2JKVA

Structure of human phosphogluconate dehydrogenase in complex with nadph at 2.53a
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
482
structure length
482
Chain Sequence
AQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
publication title Structure of Human Phosphogluconate Dehydrogenase in Complex with Nadph at 2.53A
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 182
structure length 482
sequence length 482
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2jkvA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2jkvA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2jkvA01
3O9ZA 3PIDA 3WIDA 4A73A 1LDMA 1D8AA 4GSLA 4MP8A 4RVHA 4E2XA 3L4BA 2Q50A 1I36A 1P31A 1E6EA 1ZIDA 2H6EA 1LC3A 1C0KA 4C7KA 2DUUA 8ADHA 3VDRA 2DVMA 3KSZO 4S3MA 4XKJA 4YRBA 4LN1A 3BHIA 3MJTA 1ENPA 3OFSA 2B5VA 4NFSA 2AEFA 2DLDA 3S2EA 3OJ0A 4UAGA 1ADBA 1JN0A 4R5MA 4JX8A 2O3RA 1MX3A 1VSVA 3GG2A 2WD7A 1N5DA 3VTFA 2X0JA 4I5FA 3FF4A 1D3AA 1EK5A 4MVJE 4R1SA 4C7JA 1U3VA 4GPD1 5C7OO 1SNYA 1JLLA 4YJHA 1F8GA 3EMKA 3GR6A 2HKIA 3QIVA 5LC1A 2V7PA 4YAGA 4UEJA 5BQFA 4FOOA 4IJUA 1RKXA 1V3UA 4K26A 4F3YA 5L7YA 1UZLA 1U5CA 2PNFA 3CTMA 4GX5A 4NR0A 4LK3A 4LRSB 4KOAA 2O4UX 1LA2A 5TF4A 4OQYA 3FWZA 4H16A 1D1SA 1VSUA 1GCUA 3BA1A 3OQ6A 4JXKA 1N1EA 4M49A 3TFOA 5DF1A 2EP7A 1I0ZA 1Y5RA 4KDEA 5JXWA 1O89A 3LT0A 1PS0A 3WGHA 4MPDA 4XGNA 3RUEA 1F06A 1R0LA 2BKAA 2QW8A 4IS2A 3V8BA 5JW6A 2VWQA 3ZV4A 2CDBA 3EZYA 2AE2A 4BV9A 1KEWA 2FZWA 2NTNA 5AOVA 3Q2IA 5BSHA 2OBYA 3KLPX 3QQPA 2NVWA 1GZ6A 3ROMA 4PCVA 4XWYA 3VZQA 2IZ0A 3K73O 5EN4A 5TNXA 1HDYA 1PJ4A 3MCVA 2C7VA 2CNBA 1N7HA 4FSHA 1B26A 1A9YA 4YQZA 1WAMA 3WQRA 2HO5A 4OHUA 4Z0HO 3ZH2A 2OP0A 4MVJF 3QHAA 3HUDA 1Q7CA 4G2NA 4IM7A 4HX5A 2Q1UA 1NHWA 4UVIA 4B4WA 3ZN2A 1UUFA 1HZJA 5FF9A 3UCEA 4CUJA 1V0JA 4RL6A 3RU9A 4MOWA 3KM0A 1OFGA 4A26A 3JQ7A 1OAAA 2VHZA 3ZHBA 4L4SA 3NT2A 4DMLA 1HDRA 4W7IA 4DIFA 3QWBA 4W6ZA 3DFZA 3JQ6A 3KO8A 4ALKA 3RKRA 3SLKA 3FR7A 1QG6A 2NM0A 4GLOA 2PKQO 3JD2A 2EKPA 4QFCA 1GYQA 3EY4A 2WD8A 1PGOA 3LQFA 4BNFA 3OBBA 2VRCD 2YV3A 2VN8A 3FHLA 2IYPA 1ZMTA 1JVSA 1O0SA 1CRWG 1H0KA 4WKGA 2PR2A 3RKUA 2NACA 1NP3A 2VUTA 3BMQA 3LLVA 4BKQA 3ZWVA 3H5RA 5IN4A 4CM3A 2YQ5A 5BNFA 5TC4A 2DBQA 3B1FA 4O5OA 1GDHA 1OBFO 4J43A 1C1XA 1Y81A 3QA9A 3W6UA 3ASUA 1GYRA 4DYDA 4KDFA 3PLNA 4PLZA 1JKFA 1P3DA 4IIUA 1HETA 5U4QA 4CMKA 4LCJA 4BO3A 4XQGA 4H3VA 4ZQEA 4II3A 1EE2A 3G17A 3PHIA 3DHEA 5ES3A 3AOGA 3E9NA 3EAGA 4W9NC 4YQYA 2X0NA 5JYDA 3CE6A 1WLYA 2AG5A 2QYTA 1I5RA 3KSUA 3OHSX 4IJVA 1Z7BA 4MO2A 3RC7A 3L4SO 1IL0A 3GZNA 1B3BA 3RFTA 3DTTA 2QIOA 3KEQA 4W99A 4W9NA 5F1KA 2Q49A 3ENKA 4IZHA 1U8XX 2UUPA 4CL8A 4OM8A 3PP8A 2AE1A 1RWBA 4U5QA 2YV1A 5EL0A 4AJLA 1E5LA 4RF3A 4RO0A 3VVBA 1P0CA 3NV9A 5JAQA 1W6UA 3BTVA 2ZYGA 2QG4A 2X9VA 5IZ4A 3H5NA 2BRUA 3JQAA 3UFXA 4BB6A 3U0BA 3PK0A 4L76A 5TSDA 4BMNA 1A7KA 1XG5A 4N5MA 3FWNA 3T4XA 1YOVA 1NFFA 1T26A 4OL9A 2X1HA 5B1YA 1YBMA 5B12A 1KIFA 1OC2A 2C2XA 3IOYA 4FGSA 2DTXA 4D41A 5A1TA 2FMUA 3WFJA 3JD0A 3PJFA 4ZN6A 4D0RA 1MGOA 2ZTLA 4R69A 3FPLA 2WYWA 3P7MA 3VH4A 4FJ2A 3ABIA 4FJ1A 4EUEA 2GZ2A 1A9ZA 2NTJA 5KKAA 3DR3A 1VL8A 2GZ1A 2H63A 3I9JA 4NIMA 2Y67A 2UUOA 4U6SA 2IXBA 4IS3A 4YRAA 1DC3A 5A03A 1SCUA 2E82A 3I5MA 2UAGA 1VKOA 1EBFA 5A4DA 4R54A 4EW6A 5I8WA 1ZSNA 2HK9A 4HY3A 2GF2A 3PGJA 4NG5A 3GEDA 2PH5A 1X15A 4AJKA 4QO8A 3PYXA 3O03A 5DBIA 1Q1NA 1QKIA 2C29D 3LT4A 4PG7A 1BG6A 2WD7B 3KEOA 4CLEA 1P74A 4XYLA 1DIHA 4LMRA 4N5LA 4L9RA 1M66A 2J3IA 4J1TA 5KJCA 3O8QA 4RVFA 3SJUA 1NPDA 4J2OA 2YJZA 1WP4A 1DIGA 1T2EA 2D59A 3MJCA 4RVGA 4CUKA 1DFIA 4Q9NA 2O2YA 4M55A 1SB9A 4MKRA 2PD4A 1J0XO 4WCDA 4E31A 2B36A 3LLSA 5L9AA 1P1IA 1ISIA 2E37A 4WUVA 1T24A 5KVSA 3KVOA 4BO9A 2PTGA 3GNTA 3UH1A 1PJ2A 3F1LA 3LK7A 4RF2A 1YS4A 1U4OA 3OQ1A 1JA9A 9LDTA 2IYOA 1AN9A 4PVCA 4YAEA 3IKVA 8LDHA 3GPDG 1ZXLA 4Q3EA 1B2LA 1HSOA 1PL6A 1SOVA 3UCFA 4E30A 4RDHA 4JBHA 3I9MA 5BSGA 2P2SA 2FR0A 1A27A 4QEDA 1KC1A 1X14A 3W8EA 3JD3A 5AVOA 3N58A 4B4UA 4OOFA 3JV7A 5C7LO 1MFZA 2ZIZA 5EMHA 5U1PA 4FB5A 3PLRA 2HMWA 2FRDA 4R3NA 5KJFA 1YL5A 4L4XA 2AW5A 4RCVA 3TZHA 2C0CA 3K92A 2PK3A 3CMMA 3GN2A 4BKPA 2E4AA 4R3WA 4BNHA 1CERA 3WIEA 1WDLA 4B4OA 3IP3A 1HT0A 4RJTA 3L6EA 5DBGA 4ZU3A 3W1VA 5IZCA 4HWKA 4JP2A 4YJDA 2O48X 3MOGA 1TT7A 1TA4A 3CIFA 2PGDA 4ILKA 2B37A 4RVSA 1VJTA 4E5NA 3F4BA 1EQ2A 3E82A 4LMPA 2VYND 3NUGA 3JQ7B 2ZTVA 4YWJA 5U9CA 1PJQA 1DHTA 2BFMA 2QZ9A 1EVZA 5AYVA 3TN7A 2SCUA 3H4VA 1PJSA 5DN9A 2AG8A 4GKVA 2G82A 3STHA 5HBRA 5DULA 3GPIA 1KOLA 1TEHA 3PHLA 5JYEA 3A06A 4XIYA 5T67A 2OOSA 4IGFA 1XYGA 4GH5A 4PLHA 1DJQA 4LSMA 5I8ZA 1XA0A 2V65A 1EMDA 2EJVA 2C20A 3JQ8A 3ST7A 3UHAA 4AJIA 5KTKA 5T64A 5G0TA 2QZZA 3AM5A 4IINA 3Q0EA 3CKYA 1NWCA 1TB4A 4RVUA 3GVXA 4GX1A 4RPLA 1Y7TA 4AJ2A 1C1XB 3KBOA 3L6DA 1T25A 1GUZA 1VE9A 2CZCA 3GNSA 3IP1A 1Y8QA 2DTEA 4GLLA 5CHEA 5JO9A 2DTDA 1DLIA 3CZRA 4F6CA 3GUCA 1PJBA 2TMDA 5F1PA 3JQEA 4NBVA 4CMHA 3QVTA 3HE3A 1ID1A 4Y8VA 5MGBA 3DTYA 4MJLA 4RF4A 4BQPA 3GN1A 4IDDA 4Y6SA 4IY1A 2CUKA 2G17A 2JKVA 3AU9A 4H7PA 1YB4A 3HB4X 4K1LA 2FSVA 2QX7A 5HRUA 1FDTA 2Y1EA 3JQDA 3PIIA 5IDXA 4PLTA 1I2CA 1UXHA 4BNYA 1H2HA 1U8FO 3E9QA 3S2FA 1KVRA 5DBFA 4XD2A 2O4CA 1LQUA 4P8RA 3JQAB 2QQ5A 3NT4A 4KWHA 3HN7A 4CM6A 4E32A 5JMPA 4FFOA 4WLEA 1YOVB 1Z73A 5CP8A 2UV8A 2G0TA 4QX6A 3IJRA 3VPFA 1RM0A 4PLWA 2GSDA 1NFRA 5KVVA 3U4CA 4J1SA 1ZFNA 2OMEA 1ZW1A 3NYWA 4O59O 4YA6A 1S7CA 4DIOA 5JCJD 2VWHA 4XQ9A 1GEEA 4GAEA 3T7CA 2VTEA 4TWRA 5EINA 1H9AA 2E48A 4OXKA 4AJ4A 2HRZA 3X2EA 4BNZA 3E8XA 5CDYA 3PVZA 2VZ9A 5CG2A 1G0NA 1LDGA 4D46A 1XR3A 2X7HA 4J0FA 1BWSA 3WGQA 1W4ZA 3WGGA 3GVPA 4YAIA 3V2HA 2WE8A 4MKXA 1AE1A 4CM1A 2GDZA 4Y9DA 4YT8A 2DQ4A 3VZSA 2Q1SA 3FNEA 2FOIA 3GQVA 1HDGO 2J5RA 2ZYAA 3AK4A 3PQFA 1HWYA 1BHSA 1KVQA 3AY6A 3ZU2A 3ZV6A 2XPCA 3QWAA 3K96A 5G2OA 1WPQA 5T8KC 4OH1A 1GQQA 4Z3KA 1AXGA 3B6ZA 1ZK2A 1DC5A 4GSKA 3WWZA 4E0BA 3ZV5A 2Z1NA 3K6JA 1AVYA 2HDHA 1IULA 5JE8A 1IOLA 1X7HA 3S1LA 4E2ZA 1FDSA 4WOJA 1IHYA 3FBGA 4ALMA 5AXCA 5COAA 1MUUA 2GR9A 3ICPA 1LTHR 3O4RA 3ENNA 3E9MA 4GVXA 4P4GA 4S1VA 3ZNOA 3CINA 5THKA 3VKUA 1B16A 1QRRA 1IZ0A 1XDWA 1TI7A 1M6HA 4IGEA 3CUKA 4OMUA 3WBFA 4BO1A 1P0FA 4DC1A 2QRKA 5JFOA 5JC1A 2R6JA 2OL4A 5A06A 3L07A 4CLXA 4BOYA 4NPCA 5K9ZA 3G1UA 2JAPA 1G1AA 1OMOA 4ZQHA 1T2CA 3HSKA 4FFNA 2X5OA 2YHIB 3U49A 3NGXA 3W4JA 2ZB3A 3TPCA 4KTTE 1OC4A 1GV0A 4WJZA 2GUGA 1VJ1A 5DT9A 3VPGA 4BNMA 5I7SA 2DBZA 4PRKA 6LDHA 4PRLA 3PI7A 5KKCA 1BDMA 3S55A 1PL8A 5AXDA 5LCXA 1HYEA 1YB5A 4HFNA 4B3JA 4RZHA 1AHHA 1AHIA 4DPKA 1UR5A 3RUAA 3RC2A 3DBLA 4JLWA 1T2DA 4AJNA 3QY9A 3ZU3A 3JQBC 4D3DA 3DZHA 4G81A 1I01A 2D4AA 2RBEA 4GX2A 3DBHA 3WYEA 4IQ8A 5FWNA 2PZLA 3OETA 4J4HA 4PG6A 1UH5A 3RAJA 1T4DA 1LLUA 4BGVA 3JQBA 4Z9XA 1LJ8A 3BMOA 1PU2A 4PG5A 3L9WA 5C37A 2DBRA 1U3TA 1QYDA 2ZCVA 4WLUA 4CV2A 3DEYX 4DBZA 1JTVA 1PWXA 1RJWA 4AJEA 2BFAA 3ZWXA 3DOCA 4URFA 5IN5A 4J7XA 2FN7A 3GEGA 5F1OA 3RC1A 1E1LA 2JFGA 1HDOA 3ONEA 1WMAA 4PN3A 1O95A 1U1IA 1ADFA 4BNKA 4NDNE 3JQ8B 4R51A 1P1HA 3WQSB 3MEQA 1BW9A 2HMSA 3C1OA 3LVFO 4ALJA 1PGQA 4D43A 4OSPA 1K5HA 2AA3A 4EDFA 1NVTA 4YACA 4KQXA 4BGEA 5ER6A 2EP5A 3UVEA 1U3UA 4Z6KA 1C1DB 1NNUA 4XX0A 5EQDA 3HQ4O 1I3LA 4R1UA 5BSEA 4BB5A 1R12A 1EDZA 1NBOA 1U4SA 4NK4A 1DC4A 2FZEA 3PFFA 1O6ZA 1XLTA 3P19A 3UAGA 1RM5A 2J5QA 3BAZA 3QW2A 3GVHA 4XQEA 4I8XA 4P22A 1HRDA 3QLJA 2EXXA 4EEZA 1TLTA 4RORA 3Q6IA 4NJMA 3KYBA 1OOEA 4BS9A 4NI5A 5I9MA 3B20A 3TDKA 2FPPA 3K2EA 1KC3A 1Y6JA 2O50A 3DQPA 4JK3A 3GMDA 4UVEA 4JP3A 5A5EA 1Q0QA 1BSVA 4BHTA 4WE3A 1FK8A 3BZUA 4IJKA 4UEOA 4D3SA 3F4LA 3QE3A 3OIFA 3VPSA 1ZO8A 2W90A 2AXQA 1YONA 1T2FA 3WGYA 3RFXA 1R4NA 2BMAA 3DBRA 3TOXA 4MVJH 1KY4A 2W2LA 1V3TA 2OXIA 2DFDA 3FRJA 1ARZA 1GU7A 3UOGA 3KYCB 4EI2A 2VNAA 3FNFA 2F00A 3W4IA 4I5EA 3F47A 4PLGA 3KXDA 1X13A 4IDAA 1CYDA 3COSA 4KP7A 2JJYA 2O3QA 2DAPA 2I65A 5KIAA 2NWQA 3BHJA 3VPXA 2GO1A 1LRLA 4DQUA 2FR1A 1SZJG 1IZ9A 4Z3DA 5LDHA 2O7SA 4JNKA 3ZWWA 4R16A 4M1QA 3NDIA 4RV9A 4TRRA 2O3SA 5JDCC 1PZGA 4R5HA 5HWSA 4TRMA 1B8VA 2VCYA 3W4KA 4E12A 4I08A 4QQRA 4XEHA 3PZRA 3WQQA 5JDCA 2UDPA 4HV4A 2Q4BA 4CMCA 1NQTA 3OEYA 2QRJA 1GZ4A 2C07A 4ZQGA 4CV3A 4J9UE 5EJ2A 4LVUA 1EK6A 2FPIA 4DL9A 5IDWA 3DWFA 4KWIA 3H3JA 3U9LA 4RPJA 3ZHYA 2OZPA 2IODA 4IDEA 2ZJ0A 1BXGA 1CWUA 1AGNA 2VHYA 1LRJA 1E7RA 2RH4A 2ZTUA 4E5KA 1HXHA 3K2BA 3DB2A 4MIYA 4WEQA 1V35A 4BNVA 4EUFA 1ZKMA 3OMLA 1JKJA 3D7LA 7ADHA 4O63O 4DIBA 5I7EA 4D0SA 4D44A 1E92A 1HE4A 3P2YA 1ZMOA 3ZW8A 4ZJUA 1KY5A 4EJ0A 2B4QA 4A0SA 1DHRA 1KERA 3BTOA 3AUAA 4W7HA 4O1MA 3WG9A 2P4HX 3WS7A 5DOZA 1B8PA 1HYHA 1DSSG 1WWKA 4J3FA 4JBIA 4XJTA 3I3OA 4MVJG 4EJMA 3LC7O 5A9TA 1LBEA 1QYXA 3ZW9A 4ZQFA 1LDNA 2WJPA 1XKQA 3DBHB 2VWGA 3WBBA 3ONFA 3KETA 3GZ4A 1A72A 2OP1A 3BXXA 1E7SA 3FTPA 1FF9A 3DFUA 4PG4A 3WGOA 4BNTA 4CM5A 4NBTA 1E6WA 1HSZA 2A4KA 5CFZA 4CLRA 2I6TA 3DZBA 1DJNA 3PWKA 1YJ8A 4JROA 5CDTA 1R0SA 3S2IA 3BMNA 1GL3A 1XQ1A 3UCXA 3U62A 4E2YA 4CJXA 4YVFA 4GVLA 4NH4A 5TRTA 1SBYA 1R6DA 3OICA 3ZWAA 4I5DA 4OXNA 4AJPA 4CODB 4XB2A 3RUFA 3HHPA 4WPGA 5TIIA 2CSUA 2GN8A 4W82A 3H2SA 3KLMX 2GNAA 2NU8A 1HEUA 4I9NA 4Y67A 1GUYA 3WXBA 1GPJA 3SLGA 1Y5MA 3INGA 5L45A 1MP0A 1KETA 1J5PA 3WWYA 1BVUA 3D3WA 5EERA 1BW9B 1IPEA 2BH9A 4A27A 1X0XA 2D5CA 3H3FA 2G76A 2P5YA 4N5NA 2NUAA 3TZKA 3DZGA 1UAGA 3G3EA 3SX2A 3LT2A 3ZWPA 2YDYA 2VRCA 1EE9A 3UUWA 2WEKA 3ASVA 5HS6A 3K5PA 3L9XA 4B79A 4HXYA 2XAAA 3DBVO 2X0IA 4RPKA 1P1FA 1VI2A 3F1KA 4KZPA 5DZSA 4E4YA 3MJ4A 3ONDA 1W73A 5T6BA 5GZ3A 3GAZA 2XF8A 2VWPA 3HJAA 5DCYA 3JQCA 4NJMB 3ZZNA 1LX6A 2PLAA 3OECA 1DIRA 4WK6A 3RSHA 3AY7A 2PKRA 3RROA 4WGGA 1HKUA 3PPIA 5BSFA 3PQEA 2NNLD 2P9GA 1NFQA 1EUZA 1R16A 1T1RA 4U8GA 1E7YA 3TJRA 3LYLA 4KUHA 3I23A 1JQBA 5TJ9A 1G0OA 1PQWA 4Y6RA 3BYZA 3GG9A 3M2PA 4D42A 2VHVA 3B1JA 4GMGA 5COBA 4BIIA 3FNHA 3GVIA 4DGSA 1R4NB 2I66A 4AVYA 2ZJ1A 4TRJA 3GVCA 1NR1A 2B0JA 3KTDA 4INAA 3CZMA 3QSGA 2DU8A 3HWRA 4GGPA 4BO0A 1DOHA 3G79A 1ISFA 3SXPA 4YJGB 1LEHA 4OIMA 1EEHA 1LRKA 4LCEA 2DUWA 3WLEA 2QYSA 4DPLA 1I32A 2IEDA 3HB5X 4WLOA 3GUYA 3G49A 1XU9A 2OBNA 1Y1PA 2C5EA 3IUSA 4CR6A 2EIHA 4YT2A 2EKLA 1LQTA 3V1TC 2O2SA 4OGWA 2P91A 3ICCA 4BO4A 3I6IA 3H7AA 1SEPA 3WDSA 3GOHA 5TS3A 1U3WA 3JYOA 1B7GO 4D7AA 2IE0A 2O23A 2O7QA 2B35A 1ZSYA 4E21A 2D1YA 3GDGA 3EDMA 3A1NA 1BTOA 3HG7A 1C0LA 3CXRA 5I9NA 1P9LA 2EG9A 2D0IA 2DBVO 1EZ4A 2X22A 2Y1DA 2VQ3A 2OFPA 4BNWA 4IQ0A 4R41A 5DNAA 4RPGA 1LNQA 4JGBA 1PZHA 4U6QA 5CPFA 4BQRA 2HSDA 1SO8A 4YYZA 4MIEA 2ZQZA 4UVHA 5F3RA 4HFRA 4OQZA 1SMKA 3RVDA 4YJHB 2O3UA 3ANLA 2JFHA 2FY8A 1R0KA 2OHXA 3BTUA 1MV8A 3IC5A 3W8FA 2VHXA 4Q39A 1BXGB 5C3MA 3D0OA 1PZEA 4GBJA 4IBOA 4WEOA 2YFQA 3ZNNA 4DTIA 3H9GA 3JYNA 4DUPA 2YDXA 5BNIA 2PV7A 3VVCA 3GRPA 2FWMX 3HZZA 3VHRA 1Y9EA 1ADGA 4JJGA 1M6WA 2HMUA 4J16A 2B4TO 4R4JA 5FI5A 2NSDA 2WYVA 3LU1A 2Y0EA 1IYZA 1YBVA 3M6IA 4ZQBA 4BKOA 4BO8A 3U09A 4AL4A 4EITA 2Q1TA 1BXZA 4AFNA 5G4KA 1H9BA 2CF6A 4XYGA 5KCZA 3OJFA 2V6BA 1DFHA 1I2ZA 3FN4A 4HFJA 4TVBA 4ZRMA 4J0EA 4JIGA 1I3MA 5IZCC 1KS9A 4QTZA 3GK3A 3WJ7A 4RVDA 3UGKA 3PRJA 4QFDA 3ADPA 2HCTA 4XIJA 4ALNA 1HE2A 3ROPA 1ADCA 3H2ZA 4RQTA 1T1SA 1SB8A 3E03A 5B4UA 5L7TA 2VYVD 2VZ0A 3DAPA 1U28A 1VPDA 6ADHA 5IXSA 1E0DA 3ANMA 3W6ZA 3OJOA 1LXCA 1E7MA 4CLRB 4ID9A 1SAYA 4N18A 3VZPA 3QV1A 3I9KA 3QJ5A 4HNGA 4XJSA 3IQDB 4B8ZA 1YB1A 3BMNB 2VYVA 1XELA 2Y0CA 3GF4A 1CF2O 5G0WA 1DC6A 1PZFA 1GY8A 4L74A 2WM3A 3DZIA 1HE3A 3QWHA 4UVDA 4B3HA 3OA2A 4KQWA 4NFYA 2JHGA 1MB4A 2R00A 4NU5A 2VYNA 2ZATA 1PQPA 3P2OA 1BXKA 3KHUA 3L6OO 5A05A 5TQVA 3U3XA 5CAEA 1E3LA 3OF2A 3EHEA 1N9GA 3ZU5A 2Y1GA 4I5GA 3ITDA 1IPFA 3ZWMA 3MTGA 3BMQB 4PFJA 3ZU4A 1GPDG 3VPHA 3FCOA 3NAQA 3IL2A 4FJ0A 1H93A 2JFFA 3EVTA 1GQ2A 1S6YA 5K0ZA 3FI9A 4ROSA 3RU7A 4DYVA 3WMWA 3JQGA 4K9DA 4L73A 1KYQA 1I8TA 1YBAA 1NQOA 2GRAA 2HQ1A 3I83A 1K6JA 3PEFA 3E1KA 2OUIA 1EVJA 1PR9A 4NK5A 1DRUA 1NWHA 2J3JA 4M87A 1GQYA 1LSSA 3HADA 1EQUA 1DIAA 2RAFA 1YGYA 3GZNB 4F46A 5JSFA 3VC7A 4OKNA 3MTJA 1NAIA 4EJ6A 3ZGYA 4UUOA 3C85A 5EESA 1VM6A 2E49A 5JNLA 3Q11A 4DQXA 4DA9A 2Q1WA 3IUPA 3TSCA 3H9UA 3RUHA 4B7CA 4CV1A 1HTBA 2X23A 3NT5A 3QVXA 3GAFA 5ITVA 3UF0A 3AOEA 3GA0A 1Z7EA 3GFGA 3PJEA 4DQVA 4L75A 4IQGA 1E3WA 3EZLA 2PZKA 1YH3A 4A2CA 4WNCA 4NFHA 4CQMD 3GLQA 3RBXA 2H1SA 4U0KA 1WDKA 4WLNA 3WNQA 3RUDA 5L40A 1GAEO 5KOIA 2JD0A 4TKMA 1YDWA 1AUPA 3RJ9A 1LSJA 2VZ8A 3PHGA 1YJQA 3WB9A 4ZD6A 2C82A 1EUDA 2YV2A 2EERA 3CSDA 4B3IA 5L4LA 2XOXA 4BNUA 1ZK3A 1ML3A 3MWDB 1R4MA 4IDBA 4BNXA 4HADA 1W0CA 2B4RO 5JCJA 3BHMA 4PG8A 1PL7A 2D8AA 3UKOA 1W8DA 4MP6A 4CM8A 4EGFA 3LDHA 4IMPA 2PZJA 3RI3A 3JQFC 2P4QA 4DLAA 1WZIA 3MWEB 4NJOA 3JQ9C 3DZFA 3QRWA 1YXMA 5TLSA 3HDHA 2ZCUA 2PA3A 1N1GA 2I9PA 4CLOA 3TRIA 3NGLA 3O8QB 2UYYA 3JQFA 3U4DA 1YRLA 1UP7A 4GWGA 5DOVA 3H6KA 5ICSA 2CD9A 4O6VA 1QMGA 2GPTA 2Y1CA 3JQ9A 4YTEA 1Z45A 3SVTA 3GDOA 3P5SA 2OGUA 3RUCA 1D4FA 2WDZA 1WMBA 4NNJA 4LW8A 3OJLA 5L7WA 3ON5A 4YCAA 3OH8A 4P38A 1HF3A 4EEXA 2GCGA 3INTA 3Q9NA 4ZGWA 4CM7A 4J91A 2Q2VA 4A5OA 4XRRA 2CDAA 2W4QA 5GY7A 4G5HA 3NEPX 4MP3A 2HLPA 1OZAA 2Y05A 4CR8A 2GD1O 4TZTA 2HK7A 4U7WA 2PD6A 1UDAA 4OJNA 4J90A 1ZEJA 1E7QA 4J7UA 4Q3AA 2JD2A 1YQDA 3PWSA 2OORA 2NVUA 2D3TA 1QV6A 5IAAA 3I9LA 3PZBA 3WOHA 4YAJA 4FD3A 1RYEA 2W98A 4BNGA 4EZBA 2GN9A 3DHYA 4FC7A 4OKIA 4L4RA 1H6DA 2YW9A 3OSUA 1E6UA 1T4BA 1DAPA 3M1LA 5A5FA 3V2UA 4ND2A 1ENOA 1ZVMA 1H94A 5CPBA 1WXDA 2ZB7A 3DC2A 4WASA 4ND3A 2YZ7A 4BNJA 3GNQA 4DVJA 1M2WA 5G0UA 1U7TA 3PWZA 3NX4A 2PY6A 4QSMA 2JL1A 1NPTO 4KUEA 2HK8A 2XXJA 5LDGA 3TZQA 1MXHA 5L51A 5JDIC 4AJOA 1DPGA 1EFKA 3NDJA 4XCVA 4BUCA 1RM3A 5EQFA 1UXIA 3BMCA 1PQUA 3PJDA 3HN2A 1F0YA 1QXSA 3C8MA 2GYYA 1PJTA 1RYDA 3AY3A 4Q3BA 4CMAA 5JMWA 4ONEA 1AA0A 4UULA 2DT5A 4Q3CA 5JDIA 3E48A 3I1JA 1LDYA 3HFGA 3C7AA 1BMDA 3NKLA 3R0IA 4FS3A 2CMDA 3IIEA 4BNNA 4ZA2A 4UUMA 4XR9A 1UZMA 1H6CA 3PHHA 4R9SA 3OM9A 5IG2A 4X54A 3EVNA 3EW7A 4JCOA 3D5QA 4D45A 3I4FA 1QR6A 1ULUA 4J49A 4GX0A 3WICA 4E2WA 4IZIA 1K2WA 1ONNA 1HZZA 3E5RA 2AQHA 4CM4A 1Y8QB 2DC1A 4J4TA 4E5YA 3RC9A 3BTSA 3JQGB 4FW8A 4MKZA 4J7CA 1NAYA 1GD1O 1QYWA 3R1IA 2QHXA 3AW9A 5F5LA 4ZRNA 2X9NA 3VZRA 1LU9A 1QLHA 1U2GA 2HU2A 2WMDA 5G0VA 1UDBA 1CQIA 3PGXA 2RCYA 4TVOA 1QYCA 3DONA 1PGNA 3LC2O 4QUKA 1ZXBA 3H5AA 3QVSA 3R3SA 2I99A 4UEKA 4DMMA 5IFLA 5HS4A 1GUFA 2Q2QA 3AI2A 1I24A 1SC6A 4P4NA 1N8KA 2Y93A 2I3AA 4E3ZA 4QXMA 4PZEA 3GT0A 1LDBA 5L53A 1Z74A 4HBGA 3DOJA 3NJ8A 2NU7A 3HDQA 3PTZA 1PX0A 4LSWA 5F5NA 1P1RA 4FDAA 3Q3CA 3O38A 3VKVA 2C7GA 3E18A 1R15A 1K6IA 2IXAA 1M76A 2PD3A 3JYPA 4R01A 5ADHA 3D3EA 3G1TA 1DFGA 4OOEA 3FBTA 4UVGA 2VUSA 4ND5A 4E33A 9LDBA 3F3SA 1MC5A 5BNTA 5HM8A 1R4MB 3MJSA 5T57A 1PTJA 1Z75A 1N92A 1UXJA 3DL2A 1TT5A 2P68A 4IPTA 1KEVA 1R37A 5G4LA 3IKTA 3JSAA 3IMFA 3RWBA 1JAXA 2GASA 1ZK0A 1FDUA 3QWIA 1CETA 1CEQA 1Q7GA 1FMCA 3UXYA 3LC1O 2EF1A 4BNIA 5B37A 1OX3A 4KTVE 4XYEA 1ZZEA 1C0IA 4GMFA 1E77A 1F8FA 3DMTA 5DDIP 1UXKA 5F21A 1A7AA 1HE5A 2X5JO 2BFOA 4IJWA 2JCVA 3WSVA 4FGWA 2PGJA 2RHCA 4CMIA 5AXBA 3RD5A 4PLPA 2BD0A 2VRBA 1KVTA 1FJHA 4JJFA 3QVWA 1Y9AA 3C7DB 3I4CA 4FQ8A 4KUGA 2JHFA 1H6BA 1V8BA 4B7XA 3DZKA 5CDGA 3OJEA 1EVIA 3NTRA 1ENYA 3WNVA 4PIVA 1X7DA 1PJ3A 1MC4A 2NV6A 3GGOA 4WOKA 3NJ4A 1PSDA 3CTVA 3GHHA 3WYCA 1NQAO 1PEDA 4E13A 4O0LA 2RIRA 4PZDA 2D5AA 1P77A 1XWFA 2PGLA 2NQTA 2Y66A 4B8WA 3F5QA 2NLOA 4YPOA 4BMVA 3DXFA 3FNGA 1X7GA 2X9GA 1LSUA 4MDHA 3AUUA 4M89A 1C14A 2NVUB 5JAMA 1ZCJA 3MZ0A 5KVQA 4A03A 5KJ1A 1V9LA 4N7RA 3D64A 3AM4A 2BI7A 2B69A 3HFSA 1CJCA 5GZ6A 1JU9A 4TRNA 4RGBA 1YDEA 3UICA 2V6MA 1JWAB 2VUUA 2X86A 3DBLB 4N54A 3V1YA 1O5IA 3WX0A 3GHYA 4W4TA 1F12A 3SJ7A 1PR3A 2W2KA 4YB8A 1YWGO 2Q45A 3H8VA 3SC6A 4BV8A 3PQDA 4GGOA 5CDSA 2EKQA 1I10A 1O94A 3Q1LA 1N7GA 5A9SA 3JYQA 2J8ZA 5KVCA 3EUWA 5KJEA 3BMOB 5IF3A 1H6AA 3KV3O 4K6FA 5A04A 3EC7A 1V6AA 2FHSA 5JCXA 1YL7A 4OAQA 5DCUA 1LSOA 3BMCB 4TROA 1GTMA 2P9CA 4RLSA 4CMGA 4YRDA 1PS8A 5IDYA 3OIDA 2HJRA 1E3IA 3WGIA 4YXFA 2ZTMA 1KVSA 4YJFA 1ISGA 5FYDA 5KNLA 1FXSA 4YR9A 5L95A 3UW3A 3PFWO 1VLLA 2A9FA 2VHWA 2NQ8A 5TT0A 1G6KA 1YL6A 2O3TA 2NTVA 1A71A 2IZZA 4LVCA 1AXEA 3AI1A 4ZICA 1ZK1A 4L8VA 1ZEMA 4FR5A 2IZ1A 4ND4A 1BRMA 3CMCO 3OIGA 3AFMA 4Q3NA 1D7OA 4P4LA 4YT4A 3GGPA 2VNSA 7MDHA 2C54A 3ETGA 3TFQA 4IXWA 4OSOA 2PWZA 4CM4B 5TX7A 1DDOA 3D4NA 4WCFC 1JVBA 3JD1A 1GYPA 2B83A 1F14A 3V1UA 1KEPA 3RASA 4CMEC 4MVJM 4UUNA 1J49A 1KBZA 1NQ5A 5DP1A 4BO2A 2I67A 4TKLA 3TZ6A 1JWBB 3ROKA 2PKQP 1GADO 4FBGA 1P33A 5IJZA 4FFLA 4WCFA 3TOZA 4NBRA 2CF5A 1E7WA 1WDMA 3ROQA 4CMEA 4DLBA 4TQGA 5A02A 1HDXA 3RBVA 2PH3A 1X0VA 2Z5LA 5COQA 1GR0A 3GC6A 2WTBA 2GN6A 2IDZA 2CDCA 3V5NA 4CUZA 5CEJA 3WGZA 1WNTA 3WJAA 1ZUD1 3WSWA 3ZI0A 3V2GA 1K0UA 1Q0LA 4BO5A 4Q3DA 1NVMB 2GZ3A 3GDFA 4IUYA 1E1NA 1B14A 5JS6A 2A94A 2ZQYA 1KVUA 3CPSA 3TF5A 3I9NA 4BVAA 3K30A 4PZCA 3DBRB 2YY7A 4JBGA 1Z6ZA 3DMYA 4IDFA 3E6AA 2YHUA 1NXQA 3GEMA 3GRKA 4D3FA 3JQAD 3ZWCA 2Y68A 1NR7A 4DRYA 2X5KO 2CVQA 1NX6A 3PXXA 3UN1A 1LLCA 1BDBA 1SEVA 2HMVA 4RQUA 3RCBA 5KJ6A 1E3EA 4HP8A 4C4OA 1Q0HA 3NTOA 1IB6A 4QECA 5B4TA 4Z9YA 1UJMA 4XYBA 4FFPA 1Z82A 4R1TA 4I9UA 2ZB4A 1TT5B 4IXTA 1IY8A 3DDNA 1B3RA 4BO7A 2V6GA 2C5AA 4HUJA 1BGVA 1CDOA 5FFFA 1IUKA 1IE3A 1B8UA 3T7EA 3F46A 1FDVA 2D2IA 4CLDA 1PGJA 4YAKA 3INRA 1J4AA 3R3JA 2Q99A 4I1IA 4EBFA 1NTOA 1R66A 3H9EO 1MXFA 2W8ZA 2BFPA 3TQHA 1K6XA 2A92A 2X8LA 1XGKA 4CMIB 5JAIA 2AEMA 3H9JA 1FDWA 5TT1A 3ZNQA 4ZHSA 1ZBQA 1TXGA 2NU6A 5CG1A 2POQX 1WW8A 1NM5A 4MINA 4M8SA 1XU7A 1P44A 3U4HA 1NVGA 4FFMA 4R1NA 3WTCA 3VH3A 2FSSA 2CVZA 4TZKA 3F5SA 3AI3A 4XDYA 2DM6A 1U2DA 1E3SA 1MG5A 2GLXA 4GI2A 1PS9A 4JJIA 4WLFA 3LSYA 4I9HA 2DPGA 3X2FA 1VRWA 3ULKA 2VTDA 4CLHA 3RBZA 5IDQA 1IHXA 4NBWA 4E5PA 3NTQA 5THQA 3DAFA 3A9WA 3PJGA 3ZHZA 2J3KA 2EGHA 2IEBA 3DO5A 2BHLA 1LUAA 1Q7BA 4GQAA 5K6AC 1XCBA 4JN6B 5KWEA 3E5MA 3A4VA 3VOSA 2Y1FA 5ENDA 2ZB8A 1JDJA 2BELA 2X0RA 3DHNA 4OXYA 3WYBA 5MDHA 2Q2WA 3N74A 5FEUA 5K6AA 1ZJYA 1P1JA 2E6UX 3KSDO 4OO3A 1PJCA 2B5WA 4FC6A 4JQCA 4LRTB 3OQBA 2Q3EA 1QLJA 4M86A 1PJLA 2VOJA 2JCXA 4D79A 3AWDA 2W2KB 4MIOA 1J6UA 4PLFA 3RFVA 3G0OA 2YHIA 3GY0A 3RQSA 5A9SB 4YT5A 3ZNPA 1HLPA 2C59A 3KRTA 3AUTA 1VKNA 4WNIA 4Z0TA 5GZ1A 1VC2A 2R00C 1MLDA 4BNLA 1DLJA 1PGPA 1ISHA 1RM4A 1GV1A 3QVOA 3KZVA 1DB3A 5A9RA 5DP2A 4YJFB 3RIHA 2ZKLA 3JYLA 4MVJD 2DPHA 2WE7A 4FN4A 3KYDA 1SPXA 3C7CB 4XRGA 1JKIA 4WECA 5ICMA 3HNPA 1O9BA 2FPGA 1DRVA 1MFPA 3PDUA 1H2BA 4J9VA 1P1KA 1YE3A 3Q2KA 3LF1A 1L1FA 4BL5A 1ISJA 3D3WB 1E5QA 3B1KA 4MVJA 1E1MA 2I5PO 2QRLA 5DCWA 3ORFA 3DAGA 3F6YA 2JAHA 4XA8A 4CPDA 3TL3A 2I3GA 2RHRA 3CEAA 2Y1OA 4A10A 3FR8A 1PIWA 2WYUA 1HYGA 5A3VA 2CY0A 4PLVA 1H5QA 1LDEA 5ILOA 5ILGA 4RPHA 1I30A 2PFGA 1F17A 2VT2A 3I6QA 4G65A 3IJPA 4FPXA 1XIVA 4WCFB 4Y98A 5HTOA 5I9LA 1GEGA 3C24A 3C3XA 3L0DA 3TL2A 5JBIA 3AM3A 5C5IA 3TNLA 1O8CA 2EHDA 1DO8A 2J5KA 1BVRA 1ISMA 1QYVA 1A4UA 5C7IO 1C1DA 4R9RA 1I2BA 2J6IA 1UXGA 2DKNA 3AOEC 3EK2A 4HKTA 1UDCA 4K28A 3TZCA 2J3HA 3LT1A 1QP8A 1OI7A 4XYMA 3SEFA 3VH2A 1ZH8A 1SOWA 2I76A 3D5TA 3FTNA 3TWOA 5JC8A 1HDZA 5G0SA 2NVBA 4II2A 1UZNA 4J6FA 4IDGA 3S8MA 4BO6A 4NBUA 1UP6A 1ORRA 4GKBA 4AJ1A 2BGKA 4Y6PA 1B15A 1Y8RA 5T5QA 3F9IA 4CL3A 3S2GA 3PDJA 2AQIA 1EFLA 4B7UA 1ONOA 4GWKA 2EWMA 3N7UA 4HFMA 5H81A 4XB1A 5GMOA 1XHLA 2UVDA 4NU6A 1MG0A 3ANNA 3A14A 1QSGA 4TMFA 4YBZA 4CQMA 4AJJA 3WLFA 5EIOA 2HMTA 3I9OA 1GFSA 4RF5A 1DXYA 2F1KA 4H15A 1Q2XA 2DFVA 4F45A 1RPNA 3FPCA 1D1TA 3LZ6A 4CQLA 4DXHA 1ZK4A 2C2YA 4K6CA 2YUTA 4CM9D 2EGGA 5JLAA 3KYCA 3D1LA 4U0JA 4BGIA 3DZJA 2HAEA 2GN4A 4GL4A 5BT9A 1EVYA 5TJHA 5B4VA 4LISA 1QV7A 4CM9A 3FSRA 3LF2A 2EW8A 4AICA 3OP4A 4CMBA 4EUHA 1M67A 3WFIA 3C1TA 1HLDA 1P45A 1C0PA 1L7EA 2H5LA 4NZ9A 3M1AA 1U7HA 4EYEA 4AJHA 1KEUA 1VL6A 3PHJA 2X6TA 3D4OA 2V6FA 4ALLA 2BGLA 5IXYA 1YVEI 2NADA 1UAYA 5L4NA 1VL0A 1X1EA 4J2HA 2R2GA 1VJ0A 3H9QA 2FP4A 2HJSA 2Q4EA 1PWZA 3B70A 3PYLA 4PVDA 3W8DA 1MA0A 3QWFA 2Z95A 3VH1A 1L7DA 3HDJA 2BI8A 1LC0A 2HUNA 2XXBA 1X1TA 1K89A 1NYTA 3DOOA 3MJEA 3GGGA 4Z9FA 5T8KA 1YQXA 1A4IA 1B0AA 2WSBA 3OEWA 1NPYA 5CEEA 2G5CA 2OO5A 4FIZA 5G4KB 1LLDA 4E6PA 1T2AA 1DBVO 2JD1A 2O3JA 4NMHA 3JCZA 2BF7A 4XZ3A 4F6LA 1ZNQO 3ZCXA 1N2SA 2PZMA 3HDYA 2P5UA 1I33A 3SBOA 2EEZA 1XQ6A 3WGTA 4PLYA 2VT3A 5FI3A 2CVOA 4DC0A 2ET6A 2VOEA 2G1UA 4KMSA 3RJ5A 1CQJA 1ENZA 2LDBA 5J23A 1HDCA 1GZ3A 4FCCA 5AQ1A 3EYWA 4R68A 4IIVA 4J1QA 4J4BA 4MVJI 5A3JA 1E3JA 1YO6A 3K31A 1XSEA 3ETEA 4XDZA 4IDCA 1ZSVA 4BKRA 1NASA 3SC4A 1E1KA 5AXAA 3L77A 2AEJA 3M2TA 3KYDB 4L0QA 5CDUA 4DPMA 5EPOA 2ZK7A 3NDRA 5BR7A 2RH8A 2Y99A 4ALIA 3WTBA 4DWVA 4XGKA 1N9GB 1WVGA 2ZYDA 2X4GA 3MJVA 4TSKA 1DAOA 4YEDA 4RLHA 5ENVA 4Z0PA 2LDXA 3AJRA 4PGFA 4CV0A 3ZWYA 3BIOA 3U4IA 1EUCA 5L4SA 1GCOA 2GGSA 3T4EA 4XGIA 3O26A 3AU8A 3ZV3A 1LLQA 3A28A 4QO7A 4FFRA 3MOIA 3KUXA 3NRCA 2EW2A 2JCYA 4M54A 5ITWA 3RUIA 5JO0A 3IAHA 4CR7A 2AHRA 1JW9B 4NQZA 3IS3A 4ESOA 1I3KA 3EGOA 4CMJA 5HA5A 4LGVA 1JAYA 4MVJP 3CH6A 5JAZA 1U9JA 5TGDA 1K3TA 4DBVO 1DEHA 3U5TA 1WZEA 3AFNA 2X58A 1LI4A 5JPIA 4UREA 1NAHA 1UP4A 2GERA 2HRBA 4XQCA 3ZWNA 4UUPA 3C1AA 3FD8A 3KOUA 1U5AA 1V3VA 3PYMA 1NHGA 4YDRA 1QORA 4E5MA 2A35A 3ITKA 3K8ZA 3ZDFA 3GH3A 1DRWA 4AG3A 4J1NA 1DIBA 1YQGA 1E3WB 5CEFA 3JTMA 2Z1MA 1C3VA 1I3NA 4NHEA 1ULSA 4BGUA 4BMSA 3Q9UA 3K9QO 5JY6A 1Y8RB 2Y0DA 4RDIA 1EDOA 3OA0A 2CFCA 1TVEA 1ONPA 2TMGA 5I7VA 2FR8A 3KB6A 3WMXA 3QP9A 4ND1A 3ZWBA 1M75A 2NU9A 2W2LD 1XEAA 4QT0A 4DREA 5H83A 4IMRA 2P9EA 4CQMB 2YFHA 1EBUA 2YQ4A 4ITUA 3WR5A 1ZJZA 4B4VA 4XR4A 3VDQA 3ZHXA 3I52A 3H65A 2H9IA 2IRWA 3GMSA 4WLVA 5H82A 3GFBA 5L3ZA 2Q46A 2EJWA 3DMTC 3ZWOA 2AQ8A 4OYRA 4CM8B 5I7FA 4CQLB 5ER9A 3ETDA 3R6DA 1A5ZA 4DLLA 4A7PA 3ADOA 2ILTA 2BGMA 4RZIA 4HNHA 4YJGA 4ZVVA 4BKUA 3D4PA 3VAZA 2AMFA 2AQKA 2YYYA 2EV9A 3L4BC 2WWRA 1YKFA 5JY1A 4CLOB 3IDSA 1CIVA 4PLCA 3VTZA 3AUSA 2BLLA 4FOSA 3JD4A 1HL3A
chains in the Genus database with same CATH superfamily
2H29A 3O9ZA 3WIDA 2X2PA 1HDIA 2HTEA 4E2XA 5F7JA 3H86A 4PEVA 2UZ1A 4LQLA 4RY9A 4TV9F 3KSZO 4S3MA 7REQB 3HSYA 5FHQA 1ADBA 1N5DA 2X0JA 1E5VA 5DXFA 3JARA 5C7OO 3DMFA 1F8GA 4FMCB 5LC1A 1Y80A 4LUCA 4JMLA 3U5ZB 3A11A 4FOOA 3WV5A 5LIRA 13PKA 2FK7A 4JLKA 1V6CA 2PNFA 2QTRA 1LA2A 5TF4A 1E1QA 5I9IA 1NF9A 1D1SA 3CLTC 3BE5A 3V8PA 1E20A 1N77A 2PGXA 2BVNA 1U0BB 2D2EA 1PS0A 3V8BA 2XKBA 4FFBA 5EHGA 2XZPA 5LWQA 4G6ZA 3QFHA 2ZT9C 3OU6A 3IOBA 2JAWA 3ROMA 4XWYA 1USVA 5F7ZA 4OHWA 4PN7A 4G2NA 1UBTS 2C2OA 4LOIA 4UVIA 4D4JA 1L0NK 4TTJA 3QPCA 3OCVA 1YSCA 2OBXA 5CCGC 2CLOB 2VHZA 2J5BA 3GLHE 5B66E 3AVUA 3EVFA 5F4ZA 3IP5A 1ZMTA 1CRWG 3KDSE 3MOSA 4L4UA 2IPMA 1D04A 3FUWA 2MMCA 2XMQA 4EHFA 3EXG2 2BSQA 2XV1A 3F5DA 4OI1A 1Y4UA 3DT8A 5J2TB 3DJFA 2Y76A 5IBCA 4B73A 2LXCB 4QXRA 1T8UA 4LOHA 4W9NA 4GE0A 5C3UA 1FZBA 5ES4B 1B6SA 3H5VA 1TZJA 4K7JA 4L76A 4QNMA 1SJ9A 1CS0A 4WX2B 2DWUA 4C6RA 3C5EA 2HR3A 1FNBA 1QDEA 4QHTA 1Y89A 2Q6LA 5LP6B 2WHYA 1J0CA 3QMVA 2RAUA 5JADA 3HE5A 4AN0A 2IXBA 1H0TA 2E75B 5IKPA 5H8WA 2OLEA 2V58A 5HQ3A 4GD3Q 2YVKA 2H0AA 1SQQK 1NPDA 3KWJA 4Q9NA 1GL2A 1RW4A 1T43A 3TSOA 4Z2AA 4RW0A 2ZM5A 2YFKA 2BGRA 1JI0A 4MWDA 4FDMA 2HF7A 4JB2A 3IKVA 1T1GA 4E30A 3G82C 3MXOA 1XNQB 1M2FA 2EFJA 5FOSA 1X14A 4TXMA 1EFUA 3W3ZB 2HMWA 4LC0A 5LJIA 4OHYA 4DCGA 3N28A 3I2HA 1Z17A 1LNZA 1W5CE 3WIEA 4PBSA 5GP1A 2O48X 3MOGA 1GU5A 2B37A 4RVSA 1ECFA 4OA8A 1WUHS 1Z88A 3EMBA 3BRTB 3TMKA 4M0UA 1VQ4P 2K9JB 2Q4RA 2EVWX 4LYJA 1KEEB 3STVA 3GPIA 5JYEA 2HT1A 5KU7A 1BE1A 3I2IA 1MAVA 2ZANA 1OWAA 4LJ5A 3J81k 3OF5A 3BICA 2VSFA 1ISRA 3R0XA 4O4HF 3CWBJ 1NVBA 3BRVB 4JYPA 3NM5A 2CUKA 5E1DA 2DPMA 3WQBA 2VSOA 4MHSA 1G38A 3PFBA 2O4CA 1WCWA 2R3SA 5IC5A 3ILHA 2H4HA 2E7ZA 1OXMA 3T7DA 1A1SA 1N8RQ 5E8RA 1SKMA 3OJAB 5IVDA 1H8ED 5CU7A 2E21A 2DB3A 3AK4A 2XGSA 1RQGA 1BHSA 1KVQA 3C6MA 3ZU2A 2OB1A 5G2OA 3KOMA 4K86A 4ATNA 1CZHA 4F5DA 4PE5B 5AXCA 2XIQA 2C98A 2PDAA 3ZNOA 3ENNA 3T52A 4N5IX 4IGEA 4JEIA 5DYGA 2V7QA 2OL4A 1A2QA 4AMGA 3ZIUA 4DJEC 4DMCA 3VN0A 1PV2A 1SURA 1EFPB 3W1EA 1OF1A 3TX6A 4E1VA 2WM9B 4GMKA 2QTMA 4B3JA 1XZFA 4DPKA 4L22A 2QLFA 3DZHA 1REQB 1Z0AA 2D4AA 2RBEA 2A7XA 3A6KA 4EDHA 4EYYQ 4WOPA 4QXPA 4BGVA 4AYXA 2YXDA 4KBYA 4UMEA 5IU6A 5K8CA 4FQ5A 3JAMA 5DGIA 2JNWA 4TWAA 1VYVA 1S8NA 4IV5A 4Q4AA 3I5UA 4KSYA 4MRNA 3IUBA 5AVWA 5BWCA 2EP5A 4L5CA 2CWDA 4JI7B 3HQ4O 2HV8A 1NBOA 3LVQE 1XLTA 3FPEA 3U6BA 1N7JA 4HN4B 1EDKA 3EDOA 1EQ7A 1HRDA 3DE3X 4P93A 5K8LA 3GMIA 3IPYA 1AS2A 3DAYA 3DLIA 4PYNA 4M1TA 4WE3A 4PHFA 3UQYS 1V1RB 1T4GA 3R5KA 4INZA 1MO5A 3DE7X 1IIRA 1V3TA 1PPJG 2OXIA 4ENQA 2PWBA 2WR8A 3K32A 3HXKA 3HYCA 4IDPA 2XYHA 1XFAA 2ZPAA 1VHWA 2KYRA 2ZSFA 3OTQA 3FJ1A 2ZAYA 3BVHA 5LD2C 3TIGA 1GA1A 1ODFA 2HQBA 2QJPC 1SELA 1YR1A 1NN5A 2PXAA 4DR4B 1EM8A 4E12A 2GPSA 3RS3A 3WQQA 1AGPA 3ED5A 4F4FA 4J9UE 1HTTA 2FPIA 4DL9A 2LRHA 3MIIA 1W25A 3UT0A 2ZJ0A 5EJ5A 1IHOA 3D7RA 3F8WA 4NOJA 2HA0A 3K6SA 1KO5A 1FMFA 3CNQS 3CRVA 1H2EA 1UBCA 5HIIA 1OVRA 5ARDA 4C1NA 4EJ0A 3HJHA 4KSBA 2QA4P 4A0SA 1KERA 3BTOA 1N2CE 2HXSA 4MB6A 4RD3A 5DOZA 1YCHA 3LC7O 1ECPA 1O08A 1KYWA 2C0PA 4WJKB 1OWLA 2WSLA 2J7PD 4MGIR 1UBHS 1RSZA 2W2VA 4CLRA 2FYUG 5CDTA 2Y0PA 1UC4B 1S5PA 3KR0A 3SBDA 2LUOA 3CX4A 3HHPA 2GN8A 2KK7A 1B0ZA 3FLBA 1T9ZA 3L73D 3IQIX 1ULZA 4TWBA 5EERA 1BW9B 3IAM6 3LT2A 2I1KA 2XQVA 5HJ2A 5DB4A 4HGNA 3I09A 4Z7JA 3K8OE 3NC4A 1Q17A 4DA6A 3FPBA 2EQAA 3T97A 1M90Q 2CFTA 4X92A 5I3CA 5CX1B 3RROA 4RXTA 1KNQA 4U8HA 1QQBA 3GG9A 4I50A 1GKUB 4ZI3A 3V97A 1VJ5A 1XP5A 1MCZA 1POWA 1GU4A 4YMGA 4ZOLB 4YJGB 2J1LA 3BRQA 3WLEA 3H4TA 1D2MA 5D85A 3U26A 3I6IA 3A4NA 5IYZA 5IAOA 2QLLA 2V7GA 3ESXA 1YB2A 2DBVO 4UZFA 2HU7A 3AEUA 3LY7A 1DEOA 4RPGA 4ZFNA 2VP3A 1NDQA 1S3SA 5LXTA 2BM9A 2FQQA 3BKXA 5F3RA 3KPVA 1QMPA 4Y3UA 1R0KA 3L05A 2YZKA 2ONKA 1ACJA 4CFSA 2O8VA 4HAZA 3LYHA 4IBOA 4L3WA 4Q5IA 1J99A 4AI6A 4KWCA 1MU0A 3H8WA 1ZGBA 3OT1B 2B4TO 1YBVA 3CCCA 1H9BA 4P5DA 3AKEA 3CL3D 4YXWH 2V1UA 4LF5B 3W5UA 2RJNA 4HYTB 3B1ZA 3GJXC 4Z1MD 3ZUPA 2FXVA 3D31A 5EXDA 1J5XA 1UQTA 5HQTA 5HP4A 3ZJVA 4RD0A 4CF6A 3K9FC 3C6YA 2C5GA 2Y0CA 3JZIA 4E15A 4FHEA 5FA8A 1KZ6A 2JGJA 5A05A 3QEJA 2WM8A 2DR3A 2X76A 3GRFA 1P2VA 2OXFA 4L72A 2V8BA 2XOKD 2I03A 2ZI9A 3O4JA 1FE6A 4EKNB 4F5ZA 1G8MA 1AKYA 3MPOA 4NK5A 4HAOA 3VC7A 3ZGYA 3CUEF 4UUOA 2E49A 2C7RA 1UWVA 3NT5A 4U9UA 3MTAA 1TM5E 1NTZD 3GA0A 4ZQIA 4DQVA 4B31A 4LNUB 3RBXA 4IIJB 5AM3A 4BLRA 1FAVA 1EUDA 1MOSA 2XOXA 3WUVA 4OGGA 1ZOLA 4KLAA 4JR0A 4GICA 4JP8A 3ND7A 3S2SA 3JQFC 2F9MA 3CC7P 1YXMA 1SQXG 2WJYA 3VSDA 1WMBA 1D07A 1GP2A 1GPLA 1X1RA 4LWOA 1GO2A 3NEPX 3VHQA 5CB6A 2ZYTX 1G9TA 3TNFA 4QYSA 3LPCA 4HN9A 4OP2A 4EEKA 2D3TA 3I9LA 2HEGA 1UBEA 4FD3A 3CCLP 5FOQA 2G71A 3TW4A 2KHZA 4YCLA 4RACA 3PA6A 4H3HB 3E35A 4RAQA 5HSGA 4BFWA 3V8MA 2DJIA 2XXJA 3UOWA 1YVDA 1RM3A 4Q3BA 2UYHA 3GP8A 2CXRA 5K1ZA 5FAKA 3TLKA 4UFNA 3ZDCA 2R8OA 1NTZK 3R7WA 4N8DA 1ZUIA 4MKZA 1X22A 2G8YA 4J7CA 3DO8A 4KHZA 4B34A 1KU0A 4TN5A 5F77A 1DTWB 2HU2A 4XDHA 1YBKA 2O06A 5JG7A 4EPVA 2RCYA 1U65A 3TQSA 5CVTA 1OVGA 3BZWA 4BN4A 1K7YA 1E4YA 3AI2A 3OHPA 3U4QA 2VA9A 4ANFA 2QN1A 4IUDS 1YUMA 4KXVA 2A1TS 1Z74A 2BP7B 1XMIA 4W5HA 3O38A 3I12A 3NTLA 1F3OA 1FTWA 1LBSA 2YVAA 2OK7A 4C3VA 3JRXA 2Q7CA 1VQ5P 3CX5D 3QE0A 3LX5A 4YXWD 3SYKA 3FCCA 3I04M 3IMFA 1NLUA 4WNYA 1TJ5A 1NJGA 2B20A 1N6LA 2XYRA 5LXTF 4IJ5A 5K0BA 1XL0A 2O14A 3LYAA 4LWPA 5FUVA 1RPJA 2FB9A 3QVWA 4XLLA 3UQZA 1TA9A 5AVJA 1LX7A 3EEOA 4PIVA 3QM1A 3N2ZB 3GGOA 1ESDA 1GU1A 3VKGA 1L1QA 1PDOA 1NQAO 4O0LA 4PZDA 1G8GA 2PGLA 1U94A 4JC5A 3EPRA 3VR3A 1RQLA 3USCS 3JAWB 3VISA 1U1DA 3AUUA 4YNBA 1IQ0A 1ZCJA 4DSNA 2YVUA 2BR5A 2OTJP 3BULA 4X44A 3B85A 4MRVA 3SY8A 4ZI7A 1X6VA 3GDHA 2B8TA 2IS1A 2VUUA 4Q3KA 3SMQA 3VYWA 3NXSA 1Z47A 5TGTA 5AM0A 3NWJA 5E2IA 2YWHA 1J24A 4C2AA 5TQJA 2XMBA 2HO4A 1LSOA 2NZ8A 4L8GA 1TF7A 4GLJA 4US2R 2LPMA 3KOZA 3CXHH 1ZRNA 1TVKB 3KSRA 4P4SB 4ZICA 4L8VA 1J1ZA 1IG3A 3AFMA 2YIVX 4P4LA 2NPSA 5I7WA 2C54A 5JH7F 3FSEA 4X8LA 3CRW1 4FW9A 2XWPA 1M7BA 1JB0J 5C8VA 2PH3A 1GR0A 2FPPB 3N2NA 2IUFA 4MPJA 1C0EA 1T6AA 4ZVRA 3GDFA 6ABPA 1OAKA 1JG1A 1FTGA 4HTAA 4KQ1A 4RJKA 4JBGA 4G5YA 1EWTA 3AI7A 1K3FA 4QPNA 1SQ0A 2HMVA 3PA8A 1TT5B 3AC0A 2CL6X 1IE3A 4C5AA 3NG1A 3H04A 4HDMB 3KPWA 1J2TA 5DI9A 1MXFA 4HZUA 1Y4SA 2HA3A 3PL1A 4W7YA 3D7SA 2AEMA 1OW3B 4XM2A 3L40A 5EYPA 1WABA 1BEUB 2WA1A 3HKEB 1EXMA 2PUDA 1ZJJA 2YMMA 1W1UA 2XDQB 1M57D 1S8AA 2IXDA 3LSYA 1QTIA 3AYXB 3X2FA 3I61A 4J0DA 3GRYA 1H1LA 1C3OB 1EJ6A 3P0EA 2BHLA 1JLHA 2DETA 1CNEA 4GU5A 4YFYA 1TUGA 5GONA 4V2UA 5EWJB 1BKDR 1DCKA 3R4VA 2WG1A 3U7EB 2QM0A 1YRQA 1TO1E 4D79A 3EC2A 1T2UA 4O4LA 3TR0A 4U7JA 1FYWA 3KD3A 3WJ2A 3N0RA 3GEPA 4WNIA 2B9EA 2DR2A 2PQ2A 5DGCA 4DQDA 2QBYA 4ASUA 2PUVA 3RIHA 2REQA 3JYLA 2IH4A 5DNYB 2YASA 4FYPA 1H2BA 1MA3A 3BZBA 1EWQA 1M2OA 1K5DA 1ZN7A 1EK1A 1PJZA 3RLFA 2RH9B 3VAYA 4PD4I 4G36A 1JEYB 2O8CB 5K3EA 1GEGA 1L9KA 1A02F 3L0DA 1L4AD 2XMGA 4LXTA 2EHDA 4ZMRA 3L71D 2Q5OA 3S3TA 1C1DA 5KYWB 3MS2A 4S1WA 1NI4B 5DBHX 2WW8A 3P4XA 5L6MB 4DM3A 4ZDIA 3Q7SA 4YMVA 5G0SA 3LCVB 2W6NA 4J6FA 2CBZA 2VCHA 4E5SA 4MA0A 3C1UA 4AZ0A 1LWUB 2XTMA 3PVCA 1NKZB 5BVGB 4AJJA 1G60A 2O2HA 1RWPA 3R8XA 3U60B 4FD2A 3PP5A 4DXHA 2GEFA 4QGHA 3LY8A 5AUNB 1SCJA 3DZJA 1VE1A 3LCMA 4B2LA 3WKCA 2RGXA 2Z3VA 2Q5FA 3FSRA 2XZRA 4NONA 3KE9A 4TKVB 1HLDA 1P45A 1G20B 4EYEA 3I2YX 2X6TA 1X0TA 2IOHA 3KVNA 2WIAA 4M88A 3GBSA 2IIVA 3M7IA 4ETMA 2Z95A 1LC0A 5CFNA 4Q4JA 1K89A 3OEWA 3B38A 3NVAA 3WYAA 4G24A 2QGFA 1IY0A 3D7MA 2OLKA 3E23A 4MW5A 2QVBA 4PLYA 2CVOA 2J46A 3AYZB 2ET6A 3RJ5A 3CF4A 3GUHA 4J1QA 3K31A 1KH3A 2J08A 4H3KB 1L7QA 3QXGA 4S35A 3V7UA 2YXBA 5EPOA 1IEVA 1JLSA 2RH8A 2ZW9A 1GCGA 1M2JA 3HO6A 2D06A 4K3VA 2Z2ZA 4ZO4A 5FA5A 3ZWYA 4OHPA 3BIOA 1IK9A 3EAFA 2C42A 1N2CB 1EHYA 4RENA 2EW2A 2CMGA 1PO7A 5ITWA 2QKYA 2QP3A 4NQZA 5EOVA 1G8YA 1O9HA 1DEHA 1I0LA 1N5OX 2GH1A 3SM3A 1MC1A 2C9DA 3AETB 1USDA 2CB0A 3E05A 1Z33A 4ZV7A 4E5MA 3K8ZA 3ITKA 3ZDFA 2AF4C 3L7JA 4MKGA 2YIDA 1RF0A 2DUNA 4MR8A 5SY9A 4MVCA 1M8GA 1EDOA 2VHEA 5GOTA 4DREA 4CQMB 3I55P 2N1MA 3I52A 1VQLP 1IEQA 2IRWA 3I1IA 4XASA 5EZSA 3WL6A 2AQ8A 3THRA 3K71B 3EG5A 4DLLA 3ZHUA 4EL0A 2IV7A 1N7IA 2V4UA 5DCLA 1JQEA 4JDUA 3PIDA 3I58A 1W2HA 3VP8A 4XKJA 3ZE8A 3H2GA 4JX8A 1XMSA 4PHTA 1E3DA 1MX3A 2O05A 2OHJA 5AP9A 2ORED 1WJGA 3RK2D 5CLQA 4WOCA 1NTKG 4UEJA 1OHHA 3B5JA 4IMIB 3NCTA 5A7HA 1AXRA 5E6SA 3UC5A 2AR7A 2XJ4A 5JCOC 4EX6A 2QMZA 4M49A 4AX4A 1R88A 2ZRHA 3EW9A 4OUDA 4I36A 3PQ8A 1C30A 1WVIA 3OX4A 1P5FA 1APBA 4GI7A 3SZMA 3W2FA 3KOOA 3IVRA 3G0BA 5EXSA 3OKCA 4OHUA 4QUEA 4BVKA 1QFMA 1Q7CA 3V2PA 3M33A 4MRAA 4B4WA 1E8NA 1Q1AA 4MOWA 1CT9A 1KP2A 1OFGA 3QSYA 1O03A 3JQ7A 4JBYA 1U0GA 2UYQA 3CH4B 3QWBA 2H0QA 3Q5DA 2HX1A 1B76A 2HXYA 2AFIA 3ASUA 1XD8A 3S44A 4G0UA 3MTEA 2J85A 3UJCA 2QT9A 3AOGA 4YQYA 4FEAA 3KJQA 2CFRA 2BCEA 1QTQA 2QYTA 3SN6A 1MB2A 3DTTA 2J4DA 1T0JB 4IZHA 2GHIA 4IMJB 1L7OA 2GRJA 3BTVA 3LNCA 4KI7A 4NZOA 4TVSA 1XG5A 3EA5A 3UTDA 4IF4A 3N7AA 1ODIA 1KIFA 1KO8A 2AX4A 2D1QA 4IJ6A 4ML3A 2XKKA 2GZ1A 2DHRA 4JLNA 1AOXA 2M1ZA 4EPTA 2IU4A 1SCUA 3NYIA 2O6LA 1MNQA 2J4CA 5SZKB 3CW9A 1ZSNA 2HK9A 3GFQA 3KXLA 1EWYA 2FPXA 1OGYA 3O3OB 3BA6A 3KEOA 1KTIA 3D2LA 1M66A 3K9NA 3CLRC 4RVGA 4CUKA 2QV7A 3LDFA 3ISVA 5KINB 4JD5A 3PKJA 1K6EA 5F64A 4Y2QA 3HD7D 4NV0A 3GJYA 1AO0A 3TJZA 2IX3A 1Y9BA 4N3CA 5BSGA 4R7ZA 1G21E 1B73A 5EMHA 3SS7X 5C52B 1FU7A 3CMMA 2ZR9A 2OZVA 4UTZA 5DNWA 3AKYA 4PQEA 5E6RB 4RJTA 2C03A 4ZU3A 4JFRA 2Z3ZA 3CIFA 3LW7A 1ZV8A 3H5WA 5A4FS 2G40A 3UUGA 3FUUA 3CKLA 4IGAA 3AJEA 3GO4A 1U7XA 2HADA 4IYJA 3L8GA 4E7PA 3RTCA 3MRXA 1BWPA 4QDOA 3EXG1 4Q01A 4OPMA 4NBLA 2CXSA 3ST7A 1CR0A 5T64A 5K51A 2QZZA 1YR9A 2PL1A 1Y8QA 3OTHA 5FWYA 3RC3A 1AMNA 3IEKA 2IVZA 5AK0A 3BREA 1INLA 3CRRA 5JECA 2A57A 3EASA 4RF4A 1V45E 4UCQA 1E94E 1YB4A 4M83A 1ONSA 3FOZA 3SQLA 2Y1EA 5AVXB 3M6WA 2VK8A 1PNVA 4W80A 4QUGA 3FCXA 4ZU6X 3HI4A 3HN7A 5E4TA 1II8B 4OGFA 1OR8A 4X1YA 1ODSA 3TD2A 2C2MA 4WERA 4AN1A 1Q14A 2WYOA 2IXEA 4DIOA 3H11A 2BKLA 2BEKA 2HRZA 2H1OA 5FP0A 4D9EA 4YUZA 3GOQA 4G09A 2YOFA 3HEAA 2UVPA 3Q7PA 1AHNA 2DQ4A 5CM2Z 4UB6H 1EG7A 4Y18A 5DXAA 1Y3FE 4GP9A 1DCMA 3KPJA 1W30A 2QTTA 2OQ2A 2JLXA 4G0QA 1Y3IA 1E9RA 1AVYA 2Y6VA 5JE8A 2HY7A 3S1LA 4RGVA 1IHYA 3O1LA 1G8PA 3JZDA 5MFPA 3FIJA 3O21A 1PTKA 4Q4HB 1EGAA 3H2IA 3DV0B 5BQOA 2QDXA 5CM8B 2G04A 1P0FA 2CXTA 4AX8A 3ACDA 3AFGA 3DHVA 3WLJA 2POCA 3X1WA 2QOEA 3FVQA 3S55A 2EATA 1W4LA 4PICA 2Z8YM 2XMZA 3DBLA 4AJNA 1PYGA 1O96B 1A9PA 4Q9JA 2GN0A 2PZLA 1PT5A 2R60A 2XTZA 4FFWA 1VJRA 2WJZB 4CN8A 1ZMBA 4GBED 5F9MA 2VNHA 4AWBA 4CV2A 1YRAA 2HFJA 3DO6A 2ZP1A 2W83A 1DKUA 4JSTA 1PI3A 1RYFA 1K2VN 1OYWA 1YQTA 4H17A 2HQOA 4UDNA 1ECJA 1WSWA 4IFMA 4D43A 4EDFA 1CJSA 3U31A 4ERNA 5KC9A 1U3UA 4FXPA 5BSEA 2A45G 4XD7D 3TKLA 1A02J 4MV9A 2AOTA 2J5QA 4CFZA 2KBEA 3QKTA 4MRRA 3ZR4B 4GM0A 3KYBA 3B20A 2CUNA 5FLXA 4HGYA 4RBNA 4MGKR 2W90A 3U1VA 4WBAA 1PYOA 3G8AA 1FUYB 2OENG 2RDMA 1Z22A 2BASA 2D2VA 1RBMA 4MVJH 2RGCA 5FBZA 3WIOA 1ARZA 2VS1A 4PX2A 3RW9A 1PZQA 4PLGA 3WRYA 4KP7A 2GO1A 2J48A 3E81A 1CUEA 4IG9A 2FCRA 2WU0A 4B85A 1R5LA 4D9JA 2CLCX 3URKA 3UK7A 1KPGA 4HV4A 4NCJA 2WHXA 4TVKA 2CHGA 3KXKA 2R5BA 1P4AA 4Y7CA 1BCCJ 5ILQA 4QDZA 1ECLA 1HE8B 1KOFA 2XDYA 2ZSIA 4JJKA 2NOGA 4QZVA 4NPAA 2JHCA 2YOGA 3LOUA 2YJ3A 4ZOAA 3SHWA 4BBAA 2HMAA 5C7YA 4EJMA 1DG3A 2YN4A 4EG0A 3Q40A 2VUHB 4HWGA 4QBFA 5DHRA 3IMEA 1YIDA 2BLNA 5F76A 3PWKA 2FSPA 5DGXA 4M8KA 2WPRA 1NC1A 1RRPA 1JFLA 4BLVA 3I64A 1QS0B 1MP0A 2C2ZA 5KWVA 3RGGA 2P5YA 3A32A 2FWNA 5A6SA 4I55A 3BS4A 2CLHB 2X0IA 3BB3A 5LKAA 1YR8A 3F1KA 2V0GA 4QEZA 5T6BA 3R7AA 1YB6A 2VWPA 4BKMA 4IOMA 2IWRA 2PLAA 1NQVA 1IFNA 1IU9A 2QVXX 1E4VA 4B3SB 3I23A 1X7WB 2CLEB 1SQBE 4GMGA 2HYDA 1XA4A 4JLMA 4OREX 4G07A 3SSNA 3D81A 4ZYVA 4MUKA 2BN4A 2V6IA 2DUWA 4OYLA 3KKMA 4TMTA 4HVLA 1SQPE 5ITSA 5BR4A 2IZOA 5BV2P 2QN3A 4EYGA 1IUPA 3ICCA 2A5JA 2Z2YA 2BGGA 5TY0A 1U3WA 1JU3A 2G9UA 2HIMA 1CQWA 5IJ9B 3MK31 1KB9H 1XEXB 3T34A 5CPFA 4H7FA 5BU8B 1RWNA 2WHPB 2XUFA 2HA4A 3ZNNA 1AMOA 3K1AB 4QG7A 4DNXA 2FEAA 4FYXA 1AH2A 4BAGA 5B30A 4BO8A 1J1UA 5AKEA 1ZGCA 4HFJA 4J0EA 1IZNB 1Z68A 2GPBA 1CC1S 3F8TA 4KSCA 2W58A 3K9HA 5KHAA 4ZAXA 4CI0B 3N2KA 2W6OA 2L17A 4D6XA 4C2UA 1NUTA 4ZO7A 2KIKA 3F9RA 4PCLA 1FS5A 4IL6X 5APSA 2NU8B 3U3XA 5AICA 1SVNA 4CIXA 2G06A 3FZYA 3ZU5A 3ITDA 4MQLA 3TIXB 2PL9A 2VP4A 3FCOA 4YMSA 1H93A 1UK6A 3HLYA 3O8RA 4KAFA 3A9RA 4EHLA 2QVLA 4G5SA 1SCKA 4OQ4A 3M5DA 3TSAA 4D99A 4Y2UA 3ZJ5A 5JRDS 1AQYA 1WCV1 2CD7A 4F46A 4YFVA 4DCVA 3IUPA 3TSCA 5DLYA 5LZ7A 3QVXA 4IDOA 3NHZA 3OLYA 1ZD4A 1XZNA 2NP6A 2H5IA 5TISE 1YH3A 3OZ7A 2J67A 4U0KA 5JD6A 2YS7A 5D00A 3RK3D 2G3YA 4R2MA 1C7ZA 4LV5B 5DO9A 3N0XA 2F8MA 1UMKA 1BOOA 3F67A 4PG8A 4CKWB 4N8EA 4MP6A 1X2BA 5IT9A 1XYVA 4ZK6A 1L4FA 1YF3A 3CBQA 2WFZA 1GUDA 1WZIA 4D8VA 3MWEB 3BPSA 5TLSA 3RS9A 4HGQA 3G0HA 1QUFA 2XUJA 3QI7A 2MJLA 1Z06A 3T38A 5BW8A 5DEIA 2VJQA 1SQBJ 3I62A 4A5OA 4XRRA 2Z4TA 3ZHCA 5ECYA 5CTAA 4IHJA 4U7WA 5FJIA 4ZYZA 5DIZA 1Q90D 1SQPJ 3PQ5A 3KBBA 4F9FA 3G6WA 1H94A 1QANA 3IAAA 2P69A 2AXTH 2X77A 1PRYA 4W5WA 3NDJA 2ADFA 1PQUA 2NIPA 1JF8A 2D3WA 4B7AA 3IN6A 1LDYA 1NUQA 3NKLA 2FVYA 2OILA 5JASA 4KL8S 4M9ZA 4P84A 4TMXA 1USUA 5BPFA 3PR1A 1XLTC 4X20B 3IOMA 1JFVA 5BN3A 3MINA 3BTSA 5IT5A 3B2NA 1SOUA 2XYQA 1KB9D 2X9NA 4BFXA 2CWWA 2ECFA 1IJDB 1RIIA 4ZCIA 3B78A 1E99A 5TXGA 1AQIA 1OW6A 3K3PA 1QYCA 3ZBTA 1ZXBA 5HS4A 2HA2A 1HNWB 1BS9A 3DOJA 5F5NA 2ZPTX 2IFNA 5EMMA 2CN1A 1EZVD 2B1GA 3FCEA 4HB4A 3B48A 2VUSA 3W5CA 2FWJA 3EFGA 3EUAA 5T57A 1R2QA 1BYIA 4BASA 4G23A 3HEBA 4JOCA 4PTZA 4GDFA 2ZUEA 1ZK0A 1IVSA 3A0BH 1SN7A 2R0QC 2EHJA 3Q5PA 2D7CA 4JVSB 2OG1A 3W0LB 1UXKA 4QAJA 1HE5A 3QEOA 3P0FA 4EHNA 5AXBA 5AH0A 3RM3A 2WT4A 1S5LX 2L42A 2R79A 5BORA 3T9FA 4J0CA 3NTRA 4RVOA 1PJ3A 1HKHA 3CTVA 4EB6A 1PLJA 2D5AA 3QUSA 4DG9A 2AI1A 4BQFA 3NGMA 3E1GA 3PEWA 4H4DA 1V9LA 3L35A 2ARKA 4EPWA 1JWAB 3V1YA 4W4TA 1GFIA 3CZPA 3R5JA 3CWBE 3W68A 4KREA 2QZ4A 1C8KA 3C6KA 2VAPA 4EG4A 1RF1A 4YAOA 4EG6A 2F67A 5IDYA 3V4RA 1E3IA 5LR6A 3EDYA 2KJQA 3HB0A 5H02A 1UOOA 3KP1A 2O3TA 1NTMK 3AI1A 1GZHB 2P4UA 3OZXA 2CVHA 1KQGB 3ES9A 2HDOA 3HKDB 1W34A 2GAOA 4JP1A 5TX7A 2GUSA 3JD1A 3WWOA 3V1UA 5FQOA 2XGJA 5DP1A 1KBZA 1NQ5A 3FNRA 3CF6R 2JDIA 1X8KA 2CF5A 5A02A 4CMEA 1T5BA 3VR5H 2ODWA 4O33A 4JVLA 5CDFE 3WGZA 2F43A 3NP9A 3WOVA 1SCQA 4OB8A 2VDJA 4CG2A 2A94A 3CPEA 2OLJA 3DDUA 2CCJA 4MI6A 1M8FA 5D51S 2I7CA 4DRYA 3S4RA 4ODIA 3EVZA 4YV1A 2XDAA 1NVVR 1E2LA 3HXTA 3LAWA 2J31A 1OCEA 4TM8A 1PGJA 3AV0B 3MAGA 1XGKA 5JAIA 4IL5A 1L5OA 1UBUS 5ELLA 5TT1A 5CG1A 2FQYA 2OXCA 2LKCA 2H65A 3HBMA 1EP1B 2FSSA 4ZKUA 2MSLA 4M0FA 3ZDRA 2GLXA 2AJ8A 4IHJF 3ULKA 4HXEB 1OYOA 5IDQA 3DD1A 3B6JA 4FP9A 1QIFA 1KO1A 1RJDA 2IEBA 4ARIA 3A58B 3A4VA 4EGAA 4DA0A 5K6AA 5GPBA 3KSDO 2WUFA 1Q1EA 2WI8A 3OOHA 3CCUP 3RQSA 1HLPA 4AUNA 2FPKA 4LNHA 1XTGB 4HH3C 1VC2A 4XCQA 1RM4A 1S96A 3HTKB 4H6VA 3KZVA 8ATCA 3TW8B 1L5ZA 2FN9A 3S1AB 2IHBA 4LXHA 1O9BA 1QX8A 2SECE 3ZVLA 4U9HS 3CCEP 2QRLA 1K7CA 3E58A 2NUAB 2JAHA 5B1EA 4XA8A 3IALA 2BMJA 5FWXA 5K0FA 3BRWD 5ILGA 2CJFA 3I6QA 3M6LA 5HTOA 1K8QA 1QX3A 4F4CA 4YRCA 4JOSA 1PWHA 5IM4F 1J1EC 1J00A 1PFKA 4HKTA 4PNZA 3SR3A 2X13A 1WQ1R 2AOWA 1ZH8A 1T9DA 2Y9YA 1EJBA 2P8SA 5AVSB 3IO3A 4CL3A 1LK7A 2RJ3A 3PDJA 4B7UA 4C4XA 4JA2A 3UMBA 1U9IA 3BGIA 4YRNA 3LGXA 3TQIA 2DFVA 4F45A 1KAQA 1R5OA 4BGIA 2EFHB 4F56A 3RVQA 5TJHA 4U2KA 4B0OA 1FS0E 1Q92A 4PPGA 2CK3D 2FPOA 1TCCA 1G4UR 4CMBA 2OTLP 5EKSA 1VHJA 3JC22 5FD8A 5KOJB 3PHJA 1FZCB 3GZJA 3H9QA 3OG9A 3WLMA 4H7DA 1IUOA 3QWFA 3FYTA 3AR3A 2KI5A 2VSNA 5T8KA 3LQ1A 5CEEA 3DDCA 4ZVQA 1RQ2A 4ZAFA 2BF7A 5KOHA 2O0KA 3VR5D 5K8UA 4AP9A 1BHJA 1FFSA 3WWDA 2H18A 5FI3A 1P2BA 3KPYA 1C3EA 3RRYA 1YAJA 4RMNA 3HUSB 1QCZA 1A82A 2A9OA 5CH8A 3RYTC 5A3JA 4BKRA 1W88A 4RH1A 1Z13A 3JX9A 1TW3A 5ALSA 3OLWA 1ODKA 3Q9LA 1X1DA 1CUWA 3EJ6A 5CAEB 1JJFA 1O87A 3SS8A 3MJVA 2DCUA 4Z0PA 1SXJB 3U4IA 4QGBA 4BQIA 3JALB 4RSMA 3A28A 3D3KA 4M54A 4MSUA 4NYIQ 3E0QA 3P9ZA 2K4MA 2RGNA 2IY8A 2NUPB 3U5TA 1G7RA 2K87A 1YIOA 1QZUA 3LPDA 4BB0A 5JYBA 1I51A 1ULAA 3IQZA 3VKFA 1OWMA 3AE3C 4OHVA 3AG6A 1DG1G 2QX8A 4Z1MH 4ZAGA 3HV2A 1DARA 2BOVA 5I7VA 4V0OA 3CJQA 2W2LD 4QT0A 1Q95A 1IN8A 3KZIE 4ITUA 4B4VA 4V0MA 2P2YA 1NXPA 4CTOA 1RRMA 4WXPA 4UPVA 5HF6A 5CVVA 3IMKA 3WMGA 3A5TA 4WINA 4W5OA 3ADOA 1LNSA 3RC8A 4B6OA 3PSAA 4PLCA 3JD4A 2OV8A 2O5RA 3Q6NA 3WGUA 1R6XA 4DCKA 2J0EA 2DKFA 721PA 3HGQA 3RS8A 1UPBA 1KMQA 3CWQA 1EAMA 4F9GA 2R5WA 2R7KA 4YROA 2PJRA 3GR6A 2B8WA 4P0TA 1WUKS 3G2PA 4K26A 1RTTA 2Y9MB 4R1MA 3OQ6A 4CFYA 4KDEA 1AKUA 1XXHE 4BV9A 5FADA 2NTNA 3AKDA 4WUTA 3KLPX 2NVWA 4PCVA 5AW8A 3P5BA 2YMQA 2JFPA 3QHAA 1I1NA 2NPSC 3JPYA 1XAIA 1JIQA 1FZGA 5BR1A 1DXHA 1SVOA 4QRIA 1ZL0A 1FFEA 4IW3B 4RKRA 1EBBA 4LFAB 2P1JA 5JRZA 3OQIA 1PNOA 1H0KA 1QEXA 3G2KA 4MJ3A 2VDRB 3BQ9A 1CUFA 3RYCB 2JLUA 4DT1B 1SXIA 3UYKA 1A9SA 3UJAA 2WPDD 2Y77A 2DFTA 3IE2A 2HNBA 1MX5A 2VKQA 1GTJ1 2Q49A 2XNHA 1B6GA 1TLFA 5AVZA 1UBJS 2E89A 3JQAA 3ZQ6A 5HX7A 3DMRA 4B32A 3L70E 4BFUA 4UNIA 4WFIA 3AIKA 3TS1A 4R69A 3L18A 5K45A 2GCOA 1FVHA 4CZ2A 1N2JA 1H89A 3A25A 2O57A 3EGDB 4AB1A 3ABOB 1GCAA 4M36A 4HWSA 5CBNA 2IYFA 1DAIA 3NBZC 5AOBA 3PYXA 3LT4A 3FFAA 3H1AA 4RVFA 1XAJA 1JLLB 1YBFA 2LD4A 4MKRA 3T5MA 4N03A 4BO9A 3FYUA 4PXYA 1SFCB 2VK1A 3IR6A 2YWFA 3OZRA 1BEZA 4MQMA 2E87A 2IITA 1L2TA 1C4KA 5FLYA 1ULHA 3HDVA 1KC1A 3CX5H 3N58A 4GR9A 3EFBA 3R7FA 2AK2A 2FRDA 1YR2A 3TZHA 3QOYA 4KBGA 2C4KA 2OQIA 4BNHA 3QX8A 1Y48E 4XSHA 1CG6A 4ILKA 4POAA 4DF3A 1ESNA 3NUGA 4Q0MA 2VG8A 4LX8A 2C57A 3A2AA 1NU8A 4Y2GA 1KSJA 4ER3A 1ZM4A 2XVZA 2PMDA 2W6JA 2FE4A 1L2PA 5G3ZA 3EEYA 4GH5A 4PLHA 4HL6A 4JC4A 5D86A 3KBOA 3T7KA 1OB5A 3L0IB 1WB4A 4DMHA 1T3GA 3GUCA 2FFDB 2TMDA 3DTYA 3NHFA 1W4AA 4O2AB 2IBZG 1Y1LA 5ESDA 1LTTC 2RAPA 5KNCD 3G68A 3AE4C 3IIMA 4F72A 1FDTA 1TTHA 5FORA 2I1QA 5FPKA 4CM6A 2ZDQA 4AUWA 2YS6A 1Z73A 3N7TA 1URQB 1AQ5A 1ZW1A 3GEBA 4C7XA 3PXDA 4YA6A 3KLNA 2GFHA 4GO1A 3VC2A 5MGNA 3CT6A 2VTEA 2Y71A 4HWPA 3ZZ0A 1XTTA 3PVZA 2WSCH 3B7PA 5BQXA 1F9AA 4CM1A 3MN1A 4M8LA 4URYR 3TYXA 2Q3HA 1RMQA 2J5RA 2ZYAA 2HBYA 3SDBA 2HHJA 5ED0A 2JIPA 4PSCA 5AW2B 4JB8A 1A9QA 3LZCA 1R0WA 1IM5A 1G4AE 4LG1A 3FBGA 3ICPA 4GVXA 4F12A 3ROEA 4N4AA 3NOQA 5CJPA 4WGFA 2GMWA 5A06A 3L70J 1G1AA 3A3KA 4NPFX 4E03A 2V8OA 3GRRA 4U6NA 1GV0A 1XF1A 2OXRA 3PLAE 4XWOA 2ZJ7A 3VBEA 3JW8A 2BFNA 3K16A 1RJGA 2E74B 3KJFA 1OFTA 1EFRA 3NHMA 3RAJA 1T4DA 4EOTA 1P7WA 3G88A 4JZYA 5BUCA 5KSWB 4FYKA 4AJEA 4B44A 4URFA 4K8RB 1XZBA 4JUAA 1OXKB 4IKEA 2QTHA 4PN3A 1P6UA 4BNKA 3U4GA 3MB8A 1QG4A 1IVNA 1EWRA 3HM9A 5ER6A 2FYZA 4YUWA 1Z83A 4QOIA 3NHKA 3HEMA 5IHXA 3P19A 3M6XA 4DJTA 3ZDDA 1RF0C 4QBKA 3OCXA 4LF8B 3GVHA 2QS9A 4EIWA 1NYRA 1I5OA 1PT7A 3FCAA 3TDKA 3E3LA 3S5UA 4I50F 3F4LA 1ZX1A 3GLHB 2Z58A 1TW2A 4HB1A 5GWXA 2BMAA 2QLNA 2W6ZA 3FRJA 3UOGA 4DDUA 4UBIA 1KL7A 5IYZF 1CYDA 3ZZTA 2JFWA 3WK7A 1W35A 3VPXA 1VQ6P 4W6QA 2GETA 3MA0A 1X80A 1SY7A 4HDSB 4RV9A 4CCWA 3CZ4A 5J43A 1FVOA 4ESEA 1W36B 5HWSA 1JU4A 3LWDA 2CEAA 3K9GA 2YTZA 4N9QA 5F2KA 1KJNA 3PZRA 4D4IA 5EJ2A 1B42A 3LQQA 5LB2A 4JQOA 3HZRA 4WDRA 1A8HA 4FYMA 3GFOA 1PEYA 3BCCD 3OY2A 5F5XA 4C0XA 3OMLA 4NY1A 7ADHA 3GRZA 1XO1A 5I7EA 1ZMOA 3KQLA 3KE8A 2G09A 2QAIA 3D2CA 2ESRA 3WG9A 1XA3A 2PUAA 2EOAA 4C29A 1M6VA 5FUWA 3TQQA 1WV1A 4OFBA 5FNVB 2XWQA 4MYSA 4EF6A 2XRMA 4L0DA 3WL4A 1LD3A 1DJNA 3QEBZ 5IF9A 1PT8A 5EGSA 3EIXA 2QD4A 4M22A 2OYCA 2PRKA 1ZGJA 4PC3A 1UBFA 3S2UA