4IL6E

Structure of sr-substituted photosystem ii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
80
structure length
80
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
publication title Structure of Sr-substituted photosystem II at 2.1 A resolution and its implications in the mechanism of water oxidation
pubmed doi rcsb
total genus 22
structure length 80
sequence length 80
chains with identical sequence e
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 4il6E00
5TISE 4UB6E 4UB8E 3KZIE 5GTIE 5GTHE 3A0BE 4PJ0E 4IL6E 5H2FE 3WU2E 5KAFE 5B5EE 5E79E 2AXTE 5B66E 3A0HE 3JCUE 5KAIE 1S5LE 1W5CE
chains in the Genus database with same CATH superfamily
1M57D 3L70D 1NU1G 1JCDA 2OTLP 5KLVK 1NTKD 2QEXP 2Q1KA 1KB9E 1S5LX 1L4AA 1NTMD 2OYHA 4AYCA 4WVZA 2E42A 4HB1A 4DJGA 3RK3E 3GLMA 3LIDA 1L4AB 5CBOA 1GL2A 2OYHB 2IBZE 1KYOE 2R5BA 2YO3A 1LTSC 2KLVA 1L0NJ 4OGQB 5CCHC 2OTJP 1GL2B 3TK1A 1S1CX 1ZLLA 2M8RA 1FZCA 2M3BA 2A06G 4H44C 3I5CA 2KOGA 5DJTB 4H0LC 1FZCB 3L72J 2O3JA 1YJNP 3IFMA 1ZOYC 4U3FD 2YO2A 2ZVNB 1GK6A 1KZUB 1X8YA 2BCCD 3AEFC 1Q81Q 1QEXA 1Q2NA 1N8RQ 1EDJA 2H43A 3L72E 4EOTA 1MV8A 2QJYB 2ZAEB 1K8AQ 3M0AA 1EZVD 2YKQA 4D6TJ 5KTBA 2K9JA 1YYCA 2Y0DA 2ZXXA 3A0BE 1QX8A 2K9JB 1EXJA 1KB9H 1NU1K 1RF0C 2RH0A 4HH2A 2WTYA 3P8MC 1OVVA 3CCUP 1JMBA 2QRXA 5KJ7C 3CX5I 1SQPG 3Q5SA 3B5ND 5AVYB 2AEMA 3NMDA 1DH3A 3L71J 3C9IA 2E76B 3L75D 2Y0CA 2OTKE 2A45G 1VF5D 3K5BA 3L70G 1WMKA 1IFDA 3BVHA 3TYYA 3CI9A 1LWUB 4ZMDA 4OH8B 4EYYQ 2K3RA 1S72P 2H7HA 3QWOC 1T2KD 2KSJA 3V4WA 4EIJA 3OJAB 4GODA 1BCCD 1VQ6P 3L70J 1HBWA 1NTKJ 2LKMA 2KYVA 1USEA 4L74A 4WBAA 4GKGA 3JCUE 2D2CD 5AVWB 1NTZD 2ZJSE 1PL5A 2WPVB 1NTMJ 3U1CA 2AEJA 5C39A 1X22A 2W6JH 3C8VA 4ASVA 1RE4C 1OX3A 1VQPP 1N7SA 3L74D 3LW5J 1DIPA 1RF1C 2ITAA 3JSVC 3CWBE 2XDJA 1N7SB 2FYUG 2NPSC 3RGUA 3PH0A 1BDDA 1K04A 1NTKE 3U1AA 3CX5E 4UB8E 4PD4E 1ZRTD 3H1LD 5CCGA 2E43A 1BGYG 1JM0A 1NTME 3H1JG 1WT6A 1RQUA 2H8PD 4N78D 4U3FJ 2WMMA 4AUWA 3W67A 2UWJE 3H1KD 2JKVA 4B86A 3G3ZA 2HODA 4ZNCA 2BCCJ 1IFIA 1EXIA 1IC2A 1OVRA 5EFWB 1ZMEC 2HODB 2ZXEB 1ZP0C 2B88A 4MN4C 1HGZA 1JY3P 4Y99C 3Q1MA 2FYNB 4U3FE 2N1TC 5AVQB 2OARA 3VYIA 4I2LC 1SQBG 2B9BA 5B66E 4TLFA 2BCCE 4HKZH 4JQ0D 5AW3B 1LTJA 3B71A 4GDOA 2FFDA 3HD7A 1LTJB 2KB7P 3D6YA 1WRGA 1EZVE 1KB9D 3HD7B 1PP9E 4KT0J 3L75J 3RK3D 4UB8H 4PD4H 5APWA 1Q82Q 2IFMA 2IBZD 4R4MA 3IR9A 2E74D 1KYOD 5AVRB 1LTGC 1VQ4P 1OW7A 4IFMA 3KDPB 5KAIE 1SQVK 1ZN5A 1U7MA 2QM8A 1SQXG 1GW3A 3TSIA 4I7ZB 3H1ID 5CMZA 1FZAA 3RBXA 1LTAC 1KILC 2ZYDA 4PJ0E 2W8ZA 3L75E 1QL2A 3RK2C 1BCCJ 1RHZB 2WZ7A 4ASWA 1K05A 1J1DC 1Y8AA 2YXRB 5CCHD 3H1LG 4AQRD 1NTZJ 2HYNA 1HJ0A 2XV5A 1BE3G 1AVOA 1RH5B 3V6IA 1NH4A 1TU3F 1URQD 4DCKA 2O01N 4H0LD 5KAFH 1FZGA 5B66H 1FJKA 1DD3A 3D70A 1KC8Q 3L74J 2K1AA 1GW4A 1KV4A 3WUUA 1BCCE 4C7RA 1SQBK 2ZT9C 1ZR4A 1FOSF 3H1LJ 2OYOA 2FXPA 3HUSA 1NTZE 1DD4A 3HUSB 3V5BA 3CCVP 1SQQE 4K35A 4W7YA 3PRJA 3H1KJ 3VTPC 3BCCG 2E75D 5GTHE 3GMAA 3L74E 3RL0C 3OA7A 2V7QJ 5CJ0A 1J1EC 2M0BA 4BRYA 3M9BA 2R5DA 5KAIH 3PP5A 1ZRTE 5AW7B 2QSIA 1FZCC 3S1KA 3B5NA 4BRYB 1VQ5P 4JPZB 1LJ2A 3VMYA 5AW2B 1SQXK 3B5NB 1AJYA 2LR2A 1NGMB 1VQ7P 2KS1A 5KJ7D 1DEBA 1JUNA 4JBZA 1YQ4C 3MP7B 4L73A 2KS1B 1VF5B 3Q5PA 2P10A 4QMAA 4IOIH 2XNDH 3AE8C 1FZBA 1M90Q 3VOPA 4IL6E 1OW8A 5AW0B 2Z5IA 2N9YB 3EQ2A 1IFPA 1BSHA 1KD1Q 3P8CE 3M9QA 1L0NG 3TGUE 2D2CB 3CWBD 1KN7A 5AW6B 3CMAP 1A02F 2YXQB 2XU6A 3CX5D 3KXDA 1YJ9P 4PD4D 5GTHH 3H1IJ 3WUTA 3E7KA 2C9LY 2LXBA 3CXHI 3AEGC 3L72G 3MHVA 3ABVC 1PIXA 3CCJP 4R4LA 1M1KQ 3GG2A 3KZIE 5AW5B 4IFDK 2Q6QA 3V4QA 1IZNB 1LWUC 1HJBA 2NPSD 1EQ7A 4I6MC 2ZVOB 1L0LD 1M1JA 4W7ZA 1ZXGA 1QL1A 2QJKC 1W5CE 3W68A 1MKMA 2O1JA 3H1IE 2V7QH 1M1JB 2FKWB 2JP3A 1LP1A 3M0DA 3A7OA 1GMJA 1NWQA 2JDIH 2IYOA 5AW8B 3I55P 4IL6H 1K73Q 1LP1B 3F89A 2MJZA 4D6TG 5TJHA 2YMYA 2WPRA 1KQLA 2V4HA 1PPJD 1NYHA 1NAFA 2R3SA 3PHLA 3CLQA 3G9RA 1Q86Q 1YIJP 1QGKB 3CCRP 1ZV8A 4XA4A 5AW1B 4GT1A 3TNUA 1N86A 3B4SA 1GZLA 2QA4P 1AQ5A 1JY2P 2N1TD 3MUDA 3M06A 2WSEJ 3TNUB 1PP9D 3L71G 5APYA 1PGPA 4YPCA 2W6BA 1VQNP 3V2NA 1L0NK 2QJPC 1YBKA 1T3JA 4OVNF 1RE3A 4TT3H 5L8RJ 1N2DC 3VP9A 4DT0A 3RK3B 1GU4A 1KYOH 3CPWO 3KZIH 3L4FA 1CZQA 1BSNA 2E74B 2J59M 5K5GB 3CCEP 2KK7A 4EI2A 2A45I 3NFQA 1R5SA 4LGDE 3CCSP 5AVZB 3FWNA 1JY3O 1NTKG 2E5YA 1VQOP 2LXCB 1LTIC 1G1IA 1NTMG 5APTA 1SFCC 3IN6A 5CCHA 2R32A 1FDMA 2QG4A 3D71A 1KILD 3HE5A 3RK2D 3CWBJ 1OIPA 1URQA 1HH0A 1FJPA 3BATA 3NTNA 3HE5B 3I56P 1NHLA 2K9YA 2I1KA 1URQB 1N73C 4H0LB 3SWFA 3ZDMA 5KKZC 3L36A 2FYZA 1IFNA 2CK3H 1MUUA 2Q3EA 1VQKP 4U7JA 1Y47A 1SQQD 2KI7B 1FE6A 5APXA 4H13B 4U3FG 5DJUB 3A0BH 1X79B 2J58A 2QM7A 1L0LJ 2ZT9D 4CPGA 2BCCG 2O01H 1GTWA 2Q3IA 3H1HD 2OYIC 2KZIA 1MFTA 2E75B 1KQGB 3AEEC 2PGDA 2H89C 2WSEH 3MIWA 1SQPK 1EZVG 3RL0D 2WPQA 1RF0A 1UIIA 3GF3A 3SWKA 2POHA 1L0LE 5H2FE 5KJ7A 1NTKK 3VMAA 5AVVB 2PFXA 2I1JA 1JMMA 3C1LA 4HYTB 1PP9J 5KLVD 3GHGC 3L75G 1M7LA 3JCUH 1OXZA 4HJGH 1H89A 1PPJE 5AVSB 4WY4C 1N7LA 3P8CD 3A2AA 2Y0EA 1P84I 3TGUD 2RN0A 4BXLA 3G71P 1E5WA 3N4XA 2QE7H 2FFDB 4NPEA 4WWIA 1USDA 2DW3A 2W27A 1VQ9P 1M8OB 1SQVE 4PV1C 2OQQA 2NRGA 5CHXA 3CX5H 3AE4C 1BCCG 2GUSA 2FYUK 1VQLP 4RJTA 2K88A 3V2RA 3WU2E 5AVUB 1LT9C 2OGUA 1HVVA 1RE4A 1NTZG 3F5HA 2MKVA 2IFNA 1NVOA 1VL2A 5CBNA 3AE1C 2KSEA 3AE7C 2NPSA 2HG5D 3L74G 3L73D 1VDFA 2NPSB 4N6JA 1FS0E 3U59A 1FZFA 3CD6P 1ZR2A 2HR3A 3H25A 3UIAA 4L75A 2YIUC 4RKUJ 3O6QA 2SPZA 1G2CA 1XTGB 3H6PA 1IO4A 3A0HE 4H44D 1SQQJ 3H1KG 1KILE 1G2CB 5KLIC 1NU1D 2JO1A 3B8EB 1LGHB 2WQYC 2FBWC 2KP8A 4NPFX 3KQGA 3H1HJ 1VQMP 1FOSE 1MFZA 3CXHD 2N1TA 1G1JA 1X0TA 5BU8B 2FXMA 4Y99B 1L4AC 2OYHC 2J5UA 2N1TB 1QVFO 3KHUA 4OGQC 4K3AA 2WPSA 1JNMA 1GL2C 5B5EE 3WU2H 2A06D 2BEQD 1AQTA 3H1HE 1OMIA 4UB6E 1T6AA 2GUVA 3AE5C 1DX7A 1IK7A 4IL6X 3E1RA 3M91A 1NTZK 1OW6A 2QIWA 4PJ0H 2JJLA 5KLVJ 3JC22 1S9KD 2K37A 3WUVA 2HLOA 2IBZG 4WB4A 3TGUJ 3VMZA 1FAVA 3OAKA 1SP4A 2PP6A 4O9BA 3CCLP 3A0HH 1NAYA 2PAJA 2QJYC 1KILA 1JY2O 1YITP 3VP8A 1Y9BA 3H1IG 2WT7A 1KFNA 1KILB 2E5TA 1NKZB 2KXPB 5KLVE 4GOFA 2YKOA 3RK2B 1SFCD 5CJ4A 2WT7B 2JR8A 1FDOA 2W83C 2KNCA 2YMKA 1MZ9A 1VPCA 2KNCB 4RESB 1SQPD 4A7PA 2P1JA 1JY3N 1QVGO 3CL3D 2Y9YA 2O1KA 3FXDA 5B5EH 3SFDC 1UIXA 2E76C 4IFFA 3L73J 2R3CA 3EWKA 1LT1A 1KFMA 1YTZI 5TISE 3L35A 2M5AA 4UB6H 3AEDC 1GU5A 2ZT9B 1YJWP 1Q7YQ 1BDCA 1W2EA 3LIEA 1DEEG 2M5AB 1SLQA 3S4RA 1H0TA 2G8YA 2VRSA 1YHQP 4ZKUA 4XE5B 5AW9B 2W90A 1H0TB 3H32A 3RL0B 3L73E 1NU1J 1J1EB 1FC2C 3H32B 1URQC 1S5LE 1ZW0A 2N9BA 2XZRA 1HUCA 3II6A 2GM4A 3MZWB 4H13C 2C0WA 2O01J 1L0NE 4KHXA 4KJMA 4LC1A 2FYUD 1NU1E 3M9HA 3KPEA 1N7SC 1S2EA 3G6EP 3GW6A 5GTIE 1IFJA 1SQVD 1KMIZ 1K9MQ 1BGYD 3CXHE 1L2PA 3USSA 2E75C 3H1JD 1NO4A 3CCMP 4WY4D 4JYBA 2FY8A 5CCGC 4M3LA 3FWLA 2WITA 5TISH 1AA0A 1OVUA 2WWWA 3MD0A 1IFMA 2Z5HA 1EC5A 1RQVA 2ZYGA 2A06E 4GOEA 4PV1D 3CWBG 3G4SP 3TDKA 3L37A 5AVXB 2KUBA 1YQ3C 3AE6C 4PD4I 2FYNC 3IF4A 3EFGA 4D6TE 4W80A 1SQBD 2XNXA 2WVRA 1S9KE 1JOCA 3MGNA 1S5LH 2Q5UA 2ZFCA 3ITKA 1LWUA 1J2JB 1P84D 3N7NA 1H8AA 3PTZA 2WSSH 1S4XA 3BRTB 2JWAA 2B87A 1SQPJ 1LTJC 2QJKB 1L0LG 1S3JA 3R2PA 2I8DA 2Q9IA 2HFED 4H44B 2FFDC 1PZQA 2B87B 3L71E 3HD7C 4OWFA 1OZHA 2AEFA 1FBMA 5GTIH 3BRVB 2GA1A 1IJDB 2L5GB 2L91A 2KLUA 3CXHH 1PGJA 2R44A 3P7KA 1H88A 1X9VA 4C7NA 4GIFA 4LLHA 3WMM0 1SQXD 1NKNA 1AV1A 1PPJG 1SQPE 4C7NB 1KTMA 3CC7P 3CMEP 2P58A 4I7ZC 1XTCC 4BWNA 2P67A 3MTUE 4Z1MH 3TF5A 4ZKPA 1JO5A 3AEBC 2NZ2A 3T97A 3Q3DA 1AFOA 1L4AD 3L70E 1EZVI 2C0XA 2WSFJ 4OGQD 3T97B 1OFCX 3Q2YA 1PP9G 2JEEA 5BU5A 1SQVG 1GL2D 3D6ZA 1BE3D 2CPBA 3V2QA 1PV3A 2QJPB 1CW5A 1EDLA 1GD2E 1NJIQ 2P7JA 3NXSA 2IPPA 2BASA 2FYUJ 1NTMK 2P2UA 1E79H 3VN0A 2IZ1A 1PGOA 1SQVJ 3O8ZA 5APVA 1CI6A 1BGYJ 1U57A 3HE4A 3H1JJ 1YI2P 2Y9ZA 3HUSC 1CI6B 1FZEA 3HE4B 1SFCA 3SWYA 1L0LK 3BCCD 3AE9C 2KIKA 1HTLC 5KAFE 1SFCB 2AXTE 2QVAA 2FYUE 2IZ0A 4JF7A 2H88C 3CCQP 2G3AA 1AVYA 2C9NY 3P32A 4NPDA 1R8EA 1HF9A 2CPSA 3FXEA 1BGYE 1N73A 3RL0g 3A3YB 3H1JE 3KYQA 2YNYA 5AVTB 1M56D 1N73B 3AE3C 3B5NC 2WSCJ 2A45H 5KKZB 5M1BA 3VMXA 1SQBJ 2RKLA 4N3YB 4DOJA 3AE2C 1LTTC 3V2PA 3A5TA 1RF1A 1JY2N 3BASA 1GK4A 1VF5C 3CC2P 1SQQG 2Z4EA 2E76D 3AEAC 1RF1B 2OYIA 5H2FH 2IX7C 1KORA 3GF7A 5APSA 3EFFK 4XFJA 2OYIB 2IYPA 3LW5H 2XKMA 3H1HG 2JWDA 1JEKA 4C46A 1SQBE 1T2KC 1IK9A 1FDIA 2WSFH 2Q7CA 1EDIA 3O6QB 1LTBC 1L0ND 1P84E 2D2CC 1JB0J 4DZOA 1SQXJ 1PGQA 4EDFA 5APQA 5E79E 3OW2O 1VQ8P 2AXTH 3IAOA 3L72D 1EDKA 2HPCA 3GHGA 1U7JA 1SS1A 3S9OA 2HPCB 4H13D 2ZYAA 2PRRA 1LNQA 4WY4A 3GHGB 1OWAA 5KLVG 1CSBA 1N7SD 1BE3J 3PJSK 1SQXE 4WY4B 3SFEC 2FXOA 3FGAD 3TGUG 3CC4P 3HRNA 1M1JC 4JYCA 3QH9A 5CCGD 1HGVA 4L76A 4Y28J 3M0DC 3AECC 4D6TD 1KB9I 2YKPA 3HTKA 3FX0A 3H1LE 4PV1B 1SQQK 1BE3E 3HTKB 1LT9A 2IBZI 2RMZA 3E1IA 2WSCH 1KYOI 1SVFA 1FU1A 1T3UA 4N78E 1LT9B 3BCCJ 2IDBA 3H1KE 3PLNA 1YTZT 3SSUA 1JCCA 1A02J 3RBZA 1NOHA 4RO0A 3R4YA 1P84H 5AW4B 3Q5RA 3L71D 2AXCA 1QLED 1Z56A 3L73G 1D7MA 3MUDC 5E79H 1JTHA 1Q90D 1J1DB 1HWTC 2KZJA 2W6AA 3BCCE 2YIUB 2M3EA 5BVZA 1JTHB 5APUA 1RE3C 4YXDC 1W2BO 1R5LA 1GDTA 4YTPC 3RK3C 1KQSO 1PFIA 1RY3A 2B89A 4YXWH 1T8ZA 4I1LA 2E74C 3HD7D 1KQFB 2BEZF 5KLIB
chains in the Genus database with same CATH topology
5TISE 4UB6E 4UB8E 3KZIE 5GTIE 5GTHE 3A0BE 4PJ0E 4IL6E 5H2FE 3WU2E 5KAFE 5B5EE 5E79E 2AXTE 5B66E 3A0HE 3JCUE 5KAIE 1S5LE 1W5CE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS E;  4UB6 E;  4UB8 E;  3KZI E;  5GTI E;  5GTH E;  3A0B E;  4PJ0 E;  4IL6 E;  5H2F E;  3WU2 E;  5KAF E;  5B5E E;  5E79 E;  2AXT E;  5B66 E;  3A0H E;  3JCU E;  5KAI E;  1S5L E;  1W5C E; 
#chains in the Genus database with same CATH topology
 1M57 D;  3L70 D;  1NU1 G;  1JCD A;  2OTL P;  5KLV K;  1NTK D;  2QEX P;  2Q1K A;  1KB9 E;  1S5L X;  1L4A A;  1NTM D;  2OYH A;  4AYC A;  4WVZ A;  2E42 A;  4HB1 A;  4DJG A;  3RK3 E;  3GLM A;  3LID A;  1L4A B;  5CBO A;  1GL2 A;  2OYH B;  2IBZ E;  1KYO E;  2R5B A;  2YO3 A;  1LTS C;  2KLV A;  1L0N J;  4OGQ B;  5CCH C;  2OTJ P;  1GL2 B;  3TK1 A;  1S1C X;  1ZLL A;  2M8R A;  1FZC A;  2M3B A;  2A06 G;  4H44 C;  3I5C A;  2KOG A;  5DJT B;  4H0L C;  1FZC B;  3L72 J;  2O3J A;  1YJN P;  3IFM A;  1ZOY C;  4U3F D;  2YO2 A;  2ZVN B;  1GK6 A;  1KZU B;  1X8Y A;  2BCC D;  3AEF C;  1Q81 Q;  1QEX A;  1Q2N A;  1N8R Q;  1EDJ A;  2H43 A;  3L72 E;  4EOT A;  1MV8 A;  2QJY B;  2ZAE B;  1K8A Q;  3M0A A;  1EZV D;  2YKQ A;  4D6T J;  5KTB A;  2K9J A;  1YYC A;  2Y0D A;  2ZXX A;  3A0B E;  1QX8 A;  2K9J B;  1EXJ A;  1KB9 H;  1NU1 K;  1RF0 C;  2RH0 A;  4HH2 A;  2WTY A;  3P8M C;  1OVV A;  3CCU P;  1JMB A;  2QRX A;  5KJ7 C;  3CX5 I;  1SQP G;  3Q5S A;  3B5N D;  5AVY B;  2AEM A;  3NMD A;  1DH3 A;  3L71 J;  3C9I A;  2E76 B;  3L75 D;  2Y0C A;  2OTK E;  2A45 G;  1VF5 D;  3K5B A;  3L70 G;  1WMK A;  1IFD A;  3BVH A;  3TYY A;  3CI9 A;  1LWU B;  4ZMD A;  4OH8 B;  4EYY Q;  2K3R A;  1S72 P;  2H7H A;  3QWO C;  1T2K D;  2KSJ A;  3V4W A;  4EIJ A;  3OJA B;  4GOD A;  1BCC D;  1VQ6 P;  3L70 J;  1HBW A;  1NTK J;  2LKM A;  2KYV A;  1USE A;  4L74 A;  4WBA A;  4GKG A;  3JCU E;  2D2C D;  5AVW B;  1NTZ D;  2ZJS E;  1PL5 A;  2WPV B;  1NTM J;  3U1C A;  2AEJ A;  5C39 A;  1X22 A;  2W6J H;  3C8V A;  4ASV A;  1RE4 C;  1OX3 A;  1VQP P;  1N7S A;  3L74 D;  3LW5 J;  1DIP A;  1RF1 C;  2ITA A;  3JSV C;  3CWB E;  2XDJ A;  1N7S B;  2FYU G;  2NPS C;  3RGU A;  3PH0 A;  1BDD A;  1K04 A;  1NTK E;  3U1A A;  3CX5 E;  4UB8 E;  4PD4 E;  1ZRT D;  3H1L D;  5CCG A;  2E43 A;  1BGY G;  1JM0 A;  1NTM E;  3H1J G;  1WT6 A;  1RQU A;  2H8P D;  4N78 D;  4U3F J;  2WMM A;  4AUW A;  3W67 A;  2UWJ E;  3H1K D;  2JKV A;  4B86 A;  3G3Z A;  2HOD A;  4ZNC A;  2BCC J;  1IFI A;  1EXI A;  1IC2 A;  1OVR A;  5EFW B;  1ZME C;  2HOD B;  2ZXE B;  1ZP0 C;  2B88 A;  4MN4 C;  1HGZ A;  1JY3 P;  4Y99 C;  3Q1M A;  2FYN B;  4U3F E;  2N1T C;  5AVQ B;  2OAR A;  3VYI A;  4I2L C;  1SQB G;  2B9B A;  5B66 E;  4TLF A;  2BCC E;  4HKZ H;  4JQ0 D;  5AW3 B;  1LTJ A;  3B71 A;  4GDO A;  2FFD A;  3HD7 A;  1LTJ B;  2KB7 P;  3D6Y A;  1WRG A;  1EZV E;  1KB9 D;  3HD7 B;  1PP9 E;  4KT0 J;  3L75 J;  3RK3 D;  4UB8 H;  4PD4 H;  5APW A;  1Q82 Q;  2IFM A;  2IBZ D;  4R4M A;  3IR9 A;  2E74 D;  1KYO D;  5AVR B;  1LTG C;  1VQ4 P;  1OW7 A;  4IFM A;  3KDP B;  5KAI E;  1SQV K;  1ZN5 A;  1U7M A;  2QM8 A;  1SQX G;  1GW3 A;  3TSI A;  4I7Z B;  3H1I D;  5CMZ A;  1FZA A;  3RBX A;  1LTA C;  1KIL C;  2ZYD A;  4PJ0 E;  2W8Z A;  3L75 E;  1QL2 A;  3RK2 C;  1BCC J;  1RHZ B;  2WZ7 A;  4ASW A;  1K05 A;  1J1D C;  1Y8A A;  2YXR B;  5CCH D;  3H1L G;  4AQR D;  1NTZ J;  2HYN A;  1HJ0 A;  2XV5 A;  1BE3 G;  1AVO A;  1RH5 B;  3V6I A;  1NH4 A;  1TU3 F;  1URQ D;  4DCK A;  2O01 N;  4H0L D;  5KAF H;  1FZG A;  5B66 H;  1FJK A;  1DD3 A;  3D70 A;  1KC8 Q;  3L74 J;  2K1A A;  1GW4 A;  1KV4 A;  3WUU A;  1BCC E;  4C7R A;  1SQB K;  2ZT9 C;  1ZR4 A;  1FOS F;  3H1L J;  2OYO A;  2FXP A;  3HUS A;  1NTZ E;  1DD4 A;  3HUS B;  3V5B A;  3CCV P;  1SQQ E;  4K35 A;  4W7Y A;  3PRJ A;  3H1K J;  3VTP C;  3BCC G;  2E75 D;  5GTH E;  3GMA A;  3L74 E;  3RL0 C;  3OA7 A;  2V7Q J;  5CJ0 A;  1J1E C;  2M0B A;  4BRY A;  3M9B A;  2R5D A;  5KAI H;  3PP5 A;  1ZRT E;  5AW7 B;  2QSI A;  1FZC C;  3S1K A;  3B5N A;  4BRY B;  1VQ5 P;  4JPZ B;  1LJ2 A;  3VMY A;  5AW2 B;  1SQX K;  3B5N B;  1AJY A;  2LR2 A;  1NGM B;  1VQ7 P;  2KS1 A;  5KJ7 D;  1DEB A;  1JUN A;  4JBZ A;  1YQ4 C;  3MP7 B;  4L73 A;  2KS1 B;  1VF5 B;  3Q5P A;  2P10 A;  4QMA A;  4IOI H;  2XND H;  3AE8 C;  1FZB A;  1M90 Q;  3VOP A;  4IL6 E;  1OW8 A;  5AW0 B;  2Z5I A;  2N9Y B;  3EQ2 A;  1IFP A;  1BSH A;  1KD1 Q;  3P8C E;  3M9Q A;  1L0N G;  3TGU E;  2D2C B;  3CWB D;  1KN7 A;  5AW6 B;  3CMA P;  1A02 F;  2YXQ B;  2XU6 A;  3CX5 D;  3KXD A;  1YJ9 P;  4PD4 D;  5GTH H;  3H1I J;  3WUT A;  3E7K A;  2C9L Y;  2LXB A;  3CXH I;  3AEG C;  3L72 G;  3MHV A;  3ABV C;  1PIX A;  3CCJ P;  4R4L A;  1M1K Q;  3GG2 A;  3KZI E;  5AW5 B;  4IFD K;  2Q6Q A;  3V4Q A;  1IZN B;  1LWU C;  1HJB A;  2NPS D;  1EQ7 A;  4I6M C;  2ZVO B;  1L0L D;  1M1J A;  4W7Z A;  1ZXG A;  1QL1 A;  2QJK C;  1W5C E;  3W68 A;  1MKM A;  2O1J A;  3H1I E;  2V7Q H;  1M1J B;  2FKW B;  2JP3 A;  1LP1 A;  3M0D A;  3A7O A;  1GMJ A;  1NWQ A;  2JDI H;  2IYO A;  5AW8 B;  3I55 P;  4IL6 H;  1K73 Q;  1LP1 B;  3F89 A;  2MJZ A;  4D6T G;  5TJH A;  2YMY A;  2WPR A;  1KQL A;  2V4H A;  1PPJ D;  1NYH A;  1NAF A;  2R3S A;  3PHL A;  3CLQ A;  3G9R A;  1Q86 Q;  1YIJ P;  1QGK B;  3CCR P;  1ZV8 A;  4XA4 A;  5AW1 B;  4GT1 A;  3TNU A;  1N86 A;  3B4S A;  1GZL A;  2QA4 P;  1AQ5 A;  1JY2 P;  2N1T D;  3MUD A;  3M06 A;  2WSE J;  3TNU B;  1PP9 D;  3L71 G;  5APY A;  1PGP A;  4YPC A;  2W6B A;  1VQN P;  3V2N A;  1L0N K;  2QJP C;  1YBK A;  1T3J A;  4OVN F;  1RE3 A;  4TT3 H;  5L8R J;  1N2D C;  3VP9 A;  4DT0 A;  3RK3 B;  1GU4 A;  1KYO H;  3CPW O;  3KZI H;  3L4F A;  1CZQ A;  1BSN A;  2E74 B;  2J59 M;  5K5G B;  3CCE P;  2KK7 A;  4EI2 A;  2A45 I;  3NFQ A;  1R5S A;  4LGD E;  3CCS P;  5AVZ B;  3FWN A;  1JY3 O;  1NTK G;  2E5Y A;  1VQO P;  2LXC B;  1LTI C;  1G1I A;  1NTM G;  5APT A;  1SFC C;  3IN6 A;  5CCH A;  2R32 A;  1FDM A;  2QG4 A;  3D71 A;  1KIL D;  3HE5 A;  3RK2 D;  3CWB J;  1OIP A;  1URQ A;  1HH0 A;  1FJP A;  3BAT A;  3NTN A;  3HE5 B;  3I56 P;  1NHL A;  2K9Y A;  2I1K A;  1URQ B;  1N73 C;  4H0L B;  3SWF A;  3ZDM A;  5KKZ C;  3L36 A;  2FYZ A;  1IFN A;  2CK3 H;  1MUU A;  2Q3E A;  1VQK P;  4U7J A;  1Y47 A;  1SQQ D;  2KI7 B;  1FE6 A;  5APX A;  4H13 B;  4U3F G;  5DJU B;  3A0B H;  1X79 B;  2J58 A;  2QM7 A;  1L0L J;  2ZT9 D;  4CPG A;  2BCC G;  2O01 H;  1GTW A;  2Q3I A;  3H1H D;  2OYI C;  2KZI A;  1MFT A;  2E75 B;  1KQG B;  3AEE C;  2PGD A;  2H89 C;  2WSE H;  3MIW A;  1SQP K;  1EZV G;  3RL0 D;  2WPQ A;  1RF0 A;  1UII A;  3GF3 A;  3SWK A;  2POH A;  1L0L E;  5H2F E;  5KJ7 A;  1NTK K;  3VMA A;  5AVV B;  2PFX A;  2I1J A;  1JMM A;  3C1L A;  4HYT B;  1PP9 J;  5KLV D;  3GHG C;  3L75 G;  1M7L A;  3JCU H;  1OXZ A;  4HJG H;  1H89 A;  1PPJ E;  5AVS B;  4WY4 C;  1N7L A;  3P8C D;  3A2A A;  2Y0E A;  1P84 I;  3TGU D;  2RN0 A;  4BXL A;  3G71 P;  1E5W A;  3N4X A;  2QE7 H;  2FFD B;  4NPE A;  4WWI A;  1USD A;  2DW3 A;  2W27 A;  1VQ9 P;  1M8O B;  1SQV E;  4PV1 C;  2OQQ A;  2NRG A;  5CHX A;  3CX5 H;  3AE4 C;  1BCC G;  2GUS A;  2FYU K;  1VQL P;  4RJT A;  2K88 A;  3V2R A;  3WU2 E;  5AVU B;  1LT9 C;  2OGU A;  1HVV A;  1RE4 A;  1NTZ G;  3F5H A;  2MKV A;  2IFN A;  1NVO A;  1VL2 A;  5CBN A;  3AE1 C;  2KSE A;  3AE7 C;  2NPS A;  2HG5 D;  3L74 G;  3L73 D;  1VDF A;  2NPS B;  4N6J A;  1FS0 E;  3U59 A;  1FZF A;  3CD6 P;  1ZR2 A;  2HR3 A;  3H25 A;  3UIA A;  4L75 A;  2YIU C;  4RKU J;  3O6Q A;  2SPZ A;  1G2C A;  1XTG B;  3H6P A;  1IO4 A;  3A0H E;  4H44 D;  1SQQ J;  3H1K G;  1KIL E;  1G2C B;  5KLI C;  1NU1 D;  2JO1 A;  3B8E B;  1LGH B;  2WQY C;  2FBW C;  2KP8 A;  4NPF X;  3KQG A;  3H1H J;  1VQM P;  1FOS E;  1MFZ A;  3CXH D;  2N1T A;  1G1J A;  1X0T A;  5BU8 B;  2FXM A;  4Y99 B;  1L4A C;  2OYH C;  2J5U A;  2N1T B;  1QVF O;  3KHU A;  4OGQ C;  4K3A A;  2WPS A;  1JNM A;  1GL2 C;  5B5E E;  3WU2 H;  2A06 D;  2BEQ D;  1AQT A;  3H1H E;  1OMI A;  4UB6 E;  1T6A A;  2GUV A;  3AE5 C;  1DX7 A;  1IK7 A;  4IL6 X;  3E1R A;  3M91 A;  1NTZ K;  1OW6 A;  2QIW A;  4PJ0 H;  2JJL A;  5KLV J;  3JC2 2;  1S9K D;  2K37 A;  3WUV A;  2HLO A;  2IBZ G;  4WB4 A;  3TGU J;  3VMZ A;  1FAV A;  3OAK A;  1SP4 A;  2PP6 A;  4O9B A;  3CCL P;  3A0H H;  1NAY A;  2PAJ A;  2QJY C;  1KIL A;  1JY2 O;  1YIT P;  3VP8 A;  1Y9B A;  3H1I G;  2WT7 A;  1KFN A;  1KIL B;  2E5T A;  1NKZ B;  2KXP B;  5KLV E;  4GOF A;  2YKO A;  3RK2 B;  1SFC D;  5CJ4 A;  2WT7 B;  2JR8 A;  1FDO A;  2W83 C;  2KNC A;  2YMK A;  1MZ9 A;  1VPC A;  2KNC B;  4RES B;  1SQP D;  4A7P A;  2P1J A;  1JY3 N;  1QVG O;  3CL3 D;  2Y9Y A;  2O1K A;  3FXD A;  5B5E H;  3SFD C;  1UIX A;  2E76 C;  4IFF A;  3L73 J;  2R3C A;  3EWK A;  1LT1 A;  1KFM A;  1YTZ I;  5TIS E;  3L35 A;  2M5A A;  4UB6 H;  3AED C;  1GU5 A;  2ZT9 B;  1YJW P;  1Q7Y Q;  1BDC A;  1W2E A;  3LIE A;  1DEE G;  2M5A B;  1SLQ A;  3S4R A;  1H0T A;  2G8Y A;  2VRS A;  1YHQ P;  4ZKU A;  4XE5 B;  5AW9 B;  2W90 A;  1H0T B;  3H32 A;  3RL0 B;  3L73 E;  1NU1 J;  1J1E B;  1FC2 C;  3H32 B;  1URQ C;  1S5L E;  1ZW0 A;  2N9B A;  2XZR A;  1HUC A;  3II6 A;  2GM4 A;  3MZW B;  4H13 C;  2C0W A;  2O01 J;  1L0N E;  4KHX A;  4KJM A;  4LC1 A;  2FYU D;  1NU1 E;  3M9H A;  3KPE A;  1N7S C;  1S2E A;  3G6E P;  3GW6 A;  5GTI E;  1IFJ A;  1SQV D;  1KMI Z;  1K9M Q;  1BGY D;  3CXH E;  1L2P A;  3USS A;  2E75 C;  3H1J D;  1NO4 A;  3CCM P;  4WY4 D;  4JYB A;  2FY8 A;  5CCG C;  4M3L A;  3FWL A;  2WIT A;  5TIS H;  1AA0 A;  1OVU A;  2WWW A;  3MD0 A;  1IFM A;  2Z5H A;  1EC5 A;  1RQV A;  2ZYG A;  2A06 E;  4GOE A;  4PV1 D;  3CWB G;  3G4S P;  3TDK A;  3L37 A;  5AVX B;  2KUB A;  1YQ3 C;  3AE6 C;  4PD4 I;  2FYN C;  3IF4 A;  3EFG A;  4D6T E;  4W80 A;  1SQB D;  2XNX A;  2WVR A;  1S9K E;  1JOC A;  3MGN A;  1S5L H;  2Q5U A;  2ZFC A;  3ITK A;  1LWU A;  1J2J B;  1P84 D;  3N7N A;  1H8A A;  3PTZ A;  2WSS H;  1S4X A;  3BRT B;  2JWA A;  2B87 A;  1SQP J;  1LTJ C;  2QJK B;  1L0L G;  1S3J A;  3R2P A;  2I8D A;  2Q9I A;  2HFE D;  4H44 B;  2FFD C;  1PZQ A;  2B87 B;  3L71 E;  3HD7 C;  4OWF A;  1OZH A;  2AEF A;  1FBM A;  5GTI H;  3BRV B;  2GA1 A;  1IJD B;  2L5G B;  2L91 A;  2KLU A;  3CXH H;  1PGJ A;  2R44 A;  3P7K A;  1H88 A;  1X9V A;  4C7N A;  4GIF A;  4LLH A;  3WMM 0;  1SQX D;  1NKN A;  1AV1 A;  1PPJ G;  1SQP E;  4C7N B;  1KTM A;  3CC7 P;  3CME P;  2P58 A;  4I7Z C;  1XTC C;  4BWN A;  2P67 A;  3MTU E;  4Z1M H;  3TF5 A;  4ZKP A;  1JO5 A;  3AEB C;  2NZ2 A;  3T97 A;  3Q3D A;  1AFO A;  1L4A D;  3L70 E;  1EZV I;  2C0X A;  2WSF J;  4OGQ D;  3T97 B;  1OFC X;  3Q2Y A;  1PP9 G;  2JEE A;  5BU5 A;  1SQV G;  1GL2 D;  3D6Z A;  1BE3 D;  2CPB A;  3V2Q A;  1PV3 A;  2QJP B;  1CW5 A;  1EDL A;  1GD2 E;  1NJI Q;  2P7J A;  3NXS A;  2IPP A;  2BAS A;  2FYU J;  1NTM K;  2P2U A;  1E79 H;  3VN0 A;  2IZ1 A;  1PGO A;  1SQV J;  3O8Z A;  5APV A;  1CI6 A;  1BGY J;  1U57 A;  3HE4 A;  3H1J J;  1YI2 P;  2Y9Z A;  3HUS C;  1CI6 B;  1FZE A;  3HE4 B;  1SFC A;  3SWY A;  1L0L K;  3BCC D;  3AE9 C;  2KIK A;  1HTL C;  5KAF E;  1SFC B;  2AXT E;  2QVA A;  2FYU E;  2IZ0 A;  4JF7 A;  2H88 C;  3CCQ P;  2G3A A;  1AVY A;  2C9N Y;  3P32 A;  4NPD A;  1R8E A;  1HF9 A;  2CPS A;  3FXE A;  1BGY E;  1N73 A;  3RL0 g;  3A3Y B;  3H1J E;  3KYQ A;  2YNY A;  5AVT B;  1M56 D;  1N73 B;  3AE3 C;  3B5N C;  2WSC J;  2A45 H;  5KKZ B;  5M1B A;  3VMX A;  1SQB J;  2RKL A;  4N3Y B;  4DOJ A;  3AE2 C;  1LTT C;  3V2P A;  3A5T A;  1RF1 A;  1JY2 N;  3BAS A;  1GK4 A;  1VF5 C;  3CC2 P;  1SQQ G;  2Z4E A;  2E76 D;  3AEA C;  1RF1 B;  2OYI A;  5H2F H;  2IX7 C;  1KOR A;  3GF7 A;  5APS A;  3EFF K;  4XFJ A;  2OYI B;  2IYP A;  3LW5 H;  2XKM A;  3H1H G;  2JWD A;  1JEK A;  4C46 A;  1SQB E;  1T2K C;  1IK9 A;  1FDI A;  2WSF H;  2Q7C A;  1EDI A;  3O6Q B;  1LTB C;  1L0N D;  1P84 E;  2D2C C;  1JB0 J;  4DZO A;  1SQX J;  1PGQ A;  4EDF A;  5APQ A;  5E79 E;  3OW2 O;  1VQ8 P;  2AXT H;  3IAO A;  3L72 D;  1EDK A;  2HPC A;  3GHG A;  1U7J A;  1SS1 A;  3S9O A;  2HPC B;  4H13 D;  2ZYA A;  2PRR A;  1LNQ A;  4WY4 A;  3GHG B;  1OWA A;  5KLV G;  1CSB A;  1N7S D;  1BE3 J;  3PJS K;  1SQX E;  4WY4 B;  3SFE C;  2FXO A;  3FGA D;  3TGU G;  3CC4 P;  3HRN A;  1M1J C;  4JYC A;  3QH9 A;  5CCG D;  1HGV A;  4L76 A;  4Y28 J;  3M0D C;  3AEC C;  4D6T D;  1KB9 I;  2YKP A;  3HTK A;  3FX0 A;  3H1L E;  4PV1 B;  1SQQ K;  1BE3 E;  3HTK B;  1LT9 A;  2IBZ I;  2RMZ A;  3E1I A;  2WSC H;  1KYO I;  1SVF A;  1FU1 A;  1T3U A;  4N78 E;  1LT9 B;  3BCC J;  2IDB A;  3H1K E;  3PLN A;  1YTZ T;  3SSU A;  1JCC A;  1A02 J;  3RBZ A;  1NOH A;  4RO0 A;  3R4Y A;  1P84 H;  5AW4 B;  3Q5R A;  3L71 D;  2AXC A;  1QLE D;  1Z56 A;  3L73 G;  1D7M A;  3MUD C;  5E79 H;  1JTH A;  1Q90 D;  1J1D B;  1HWT C;  2KZJ A;  2W6A A;  3BCC E;  2YIU B;  2M3E A;  5BVZ A;  1JTH B;  5APU A;  1RE3 C;  4YXD C;  1W2B O;  1R5L A;  1GDT A;  4YTP C;  3RK3 C;  1KQS O;  1PFI A;  1RY3 A;  2B89 A;  4YXW H;  1T8Z A;  4I1L A;  2E74 C;  3HD7 D;  1KQF B;  2BEZ F;  5KLI B; 
#chains in the Genus database with same CATH homology
 5TIS E;  4UB6 E;  4UB8 E;  3KZI E;  5GTI E;  5GTH E;  3A0B E;  4PJ0 E;  4IL6 E;  5H2F E;  3WU2 E;  5KAF E;  5B5E E;  5E79 E;  2AXT E;  5B66 E;  3A0H E;  3JCU E;  5KAI E;  1S5L E;  1W5C E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...