4PJ0H

Structure of t.elongatus photosystem ii, rows of dimers crystal packing
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein 1
publication title Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
pubmed doi rcsb
molecule tags Oxidoreductase, electron transport
total genus 14
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 4pj0H01
4UB8H 4PJ0H 1S5LH 5GTHH 5E79H 3A0BH 4IL6H 5KAFH 5B5EH 5GTIH 4UB6H 5KAIH 3JCUH 5B66H 5H2FH 3KZIH 2AXTH 3WU2H 5TISH 3A0HH
chains in the Genus database with same CATH superfamily
1NTKG 4UB8H 2M8RA 1SQXG 2Q9IA 5APWA 3RK3C 1QGKB 3I5CA 3RK3D 1FDMA 1HVVA 1JTHB 2BCCD 1LWUA 2OYOA 1Y47A 4NPEA 4HH2A 2QE7H 2V4HA 4DCKA 1LTAC 5CCGC 5EFWB 4RKUJ 3CWBJ 1IFPA 3L71J 1KV4A 3PHLA 1FBMA 1AJYA 4Z1MH 2R3SA 2Y0DA 3WUUA 4I7ZB 4UB8E 2VRSA 1Y8AA 1KMIZ 4D6TE 4ASWA 2HODA 1YITP 2B89A 1IK7A 1SQVE 3BATA 1VQ9P 1W2BO 3MZWB 5H2FH 3TSIA 3C1LA 1SQPG 4JPZB 1SLQA 1PGOA 3L75J 2B9BA 3WUTA 1RF1C 2ITAA 1T2KD 3OW2O 1DX7A 2WSCH 1CW5A 1VQOP 3H25A 1NTMK 1J1DB 2IBZD 1VPCA 2M0BA 4GODA 2WQYC 4O9BA 2Y0EA 2YKQA 3QWOC 3EFFK 1BGYJ 5H2FE 2R44A 4PV1C 1ZN5A 1JOCA 1VDFA 4PV1D 3Q1MA 3A0HH 1LTJA 1JMMA 1ZV8A 1GK6A 4L76A 2E43A 2FYUD 1NHLA 1LTTC 4K35A 3BRVB 1XTCC 1KB9H 3V5BA 4RESB 4WY4B 4BXLA 1RF1A 5KJ7C 1JMBA 4YPCA 1OW8A 3FXDA 5KJ7D 1IJDB 5APTA 3BCCE 2KS1A 5KLIC 2H7HA 1JUNA 3CXHH 5AW1B 1FZCB 4D6TG 1SQBE 3ABVC 2ZAEB 4EOTA 1BDCA 1M56D 3A0HE 1KQGB 1RY3A 3E1IA 1SQVG 5M1BA 5K5GB 2B87B 3CCQP 3M9QA 3IR9A 5GTHH 1KB9E 1JY2O 1H89A 4RJTA 3HRNA 5KAIH 3R4YA 3PTZA 3RK3B 4XE5B 2M3BA 1SFCC 4W7ZA 1NTMD 1SFCD 3VMZA 4AYCA 3GF3A 1A02F 3CXHE 1FE6A 3L73G 3AE3C 1BE3G 4DOJA 3M9HA 1KZUB 1M1JA 3LW5J 2QA4P 2C9NY 5DJTB 1FC2C 3WMM0 2WT7A 5GTHE 2OYHA 3RK3E 5KAIE 2A45H 3H1HJ 3VMYA 2KK7A 3AE7C 1HH0A 2H8PD 3H32A 1NU1J 3NXSA 2ZXEB 4N78E 3TYYA 3USSA 1LT1A 4TT3H 3L72D 4LGDE 3HE5B 3BCCG 2P7JA 3AEEC 2Y9YA 1NTZD 3MD0A 1RF1B 1JB0J 2B88A 1YJNP 5AVUB 1SQBG 2Q7CA 1OMIA 1NJIQ 5AW3B 4IFFA 5GTIE 3GF7A 5AVZB 2IZ0A 3A0BH 3FX0A 5KAFH 1VQNP 2KXPB 4U3FE 3RBZA 5CHXA 2M5AB 3AE6C 2E76C 2HFED 2E76D 4YXWH 1DH3A 2W8ZA 4PV1B 1NH4A 3RL0g 2P58A 1FJKA 2HR3A 3CCEP 2N1TA 1M8OB 1YI2P 1LP1B 3CPWO 2NPSC 3V2QA 1LT9A 2WVRA 3B5NC 4C7NA 2NPSD 3B5ND 1FZAA 3A0BE 1P84I 5KAFE 1OW6A 1R5LA 3HD7D 3G71P 1IFJA 2FFDC 3G4SP 5KLIB 3II6A 1PP9E 1SQQE 1YBKA 3WUVA 3SWFA 5B5EH 3SWKA 1SQVD 4EIJA 3H1LJ 1LTSC 3B4SA 3P8MC 2IYOA 2E75B 1LNQA 3NMDA 2NPSA 1SFCB 1S72P 1U7MA 3HD7A 4H44C 2A45G 4H44D 2YNYA 2QJPC 3SSUA 2SPZA 3D70A 2JJLA 3H1JJ 2YO3A 1IK9A 3Q5PA 3AECC 5B5EE 1ZMEC 3Q3DA 3CMEP 5AW9B 1FOSF 4IL6H 3L71E 2GUSA 1NKNA 1FOSE 2MKVA 2MJZA 3IFMA 3VYIA 3TGUJ 1FZBA 1QVFO 2P10A 1K05A 4RO0A 3MP7B 3VN0A 2XKMA 2PAJA 4GDOA 2KP8A 3A2AA 3TF5A 2W6AA 3VMAA 1RE4C 1W5CE 5APSA 1JNMA 1S5LH 1DEBA 5APUA 2XZRA 1PP9G 3L75E 1Q2NA 3V2RA 2QIWA 2FYUG 2KZJA 2H89C 2Q3IA 2YMKA 1GU5A 3AE8C 1KQLA 2E76B 3MUDA 2G3AA 4WY4D 1KB9D 3AE2C 1BGYE 3M9BA 3KXDA 1KN7A 1YHQP 2NRGA 4IFMA 3L70J 2WPSA 1S5LE 1YQ4C 2OGUA 3O6QB 2QVAA 3GW6A 2NPSB 1X0TA 2BASA 3B5NB 3CXHD 2ZFCA 3SWYA 2YKOA 4JYCA 5KTBA 2CPSA 5AVSB 3NFQA 1T8ZA 2FFDB 3H1LD 2KSJA 1NTMG 3AE4C 2RH0A 1UIXA 4OGQB 2KSEA 4HB1A 3BVHA 4WY4A 2JDIH 3R2PA 4CPGA 1WMKA 5L8RJ 1P84D 2DW3A 4EI2A 5CCGD 4N78D 3LW5H 1L4AC 1EDKA 1SQQK 3VMXA 2KIKA 1FZCA 2GUVA 1RHZB 5BU5A 1AFOA 5AW8B 3F5HA 4LC1A 4HKZH 1X79B 4EYYQ 2W6JH 2E42A 4H44B 3MGNA 1MFZA 2B87A 2WSFJ 3NTNA 2QJPB 2K88A 1DD3A 1NTKJ 3Q2YA 1JY2P 1SQXJ 1XTGB 1FZFA 3L72G 4U3FD 2O1KA 1IFIA 1L0NJ 1EC5A 3L74J 2A06E 1NTZG 1BGYG 2J59M 5AVWB 1OX3A 1JY3O 1HWTC 1G2CB 5CCGA 1EXJA 2WSEJ 1RF0C 3A3YB 3H1HE 5CCHC 2YO2A 1S1CX 3QH9A 5CCHD 2ZYDA 3RK2C 1NAYA 1NU1E 3EFGA 3RK2D 2YXRB 1R5SA 5KLVJ 1N73B 2M3EA 1ZP0C 3MTUE 2KNCB 1LGHB 4M3LA 4KT0J 1JCDA 1U7JA 1VQLP 1L0NK 1PP9D 1NO4A 1FDIA 1SQQD 1N7SC 1SQPJ 1EQ7A 1URQC 3HE5A 1HF9A 1N7SD 1URQD 3GHGC 2ZVNB 5B66H 4OVNF 2QJKB 3KYQA 3PLNA 1GK4A 2QRXA 1BCCJ 4ZKUA 1ZLLA 2XNXA 1LTBC 1IZNB 1QX8A 1J2JB 1EDJA 5CBNA 5CCHA 5APQA 2ZXXA 1NGMB 2WWWA 3AE5C 5AW6B 1RE3C 2M5AA 3S4RA 5KLVK 1KFMA 1GDTA 1K8AQ 1NAFA 5AVXB 3CMAP 2R5BA 1KTMA 4PJ0H 3CL3D 5B66E 3CWBD 1LP1A 3L71D 1ZW0A 2E75C 2E75D 4IOIH 1RQUA 4K3AA 2QG4A 3GHGA 4N3YB 1K04A 1P84H 2JR8A 5KJ7A 1EZVE 3RL0C 1YJ9P 1DD4A 3IAOA 1M1KQ 3RL0D 2XNDH 1PIXA 3G3ZA 2AEMA 2OTKE 1L4AB 1LTIC 2KOGA 1VF5C 4GKGA 1S9KE 2WTYA 3EQ2A 3H1LE 4PJ0E 4D6TJ 1RE3A 1VQ4P 1JO5A 3V2NA 2IZ1A 1KFNA 5GTIH 1K9MQ 3VP9A 3L75D 1L0LJ 2V7QJ 1IFMA 3L36A 2FXOA 2NZ2A 1P84E 3KQGA 2KB7P 3HE4B 1DIPA 3H1JE 1SFCA 2I8DA 2P67A 3AEGC 2ZYGA 1PPJD 4IFDK 3L73J 3GG2A 5KLVD 1GW4A 1BGYD 1BE3J 4GIFA 4U7JA 1N2DC 2E5TA 3TGUE 1Q82Q 1HTLC 4NPFX 2Z4EA 1KYOI 1GTWA 2N9YB 3RK2B 2AEJA 3M0DC 3JCUH 1EZVI 4YXDC 2K37A 2PGDA 2R32A 4I2LC 1L0LK 2UWJE 4C46A 1K73Q 1NU1K 1NVOA 3ZDMA 1H88A 1N7SB 2HG5D 1URQB 1Q7YQ 1N7LA 3A5TA 4I1LA 2JEEA 3GHGB 4BWNA 2POHA 1PGQA 1FU1A 3H1LG 2ZJSE 3H1IJ 3JCUE 1PGPA 1Q90D 1Y9BA 5APYA 2Q6QA 2C0WA 2Z5HA 1JM0A 4PD4H 1J1EC 5TISH 4OGQC 2WZ7A 2KLUA 1KORA 3CI9A 2D2CC 4OGQD 3P8CE 1G1IA 3E1RA 1JY2N 3L70E 2D2CD 1VQ8P 1BSNA 2FBWC 5TJHA 1OW7A 1BDDA 4C7RA 3JSVC 2O1JA 1GW3A 3L4FA 2Q3EA 2A06D 4BRYB 2RKLA 4AQRD 3O6QA 1H0TB 4XA4A 3H6PA 5CMZA 3B5NA 2IDBA 4IL6X 2WSFH 1OVUA 4PD4E 5TISE 2BEQD 3RL0B 4U3FG 2FFDA 3H1HD 3CCVP 3AE9C 2OYIC 2BCCJ 1AVOA 1VF5B 1E5WA 1NU1D 3P32A 5E79H 3TNUA 3CWBE 1USEA 2QM8A 1GZLA 2OARA 3IF4A 3L35A 2KLVA 2WSEH 2QEXP 1AQTA 1S5LX 1QLED 2IBZI 3AEBC 3C8VA 1X9VA 3CD6P 1T3UA 3HUSC 5AW7B 2AXCA 2XU6A 2KUBA 1NTKE 1SQXE 2JKVA 1BSHA 4GT1A 2W27A 1L0NE 1R8EA 1H8AA 3L74E 2I1KA 5APXA 1N73C 3Q5RA 1CZQA 5E79E 1RH5B 1M7LA 1WRGA 4GOFA 3L70G 5CBOA 1SQQG 3IN6A 1KILE 3FWLA 1VL2A 3VOPA 2OQQA 1ZR2A 2AXTH 3CX5H 2C9LY 2LR2A 2BEZF 4PD4I 1FAVA 1JY3P 2QJKC 1LTGC 1G2CA 1PPJE 3LIDA 1QEXA 1CI6B 2K9JA 3SFDC 2O3JA 3B8EB 5KLVE 1Q81Q 2Y0CA 3WU2H 1CSBA 2JP3A 1OWAA 1LWUC 1T6AA 1RE4A 3TDKA 1EZVD 1N73A 1SQPE 2AXTE 3CX5E 2KNCA 3CWBG 3L71G 2FYUJ 1N8RQ 1S9KD 2PP6A 1BCCE 4WVZA 3OA7A 1J1EB 1X8YA 3G9RA 1D7MA 3S9OA 3TNUB 2D2CB 4XFJA 1OVVA 1MZ9A 3D6YA 4H0LC 3WU2E 3B71A 2OTLP 3CCMP 2J5UA 2C0XA 5AW4B 1L0NG 3CCLP 3H1JD 5AVQB 1OFCX 3L74G 1L4AD 3H1KJ 3M06A 1E79H 2IFNA 4WB4A 5KKZC 1JEKA 1OZHA 1SVFA 3L75G 1YYCA 4DZOA 3P7KA 3RBXA 2V7QH 3TGUD 2FYUK 2JWDA 1GD2E 3CCJP 2O01J 2LXCB 1NTMJ 4W80A 1KD1Q 4A7PA 2OYIB 1HUCA 1G1JA 3FWNA 1FS0E 1PPJG 3AEFC 3CX5I 5KLVG 2L91A 1HBWA 3AE1C 1VQ6P 2OTJP 5AW0B 1LTJC 2RMZA 4UB6H 4JF7A 2IFMA 2PRRA 4OWFA 2K9JB 1L4AA 1IO4A 2WPVB 3G6EP 3HUSB 1L0LE 3PRJA 1GL2C 3OAKA 1AV1A 2QM7A 3M91A 2O01N 1GL2D 2KI7B 3V4WA 4DJGA 1T2KC 3LIEA 3CCSP 4L74A 3I56P 2K1AA 1BCCG 1NTKK 3U1AA 1SQXK 4ZNCA 1IFDA 3L72J 3L73E 3VTPC 1PV3A 3HE4A 5C39A 1BE3E 3PH0A 3P8CD 4W7YA 1ZXGA 1NTZJ 3L70D 4UB6E 2Z5IA 2FYNC 1MKMA 1NYHA 2FY8A 3KZIH 1ZRTE 2CK3H 3K5BA 3C9IA 3VP8A 1QL1A 1MUUA 1KYOH 1RF0A 1GU4A 1GL2A 2FXMA 2YIUC 2Q1KA 3CLQA 1LWUB 3I55P 4R4LA 4PD4D 1DEEG 3JC22 3OJAB 1KC8Q 3U59A 2A06G 4KHXA 4JQ0D 1M1JC 1IFNA 3F89A 1SP4A 1JCCA 4LLHA 1HGVA 4HYTB 3H1IE 2WPRA 3KZIE 1NTZK 2OYHC 1SQPK 1WT6A 1N7SA 1URQA 3FGAD 3H1KD 1AA0A 1KYOE 1W2EA 2YXQB 4H0LB 4QMAA 1L0LG 3H1HG 3FXEA 2FKWB 2HODB 3A7OA 5CJ4A 3CC7P 3N7NA 1S2EA 1NU1G 1SS1A 2FXPA 2IYPA 4JBZA 4TLFA 1NTKD 3BASA 1SQXD 1FZEA 2K3RA 1VF5D 1UIIA 1L0ND 3SFEC 2WITA 5KKZB 3L74D 5CJ0A 2HPCA 2XDJA 1SQVJ 1ZR4A 1N86A 1ZOYC 2Y9ZA 3U1CA 2E74C 1KILC 1OXZA 1S4XA 2E74D 1KILD 3Q5SA 1VQ5P 4BRYA 1PZQA 1JY3N 2WMMA 1MV8A 1Q86Q 1KQFB 2N9BA 1H0TA 2I1JA 1NKZB 2HLOA 2BCCE 2PFXA 4B86A 2QJYC 4DT0A 1MFTA 3M0AA 3O8ZA 2P1JA 2ZYAA 1S3JA 1LTJB 2N1TC 2W90A 4MN4C 4GOEA 1IC2A 2N1TD 2HYNA 3CCRP 1GL2B 1LT9C 1KB9I 1SQVK 2LKMA 5AVVB 1EDIA 1SQPD 4I6MC 3CX5D 2GA1A 2ZT9C 1YIJP 1KILA 3H1IG 2JWAA 2ZT9D 1T3JA 2KS1B 2WSCJ 1YTZI 5AVYB 1BCCD 3V2PA 3CXHI 4WWIA 5AVRB 2AEFA 1L2PA 4L73A 5BU8B 1EZVG 1TU3F 4Y99C 1PGJA 4L75A 3BCCJ 2FYNB 3L37A 2W83C 3ITKA 3S1KA 1KQSO 1SQBJ 4H13C 2FYZA 3D71A 4H13D 1VQKP 1LJ2A 4N6JA 2YIUB 2H88C 4OH8B 2IBZE 3HD7C 3M0DA 2HPCB 2L5GB 3TK1A 5BVZA 1VQMP 1HGZA 3H1JG 1CI6A 3PJSK 2R5DA 3HTKA 3CC4P 1M1JB 2BCCG 3AEDC 3KDPB 3GMAA 2WPQA 1RQVA 2WT7B 3GLMA 5AVTB 2FYUE 2OYHB 1A02J 4WBAA 2YKPA 3N4XA 4D6TD 1PFIA 4ASVA 3TGUG 2KYVA 2A45I 1SQBK 1NOHA 2O01H 3H32B 2IPPA 4AUWA 1Z56A 2RN0A 1L0LD 5AW5B 2IX7C 3CCUP 3UIAA 3V4QA 3RGUA 1FZGA 4I7ZC 3T97A 4JYBA 2H43A 4HJGH 1NWQA 2Q5UA 1M90Q 2JO1A 2J58A 3H1KE 1AVYA 4EDFA 2E74B 1KILB 3MHVA 2YMYA 4NPDA 3L73D 3W67A 1OIPA 1BE3D 1VQPP 1HJ0A 3W68A 1JTHA 3D6ZA 1NTME 3MUDC 2E5YA 1QVGO 1QL2A 1ZRTD 5AW2B 1GMJA 2QJYB 4U3FJ 3E7KA 3PP5A 2IBZG 3EWKA 1YTZT 2N1TB 1U57A 3KHUA 4ZMDA 2K9YA 1J1DC 2OYIA 1X22A 2GM4A 1OVRA 2ZVOB 1LT9B 4C7NB 2G8YA 2CPBA 1AQ5A 5DJUB 1USDA 2W6BA 4IL6E 3BCCD 2ZT9B 2QSIA 1EXIA 5APVA 1EDLA 3BRTB 1SQBD 2KZIA 3H1ID 3HTKB 4ZKPA 3HUSA 1FDOA 2P2UA 1KYOD 3MIWA 3V6IA 4WY4C 3L72E 1VQ7P 4Y99B 1FJPA 1NTZE 4YTPC 2R3CA 1HJBA 4Y28J 2XV5A 1PP9J 3AEAC 4H13B 1SQQJ 1FZCC 2LXBA 4R4MA 3H1KG 2WSSH 3T97B 1PL5A 3HD7B 3CC2P 1M57D 3KPEA 1YQ3C 4H0LD 1YJWP 4KJMA
chains in the Genus database with same CATH topology
4UB8H 4PJ0H 1S5LH 5GTHH 5E79H 3A0BH 4IL6H 5KAFH 5B5EH 5GTIH 4UB6H 5KAIH 3JCUH 5B66H 5H2FH 3KZIH 2AXTH 3WU2H 5TISH 3A0HH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 H;  4PJ0 H;  1S5L H;  5GTH H;  5E79 H;  3A0B H;  4IL6 H;  5KAF H;  5B5E H;  5GTI H;  4UB6 H;  5KAI H;  3JCU H;  5B66 H;  5H2F H;  3KZI H;  2AXT H;  3WU2 H;  5TIS H;  3A0H H; 
#chains in the Genus database with same CATH topology
 1NTK G;  4UB8 H;  2M8R A;  1SQX G;  2Q9I A;  5APW A;  3RK3 C;  1QGK B;  3I5C A;  3RK3 D;  1FDM A;  1HVV A;  1JTH B;  2BCC D;  1LWU A;  2OYO A;  1Y47 A;  4NPE A;  4HH2 A;  2QE7 H;  2V4H A;  4DCK A;  1LTA C;  5CCG C;  5EFW B;  4RKU J;  3CWB J;  1IFP A;  3L71 J;  1KV4 A;  3PHL A;  1FBM A;  1AJY A;  4Z1M H;  2R3S A;  2Y0D A;  3WUU A;  4I7Z B;  4UB8 E;  2VRS A;  1Y8A A;  1KMI Z;  4D6T E;  4ASW A;  2HOD A;  1YIT P;  2B89 A;  1IK7 A;  1SQV E;  3BAT A;  1VQ9 P;  1W2B O;  3MZW B;  5H2F H;  3TSI A;  3C1L A;  1SQP G;  4JPZ B;  1SLQ A;  1PGO A;  3L75 J;  2B9B A;  3WUT A;  1RF1 C;  2ITA A;  1T2K D;  3OW2 O;  1DX7 A;  2WSC H;  1CW5 A;  1VQO P;  3H25 A;  1NTM K;  1J1D B;  2IBZ D;  1VPC A;  2M0B A;  4GOD A;  2WQY C;  4O9B A;  2Y0E A;  2YKQ A;  3QWO C;  3EFF K;  1BGY J;  5H2F E;  2R44 A;  4PV1 C;  1ZN5 A;  1JOC A;  1VDF A;  4PV1 D;  3Q1M A;  3A0H H;  1LTJ A;  1JMM A;  1ZV8 A;  1GK6 A;  4L76 A;  2E43 A;  2FYU D;  1NHL A;  1LTT C;  4K35 A;  3BRV B;  1XTC C;  1KB9 H;  3V5B A;  4RES B;  4WY4 B;  4BXL A;  1RF1 A;  5KJ7 C;  1JMB A;  4YPC A;  1OW8 A;  3FXD A;  5KJ7 D;  1IJD B;  5APT A;  3BCC E;  2KS1 A;  5KLI C;  2H7H A;  1JUN A;  3CXH H;  5AW1 B;  1FZC B;  4D6T G;  1SQB E;  3ABV C;  2ZAE B;  4EOT A;  1BDC A;  1M56 D;  3A0H E;  1KQG B;  1RY3 A;  3E1I A;  1SQV G;  5M1B A;  5K5G B;  2B87 B;  3CCQ P;  3M9Q A;  3IR9 A;  5GTH H;  1KB9 E;  1JY2 O;  1H89 A;  4RJT A;  3HRN A;  5KAI H;  3R4Y A;  3PTZ A;  3RK3 B;  4XE5 B;  2M3B A;  1SFC C;  4W7Z A;  1NTM D;  1SFC D;  3VMZ A;  4AYC A;  3GF3 A;  1A02 F;  3CXH E;  1FE6 A;  3L73 G;  3AE3 C;  1BE3 G;  4DOJ A;  3M9H A;  1KZU B;  1M1J A;  3LW5 J;  2QA4 P;  2C9N Y;  5DJT B;  1FC2 C;  3WMM 0;  2WT7 A;  5GTH E;  2OYH A;  3RK3 E;  5KAI E;  2A45 H;  3H1H J;  3VMY A;  2KK7 A;  3AE7 C;  1HH0 A;  2H8P D;  3H32 A;  1NU1 J;  3NXS A;  2ZXE B;  4N78 E;  3TYY A;  3USS A;  1LT1 A;  4TT3 H;  3L72 D;  4LGD E;  3HE5 B;  3BCC G;  2P7J A;  3AEE C;  2Y9Y A;  1NTZ D;  3MD0 A;  1RF1 B;  1JB0 J;  2B88 A;  1YJN P;  5AVU B;  1SQB G;  2Q7C A;  1OMI A;  1NJI Q;  5AW3 B;  4IFF A;  5GTI E;  3GF7 A;  5AVZ B;  2IZ0 A;  3A0B H;  3FX0 A;  5KAF H;  1VQN P;  2KXP B;  4U3F E;  3RBZ A;  5CHX A;  2M5A B;  3AE6 C;  2E76 C;  2HFE D;  2E76 D;  4YXW H;  1DH3 A;  2W8Z A;  4PV1 B;  1NH4 A;  3RL0 g;  2P58 A;  1FJK A;  2HR3 A;  3CCE P;  2N1T A;  1M8O B;  1YI2 P;  1LP1 B;  3CPW O;  2NPS C;  3V2Q A;  1LT9 A;  2WVR A;  3B5N C;  4C7N A;  2NPS D;  3B5N D;  1FZA A;  3A0B E;  1P84 I;  5KAF E;  1OW6 A;  1R5L A;  3HD7 D;  3G71 P;  1IFJ A;  2FFD C;  3G4S P;  5KLI B;  3II6 A;  1PP9 E;  1SQQ E;  1YBK A;  3WUV A;  3SWF A;  5B5E H;  3SWK A;  1SQV D;  4EIJ A;  3H1L J;  1LTS C;  3B4S A;  3P8M C;  2IYO A;  2E75 B;  1LNQ A;  3NMD A;  2NPS A;  1SFC B;  1S72 P;  1U7M A;  3HD7 A;  4H44 C;  2A45 G;  4H44 D;  2YNY A;  2QJP C;  3SSU A;  2SPZ A;  3D70 A;  2JJL A;  3H1J J;  2YO3 A;  1IK9 A;  3Q5P A;  3AEC C;  5B5E E;  1ZME C;  3Q3D A;  3CME P;  5AW9 B;  1FOS F;  4IL6 H;  3L71 E;  2GUS A;  1NKN A;  1FOS E;  2MKV A;  2MJZ A;  3IFM A;  3VYI A;  3TGU J;  1FZB A;  1QVF O;  2P10 A;  1K05 A;  4RO0 A;  3MP7 B;  3VN0 A;  2XKM A;  2PAJ A;  4GDO A;  2KP8 A;  3A2A A;  3TF5 A;  2W6A A;  3VMA A;  1RE4 C;  1W5C E;  5APS A;  1JNM A;  1S5L H;  1DEB A;  5APU A;  2XZR A;  1PP9 G;  3L75 E;  1Q2N A;  3V2R A;  2QIW A;  2FYU G;  2KZJ A;  2H89 C;  2Q3I A;  2YMK A;  1GU5 A;  3AE8 C;  1KQL A;  2E76 B;  3MUD A;  2G3A A;  4WY4 D;  1KB9 D;  3AE2 C;  1BGY E;  3M9B A;  3KXD A;  1KN7 A;  1YHQ P;  2NRG A;  4IFM A;  3L70 J;  2WPS A;  1S5L E;  1YQ4 C;  2OGU A;  3O6Q B;  2QVA A;  3GW6 A;  2NPS B;  1X0T A;  2BAS A;  3B5N B;  3CXH D;  2ZFC A;  3SWY A;  2YKO A;  4JYC A;  5KTB A;  2CPS A;  5AVS B;  3NFQ A;  1T8Z A;  2FFD B;  3H1L D;  2KSJ A;  1NTM G;  3AE4 C;  2RH0 A;  1UIX A;  4OGQ B;  2KSE A;  4HB1 A;  3BVH A;  4WY4 A;  2JDI H;  3R2P A;  4CPG A;  1WMK A;  5L8R J;  1P84 D;  2DW3 A;  4EI2 A;  5CCG D;  4N78 D;  3LW5 H;  1L4A C;  1EDK A;  1SQQ K;  3VMX A;  2KIK A;  1FZC A;  2GUV A;  1RHZ B;  5BU5 A;  1AFO A;  5AW8 B;  3F5H A;  4LC1 A;  4HKZ H;  1X79 B;  4EYY Q;  2W6J H;  2E42 A;  4H44 B;  3MGN A;  1MFZ A;  2B87 A;  2WSF J;  3NTN A;  2QJP B;  2K88 A;  1DD3 A;  1NTK J;  3Q2Y A;  1JY2 P;  1SQX J;  1XTG B;  1FZF A;  3L72 G;  4U3F D;  2O1K A;  1IFI A;  1L0N J;  1EC5 A;  3L74 J;  2A06 E;  1NTZ G;  1BGY G;  2J59 M;  5AVW B;  1OX3 A;  1JY3 O;  1HWT C;  1G2C B;  5CCG A;  1EXJ A;  2WSE J;  1RF0 C;  3A3Y B;  3H1H E;  5CCH C;  2YO2 A;  1S1C X;  3QH9 A;  5CCH D;  2ZYD A;  3RK2 C;  1NAY A;  1NU1 E;  3EFG A;  3RK2 D;  2YXR B;  1R5S A;  5KLV J;  1N73 B;  2M3E A;  1ZP0 C;  3MTU E;  2KNC B;  1LGH B;  4M3L A;  4KT0 J;  1JCD A;  1U7J A;  1VQL P;  1L0N K;  1PP9 D;  1NO4 A;  1FDI A;  1SQQ D;  1N7S C;  1SQP J;  1EQ7 A;  1URQ C;  3HE5 A;  1HF9 A;  1N7S D;  1URQ D;  3GHG C;  2ZVN B;  5B66 H;  4OVN F;  2QJK B;  3KYQ A;  3PLN A;  1GK4 A;  2QRX A;  1BCC J;  4ZKU A;  1ZLL A;  2XNX A;  1LTB C;  1IZN B;  1QX8 A;  1J2J B;  1EDJ A;  5CBN A;  5CCH A;  5APQ A;  2ZXX A;  1NGM B;  2WWW A;  3AE5 C;  5AW6 B;  1RE3 C;  2M5A A;  3S4R A;  5KLV K;  1KFM A;  1GDT A;  1K8A Q;  1NAF A;  5AVX B;  3CMA P;  2R5B A;  1KTM A;  4PJ0 H;  3CL3 D;  5B66 E;  3CWB D;  1LP1 A;  3L71 D;  1ZW0 A;  2E75 C;  2E75 D;  4IOI H;  1RQU A;  4K3A A;  2QG4 A;  3GHG A;  4N3Y B;  1K04 A;  1P84 H;  2JR8 A;  5KJ7 A;  1EZV E;  3RL0 C;  1YJ9 P;  1DD4 A;  3IAO A;  1M1K Q;  3RL0 D;  2XND H;  1PIX A;  3G3Z A;  2AEM A;  2OTK E;  1L4A B;  1LTI C;  2KOG A;  1VF5 C;  4GKG A;  1S9K E;  2WTY A;  3EQ2 A;  3H1L E;  4PJ0 E;  4D6T J;  1RE3 A;  1VQ4 P;  1JO5 A;  3V2N A;  2IZ1 A;  1KFN A;  5GTI H;  1K9M Q;  3VP9 A;  3L75 D;  1L0L J;  2V7Q J;  1IFM A;  3L36 A;  2FXO A;  2NZ2 A;  1P84 E;  3KQG A;  2KB7 P;  3HE4 B;  1DIP A;  3H1J E;  1SFC A;  2I8D A;  2P67 A;  3AEG C;  2ZYG A;  1PPJ D;  4IFD K;  3L73 J;  3GG2 A;  5KLV D;  1GW4 A;  1BGY D;  1BE3 J;  4GIF A;  4U7J A;  1N2D C;  2E5T A;  3TGU E;  1Q82 Q;  1HTL C;  4NPF X;  2Z4E A;  1KYO I;  1GTW A;  2N9Y B;  3RK2 B;  2AEJ A;  3M0D C;  3JCU H;  1EZV I;  4YXD C;  2K37 A;  2PGD A;  2R32 A;  4I2L C;  1L0L K;  2UWJ E;  4C46 A;  1K73 Q;  1NU1 K;  1NVO A;  3ZDM A;  1H88 A;  1N7S B;  2HG5 D;  1URQ B;  1Q7Y Q;  1N7L A;  3A5T A;  4I1L A;  2JEE A;  3GHG B;  4BWN A;  2POH A;  1PGQ A;  1FU1 A;  3H1L G;  2ZJS E;  3H1I J;  3JCU E;  1PGP A;  1Q90 D;  1Y9B A;  5APY A;  2Q6Q A;  2C0W A;  2Z5H A;  1JM0 A;  4PD4 H;  1J1E C;  5TIS H;  4OGQ C;  2WZ7 A;  2KLU A;  1KOR A;  3CI9 A;  2D2C C;  4OGQ D;  3P8C E;  1G1I A;  3E1R A;  1JY2 N;  3L70 E;  2D2C D;  1VQ8 P;  1BSN A;  2FBW C;  5TJH A;  1OW7 A;  1BDD A;  4C7R A;  3JSV C;  2O1J A;  1GW3 A;  3L4F A;  2Q3E A;  2A06 D;  4BRY B;  2RKL A;  4AQR D;  3O6Q A;  1H0T B;  4XA4 A;  3H6P A;  5CMZ A;  3B5N A;  2IDB A;  4IL6 X;  2WSF H;  1OVU A;  4PD4 E;  5TIS E;  2BEQ D;  3RL0 B;  4U3F G;  2FFD A;  3H1H D;  3CCV P;  3AE9 C;  2OYI C;  2BCC J;  1AVO A;  1VF5 B;  1E5W A;  1NU1 D;  3P32 A;  5E79 H;  3TNU A;  3CWB E;  1USE A;  2QM8 A;  1GZL A;  2OAR A;  3IF4 A;  3L35 A;  2KLV A;  2WSE H;  2QEX P;  1AQT A;  1S5L X;  1QLE D;  2IBZ I;  3AEB C;  3C8V A;  1X9V A;  3CD6 P;  1T3U A;  3HUS C;  5AW7 B;  2AXC A;  2XU6 A;  2KUB A;  1NTK E;  1SQX E;  2JKV A;  1BSH A;  4GT1 A;  2W27 A;  1L0N E;  1R8E A;  1H8A A;  3L74 E;  2I1K A;  5APX A;  1N73 C;  3Q5R A;  1CZQ A;  5E79 E;  1RH5 B;  1M7L A;  1WRG A;  4GOF A;  3L70 G;  5CBO A;  1SQQ G;  3IN6 A;  1KIL E;  3FWL A;  1VL2 A;  3VOP A;  2OQQ A;  1ZR2 A;  2AXT H;  3CX5 H;  2C9L Y;  2LR2 A;  2BEZ F;  4PD4 I;  1FAV A;  1JY3 P;  2QJK C;  1LTG C;  1G2C A;  1PPJ E;  3LID A;  1QEX A;  1CI6 B;  2K9J A;  3SFD C;  2O3J A;  3B8E B;  5KLV E;  1Q81 Q;  2Y0C A;  3WU2 H;  1CSB A;  2JP3 A;  1OWA A;  1LWU C;  1T6A A;  1RE4 A;  3TDK A;  1EZV D;  1N73 A;  1SQP E;  2AXT E;  3CX5 E;  2KNC A;  3CWB G;  3L71 G;  2FYU J;  1N8R Q;  1S9K D;  2PP6 A;  1BCC E;  4WVZ A;  3OA7 A;  1J1E B;  1X8Y A;  3G9R A;  1D7M A;  3S9O A;  3TNU B;  2D2C B;  4XFJ A;  1OVV A;  1MZ9 A;  3D6Y A;  4H0L C;  3WU2 E;  3B71 A;  2OTL P;  3CCM P;  2J5U A;  2C0X A;  5AW4 B;  1L0N G;  3CCL P;  3H1J D;  5AVQ B;  1OFC X;  3L74 G;  1L4A D;  3H1K J;  3M06 A;  1E79 H;  2IFN A;  4WB4 A;  5KKZ C;  1JEK A;  1OZH A;  1SVF A;  3L75 G;  1YYC A;  4DZO A;  3P7K A;  3RBX A;  2V7Q H;  3TGU D;  2FYU K;  2JWD A;  1GD2 E;  3CCJ P;  2O01 J;  2LXC B;  1NTM J;  4W80 A;  1KD1 Q;  4A7P A;  2OYI B;  1HUC A;  1G1J A;  3FWN A;  1FS0 E;  1PPJ G;  3AEF C;  3CX5 I;  5KLV G;  2L91 A;  1HBW A;  3AE1 C;  1VQ6 P;  2OTJ P;  5AW0 B;  1LTJ C;  2RMZ A;  4UB6 H;  4JF7 A;  2IFM A;  2PRR A;  4OWF A;  2K9J B;  1L4A A;  1IO4 A;  2WPV B;  3G6E P;  3HUS B;  1L0L E;  3PRJ A;  1GL2 C;  3OAK A;  1AV1 A;  2QM7 A;  3M91 A;  2O01 N;  1GL2 D;  2KI7 B;  3V4W A;  4DJG A;  1T2K C;  3LIE A;  3CCS P;  4L74 A;  3I56 P;  2K1A A;  1BCC G;  1NTK K;  3U1A A;  1SQX K;  4ZNC A;  1IFD A;  3L72 J;  3L73 E;  3VTP C;  1PV3 A;  3HE4 A;  5C39 A;  1BE3 E;  3PH0 A;  3P8C D;  4W7Y A;  1ZXG A;  1NTZ J;  3L70 D;  4UB6 E;  2Z5I A;  2FYN C;  1MKM A;  1NYH A;  2FY8 A;  3KZI H;  1ZRT E;  2CK3 H;  3K5B A;  3C9I A;  3VP8 A;  1QL1 A;  1MUU A;  1KYO H;  1RF0 A;  1GU4 A;  1GL2 A;  2FXM A;  2YIU C;  2Q1K A;  3CLQ A;  1LWU B;  3I55 P;  4R4L A;  4PD4 D;  1DEE G;  3JC2 2;  3OJA B;  1KC8 Q;  3U59 A;  2A06 G;  4KHX A;  4JQ0 D;  1M1J C;  1IFN A;  3F89 A;  1SP4 A;  1JCC A;  4LLH A;  1HGV A;  4HYT B;  3H1I E;  2WPR A;  3KZI E;  1NTZ K;  2OYH C;  1SQP K;  1WT6 A;  1N7S A;  1URQ A;  3FGA D;  3H1K D;  1AA0 A;  1KYO E;  1W2E A;  2YXQ B;  4H0L B;  4QMA A;  1L0L G;  3H1H G;  3FXE A;  2FKW B;  2HOD B;  3A7O A;  5CJ4 A;  3CC7 P;  3N7N A;  1S2E A;  1NU1 G;  1SS1 A;  2FXP A;  2IYP A;  4JBZ A;  4TLF A;  1NTK D;  3BAS A;  1SQX D;  1FZE A;  2K3R A;  1VF5 D;  1UII A;  1L0N D;  3SFE C;  2WIT A;  5KKZ B;  3L74 D;  5CJ0 A;  2HPC A;  2XDJ A;  1SQV J;  1ZR4 A;  1N86 A;  1ZOY C;  2Y9Z A;  3U1C A;  2E74 C;  1KIL C;  1OXZ A;  1S4X A;  2E74 D;  1KIL D;  3Q5S A;  1VQ5 P;  4BRY A;  1PZQ A;  1JY3 N;  2WMM A;  1MV8 A;  1Q86 Q;  1KQF B;  2N9B A;  1H0T A;  2I1J A;  1NKZ B;  2HLO A;  2BCC E;  2PFX A;  4B86 A;  2QJY C;  4DT0 A;  1MFT A;  3M0A A;  3O8Z A;  2P1J A;  2ZYA A;  1S3J A;  1LTJ B;  2N1T C;  2W90 A;  4MN4 C;  4GOE A;  1IC2 A;  2N1T D;  2HYN A;  3CCR P;  1GL2 B;  1LT9 C;  1KB9 I;  1SQV K;  2LKM A;  5AVV B;  1EDI A;  1SQP D;  4I6M C;  3CX5 D;  2GA1 A;  2ZT9 C;  1YIJ P;  1KIL A;  3H1I G;  2JWA A;  2ZT9 D;  1T3J A;  2KS1 B;  2WSC J;  1YTZ I;  5AVY B;  1BCC D;  3V2P A;  3CXH I;  4WWI A;  5AVR B;  2AEF A;  1L2P A;  4L73 A;  5BU8 B;  1EZV G;  1TU3 F;  4Y99 C;  1PGJ A;  4L75 A;  3BCC J;  2FYN B;  3L37 A;  2W83 C;  3ITK A;  3S1K A;  1KQS O;  1SQB J;  4H13 C;  2FYZ A;  3D71 A;  4H13 D;  1VQK P;  1LJ2 A;  4N6J A;  2YIU B;  2H88 C;  4OH8 B;  2IBZ E;  3HD7 C;  3M0D A;  2HPC B;  2L5G B;  3TK1 A;  5BVZ A;  1VQM P;  1HGZ A;  3H1J G;  1CI6 A;  3PJS K;  2R5D A;  3HTK A;  3CC4 P;  1M1J B;  2BCC G;  3AED C;  3KDP B;  3GMA A;  2WPQ A;  1RQV A;  2WT7 B;  3GLM A;  5AVT B;  2FYU E;  2OYH B;  1A02 J;  4WBA A;  2YKP A;  3N4X A;  4D6T D;  1PFI A;  4ASV A;  3TGU G;  2KYV A;  2A45 I;  1SQB K;  1NOH A;  2O01 H;  3H32 B;  2IPP A;  4AUW A;  1Z56 A;  2RN0 A;  1L0L D;  5AW5 B;  2IX7 C;  3CCU P;  3UIA A;  3V4Q A;  3RGU A;  1FZG A;  4I7Z C;  3T97 A;  4JYB A;  2H43 A;  4HJG H;  1NWQ A;  2Q5U A;  1M90 Q;  2JO1 A;  2J58 A;  3H1K E;  1AVY A;  4EDF A;  2E74 B;  1KIL B;  3MHV A;  2YMY A;  4NPD A;  3L73 D;  3W67 A;  1OIP A;  1BE3 D;  1VQP P;  1HJ0 A;  3W68 A;  1JTH A;  3D6Z A;  1NTM E;  3MUD C;  2E5Y A;  1QVG O;  1QL2 A;  1ZRT D;  5AW2 B;  1GMJ A;  2QJY B;  4U3F J;  3E7K A;  3PP5 A;  2IBZ G;  3EWK A;  1YTZ T;  2N1T B;  1U57 A;  3KHU A;  4ZMD A;  2K9Y A;  1J1D C;  2OYI A;  1X22 A;  2GM4 A;  1OVR A;  2ZVO B;  1LT9 B;  4C7N B;  2G8Y A;  2CPB A;  1AQ5 A;  5DJU B;  1USD A;  2W6B A;  4IL6 E;  3BCC D;  2ZT9 B;  2QSI A;  1EXI A;  5APV A;  1EDL A;  3BRT B;  1SQB D;  2KZI A;  3H1I D;  3HTK B;  4ZKP A;  3HUS A;  1FDO A;  2P2U A;  1KYO D;  3MIW A;  3V6I A;  4WY4 C;  3L72 E;  1VQ7 P;  4Y99 B;  1FJP A;  1NTZ E;  4YTP C;  2R3C A;  1HJB A;  4Y28 J;  2XV5 A;  1PP9 J;  3AEA C;  4H13 B;  1SQQ J;  1FZC C;  2LXB A;  4R4M A;  3H1K G;  2WSS H;  3T97 B;  1PL5 A;  3HD7 B;  3CC2 P;  1M57 D;  3KPE A;  1YQ3 C;  4H0L D;  1YJW P;  4KJM A; 
#chains in the Genus database with same CATH homology
 4UB8 H;  4PJ0 H;  1S5L H;  5GTH H;  5E79 H;  3A0B H;  4IL6 H;  5KAF H;  5B5E H;  5GTI H;  4UB6 H;  5KAI H;  3JCU H;  5B66 H;  5H2F H;  3KZI H;  2AXT H;  3WU2 H;  5TIS H;  3A0H H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...