IFJ A;  3G9R A;  2O01 N;  5DJU B;  3L74 E;  1N7S D;  2JDI H;  3EFF K;  4NPE A;  4I1L A;  2CK3 H;  2JJL A;  3HD7 A;  2ZFC A;  3L73 G;  1FC2 C;  3A0B H;  1PPJ E;  3RL0 g;  1NJI Q;  3KXD A;  1BE3 D;  4Z1M H;  1MZ9 A;  1N7S C;  4R4L A;  1FS0 E;  3H1L J;  1PGO A;  1FOS E;  2IBZ E;  1YIJ P;  3H1K G;  1KV4 A;  1YQ4 C;  1A02 J;  1PGP A;  1SLQ A;  2PAJ A;  3HE4 A;  3N4X A;  4Y99 B;  1DX7 A;  1T8Z A;  1BCC G;  1L0N J;  1BGY J;  1P84 H;  3GMA A;  5KJ7 A;  1NAF A;  5E79 H;  1HUC A;  1NTZ G;  2H8P D;  2CPB A;  3R4Y A;  1KFM A;  3D71 A;  3VYI A;  1ZW0 A;  1K05 A;  3PRJ A;  1PFI A;  3E7K A;  2Z5I A;  1YJW P;  1VQ9 P;  3PJS K;  5TJH A;  3CCJ P;  3F5H A;  2WPS A;  5B66 H;  2NZ2 A;  1SQQ K;  2ITA A;  1SQP D;  1G2C A;  3L35 A;  5AW8 B;  1FZF A;  5AVW B;  5CHX A;  3CL3 D;  1N7S A;  5GTI H;  1LT9 B;  3C9I A;  5CBN A;  3KYQ A;  3H1L D;  1H8A A;  1N7L A;  3BAS A;  1OWA A;  2N1T D;  1SQB E;  2HPC A;  1EZV G;  1LWU A;  4HB1 A;  3BAT A;  3CX5 H;  3CC4 P;  1U7J A;  3RK3 B;  1L0N D;  1BGY D;  1YBK A;  2N1T C;  4W7Y A;  2A06 E;  2IYP A;  1SQV J;  2WPR A;  1DIP A;  2ZXE B;  1U7M A;  2WPV B;  1ZV8 A;  2GUV A;  2WSF J;  2J59 M;  3QH9 A;  3W67 A;  4PJ0 H;  2LKM A;  3O6Q A;  1Q81 Q;  2Y0C A;  1KB9 H;  4EOT A;  1FZC C;  5KAF H;  4H0L D;  3L70 E;  2B87 A;  1T3J A;  1MV8 A;  5APY A;  1FDI A;  1S5L E;  2IBZ I;  2QM8 A;  3AE8 C;  2MJZ A;  4C7N B;  4H0L C;  1PP9 G;  1FZE A;  2K9J B;  3B5N B;  3JCU E;  2OYO A;  3M9B A;  3GF3 A;  2O1K A;  1VDF A;  2R3C A;  4MN4 C;  2WSE H;  1NTK E;  2WSS H;  5DJT B;  2W8Z A;  3CWB J;  3H1L E;  1OX3 A;  2AEF A;  4U3F J;  1AQ5 A;  2Z4E A;  2M5A B;  1PIX A;  4CPG A;  5CJ0 A;  3WUV A;  4ZNC A;  1VF5 B;  2P10 A;  1GL2 B;  2N1T A;  1BGY E;  1JMM A;  5APW A;  2DW3 A;  3L72 G;  4BXL A;  1SQV D;  3UIA A;  2P67 A;  2BCC J;  1URQ B;  4EIJ A;  1M56 D;  4BRY B;  1BDD A;  1ZRT D;  3L71 E;  5KLV J;  3E1R A;  4RES B;  3TGU G;  2ZJS E;  2YKQ A;  4EYY Q;  3H1H G;  3T97 B;  4K35 A;  2IX7 C;  1KMI Z;  2QJP C;  1FZC A;  1EDK A;  2OGU A;  2GUS A;  4C46 A;  4UB6 E;  3TNU A;  3Q5R A;  3R2P A;  3A5T A;  3CCE P;  4B86 A;  3EWK A;  4XA4 A;  1N73 B;  1DEE G;  1OW7 A;  1JTH A;  2WPQ A;  1VQ4 P;  1DD3 A;  1LP1 A;  4TT3 H;  4D6T G;  3HTK B;  1TU3 F;  5TIS E;  2XDJ A;  3AEE C;  3MUD A;  2HOD A;  3CMA P;  3CWB D;  1R5S A;  4HJG H;  2KS1 A;  1NGM B;  5AW1 B;  4U3F D;  1SQX K;  1RH5 B;  2ZAE B;  4N78 D;  1M90 Q;  3N7N A;  1NTZ K;  2KXP B;  2ZT9 D;  3E1I A;  3K5B A;  3CXH H;  1NU1 J;  3P8C D;  3H25 A;  3G71 P; 
#chains in the Genus database with same CATH homology
 5E79 H;  4IL6 H;  5GTH H;  5H2F H;  1S5L H;  5B66 H;  4UB6 H;  5TIS H;  3KZI H;  3WU2 H;  4PJ0 H;  5GTI H;  5B5E H;  3JCU H;  2AXT H;  3A0B H;  3A0H H;  4UB8 H;  5KAI H;  5KAF H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...