4PJ0H

Structure of t.elongatus photosystem ii, rows of dimers crystal packing
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein 1
publication title Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
pubmed doi rcsb
molecule tags Oxidoreductase, electron transport
total genus 14
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 4pj0H01
5E79H 3A0HH 3WU2H 5TISH 4PJ0H 4UB8H 5KAFH 2AXTH 5H2FH 5B66H 4UB6H 5B5EH 3JCUH 1S5LH 5KAIH 3KZIH 3A0BH 5GTHH 5GTIH 4IL6H
chains in the Genus database with same CATH superfamily
1PP9J 1HGVA 3BVHA 3BATA 4DCKA 1IC2A 5E79E 2V7QH 3L71E 4N6JA 3BCCE 3M9QA 1AVYA 1ZV8A 1BGYE 2JEEA 1J1EC 1OW7A 3EWKA 1FDIA 1NKNA 1FS0E 1LJ2A 4H44D 3H1HD 1KMIZ 2FYUG 1NTKG 2O01J 3M06A 1SQQG 2J59M 2QRXA 3L75D 2OYIA 3RK3E 3CCLP 2NPSC 5KLVK 4IL6H 1FE6A 2HG5D 3L70J 3EFGA 4EIJA 3S4RA 1BCCJ 1NTZE 1USEA 1OVUA 2J58A 1NO4A 2FKWB 1GW4A 1NAYA 5L8RJ 1N8RQ 1EZVG 1N7SC 2G3AA 2ZT9C 3HUSA 3QWOC 4I1LA 3PJSK 1FBMA 2QJPB 1L0LD 2IBZD 1GL2D 1SQBE 5AW6B 1Q7YQ 4D6TJ 2Q7CA 1SFCD 2KLUA 1HGZA 3WUVA 4U3FJ 1KQGB 3KXDA 1WMKA 1NOHA 1SP4A 3AE6C 1KILD 1T2KD 4NPDA 2CPBA 3LW5J 3S1KA 4EI2A 2I1KA 1U7JA 3JCUH 2WPQA 1CI6B 1SQXK 1FZFA 1M8OB 1LT1A 3CC7P 1JY3O 1KORA 3H32B 1J1EB 4R4MA 2P58A 5AVYB 1DEEG 1FOSE 5AW7B 5AW1B 2D2CC 3NTNA 4H13D 3H1JG 1HJ0A 3H6PA 1VQOP 3L74E 2B87A 3CCEP 1BE3D 2YO3A 4U7JA 1PP9E 2MJZA 4W80A 3HD7A 4IFDK 2QJKC 5AW2B 1KFNA 2W8ZA 2NPSB 3UIAA 5AW8B 2YKOA 3L73J 1QVFO 4BRYB 2ITAA 4PV1D 3A0HH 1NYHA 3RGUA 3B5NB 3TF5A 3VP9A 1N7SB 1ZN5A 1PPJD 2RN0A 2ZT9B 2YKPA 2B88A 2R44A 5KLVD 1L0ND 5AVZB 1G2CA 3KHUA 2N9BA 1NH4A 5APUA 2QM8A 3L70E 3L75E 1BCCE 4PJ0E 2E43A 2O3JA 1LWUA 2IBZI 5CCHA 2WSFJ 3T97B 3CC2P 3II6A 3TGUD 1H0TA 5AVWB 1BSNA 1CZQA 1JY3N 5AVXB 5EFWB 1OW6A 2P7JA 3H1ID 1NTKJ 2K9JA 4D6TE 3V2QA 3V2PA 3M0DC 5KJ7C 3P32A 3L72D 2H7HA 4U3FE 2M3EA 1G1IA 2P67A 1Q81Q 1EDKA 1VQ8P 5CCGD 1Y9BA 3D70A 4C7NA 1GU4A 3CCMP 3AE4C 3S9OA 4WVZA 2D2CB 2O01N 2BASA 3E7KA 4Y28J 1SQXD 2YIUC 3HD7C 2FFDC 2O1KA 1JMBA 2K9YA 4TLFA 1KQFB 3KZIE 1N2DC 2ZFCA 1RF0A 2QJKB 3PH0A 5CBOA 1NWQA 2H43A 3R2PA 1DD4A 3KYQA 1SQBK 5CBNA 2HODB 3P8CD 3B8EB 3MTUE 3CL3D 1IFDA 1M7LA 3SFEC 1GL2A 2Q6QA 1X79B 5BVZA 4WWIA 4QMAA 5H2FH 1EDLA 1SFCA 3V6IA 1YJNP 5KAFE 3SWFA 1YHQP 1Y47A 1VF5D 1LWUC 3F89A 1EC5A 1IJDB 4W7ZA 2KUBA 1P84H 1FZGA 5CJ4A 2IZ0A 2KB7P 4N78D 1KILA 2H89C 1Q90D 2OTKE 2XKMA 1P84D 3H1KD 2QVAA 1LT9C 2IYPA 4AUWA 1PGQA 5CMZA 2K1AA 1YI2P 1GMJA 1NTMK 3BRVB 3G71P 3H1JJ 1YYCA 4H44C 4KT0J 3L71D 3BCCD 2FYNC 3JSVC 2KP8A 1BGYD 1W5CE 2Y0DA 2PFXA 2XDJA 4JBZA 3MGNA 1OMIA 1QEXA 1S72P 1N73A 4YPCA 2YIUB 3HD7B 1RF0C 2FFDB 3H1HG 3H1LD 4OWFA 3VMAA 3KQGA 2GUSA 2WTYA 1NTKE 2VRSA 1VQ5P 3GHGC 3OJAB 1K9MQ 3RK2D 2OYOA 3RK3D 1FU1A 3TK1A 1JOCA 1NTZD 1KTMA 3NMDA 4HB1A 1PGPA 3TNUB 1FZCC 1H88A 5DJUB 1DH3A 1QL2A 1S9KE 1PGJA 1OVVA 1LTIC 1SQVJ 2IBZG 2OQQA 1LWUB 1USDA 4A7PA 1VL2A 2CPSA 5APTA 2QSIA 5KJ7D 3D6YA 1QVGO 1PV3A 2FXMA 2B9BA 1PGOA 2LR2A 2QJYC 1LT9B 1EDIA 1L0LK 4BWNA 2K9JB 1LTTC 1IFPA 3QH9A 4H44B 1P84I 4BRYA 4H13C 1NU1J 3IR9A 2JJLA 2WSSH 4C7NB 5CCGA 3L36A 1JTHB 2FYNB 3GW6A 1VPCA 1N73C 3M0AA 3CCSP 1N7SA 3W68A 2KS1B 1Z56A 3CWBJ 1FDOA 1A02J 1GDTA 2FY8A 4PV1C 2JDIH 3L74D 3WU2E 2WVRA 3H1JE 1P84E 1PP9D 3GHGB 1YJ9P 5APSA 1NGMB 3IN6A 4UB6E 4ZKUA 3CCRP 3A7OA 3WMM0 1KV4A 1LP1A 3G9RA 2O01H 4BXLA 2WZ7A 5DJTB 1SFCB 1YTZT 4AQRD 1FZCB 2WT7A 1FJPA 1SQPJ 1ZW0A 2E75D 2E5YA 4WY4D 3CI9A 1XTCC 4EDFA 3CCUP 5KLVG 5GTIE 3P7KA 1TU3F 1KILB 2O1JA 3Q2YA 3H1LE 4PJ0H 4DZOA 1VQKP 3HTKB 1VQ9P 3U1AA 3L70D 1BCCD 1FZAA 1S5LX 2E74D 3OAKA 3A0BH 3Q5RA 1AA0A 1WRGA 1K05A 3A2AA 1S5LE 3V4WA 1E79H 1L0NK 1GTWA 3TGUG 1SLQA 2R3CA 1KYOE 4YXDC 5CCGC 1SQVE 3W67A 2PGDA 3C1LA 3H1IG 3H1HJ 4H13B 1VQMP 2BCCG 1T6AA 2HODA 4D6TD 1MUUA 2FBWC 1S2EA 4HH2A 2YXRB 3CX5E 2FXOA 3L72G 1N73B 2BEZF 4U3FD 4WBAA 3LW5H 2GUVA 3KZIH 1KZUB 4PV1B 2JO1A 3ZDMA 1SQXG 5GTHE 1VQPP 2JKVA 1NU1E 4OGQD 3M9HA 4EOTA 3G6EP 1OW8A 1Q82Q 2A06G 3CWBE 1VF5C 3PLNA 3VMZA 4HJGH 2XV5A 5CJ0A 1JNMA 1YIJP 2IFNA 2R32A 2YXQB 5KAFH 2OTLP 3CLQA 4UB8E 3M0DA 5KJ7A 1K04A 1RHZB 5KKZC 2P2UA 2OGUA 2IX7C 3L73D 3AEGC 1R5LA 2HFED 1X0TA 5KLIC 4L76A 2FFDA 1SQPE 3CXHI 2BEQD 2K88A 1IO4A 3N7NA 3H1KG 2P10A 1MFTA 2B89A 3AE5C 3MD0A 2RH0A 2WSFH 1M56D 3SWKA 1BDDA 3BCCG 3TNUA 2KK7A 3CXHE 3RK2C 2N1TD 3VOPA 3RK3C 1JUNA 1HJBA 1CW5A 1IK9A 4L73A 2C9NY 2QM7A 4I7ZC 1RF1A 1K73Q 2CK3H 1LP1B 1NTKD 4ASWA 2WQYC 3A0BE 4H0LD 2M0BA 1L4AD 4GODA 3E1RA 5M1BA 5K5GB 1LT9A 2WT7B 4RJTA 2FYUJ 4ZNCA 1VF5B 4PD4E 1NTZG 1SQQJ 5APQA 2N9YB 1RE4A 1NVOA 4K3AA 1EZVD 2Q3EA 5KKZB 4XE5B 1JTHA 1S9KD 3MUDA 3R4YA 1SQBG 1YBKA 4M3LA 1LTJA 4ASVA 1NTZK 3AEDC 2OYHA 1MV8A 2WPVB 2R5DA 2KS1A 4ZMDA 3PP5A 2HLOA 2BCCJ 2L5GB 5KLIB 1VQNP 1GD2E 1DIPA 1NJIQ 3GLMA 1J2JB 2W90A 1YQ4C 3GHGA 5AVQB 2QIWA 1T8ZA 2JP3A 5AVUB 1OX3A 2GA1A 2IFMA 3O8ZA 2QA4P 2KSEA 3D71A 1CSBA 1ZLLA 2FYZA 2Y0CA 3A3YB 1FC2C 1IK7A 1FZCA 1NU1K 1X9VA 3AEBC 3RK2B 3RK3B 3L73E 4GDOA 4DJGA 1RF1C 3MHVA 3WU2H 2HPCB 1NTMG 2JR8A 2XZRA 4I7ZB 2KXPB 3G4SP 3L74G 4UB6H 2PP6A 3H1JD 1IZNB 1PP9G 5KTBA 3CCJP 1URQD 3HTKA 3RBZA 1UIXA 2E75C 4WY4C 4W7YA 1JMMA 4Z1MH 3L37A 2M8RA 1L2PA 2PRRA 1OZHA 2P1JA 4HYTB 1RE4C 1PFIA 3I56P 5APYA 2AXTE 3MUDC 4LGDE 1MKMA 5GTIH 5B5EE 1MFZA 2E74C 1GW3A 2IZ1A 1LTJC 3EQ2A 2OYHC 3H1KJ 1J1DC 4DOJA 1M1KQ 3AE9C 1M90Q 1NKZB 2C0XA 1YJWP 1N86A 2FYUE 1S5LH 4C46A 3VP8A 3L70G 3L75G 1BCCG 1EZVI 1AV1A 1SQQE 2E5TA 3F5HA 1RQUA 1KYOH 2IPPA 1FJKA 5BU8B 3AEFC 2NRGA 1KYOD 1JY2O 1IFNA 2PAJA 2WSEJ 1SQVD 1M1JA 3CX5H 1KB9E 5AVTB 2KIKA 1ZRTD 1Y8AA 2WITA 2BCCE 3LIDA 1EZVE 2ZXXA 3CX5D 5TISE 2Z4EA 1L0LG 2KNCB 4KJMA 4OGQC 1HTLC 1RF1B 1Q2NA 4ZKPA 2KLVA 2Q3IA 5GTHH 3MZWB 3CCQP 3Q3DA 1L4AA 2ZVNB 1JY2P 4RO0A 5AVRB 2E75B 1S4XA 1E5WA 1NU1D 3VYIA 3GMAA 4WY4B 3Q5SA 1PL5A 1SQBJ 1S1CX 5AVVB 1HWTC 3CWBD 2R3SA 2XNXA 1LTSC 4UB8H 1FZEA 3CMAP 2A06E 4NPFX 2E74B 1XTGB 1LTJB 1RE3A 3SSUA 1X22A 1JEKA 2ZYGA 2OYHB 4GKGA 1GK6A 1J1DB 3HE5A 2WMMA 1EDJA 4JYCA 2WSCJ 1RQVA 1W2EA 1QLED 4L74A 4YTPC 3E1IA 3V2NA 3G3ZA 1ZOYC 1JY2N 1BE3G 3GF7A 2MKVA 1EQ7A 3RL0D 3GG2A 1ZR4A 2I8DA 2SPZA 3I55P 1SQPD 4HKZH 3HE4B 5APVA 2FXPA 3C9IA 1M1JC 1KC8Q 1YQ3C 2YNYA 1EXIA 1G1JA 2H8PD 2N1TC 1DEBA 1NTMJ 3FGAD 5CCHD 3KDPB 5B66E 1X8YA 1PPJG 3CD6P 1KQLA 3CXHH 1KYOI 1N7LA 3TSIA 1L0NG 4OGQB 3ITKA 1Q86Q 3CXHD 4H0LC 2AEFA 1L4AC 2K37A 5AW3B 1S3JA 1URQA 2QJYB 3CX5I 3PRJA 1AQTA 2XNDH 1SVFA 5C39A 1R8EA 2AXCA 4DT0A 2V7QJ 2KSJA 2KZIA 4PD4H 1KQSO 2G8YA 2ZVOB 3FWLA 1RY3A 1RE3C 1ZRTE 4PD4D 2W6BA 3U59A 2LXBA 1MZ9A 2W6JH 3RBXA 3FXEA 1JCDA 2FYUK 3L75J 1NTKK 1HVVA 3WUUA 1SQQK 4CPGA 3AE2C 1OFCX 2WPRA 5BU5A 1LNQA 2E76D 3B5NC 3PTZA 3NFQA 3VMYA 2YO2A 1JCCA 3H25A 2KYVA 3WUTA 3BRTB 2A45H 3KPEA 1NAFA 3Q5PA 4JYBA 2HPCA 4GT1A 1ZMEC 3U1CA 2I1JA 4I2LC 1L0LJ 1M1JB 2C0WA 5AW5B 3VTPC 1VDFA 2N1TB 1T3UA 1AFOA 2HYNA 2E42A 1H8AA 1A02F 3Q1MA 1JO5A 3FX0A 3LIEA 5AW0B 1KD1Q 3AE8C 3CCVP 1URQC 4H0LB 1H89A 1L4AB 4LLHA 3CMEP 1FOSF 3V2RA 2AEJA 2YMYA 2GM4A 3O6QB 2QG4A 3IFMA 1NTME 1KFMA 2LXCB 2JWAA 2OYIC 5CHXA 3AEAC 3AECC 3FWNA 2Q1KA 2AEMA 2UWJE 2POHA 2M5AA 4IFMA 1RH5B 4O9BA 2NZ2A 2W83C 2AXTH 2R5BA 2LKMA 1BDCA 5B5EH 2H88C 1AJYA 1QX8A 3HE5B 1BE3J 1HF9A 3L71G 2IDBA 4NPEA 5KAIE 1JY3P 5APXA 3AEEC 1BGYG 3HUSC 3D6ZA 1SS1A 2XU6A 4PD4I 2RKLA 2ZYAA 2KNCA 2Q5UA 1U57A 3H1LG 3L35A 2Y9YA 3TDKA 2FYUD 3H1HE 1OXZA 1D7MA 2J5UA 4XA4A 2WWWA 1SQQD 2ZXEB 2OTJP 5KLVJ 1EXJA 1VQ4P 2Z5HA 1L0NJ 4LC1A 3EFFK 3K5BA 1OWAA 1KB9H 4WY4A 2A45I 2YMKA 4JPZB 4IL6X 2ZAEB 1SQVG 3MIWA 3BASA 5TISH 1KB9D 4IL6E 3VMXA 4C7RA 2QEXP 3P8MC 2BCCD 3GF3A 1HUCA 1URQB 1YTZI 3TGUJ 2NPSD 5TJHA 3PHLA 1L0LE 2IBZE 1SQVK 1DD3A 4Y99C 1M57D 3H1IJ 2JWDA 3M91A 2V4HA 4GOFA 1AQ5A 3B5ND 2OYIB 3JC22 1DX7A 3L72J 3MP7B 1N7SD 1WT6A 2ZT9D 3IAOA 1NU1G 1IFMA 1IFJA 2KI7B 3M9BA 1KILE 3HE4A 1SQXJ 1R5SA 3V5BA 3CWBG 1HH0A 2W27A 2A06D 1W2BO 1OVRA 3RL0C 3HUSB 3L4FA 2Y9ZA 3JCUE 1LTGC 5AVSB 1PZQA 4KHXA 1JB0J 4XFJA 1LGHB 2Q9IA 2HR3A 1UIIA 1FAVA 1VQ7P 4B86A 3OA7A 5CCHC 4GIFA 4TT3H 3RL0g 1BE3E 1SQPG 2L91A 3SWYA 5B66H 1OIPA 2D2CD 1U7MA 1IFIA 4JF7A 5E79H 1SQPK 3A0HE 4EYYQ 1PIXA 1PPJE 1K8AQ 4RESB 2KOGA 2OARA 5KLVE 1KB9I 4Y99B 1L0NE 2WSEH 2Z5IA 2M5AB 4IFFA 2B87B 3SFDC 1QL1A 1YITP 1GZLA 3L71J 3A5TA 3V4QA 3IF4A 3BCCJ 1BGYJ 5AW4B 4I6MC 3TGUE 3I5CA 2E76C 3TYYA 3H1LJ 2WPSA 2M3BA 4D6TG 3H1IE 3AE3C 2N1TA 1QGKB 2W6AA 1GL2C 1VQLP 3RL0B 2YKQA 4U3FG 1KN7A 2IYOA 2K3RA 3FXDA 3CC4P 3L72E 1SFCC 1G2CB 4GOEA 1CI6A 3OW2O 1NTZJ 3HRNA 2C9LY 1JM0A 5AW9B 2KZJA 4L75A 1SQBD 3B71A 3H32A 3USSA 4R4LA 1SQXE 1KILC 1T2KC 2A45G 2ZJSE 1AVOA 1FDMA 3O6QA 1H0TB 1NHLA 4K35A 1ZR2A 2WSCH 4N3YB 3NXSA 4RKUJ 3CPWO 3HD7D 3P8CE 1GU5A 2NPSA 3C8VA 4WB4A 3AE7C 3N4XA 1LTBC 4JQ0D 3ABVC 2DW3A 3B4SA 4IOIH 3B5NA 3L73G 2QJPC 1GK4A 2RMZA 4MN4C 5H2FE 3VN0A 1T3JA 4OH8B 4AYCA 1NTMD 1ZXGA 3AE1C 1FZBA 4N78E 1ZP0C 2Y0EA 2ZYDA 1LTAC 4YXWH 1BSHA 3H1KE 1VQ6P 2E76B 4OVNF 5APWA 5KAIH 2QE7H 3T97A 1HBWA 3L74J 1GL2B
chains in the Genus database with same CATH topology
5E79H 3A0HH 3WU2H 5TISH 4PJ0H 4UB8H 5KAFH 2AXTH 5H2FH 5B66H 4UB6H 5B5EH 3JCUH 1S5LH 5KAIH 3KZIH 3A0BH 5GTHH 5GTIH 4IL6H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E79 H;  3A0H H;  3WU2 H;  5TIS H;  4PJ0 H;  4UB8 H;  5KAF H;  2AXT H;  5H2F H;  5B66 H;  4UB6 H;  5B5E H;  3JCU H;  1S5L H;  5KAI H;  3KZI H;  3A0B H;  5GTH H;  5GTI H;  4IL6 H; 
#chains in the Genus database with same CATH topology
 1PP9 J;  1HGV A;  3BVH A;  3BAT A;  4DCK A;  1IC2 A;  5E79 E;  2V7Q H;  3L71 E;  4N6J A;  3BCC E;  3M9Q A;  1AVY A;  1ZV8 A;  1BGY E;  2JEE A;  1J1E C;  1OW7 A;  3EWK A;  1FDI A;  1NKN A;  1FS0 E;  1LJ2 A;  4H44 D;  3H1H D;  1KMI Z;  2FYU G;  1NTK G;  2O01 J;  3M06 A;  1SQQ G;  2J59 M;  2QRX A;  3L75 D;  2OYI A;  3RK3 E;  3CCL P;  2NPS C;  5KLV K;  4IL6 H;  1FE6 A;  2HG5 D;  3L70 J;  3EFG A;  4EIJ A;  3S4R A;  1BCC J;  1NTZ E;  1USE A;  1OVU A;  2J58 A;  1NO4 A;  2FKW B;  1GW4 A;  1NAY A;  5L8R J;  1N8R Q;  1EZV G;  1N7S C;  2G3A A;  2ZT9 C;  3HUS A;  3QWO C;  4I1L A;  3PJS K;  1FBM A;  2QJP B;  1L0L D;  2IBZ D;  1GL2 D;  1SQB E;  5AW6 B;  1Q7Y Q;  4D6T J;  2Q7C A;  1SFC D;  2KLU A;  1HGZ A;  3WUV A;  4U3F J;  1KQG B;  3KXD A;  1WMK A;  1NOH A;  1SP4 A;  3AE6 C;  1KIL D;  1T2K D;  4NPD A;  2CPB A;  3LW5 J;  3S1K A;  4EI2 A;  2I1K A;  1U7J A;  3JCU H;  2WPQ A;  1CI6 B;  1SQX K;  1FZF A;  1M8O B;  1LT1 A;  3CC7 P;  1JY3 O;  1KOR A;  3H32 B;  1J1E B;  4R4M A;  2P58 A;  5AVY B;  1DEE G;  1FOS E;  5AW7 B;  5AW1 B;  2D2C C;  3NTN A;  4H13 D;  3H1J G;  1HJ0 A;  3H6P A;  1VQO P;  3L74 E;  2B87 A;  3CCE P;  1BE3 D;  2YO3 A;  4U7J A;  1PP9 E;  2MJZ A;  4W80 A;  3HD7 A;  4IFD K;  2QJK C;  5AW2 B;  1KFN A;  2W8Z A;  2NPS B;  3UIA A;  5AW8 B;  2YKO A;  3L73 J;  1QVF O;  4BRY B;  2ITA A;  4PV1 D;  3A0H H;  1NYH A;  3RGU A;  3B5N B;  3TF5 A;  3VP9 A;  1N7S B;  1ZN5 A;  1PPJ D;  2RN0 A;  2ZT9 B;  2YKP A;  2B88 A;  2R44 A;  5KLV D;  1L0N D;  5AVZ B;  1G2C A;  3KHU A;  2N9B A;  1NH4 A;  5APU A;  2QM8 A;  3L70 E;  3L75 E;  1BCC E;  4PJ0 E;  2E43 A;  2O3J A;  1LWU A;  2IBZ I;  5CCH A;  2WSF J;  3T97 B;  3CC2 P;  3II6 A;  3TGU D;  1H0T A;  5AVW B;  1BSN A;  1CZQ A;  1JY3 N;  5AVX B;  5EFW B;  1OW6 A;  2P7J A;  3H1I D;  1NTK J;  2K9J A;  4D6T E;  3V2Q A;  3V2P A;  3M0D C;  5KJ7 C;  3P32 A;  3L72 D;  2H7H A;  4U3F E;  2M3E A;  1G1I A;  2P67 A;  1Q81 Q;  1EDK A;  1VQ8 P;  5CCG D;  1Y9B A;  3D70 A;  4C7N A;  1GU4 A;  3CCM P;  3AE4 C;  3S9O A;  4WVZ A;  2D2C B;  2O01 N;  2BAS A;  3E7K A;  4Y28 J;  1SQX D;  2YIU C;  3HD7 C;  2FFD C;  2O1K A;  1JMB A;  2K9Y A;  4TLF A;  1KQF B;  3KZI E;  1N2D C;  2ZFC A;  1RF0 A;  2QJK B;  3PH0 A;  5CBO A;  1NWQ A;  2H43 A;  3R2P A;  1DD4 A;  3KYQ A;  1SQB K;  5CBN A;  2HOD B;  3P8C D;  3B8E B;  3MTU E;  3CL3 D;  1IFD A;  1M7L A;  3SFE C;  1GL2 A;  2Q6Q A;  1X79 B;  5BVZ A;  4WWI A;  4QMA A;  5H2F H;  1EDL A;  1SFC A;  3V6I A;  1YJN P;  5KAF E;  3SWF A;  1YHQ P;  1Y47 A;  1VF5 D;  1LWU C;  3F89 A;  1EC5 A;  1IJD B;  4W7Z A;  2KUB A;  1P84 H;  1FZG A;  5CJ4 A;  2IZ0 A;  2KB7 P;  4N78 D;  1KIL A;  2H89 C;  1Q90 D;  2OTK E;  2XKM A;  1P84 D;  3H1K D;  2QVA A;  1LT9 C;  2IYP A;  4AUW A;  1PGQ A;  5CMZ A;  2K1A A;  1YI2 P;  1GMJ A;  1NTM K;  3BRV B;  3G71 P;  3H1J J;  1YYC A;  4H44 C;  4KT0 J;  3L71 D;  3BCC D;  2FYN C;  3JSV C;  2KP8 A;  1BGY D;  1W5C E;  2Y0D A;  2PFX A;  2XDJ A;  4JBZ A;  3MGN A;  1OMI A;  1QEX A;  1S72 P;  1N73 A;  4YPC A;  2YIU B;  3HD7 B;  1RF0 C;  2FFD B;  3H1H G;  3H1L D;  4OWF A;  3VMA A;  3KQG A;  2GUS A;  2WTY A;  1NTK E;  2VRS A;  1VQ5 P;  3GHG C;  3OJA B;  1K9M Q;  3RK2 D;  2OYO A;  3RK3 D;  1FU1 A;  3TK1 A;  1JOC A;  1NTZ D;  1KTM A;  3NMD A;  4HB1 A;  1PGP A;  3TNU B;  1FZC C;  1H88 A;  5DJU B;  1DH3 A;  1QL2 A;  1S9K E;  1PGJ A;  1OVV A;  1LTI C;  1SQV J;  2IBZ G;  2OQQ A;  1LWU B;  1USD A;  4A7P A;  1VL2 A;  2CPS A;  5APT A;  2QSI A;  5KJ7 D;  3D6Y A;  1QVG O;  1PV3 A;  2FXM A;  2B9B A;  1PGO A;  2LR2 A;  2QJY C;  1LT9 B;  1EDI A;  1L0L K;  4BWN A;  2K9J B;  1LTT C;  1IFP A;  3QH9 A;  4H44 B;  1P84 I;  4BRY A;  4H13 C;  1NU1 J;  3IR9 A;  2JJL A;  2WSS H;  4C7N B;  5CCG A;  3L36 A;  1JTH B;  2FYN B;  3GW6 A;  1VPC A;  1N73 C;  3M0A A;  3CCS P;  1N7S A;  3W68 A;  2KS1 B;  1Z56 A;  3CWB J;  1FDO A;  1A02 J;  1GDT A;  2FY8 A;  4PV1 C;  2JDI H;  3L74 D;  3WU2 E;  2WVR A;  3H1J E;  1P84 E;  1PP9 D;  3GHG B;  1YJ9 P;  5APS A;  1NGM B;  3IN6 A;  4UB6 E;  4ZKU A;  3CCR P;  3A7O A;  3WMM 0;  1KV4 A;  1LP1 A;  3G9R A;  2O01 H;  4BXL A;  2WZ7 A;  5DJT B;  1SFC B;  1YTZ T;  4AQR D;  1FZC B;  2WT7 A;  1FJP A;  1SQP J;  1ZW0 A;  2E75 D;  2E5Y A;  4WY4 D;  3CI9 A;  1XTC C;  4EDF A;  3CCU P;  5KLV G;  5GTI E;  3P7K A;  1TU3 F;  1KIL B;  2O1J A;  3Q2Y A;  3H1L E;  4PJ0 H;  4DZO A;  1VQK P;  3HTK B;  1VQ9 P;  3U1A A;  3L70 D;  1BCC D;  1FZA A;  1S5L X;  2E74 D;  3OAK A;  3A0B H;  3Q5R A;  1AA0 A;  1WRG A;  1K05 A;  3A2A A;  1S5L E;  3V4W A;  1E79 H;  1L0N K;  1GTW A;  3TGU G;  1SLQ A;  2R3C A;  1KYO E;  4YXD C;  5CCG C;  1SQV E;  3W67 A;  2PGD A;  3C1L A;  3H1I G;  3H1H J;  4H13 B;  1VQM P;  2BCC G;  1T6A A;  2HOD A;  4D6T D;  1MUU A;  2FBW C;  1S2E A;  4HH2 A;  2YXR B;  3CX5 E;  2FXO A;  3L72 G;  1N73 B;  2BEZ F;  4U3F D;  4WBA A;  3LW5 H;  2GUV A;  3KZI H;  1KZU B;  4PV1 B;  2JO1 A;  3ZDM A;  1SQX G;  5GTH E;  1VQP P;  2JKV A;  1NU1 E;  4OGQ D;  3M9H A;  4EOT A;  3G6E P;  1OW8 A;  1Q82 Q;  2A06 G;  3CWB E;  1VF5 C;  3PLN A;  3VMZ A;  4HJG H;  2XV5 A;  5CJ0 A;  1JNM A;  1YIJ P;  2IFN A;  2R32 A;  2YXQ B;  5KAF H;  2OTL P;  3CLQ A;  4UB8 E;  3M0D A;  5KJ7 A;  1K04 A;  1RHZ B;  5KKZ C;  2P2U A;  2OGU A;  2IX7 C;  3L73 D;  3AEG C;  1R5L A;  2HFE D;  1X0T A;  5KLI C;  4L76 A;  2FFD A;  1SQP E;  3CXH I;  2BEQ D;  2K88 A;  1IO4 A;  3N7N A;  3H1K G;  2P10 A;  1MFT A;  2B89 A;  3AE5 C;  3MD0 A;  2RH0 A;  2WSF H;  1M56 D;  3SWK A;  1BDD A;  3BCC G;  3TNU A;  2KK7 A;  3CXH E;  3RK2 C;  2N1T D;  3VOP A;  3RK3 C;  1JUN A;  1HJB A;  1CW5 A;  1IK9 A;  4L73 A;  2C9N Y;  2QM7 A;  4I7Z C;  1RF1 A;  1K73 Q;  2CK3 H;  1LP1 B;  1NTK D;  4ASW A;  2WQY C;  3A0B E;  4H0L D;  2M0B A;  1L4A D;  4GOD A;  3E1R A;  5M1B A;  5K5G B;  1LT9 A;  2WT7 B;  4RJT A;  2FYU J;  4ZNC A;  1VF5 B;  4PD4 E;  1NTZ G;  1SQQ J;  5APQ A;  2N9Y B;  1RE4 A;  1NVO A;  4K3A A;  1EZV D;  2Q3E A;  5KKZ B;  4XE5 B;  1JTH A;  1S9K D;  3MUD A;  3R4Y A;  1SQB G;  1YBK A;  4M3L A;  1LTJ A;  4ASV A;  1NTZ K;  3AED C;  2OYH A;  1MV8 A;  2WPV B;  2R5D A;  2KS1 A;  4ZMD A;  3PP5 A;  2HLO A;  2BCC J;  2L5G B;  5KLI B;  1VQN P;  1GD2 E;  1DIP A;  1NJI Q;  3GLM A;  1J2J B;  2W90 A;  1YQ4 C;  3GHG A;  5AVQ B;  2QIW A;  1T8Z A;  2JP3 A;  5AVU B;  1OX3 A;  2GA1 A;  2IFM A;  3O8Z A;  2QA4 P;  2KSE A;  3D71 A;  1CSB A;  1ZLL A;  2FYZ A;  2Y0C A;  3A3Y B;  1FC2 C;  1IK7 A;  1FZC A;  1NU1 K;  1X9V A;  3AEB C;  3RK2 B;  3RK3 B;  3L73 E;  4GDO A;  4DJG A;  1RF1 C;  3MHV A;  3WU2 H;  2HPC B;  1NTM G;  2JR8 A;  2XZR A;  4I7Z B;  2KXP B;  3G4S P;  3L74 G;  4UB6 H;  2PP6 A;  3H1J D;  1IZN B;  1PP9 G;  5KTB A;  3CCJ P;  1URQ D;  3HTK A;  3RBZ A;  1UIX A;  2E75 C;  4WY4 C;  4W7Y A;  1JMM A;  4Z1M H;  3L37 A;  2M8R A;  1L2P A;  2PRR A;  1OZH A;  2P1J A;  4HYT B;  1RE4 C;  1PFI A;  3I56 P;  5APY A;  2AXT E;  3MUD C;  4LGD E;  1MKM A;  5GTI H;  5B5E E;  1MFZ A;  2E74 C;  1GW3 A;  2IZ1 A;  1LTJ C;  3EQ2 A;  2OYH C;  3H1K J;  1J1D C;  4DOJ A;  1M1K Q;  3AE9 C;  1M90 Q;  1NKZ B;  2C0X A;  1YJW P;  1N86 A;  2FYU E;  1S5L H;  4C46 A;  3VP8 A;  3L70 G;  3L75 G;  1BCC G;  1EZV I;  1AV1 A;  1SQQ E;  2E5T A;  3F5H A;  1RQU A;  1KYO H;  2IPP A;  1FJK A;  5BU8 B;  3AEF C;  2NRG A;  1KYO D;  1JY2 O;  1IFN A;  2PAJ A;  2WSE J;  1SQV D;  1M1J A;  3CX5 H;  1KB9 E;  5AVT B;  2KIK A;  1ZRT D;  1Y8A A;  2WIT A;  2BCC E;  3LID A;  1EZV E;  2ZXX A;  3CX5 D;  5TIS E;  2Z4E A;  1L0L G;  2KNC B;  4KJM A;  4OGQ C;  1HTL C;  1RF1 B;  1Q2N A;  4ZKP A;  2KLV A;  2Q3I A;  5GTH H;  3MZW B;  3CCQ P;  3Q3D A;  1L4A A;  2ZVN B;  1JY2 P;  4RO0 A;  5AVR B;  2E75 B;  1S4X A;  1E5W A;  1NU1 D;  3VYI A;  3GMA A;  4WY4 B;  3Q5S A;  1PL5 A;  1SQB J;  1S1C X;  5AVV B;  1HWT C;  3CWB D;  2R3S A;  2XNX A;  1LTS C;  4UB8 H;  1FZE A;  3CMA P;  2A06 E;  4NPF X;  2E74 B;  1XTG B;  1LTJ B;  1RE3 A;  3SSU A;  1X22 A;  1JEK A;  2ZYG A;  2OYH B;  4GKG A;  1GK6 A;  1J1D B;  3HE5 A;  2WMM A;  1EDJ A;  4JYC A;  2WSC J;  1RQV A;  1W2E A;  1QLE D;  4L74 A;  4YTP C;  3E1I A;  3V2N A;  3G3Z A;  1ZOY C;  1JY2 N;  1BE3 G;  3GF7 A;  2MKV A;  1EQ7 A;  3RL0 D;  3GG2 A;  1ZR4 A;  2I8D A;  2SPZ A;  3I55 P;  1SQP D;  4HKZ H;  3HE4 B;  5APV A;  2FXP A;  3C9I A;  1M1J C;  1KC8 Q;  1YQ3 C;  2YNY A;  1EXI A;  1G1J A;  2H8P D;  2N1T C;  1DEB A;  1NTM J;  3FGA D;  5CCH D;  3KDP B;  5B66 E;  1X8Y A;  1PPJ G;  3CD6 P;  1KQL A;  3CXH H;  1KYO I;  1N7L A;  3TSI A;  1L0N G;  4OGQ B;  3ITK A;  1Q86 Q;  3CXH D;  4H0L C;  2AEF A;  1L4A C;  2K37 A;  5AW3 B;  1S3J A;  1URQ A;  2QJY B;  3CX5 I;  3PRJ A;  1AQT A;  2XND H;  1SVF A;  5C39 A;  1R8E A;  2AXC A;  4DT0 A;  2V7Q J;  2KSJ A;  2KZI A;  4PD4 H;  1KQS O;  2G8Y A;  2ZVO B;  3FWL A;  1RY3 A;  1RE3 C;  1ZRT E;  4PD4 D;  2W6B A;  3U59 A;  2LXB A;  1MZ9 A;  2W6J H;  3RBX A;  3FXE A;  1JCD A;  2FYU K;  3L75 J;  1NTK K;  1HVV A;  3WUU A;  1SQQ K;  4CPG A;  3AE2 C;  1OFC X;  2WPR A;  5BU5 A;  1LNQ A;  2E76 D;  3B5N C;  3PTZ A;  3NFQ A;  3VMY A;  2YO2 A;  1JCC A;  3H25 A;  2KYV A;  3WUT A;  3BRT B;  2A45 H;  3KPE A;  1NAF A;  3Q5P A;  4JYB A;  2HPC A;  4GT1 A;  1ZME C;  3U1C A;  2I1J A;  4I2L C;  1L0L J;  1M1J B;  2C0W A;  5AW5 B;  3VTP C;  1VDF A;  2N1T B;  1T3U A;  1AFO A;  2HYN A;  2E42 A;  1H8A A;  1A02 F;  3Q1M A;  1JO5 A;  3FX0 A;  3LIE A;  5AW0 B;  1KD1 Q;  3AE8 C;  3CCV P;  1URQ C;  4H0L B;  1H89 A;  1L4A B;  4LLH A;  3CME P;  1FOS F;  3V2R A;  2AEJ A;  2YMY A;  2GM4 A;  3O6Q B;  2QG4 A;  3IFM A;  1NTM E;  1KFM A;  2LXC B;  2JWA A;  2OYI C;  5CHX A;  3AEA C;  3AEC C;  3FWN A;  2Q1K A;  2AEM A;  2UWJ E;  2POH A;  2M5A A;  4IFM A;  1RH5 B;  4O9B A;  2NZ2 A;  2W83 C;  2AXT H;  2R5B A;  2LKM A;  1BDC A;  5B5E H;  2H88 C;  1AJY A;  1QX8 A;  3HE5 B;  1BE3 J;  1HF9 A;  3L71 G;  2IDB A;  4NPE A;  5KAI E;  1JY3 P;  5APX A;  3AEE C;  1BGY G;  3HUS C;  3D6Z A;  1SS1 A;  2XU6 A;  4PD4 I;  2RKL A;  2ZYA A;  2KNC A;  2Q5U A;  1U57 A;  3H1L G;  3L35 A;  2Y9Y A;  3TDK A;  2FYU D;  3H1H E;  1OXZ A;  1D7M A;  2J5U A;  4XA4 A;  2WWW A;  1SQQ D;  2ZXE B;  2OTJ P;  5KLV J;  1EXJ A;  1VQ4 P;  2Z5H A;  1L0N J;  4LC1 A;  3EFF K;  3K5B A;  1OWA A;  1KB9 H;  4WY4 A;  2A45 I;  2YMK A;  4JPZ B;  4IL6 X;  2ZAE B;  1SQV G;  3MIW A;  3BAS A;  5TIS H;  1KB9 D;  4IL6 E;  3VMX A;  4C7R A;  2QEX P;  3P8M C;  2BCC D;  3GF3 A;  1HUC A;  1URQ B;  1YTZ I;  3TGU J;  2NPS D;  5TJH A;  3PHL A;  1L0L E;  2IBZ E;  1SQV K;  1DD3 A;  4Y99 C;  1M57 D;  3H1I J;  2JWD A;  3M91 A;  2V4H A;  4GOF A;  1AQ5 A;  3B5N D;  2OYI B;  3JC2 2;  1DX7 A;  3L72 J;  3MP7 B;  1N7S D;  1WT6 A;  2ZT9 D;  3IAO A;  1NU1 G;  1IFM A;  1IFJ A;  2KI7 B;  3M9B A;  1KIL E;  3HE4 A;  1SQX J;  1R5S A;  3V5B A;  3CWB G;  1HH0 A;  2W27 A;  2A06 D;  1W2B O;  1OVR A;  3RL0 C;  3HUS B;  3L4F A;  2Y9Z A;  3JCU E;  1LTG C;  5AVS B;  1PZQ A;  4KHX A;  1JB0 J;  4XFJ A;  1LGH B;  2Q9I A;  2HR3 A;  1UII A;  1FAV A;  1VQ7 P;  4B86 A;  3OA7 A;  5CCH C;  4GIF A;  4TT3 H;  3RL0 g;  1BE3 E;  1SQP G;  2L91 A;  3SWY A;  5B66 H;  1OIP A;  2D2C D;  1U7M A;  1IFI A;  4JF7 A;  5E79 H;  1SQP K;  3A0H E;  4EYY Q;  1PIX A;  1PPJ E;  1K8A Q;  4RES B;  2KOG A;  2OAR A;  5KLV E;  1KB9 I;  4Y99 B;  1L0N E;  2WSE H;  2Z5I A;  2M5A B;  4IFF A;  2B87 B;  3SFD C;  1QL1 A;  1YIT P;  1GZL A;  3L71 J;  3A5T A;  3V4Q A;  3IF4 A;  3BCC J;  1BGY J;  5AW4 B;  4I6M C;  3TGU E;  3I5C A;  2E76 C;  3TYY A;  3H1L J;  2WPS A;  2M3B A;  4D6T G;  3H1I E;  3AE3 C;  2N1T A;  1QGK B;  2W6A A;  1GL2 C;  1VQL P;  3RL0 B;  2YKQ A;  4U3F G;  1KN7 A;  2IYO A;  2K3R A;  3FXD A;  3CC4 P;  3L72 E;  1SFC C;  1G2C B;  4GOE A;  1CI6 A;  3OW2 O;  1NTZ J;  3HRN A;  2C9L Y;  1JM0 A;  5AW9 B;  2KZJ A;  4L75 A;  1SQB D;  3B71 A;  3H32 A;  3USS A;  4R4L A;  1SQX E;  1KIL C;  1T2K C;  2A45 G;  2ZJS E;  1AVO A;  1FDM A;  3O6Q A;  1H0T B;  1NHL A;  4K35 A;  1ZR2 A;  2WSC H;  4N3Y B;  3NXS A;  4RKU J;  3CPW O;  3HD7 D;  3P8C E;  1GU5 A;  2NPS A;  3C8V A;  4WB4 A;  3AE7 C;  3N4X A;  1LTB C;  4JQ0 D;  3ABV C;  2DW3 A;  3B4S A;  4IOI H;  3B5N A;  3L73 G;  2QJP C;  1GK4 A;  2RMZ A;  4MN4 C;  5H2F E;  3VN0 A;  1T3J A;  4OH8 B;  4AYC A;  1NTM D;  1ZXG A;  3AE1 C;  1FZB A;  4N78 E;  1ZP0 C;  2Y0E A;  2ZYD A;  1LTA C;  4YXW H;  1BSH A;  3H1K E;  1VQ6 P;  2E76 B;  4OVN F;  5APW A;  5KAI H;  2QE7 H;  3T97 A;  1HBW A;  3L74 J;  1GL2 B; 
#chains in the Genus database with same CATH homology
 5E79 H;  3A0H H;  3WU2 H;  5TIS H;  4PJ0 H;  4UB8 H;  5KAF H;  2AXT H;  5H2F H;  5B66 H;  4UB6 H;  5B5E H;  3JCU H;  1S5L H;  5KAI H;  3KZI H;  3A0B H;  5GTH H;  5GTI H;  4IL6 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...