2JKVA

Structure of human phosphogluconate dehydrogenase in complex with nadph at 2.53a
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
482
structure length
482
Chain Sequence
b'AQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Structure of Human Phosphogluconate Dehydrogenase in Complex with Nadph at 2.53A
rcsb
total genus 182
structure length 482
sequence length 482
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2jkvA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2jkvA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2jkvA01
2XF8A 3PDJA 3D3EA 4FB5A 2FN7A 1H6DA 2YV3A 4M54A 3ROMA 4UVDA 3H7AA 4OOEA 2D59A 1O6ZA 3JQDA 4QT0A 2Y68A 3TZQA 4RO0A 4BMVA 4R3NA 3BTUA 3WFIA 3I3OA 2AA3A 3ZZNA 2Q1WA 4F46A 1YB5A 3PGXA 4UVHA 3RBXA 3MEQA 4J9VA 3RWBA 4BV8A 2UUOA 4S1VA 4YQYA 4OJNA 5BSEA 1U8FO 5ILGA 1NQTA 3E48A 2X0RA 3AOGA 1Z45A 3WYBA 4FJ0A 1PWZA 2FR0A 4DBVO 1TXGA 4CLRB 4U5QA 3DBLA 1LQUA 1A7KA 3I6QA 1Q1NA 1RKXA 1B7GO 4K26A 2QZ9A 5JNLA 5K0ZA 2HQ1A 2Y1DA 3V1YA 1YDEA 1KERA 4RVGA 1YONA 3MJ4A 5L4LA 1BGVA 2Z5LA 2GDZA 3DZFA 1HSOA 3RKUA 1PQWA 2WD8A 3CXRA 1N5DA 2PKQP 1YBAA 3VPFA 5COQA 1KS9A 1ZFNA 4ALMA 4BIIA 2GRAA 3WSWA 3ZHXA 1RM3A 1JDJA 5KWEA 4MKXA 1JTVA 2A9FA 5L4SA 4XRRA 2J8ZA 1PJ4A 3QQPA 4FDAA 3UCFA 1ISGA 1EFLA 1GQYA 3F1LA 2IRWA 3ZW9A 1I10A 1MXHA 4IJKA 3ZI0A 1DLIA 1FDWA 1GQ2A 4TMFA 2AEMA 2ET6A 1NPTO 3HDYA 3ZNNA 3W6UA 3JQCA 4FGSA 4DPLA 5FI5A 4ESOA 3DBHA 3A4VA 2Q2QA 4BNFA 4NK4A 4BGUA 1YKFA 1YDWA 4CLOA 3HN7A 5FI3A 1V6AA 1C1XA 2D3TA 5KJ1A 4W9NC 4YYZA 1HWYA 3WQSB 4OXYA 5JAIA 3NT4A 4NFYA 4HBGA 3ZN2A 2V6MA 4NJMA 2OGUA 2Y1CA 1DJQA 2FR1A 1ADGA 3U9LA 1OX3A 4U0JA 4IIVA 4WCFA 4RQUA 2Q3EA 5T57A 3U09A 1IOLA 5HWSA 4XGNA 1J4AA 3OQBA 3ZNPA 3VTFA 3VVCA 3WIEA 4XZ3A 3HADA 1BMDA 4RZHA 1QYVA 3K92A 3VOSA 3ENKA 1HDGO 5H82A 3AUUA 4L4RA 3WGHA 5L95A 3I6IA 4EJ0A 3OP4A 5KJCA 1D1SA 4XJSA 5TC4A 4AJEA 2EKLA 3NRCA 3GGPA 5JDIA 1ISHA 3GN2A 3PHIA 2GGSA 2GZ3A 4ZQHA 2H5LA 3NTOA 1O89A 2GSDA 3CTMA 5I9LA 2UAGA 4IQ8A 3DBLB 2P9EA 3KLPX 1T1SA 4LW8A 1M67A 1GFSA 1HE5A 3DMTA 1ZBQA 1N92A 5AVOA 2X4GA 1LRJA 5FYDA 5JSFA 4TRNA 1YJ8A 2OFPA 1LDNA 5IJZA 3GN1A 4R4JA 4J7CA 2P4QA 2VCYA 2OMEA 1NVGA 2J3KA 3KSUA 3ROKA 2C07A 4ND2A 2GN4A 4A26A 1K6IA 3FWNA 1WDLA 4MVJH 4D41A 3TNLA 4YAKA 5MGBA 1TA4A 5IN5A 1ZXLA 4J16A 2DBRA 1NXQA 4Y6PA 1P1KA 3CZRA 4GI2A 4NJMB 1NQOA 3AFMA 3E8XA 1CIVA 3OETA 3ETGA 3UCEA 5LC1A 4MINA 2A92A 3DHNA 4E0BA 1YQGA 1LSOA 3X2EA 1DXYA 2G0TA 5CDUA 1PJTA 1YBMA 1P31A 1KEVA 2D8AA 4UUPA 4I9UA 2X5JO 4F6LA 5TGDA 5CDGA 3FPCA 4CL3A 3ONEA 4YJFB 4ZQEA 1F0YA 2G1UA 4E2ZA 4OHUA 4BNWA 2CSUA 1UP7A 2V6BA 3A9WA 4A7PA 4TQGA 2C5AA 2JFHA 4BGIA 3R3SA 5IXSA 4IY1A 3C7AA 2G76A 2LDBA 3EDMA 1YXMA 1LC3A 3CE6A 3I9MA 1NBOA 3L6OO 1E3LA 2CD9A 2H6EA 4AJ4A 1CQIA 1QV6A 3EHEA 1PU2A 1MUUA 2CVQA 3DTTA 5JS6A 2Y67A 4FJ1A 1R16A 3WB9A 2C29D 2WMDA 3ZU2A 3PVZA 1MB4A 2R00A 2NU6A 4RCVA 4GSLA 1VC2A 3HFSA 1HKUA 1WPQA 4RF3A 3TL3A 3I83A 3GZ4A 5AXCA 1F14A 3OHSX 4ZA2A 1SO8A 3TRIA 2A94A 2X0IA 4FBGA 2P5UA 3KO8A 2YDXA 5J23A 4M55A 1B16A 4ALNA 2QRJA 1Q7CA 4NFSA 1HT0A 2GO1A 1R0KA 1U2GA 4OAQA 3LLSA 4RORA 3P2YA 3PYXA 4GBJA 3DB2A 4G5HA 4W9NA 1HEUA 4AJIA 1IPFA 3UOGA 4UUMA 4F3YA 3F4BA 3L4SO 1SPXA 3BHJA 4WPGA 5HM8A 1IZ9A 2ZQYA 3O9ZA 4IDFA 3WGZA 5TRTA 4PLHA 5EESA 4GX0A 2G82A 5U4QA 4D3FA 4FCCA 2ZKLA 4P4LA 2AW5A 5GZ6A 1OMOA 1JKIA 2B0JA 1SEVA 1UDBA 4OL9A 3M1LA 4J6FA 5JBIA 2X9GA 1LLDA 2YFQA 4FGWA 4CV3A 1H9AA 1GY8A 3TJRA 3R1IA 4BNJA 3GVPA 3WNQA 1E7YA 1Y1PA 4GWGA 3BYZA 3TZHA 3UXYA 5JY1A 5JC8A 4PCVA 1RYDA 3BMNA 3TFQA 1X15A 2EJVA 2QZZA 3FNGA 3OM9A 4GVXA 3KB6A 1SBYA 3GMSA 4ZQFA 4EUHA 5JMWA 1VJTA 4YWJA 3S2FA 3QV1A 3FF4A 4YB8A 5BT9A 1KC3A 4J49A 4CQMB 1A9YA 4EEXA 5JAZA 1NM5A 1UXIA 2DBVO 5G0SA 2I5PO 3GRKA 1CDOA 3DWFA 3ZH2A 3PRJA 5KVCA 4CM5A 3UCXA 2Q1TA 3E6AA 3E9QA 2HU2A 3RC9A 3LVFO 1CRWG 1U7TA 3BXXA 3JQ8B 1DIAA 4NR0A 2WYVA 3SVTA 4Z9XA 3WMXA 2VT2A 3ORFA 4UUNA 5TX7A 3PHLA 2YHUA 4YJHB 4HY3A 4KWIA 3G0OA 2AXQA 4AJOA 4LCJA 3GVIA 3CMMA 3IKVA 5IN4A 3O03A 5EMHA 3IP3A 3GA0A 5BSGA 4OM8A 2HK7A 4E31A 1XR3A 2DC1A 4Y8VA 2H9IA 3GT0A 4OKNA 2C7VA 1NFRA 4PG4A 4DQXA 1SB9A 3BMCA 4CR7A 1EMDA 1NFFA 3UAGA 1MC5A 4J9UE 4RLSA 3F4LA 3Q9NA 4FFOA 1ZO8A 4E2YA 4L9RA 4NNJA 3UF0A 4ITUA 4CMKA 2EKQA 2PGLA 5DCUA 4NJOA 1PL8A 3GMDA 4Z3KA 4MVJP 1E3EA 5BNTA 4YDRA 1JAXA 1FDSA 4GSKA 4KQWA 4Y6RA 3PLNA 4L4XA 4WLOA 3G79A 2D4AA 5JO0A 2PZJA 2PNFA 3K30A 1SB8A 3DDNA 4MKZA 2FSVA 4DC0A 1LEHA 4JIGA 1PS8A 3D4NA 5JO9A 4CV2A 4IM7A 3BMNB 4ONEA 3U49A 3MZ0A 4TKMA 3LSYA 4KWHA 2FOIA 4B7CA 1IPEA 4EUFA 4J90A 5JC1A 1EFKA 4NBWA 4ZICA 5BQFA 2ZJ1A 1IYZA 1HDXA 4WCFC 5C3MA 1QRRA 2J5RA 2D5AA 4YR9A 3JSAA 2GCGA 3DFZA 3ZV5A 2B4TO 3FR8A 3VKVA 1K2WA 3GUYA 3PLRA 1IL0A 4KUEA 3HG7A 1T1RA 4DQVA 3RUHA 1X13A 2I3GA 1UAYA 4PRKA 4BQPA 2O3SA 1N9GA 1GPDG 4R1SA 4WCDA 3T4EA 2OUIA 2W4QA 3Q0EA 1BG6A 4JJGA 3LF1A 1DIBA 5IXYA 4A0SA 4IXTA 1DLJA 9LDBA 5JLAA 2F00A 5TJHA 3AFNA 4YT4A 1BXKA 2HJRA 1HYHA 2DPGA 4IZIA 1CETA 2QX7A 1QV7A 1YH3A 4JBGA 3LT0A 2CF5A 2DBZA 1EEHA 3U4CA 1T24A 2Q99A 2DUUA 3VPSA 4BNKA 2NM0A 2X86A 2PD6A 3PIDA 1A5ZA 4GMGA 4OOFA 1ZXBA 1WDKA 4EI2A 4CM4A 1B15A 1KC1A 3L9XA 1PS9A 4HFRA 3DOJA 3V1TC 4O0LA 3LZ6A 4BNUA 4MKRA 2OO5A 2RCYA 1R37A 2IZ1A 1Z7BA 2VHZA 3H5RA 1SAYA 3H9UA 4I5EA 4ZD6A 3S2EA 2Y93A 3M6IA 3FRJA 2PGDA 1FDUA 4RVHA 1GYPA 2QRLA 1AXGA 1DRWA 2VT3A 2EEZA 1ZMOA 5JAMA 1ZK2A 1K89A 4Y98A 1HDYA 4E5MA 4BS9A 2OHXA 3QWFA 3VDQA 4D43A 3DBRA 2FRDA 2YV2A 3ANLA 2OZPA 3INGA 1M2WA 2Y1FA 4E13A 1UXGA 5A1TA 4WLNA 3W1VA 4BNLA 4RVFA 1NAYA 3P7MA 4ALJA 3W6ZA 1U2DA 1R0SA 4KP7A 2EWMA 5ENDA 1V3UA 4UEOA 2AE2A 4BQRA 5B4TA 1H94A 1W73A 4MO2A 8LDHA 1PQPA 2WSBA 3ROQA 1NFQA 5G0VA 1YB4A 4I5FA 3RJ9A 1VLLA 5A3JA 2UVDA 2BFAA 2VNSA 3K73O 4N18A 1YS4A 1U7HA 3I9JA 2O7QA 4E33A 4WNCA 1GZ6A 2RIRA 3C3XA 2FR8A 5B4UA 3WIDA 1YJQA 1VPDA 5I8WA 5JDCA 4MVJG 2EG9A 3U62A 4MIYA 2D5CA 3WNVA 4R16A 3WQRA 4IGFA 4TRJA 3C7DB 1NWCA 3X2FA 2X23A 3DMTC 2WD7A 3FCOA 3DTYA 1NNUA 7MDHA 2POQX 3GAFA 3ZGYA 4CLEA 2W2LD 1M6WA 2PK3A 3NEPX 4CMEC 4AICA 1P74A 3SXPA 3UFXA 5L51A 1ZSVA 4AJ1A 3A06A 3ZWOA 5C37A 4I5DA 4CM7A 1Q0HA 4CR6A 3PJGA 2EGHA 5HA5A 5KJEA 4EYEA 1BW9B 3QW2A 3RFVA 3SJUA 3IS3A 4FOOA 2C54A 4XX0A 4PLTA 1Q7GA 3NAQA 4MP8A 3D3WB 4CMBA 3TF5A 1V8BA 1BRMA 1T2CA 3TDKA 1ZUD1 1KY5A 4E21A 5BNIA 3GGGA 1O5IA 4BKPA 4PG5A 1OFGA 2PH5A 2RH4A 3LC2O 2YV1A 3DBRB 4BL5A 1QYDA 3JD4A 4BNVA 1XU9A 3W4IA 2GERA 3H2SA 3MJEA 2RBEA 2ZJ0A 1ZW1A 4B3HA 4B3JA 4BGEA 4E2WA 1V0JA 3DAFA 5JFOA 3KZVA 1VKNA 1QYCA 4HADA 1JN0A 3OJFA 2B35A 3Q11A 4GPD1 4AJ2A 5CPFA 3OIDA 1DIGA 3VKUA 2VRBA 4YA6A 1FF9A 1C0LA 2VZ9A 1ENOA 4D0SA 3EVNA 4XRGA 2VWQA 3EZYA 3K96A 2VUUA 4PZEA 2NTVA 3BMQA 1ZSNA 2X9NA 3V5NA 4Y67A 2JL1A 2PD4A 2PFGA 3GAZA 3EMKA 3KV3O 4WASA 1ISJA 5F21A 5IDYA 3ZWVA 4EJ6A 3LT2A 3FNFA 4B7XA 8ADHA 1AXEA 3OA2A 4BB5A 2CDBA 4KOAA 3GVHA 1AHHA 1KVQA 1B14A 2IZZA 1EQ2A 4RVSA 3OEWA 4XYEA 4BNYA 3PZRA 1FDTA 2C2XA 1GYRA 1U8XX 1HYEA 4WOJA 3HN2A 2O2YA 3K2EA 1PQUA 4L73A 1AVYA 1B8PA 3FWZA 5TT1A 3RBZA 3KOUA 4FN4A 1U5AA 2BMAA 1L1FA 5ER6A 2CVZA 1YO6A 4NBRA 1O9BA 1P0CA 2J6IA 4OQZA 1XQ1A 3WGTA 3VH4A 4DC1A 1NP3A 4BKUA 1NR1A 2A4KA 5DP1A 1Z6ZA 3UHAA 4YTEA 1X0XA 5F5NA 3VVBA 4ILKA 2GD1O 1ONNA 4NFHA 1GTMA 4H16A 1UXJA 2AHRA 3ST7A 1B8UA 1YGYA 4JCOA 4QEDA 5MDHA 1YVEI 1P1IA 4EJMA 3RKRA 2HUNA 1V35A 4Q39A 4D0RA 4DPMA 4CUKA 4Q9NA 5I9MA 2VTDA 3F5QA 2Y66A 3PEFA 1UZMA 4NDNE 4UVEA 3NYWA 4DREA 1NQAO 3MTJA 4PG7A 5CFZA 1CQJA 4Y6SA 2AMFA 5F5LA 5CDTA 2D1YA 1ADFA 3PFWO 2GF2A 5IG2A 2EIHA 5U1PA 4HFMA 3GDFA 2YHIA 1DO8A 2EP5A 3QWAA 3HSKA 2ZCUA 4IDBA 3DZGA 2F1KA 1T2EA 3OJOA 1BHSA 1XEAA 2EW8A 3AM4A 4N5LA 4O59O 1X0VA 4GWKA 2RHRA 1EBUA 4HX5A 1E3JA 3PHHA 1MFPA 1ADBA 1HE2A 1HXHA 3EAGA 3M1AA 5A4DA 1RWBA 1T4DA 2UUPA 4N7RA 4MIEA 5T64A 3CTVA 3OJEA 5GZ1A 3JYOA 3OQ1A 3DO5A 1XKQA 3ENNA 4IINA 4U8GA 3ZWYA 2JFFA 5L40A 1IUKA 1XSEA 2AEFA 4MVJD 2X9VA 2C2YA 1E77A 3PI7A 3VPHA 3ZU4A 2O23A 1I2ZA 5EL0A 2X58A 2H1SA 3WMWA 2C82A 5KIAA 4BB6A 2CVOA 4JX8A 4JGBA 4GX1A 1ISMA 5LCXA 5C7IO 4WNIA 1LLUA 2YQ4A 1ZK0A 4ND5A 2YQ5A 3CIFA 1H93A 1I30A 1MG5A 3IUSA 3IAHA 3L0DA 4Z0TA 3UH1A 3TN7A 4A2CA 2NTJA 5A06A 4Z3DA 2NU9A 5L7WA 3Q2IA 1M6HA 3FD8A 2HJSA 2V6GA 1XHLA 2ZTLA 3GVCA 3I9LA 3WYEA 1AE1A 3UW3A 4IJUA 2WJPA 4ZGWA 1EE9A 1KIFA 3E5MA 4RF2A 4PLYA 1IULA 5L9AA 2Y0DA 2LDXA 3QP9A 1EUZA 3U4IA 3I4CA 4ID9A 4J2OA 3ZU3A 2BLLA 4IDAA 4JK3A 4FQ8A 1OOEA 3RC7A 1UZNA 3PJEA 1BVRA 2O3QA 4TKLA 5JYEA 3UICA 4MP6A 1HYGA 3QIVA 4HKTA 3GDOA 2NNLD 4ALIA 4E30A 3LK7A 4XCVA 4YXFA 3JQFA 4LISA 1DBVO 1WW8A 2O7SA 3RUCA 1BW9A 1HZJA 3KYCB 3BZUA 2AQKA 2EW2A 4L0QA 4XQGA 1P1JA 1L7DA 1C0PA 3RC2A 5I7EA 2YW9A 3RROA 3ZNOA 4BGVA 1YOVA 2Q45A 1UDCA 2GNAA 3AY3A 1GAEO 3CSDA 4FR5A 4NZ9A 1PZGA 4IIUA 4A10A 1T2FA 3I9NA 4BO6A 3BHMA 3QLJA 3WDSA 1PTJA 1MG0A 3LYLA 1SOVA 3WWZA 5ENVA 3JD2A 3WSVA 4MIOA 4CMIB 5DDIP 1HE4A 1WMAA 5A5EA 2HDHA 1T2DA 4U0KA 4M49A 3K8ZA 1S7CA 3ZV6A 2W8ZA 4D3DA 1MC4A 4IZHA 4BNHA 5DOZA 3KBOA 1L7EA 1W6UA 1N7HA 3VH2A 3KUXA 2Q2VA 2Y0EA 3BHIA 1ZNQO 1GUFA 3ZWAA 4BMSA 1SMKA 3WGYA 2PWZA 1PJLA 4XGKA 3DBHB 2UYYA 4KTTE 3VAZA 3K6JA 3P2OA 3RUAA 4OQYA 4EGFA 3O4RA 1F8FA 5IDWA 3RCBA 2CF6A 3FBGA 4YJFA 1MA0A 1GQQA 1AGNA 3LLVA 1PJ2A 3ONDA 4J0FA 1YRLA 3ITKA 1HETA 5JE8A 2DFVA 2EXXA 1OBFO 2O3TA 3NGXA 2EJWA 4UREA 3GNSA 1UDAA 3PPIA 5T6BA 1QORA 1RYEA 2W2KB 3OJ0A 2HMWA 3G3EA 2FY8A 3NTRA 1E6EA 1QP8A 5DZSA 1MGOA 4QUKA 2BKAA 3OQ6A 1EVYA 1ZEMA 1U4OA 4YPOA 4MPDA 3B70A 3RI3A 2IZ0A 3B20A 4Q3DA 1LLQA 1TT7A 2GZ1A 1WWKA 4AVYA 2AE1A 1LQTA 1T2AA 3PQEA 2W2LA 3QVOA 5JYDA 5A9RA 3G17A 1UP6A 2IXBA 4NHEA 3H2ZA 4DIFA 4OMUA 1BDMA 4R9RA 4YJDA 5T8KA 1D8AA 2QHXA 3WTBA 3GPIA 4FFMA 4II2A 5BSFA 3GEMA 3H9EO 1MX3A 4DYVA 1WAMA 4R51A 2FP4A 4R5HA 2B69A 4WE3A 2EGGA 1TT5A 2GYYA 4XIYA 4A27A 4L4SA 5F3RA 2Z1MA 3OBBA 4JP2A 4KUGA 2AQIA 1Z82A 4DPKA 2QYTA 3V2UA 5K6AA 4TROA 5DCYA 3T4XA 2CUKA 2JAPA 5IZCC 4CQLA 1P77A 1OI7A 3MJCA 1Y81A 2Q1SA 1D1TA 5BSHA 5I7FA 3GPDG 3KTDA 6LDHA 1NAHA 3TWOA 2W2KA 3H65A 3OEYA 1T25A 1X14A 3SEFA 4E32A 1P1FA 1ISFA 4ZJUA 4HNHA 3F3SA 1PJ3A 5H81A 4IJVA 3GFBA 1UR5A 4CQMD 1EVIA 4BKOA 4EW6A 4WJZA 3I4FA 2O48X 3AW9A 1FK8A 3TQHA 1GZ3A 1UH5A 5A02A 3GFGA 2UDPA 4E5PA 5DOVA 5BNFA 1A72A 2OORA 4XYLA 2VYNA 3JYPA 2IDZA 3KYDB 7ADHA 5DF1A 2DLDA 2TMGA 3H5NA 1F12A 3L6EA 4D79A 4KUHA 3AUTA 1KEPA 2I76A 3DFUA 1DOHA 5A9SA 1NPYA 1KOLA 3F5SA 4MDHA 5KVSA 3RD5A 4F45A 4DTIA 5L3ZA 3C7CB 3NT5A 1IHYA 4ALLA 4XKJA 1ADCA 1JWAB 3FR7A 1E7MA 2DM6A 2HRZA 1NHGA 3H6KA 4YEDA 2GASA 1XU7A 1C14A 4YAIA 2P68A 4W6ZA 4BMNA 4N5NA 3RJ5A 1B2LA 3QA9A 3V2HA 3ZDFA 3C1OA 1CWUA 3BMCB 1A71A 1LI4A 3BMOA 4M86A 1DJNA 5ER9A 3E03A 3KVOA 4CM1A 5G0TA 4HUJA 4C4OA 3ASVA 4W4TA 1PWXA 1DDOA 4NH4A 1P33A 1K6JA 4L75A 5CG2A 4DBZA 3C1AA 3C8MA 1CEQA 3D3WA 3LF2A 2YFHA 3TFOA 2D2IA 1XG5A 2E48A 4JBHA 4J2HA 4GAEA 1DPGA 3JYNA 4HNGA 2VRCD 2ILTA 1H6BA 4GLOA 3NT2A 4BO2A 4WUVA 1SNYA 2PTGA 4LRTB 4LVUA 4RPHA 4WGGA 2DTDA 2J3JA 3ZHYA 4BNMA 3ETEA 3VH3A 1EK5A 1P44A 1EBFA 2AG8A 2E4AA 4X54A 3ZHZA 1T26A 3JD3A 4CV1A 5HS6A 3DXFA 3NV9A 2HMTA 3LC7O 3C24A 4RZIA 4W99A 1XCBA 4CJXA 3GEDA 1H9BA 3K9QO 3IJRA 3JQ8A 5EQDA 4FC7A 1PGOA 2FZWA 3HB4X 4RVDA 4FSHA 3U4HA 3ZWCA 4CPDA 4P8RA 4J7XA 5IZCA 4FW8A 3P5SA 4PRLA 5KJ6A 3MJTA 3GGOA 4G81A 1ZK4A 4GL4A 1PSDA 1UJMA 2A35A 2PZLA 3KETA 3GHHA 2ZB7A 3QWIA 4A03A 3NJ4A 1NTOA 3JYQA 4DWVA 2JFGA 5CDSA 2WYWA 5G4KB 4DLBA 3SJ7A 1VL0A 3WG9A 5KVVA 2ZYGA 1LTHR 3FHLA 3G49A 1ISIA 3MWDB 4J1NA 5H83A 5IAAA 4I9NA 4DL9A 2VQ3A 3VC7A 2BD0A 4OKIA 4XDZA 3JD1A 2VHVA 4QFDA 2ZIZA 1BSVA 2WYUA 4IMRA 1QYXA 2IYPA 4DIOA 4ALKA 4BKRA 4BUCA 1R66A 3D5QA 4XYMA 5I7VA 2OBNA 1AN9A 1I3NA 4R69A 4PVCA 4N5MA 3PZBA 1KVUA 5G0WA 3HQ4O 3MTGA 4O63O 4IXWA 1DHRA 5C7OO 3IQDB 3AI2A 5DN9A 1B3RA 3UVEA 4RF4A 1EVJA 4LMRA 2B5WA 2PR2A 4DUPA 4YACA 1ZH8A 2IODA 4FPXA 3C1TA 1JKFA 3WOHA 4J4TA 5THKA 3GOHA 1PR3A 4GGOA 3WICA 3WTCA 3GDGA 4EUEA 1T4BA 1WZEA 1BTOA 1PL6A 2PH3A 3D4PA 4FFRA 3IMFA 5ITWA 4RPGA 1X7HA 1PEDA 1W0CA 4KTVE 2O2SA 1IE3A 4AFNA 4CLRA 4HV4A 3BTOA 4K28A 2J3HA 2YY7A 1WXDA 1NASA 2PLAA 2YYYA 3A14A 1WVGA 2H63A 5EPOA 5DBIA 4WCFB 1LDGA 2HSDA 5B1YA 1PJQA 3CKYA 4WLEA 3T7EA 4OSPA 1R15A 2FZEA 4G65A 5BR7A 3RFXA 1DSSG 1I8TA 1Q0LA 2Q1UA 5L7TA 3B1KA 2EKPA 3SLKA 1WLYA 2Q4EA 1H2BA 3G1TA 4IMPA 4RGBA 2OP1A 4RLHA 3JCZA 2J5QA 1K5HA 1Q7BA 5G4KA 1GR0A 1KBZA 1ZVMA 3JQ7A 2PD3A 5COAA 1SEPA 3ICPA 1HTBA 5JAQA 2P91A 2XXBA 2Y1GA 3FI9A 3GY0A 3T7CA 4XB2A 3DBVO 3ULKA 2Y0CA 4LMPA 1P1RA 3ZWWA 4IPTA 4R1NA 1J6UA 3D7LA 4R41A 4W7IA 1LUAA 5HBRA 3R0IA 3E1KA 3U0BA 2QQ5A 2VZ0A 5ADHA 1E7WA 1EK6A 4U6QA 3RUDA 4WEQA 1PL7A 3AWDA 1B8VA 3NTQA 4H15A 4CV0A 4IS2A 5TJ9A 3E5RA 2Q2WA 1RM0A 2EV9A 2CDAA 1HDZA 3H9QA 4Q3EA 1JU9A 5KVQA 3R6DA 3TZ6A 3HFGA 1Z74A 4BV9A 4HXYA 2I65A 2Q49A 1VL8A 4O5OA 3WBBA 1NVTA 4BO8A 2V6FA 3QWHA 5L53A 4GKVA 2ZB4A 4TSKA 4NBTA 3W4KA 4QO8A 5DP2A 3VPXA 4K6CA 1I01A 5DBGA 5JXWA 3RAJA 4AJLA 4NBVA 3DZIA 4C7JA 1HLDA 1QR6A 2E6UX 2OBYA 2FPPA 2P5YA 3FTNA 3HB5X 1KYQA 2NVUA 4Z6KA 1MV8A 3RBVA 3K2BA 3Q9UA 1HF3A 3RASA 4AL4A 1M75A 4JP3A 2VHYA 3HE3A 4I9HA 1DFIA 3JQAA 4CMHA 3GH3A 2E82A 2ZTVA 3H5AA 4DQUA 4CMGA 3U5TA 4B4OA 3KEOA 1W8DA 2EHDA 3OMLA 1XYGA 1FJHA 2PY6A 5CDYA 2OOSA 1O95A 2CNBA 4PIVA 1PS0A 1DAPA 1E1MA 4IDCA 4E5YA 3WFJA 1LA2A 1A4IA 1P0FA 3DL2A 5CHEA 1DHTA 4LK3A 3ADOA 2ZYAA 1DIHA 5JPIA 1I3LA 3H4VA 4YVFA 4DVJA 4L76A 4XQCA 4MVJA 4RV9A 1ZIDA 5JCJA 1Y8QB 5EJ2A 2VTEA 4FJ2A 5IZ4A 2QIOA 3NGLA 2GLXA 3WJAA 1WZIA 3GR6A 4CLHA 1ZCJA 3PYMA 1Q0QA 3KYDA 4NBUA 5TNXA 2HK8A 2JAHA 3FPLA 3WLFA 1J0XO 4IS3A 3BTSA 5A9TA 2X6TA 1H0KA 2I66A 4J7UA 4ZQGA 1Y9EA 4CUZA 5COBA 2YJZA 3GVXA 3ROPA 1NX6A 4CM8A 3VDRA 3GLQA 2YDYA 5GZ3A 1I2CA 4IQ0A 3PXXA 2JD2A 3QHAA 1C1XB 1O8CA 4PG6A 1D4FA 4RDHA 3S2GA 3KSZO 1TB4A 2QW8A 1J5PA 2SCUA 2P9CA 4CM3A 3LC1O 3MJSA 4I5GA 4FOSA 1DRUA 1E7SA 3ETDA 4FD3A 1K0UA 3WYCA 3PWZA 2XXJA 5IF3A 2BI7A 3Q1LA 2ZK7A 1X7DA 3RFTA 4CLXA 4BNNA 4INAA 4JNKA 5TQVA 1E5QA 2EP7A 2NUAA 2ZCVA 1LDEA 2OL4A 3JQBC 1B3BA 2Y1EA 5JMPA 3W8DA 3TZKA 3B6ZA 5DCWA 3GNTA 1PGPA 1BXGA 2QG4A 4OXNA 3I9KA 2NU7A 5AOVA 5JCXA 1VI2A 1TT5B 4OXKA 2R2GA 3GRPA 1E0DA 1D7OA 3ZU5A 4AJNA 3KLMX 1A9ZA 3GG9A 1I0ZA 1ML3A 3L77A 1ENYA 2AQ8A 4NI5A 2CMDA 1PGNA 1VJ1A 2VZ8A 3KYCA 3V8BA 1OC4A 2I99A 3SX2A 3ZW8A 1AUPA 2NVUB 4ND1A 5LDHA 1H2HA 1ZK3A 3ITDA 3WLEA 1GADO 1KETA 4GX5A 5GY7A 4MOWA 1BVUA 2CDCA 3H3JA 3RVDA 3F1KA 5TIIA 1I32A 2DKNA 5U9CA 3DEYX 3ONFA 4J1QA 1Y6JA 3L6DA 1I5RA 3NKLA 1PGJA 3DZHA 3I52A 4II3A 3HWRA 4CUJA 4OSOA 1JKJA 3L4BA 3KM0A 4FFNA 4JN6B 3QY9A 4XB1A 1WMBA 3MWEB 3HDQA 1U3WA 1GEGA 2GZ2A 3OECA 2ZYDA 3O38A 2VHWA 1U1IA 3PWKA 1NWHA 2DFDA 3RQSA 3PIIA 3VZRA 2IYOA 1BXZA 4D46A 1P45A 5FWNA 1E1NA 1I2BA 1EQUA 2X1HA 2ZTUA 4PLPA 1C1DB 1JLLA 2UV8A 4DIBA 4BO7A 2B36A 1YL6A 2PGJA 1I33A 4RPLA 4XYBA 3ZV4A 2X5KO 3ASUA 5A9SB 3JQBA 4K9DA 1ONOA 2Q46A 3IDSA 4LSWA 1YWGO 3GUCA 2Z95A 2XOXA 3BIOA 2JCVA 2NU8A 4KZPA 4DYDA 3O8QB 1DRVA 2V65A 1VKOA 2PKRA 4HFJA 5F1KA 1U3UA 3ADPA 4HFNA 1N9GB 5ICMA 3WGGA 2O3JA 3JV7A 1FXSA 4DGSA 4ND3A 1HL3A 2YUTA 5DNAA 2FPIA 3PFFA 4QSMA 3VZSA 5FEUA 2NVWA 3ANMA 5CP8A 3L4BC 3CMCO 3AY7A 3PDUA 3EUWA 1IHXA 1VL6A 3IUPA 5DULA 2DBQA 2ZQZA 1P9LA 1ZK1A 1YE3A 3OICA 4BNIA 4EITA 5JDIC 2E49A 1IZ0A 2B5VA 1ZZEA 2IXAA 3K31A 3OFSA 2JHFA 3U4DA 1QMGA 1CERA 1LDBA 3ON5A 4GGPA 4FS3A 3OF2A 1DFHA 4O1MA 4ZRMA 4CQLB 4C7KA 4QX6A 3CPSA 3VTZA 3TZCA 1MP0A 2RH8A 4L74A 4K1LA 3VZPA 3RUFA 1PGQA 3JQGB 2NQTA 2FWMX 4B8WA 2NLOA 1QKIA 1NAIA 1G0NA 3KYBA 1LRLA 1C1DA 1GUYA 1GUZA 1JVSA 2I9PA 3I5MA 4QFCA 4JROA 4E6PA 3IIEA 5CEEA 1IY8A 3DONA 5HTOA 4R01A 1E3WB 2AEJA 1P3DA 3BMOB 1DEHA 2DAPA 2HMUA 2P2SA 4Z9FA 1WNTA 4LN1A 4MVJM 1DFGA 2HMVA 3IJPA 2VUTA 1K3TA 2ZTMA 3JTMA 1E3WA 4E5NA 1FMCA 2GR9A 3CH6A 5CEJA 3B1FA 1FDVA 2JD1A 4B4UA 4R9SA 4M8SA 4MVJI 3S8MA 2CY0A 1QLHA 3EC7A 4XDYA 4KQXA 1MXFA 3DOCA 2BGLA 3QVTA 1F17A 1H6CA 4KDFA 4UEKA 4QXMA 4J0EA 4XWYA 2VN8A 5EIOA 4DLLA 3GF4A 2VHXA 3RUEA 1TEHA 4XD2A 2VYND 3M2PA 2OXIA 4PG8A 4KMSA 4E12A 4ZU3A 5CPBA 4CMCA 4TRMA 1P1HA 2B37A 5ES3A 4TVOA 2VYVD 3V2GA 3O26A 4D7AA 3N58A 2RAFA 5KKCA 4M1QA 1YQXA 2CZCA 1UZLA 3BAZA 3ABIA 2HAEA 3AK4A 3JQ9A 2QRKA 4D45A 1JWBB 4AJHA 1U3TA 1QLJA 1KY4A 5EN4A 5GMOA 5THQA 1R4NA 3S1LA 3FNEA 2BH9A 3JQ7B 5CEFA 3ZWBA 2DTXA 2WE8A 4J43A 1E7QA 3ZNQA 5HS4A 1AHIA 3EYWA 3KEQA 5LDGA 5EINA 3BMQB 4Z9YA 3SLGA 5JW6A 3TOZA 3WGIA 2NADA 4EDFA 5AQ1A 3GEGA 5ILOA 2HO5A 4ROSA 1RPNA 1GZ4A 1EE2A 1ZJZA 2O3RA 2O3UA 4UVGA 4ZRNA 1X1TA 3ICCA 6ADHA 2NTNA 3DZKA 1HDOA 1NPDA 1ORRA 4E5KA 1PZEA 3UGKA 1XGKA 2C59A 4M87A 2I6TA 2JCXA 1TI7A 3EY4A 1E3SA 3AI1A 3CUKA 4W7HA 3DMYA 1ENPA 4CM6A 1ARZA 2Y05A 1VJ0A 1QXSA 3Q3CA 5TLSA 3ZWXA 3ZCXA 1NR7A 3PQFA 4QO7A 5L7YA 3D64A 2IEBA 3S55A 5B4VA 3HZZA 4MVJE 3A1NA 1OZAA 2VWGA 3OIFA 4KDEA 4OO3A 4JLWA 4RQTA 1XLTA 3NDRA 3DZJA 4YJGB 1Y5RA 1N8KA 1ZEJA 4ZN6A 1GCOA 1B0AA 3JQ9C 3N74A 3PYLA 3RSHA 4O6VA 4PZDA 1E5LA 2NQ8A 3KXDA 4LVCA 1KEWA 4YAJA 3INTA 3U3XA 3JQAD 5L4NA 5B37A 4CMJA 1VE9A 1UUFA 3PK0A 2DT5A 3L9WA 3MJVA 4I1IA 2BRUA 2Q4BA 4NMHA 1XELA 4CM8B 1GCUA 1E6WA 9LDTA 2DQ4A 3EZLA 4E4YA 3H3FA 4RDIA 3IOYA 3PJFA 4GKBA 1DC6A 1YB1A 4CM9A 1ULSA 1Y5MA 1KVSA 4B79A 2ZB3A 4BNXA 4EZBA 4HWKA 3HJAA 3K5PA 4GLLA 2C20A 2JD0A 4Y9DA 3SC6A 4E2XA 3QE3A 3IKTA 3JD0A 1PJBA 1EUDA 2X7HA 4PVDA 1LRKA 3S2IA 2BI8A 1LNQA 2X0JA 4P38A 5AYVA 1SZJG 4R1UA 3W4JA 2DVMA 3LT1A 1HLPA 4P4NA 2BF7A 1OC2A 4B3IA 3OSUA 3E18A 4J3FA 1LSUA 4TWRA 1F06A 1U28A 1UP4A 3CZMA 4NK5A 3Q2KA 1H5QA 3FTPA 5HRUA 4BO5A 1YOVB 4AJJA 3AUAA 1EDOA 1R4MA 1JAYA 3IP1A 1UAGA 3DHEA 4WKGA 3TOXA 1X1EA 3W8EA 1PR9A 4DMLA 3GG2A 1YQDA 4YRBA 5CAEA 1LU9A 4JJIA 4DRYA 3L07A 3RU9A 5JY6A 4BNZA 2HK9A 1PIWA 3EGOA 4MJLA 1LJ8A 2NVBA 4P4GA 4BHTA 3SBOA 4XEHA 2WTBA 3FBTA 2I67A 2Y1OA 2YHIB 4IDGA 2BFMA 4QQRA 1EDZA 2JCYA 3AY6A 4ZVVA 5K6AC 5JDCC 4W82A 1V9LA 2EF1A 1E6UA 2E37A 3WX0A 1LXCA 4IQGA 5F1OA 2X22A 4A5OA 1GL3A 4XGIA 4YQZA 4PFJA 4B8ZA 1WDMA 3B1JA 1C0KA 1BXGB 1PJCA 3PHJA 2X8LA 3D0OA 1LX6A 3AJRA 3NJ8A 4B7UA 4BO1A 4NIMA 3N7UA 1HZZA 5T8KC 1JVBA 1U5CA 4NQZA 1LC0A 2VUSA 2G5CA 1N1GA 4BO3A 2WEKA 3JQEA 3WR5A 1HDCA 2IEDA 3GZNB 5DBFA 3V1UA 1BDBA 1J49A 2XPCA 4ZQBA 3SC4A 2WWRA 3I9OA 2YZ7A 4J1SA 4BVAA 2EERA 4GMFA 1UXHA 2NACA 2DPHA 4D44A 4DA9A 4WLFA 1LSSA 3RC1A 1PJSA 4J91A 1ULUA 4N54A 3UUWA 4BKQA 4NU6A 1E1LA 1M66A 2VNAA 3AUSA 3F46A 1ONPA 4CQMA 4IDEA 5CG1A 4R5MA 3DOOA 1YL5A 1NQ5A 2Q50A 4H3VA 3F9IA 2BFPA 5ITVA 4DMMA 1I3KA 1M76A 1E92A 2B4QA 1JW9B 4A73A 1F8GA 4NU5A 1R0LA 2BELA 4Q3BA 4RL6A 1W4ZA 4EBFA 1SCUA 2W90A 3ZHBA 1TVEA 4JBIA 4UAGA 5TT0A 1EUCA 4YCAA 3RIHA 1DC5A 1K6XA 4K6FA 3LQFA 3PHGA 4RPKA 3PQDA 4FFLA 5B12A 1BWSA 2W98A 1EVZA 4CR8A 1SOWA 2DUWA 5IDQA 3GZNA 3I1JA 3H8VA 2VOEA 4RF5A 1E3IA 2CFCA 1Y8QA 2FPGA 3ZWPA 4PN3A 2PA3A 2BHLA 3UN1A 1N1EA 1Y8RA 4DXHA 3KRTA 4H7PA 3IL2A 4YT5A 4Z0HO 4QTZA 3DZBA 2FMUA 5JCJD 4PLCA 4EEZA 1G6KA 2BGKA 2JJYA 4XR4A 4FFPA 1EZ4A 3A28A 2NV6A 4XIJA 5DT9A 1GV1A 3DR3A 2HMSA 1Q2XA 1R12A 2C7GA 4F6CA 2PZMA 4IGEA 3DC2A 5A5FA 2GN8A 1YBVA 2VRCA 1Z75A 5TF4A 4YBZA 1LDYA 3E9NA 5K9ZA 1XDWA 1QG6A 2HLPA 3NDIA 2D0IA 3C85A 1B26A 2P4HX 3Q6IA 4WK6A 1LBEA 3NX4A 5A05A 1XWFA 1Y9AA 2NWQA 2WDZA 3KSDO 4BOYA 4UUOA 3QVWA 3R3JA 3F6YA 4M89A 4PGFA 1JQBA 4CMEA 4PLWA 1V3TA 1SC6A 4XQ9A 4AJPA 5I9NA 1GD1O 2B83A 4AG3A 1MLDA 4LCEA 3HNPA 4XJTA 2QYSA 1O94A 3OA0A 3AOEC 3HHPA 3WBFA 4GX2A 5I7SA 1I36A 4NG5A 3PJDA 4YAGA 1PX0A 1DC3A 5G4LA 3PP8A 4TVBA 4BO0A 1DB3A 4TZTA 3QRWA 4BO9A 3E9MA 4R54A 4LRSB 4QECA 2R6JA 3QWBA 3W8FA 1VM6A 4PLGA 4WECA 3WS7A 3VHRA 4JQCA 5KTKA 5KKAA 4GVLA 4IJWA 4WLVA 2PV7A 4YRDA 4G2NA 5AXBA 4WOKA 4R1TA 4Q3AA 3GC6A 2VWHA 4IUYA 3QVSA 3FNHA 1CF2O 1LDMA 2X5OA 3WJ7A 4DLAA 2GUGA 1U4SA 2PKQO 3GK3A 3NUGA 5C7LO 4MVJF 4XQEA 1WP4A 5A04A 3I23A 1JA9A 3AI3A 2TMDA 3GHYA 1CJCA 2HRBA 1ZKMA 4PLVA 4RVUA 2GN9A 3QSGA 3OH8A 4OYRA 4OGWA 3WXBA 2Z1NA 3COSA 3ZWMA 4CODB 5IFLA 2HCTA 3JQ6A 1NYTA 4XA8A 4P22A 2ZATA 3MOGA 2G17A 3ZWNA 3E82A 1D3AA 5T67A 2V7PA 3EW7A 1C3VA 4I08A 4YT8A 3PGJA 1YL7A 4YT2A 1KEUA 5EQFA 3D1LA 1KVRA 1X7GA 4I8XA 4J4BA 2NSDA 5A3VA 3JQGA 4UULA 3FSRA 5C5IA 5TSDA 3AOEA 4CM4B 1MFZA 3LDHA 3INRA 3BA1A 4XYGA 4BNTA 2R00C 1I3MA 2OP0A 1U3VA 3VPGA 4NPCA 1Y7TA 1LLCA 3GNQA 5L45A 1HE3A 2Y99A 4UVIA 3AM3A 4ZHSA 3EVTA 3HUDA 5EERA 1GYQA 1R4MB 2JHGA 3STHA 3LU1A 2PZKA 3OIGA 1GU7A 4OIMA 1V3VA 3AM5A 3PWSA 2VYVA 4IDDA 2O4UX 2C0CA 1XQ6A 2DU8A 2X0NA 1ZMTA 4B4WA 1PZHA 4PLZA 3UKOA 3RUIA 2FHSA 2HKIA 1R6DA 2XAAA 4CMAA 5FF9A 3TPCA 4BNGA 3PTZA 1Y8RB 5T5QA 4L8VA 4S3MA 5F1PA 1VRWA 1HRDA 2FSSA 3LT4A 4CL8A 3WGOA 4MP3A 1GV0A 2WE7A 2BGMA 4J4HA 4CLOB 2O4CA 1Z73A 2JKVA 1A7AA 1G0OA 3DAGA 4U7WA 4D42A 3H9GA 2J3IA 3M2TA 1RM5A 4GH5A 4E3ZA 4JJFA 4B4VA 3OJLA 5AXDA 5G0UA 3DAPA 5KJFA 1UXKA 1RM4A 1S6YA 3JQAB 3NDJA 4CM9D 3QJ5A 4FIZA 3JYLA 5A03A 1O0SA 3DQPA 3G1UA 5KNLA 5I8ZA 2I3AA 1A4UA 1H6AA 3TSCA 1ZSYA 2VOJA 4Q3NA 3ANNA 1U9JA 4YJGA 4XR9A 3MOIA 3EK2A 3HDJA 2WM3A 4LGVA 4GQAA 3D4OA 1A27A 3QVXA 1G1AA 4R3WA 3TL2A 1XIVA 1GDHA 1HSZA 4CMIA 1E7RA 1Z7EA 4RJTA 5IDXA 1PZFA 4Q3CA 5FFFA 3WWYA 4PLFA 1NVMB 1ID1A 4HP8A 4ND4A 1GPJA 3VZQA 4UEJA 3ZV3A 4OH1A 4RPJA 1LSJA 3AU8A 1VSVA 3WQQA 1AA0A 4AJKA 3RU7A 1ZJYA 4FC6A 4WLUA 4YRAA 2J5KA 4Z0PA 3CINA 1N2SA 1DC4A 3CEAA 3GQVA 4YJHA 4PZCA 1QSGA 4U6SA 1RJWA 2AG5A 2WD7B 2GPTA 3FN4A 4IBOA 5TS3A 4LSMA 1OAAA 4BO4A 2GN6A 4D3SA 1TLTA 2O50A 4CLDA 1KVTA 2DTEA 3DHYA 3IC5A 3P19A 1I24A 1N7GA 1QYWA 3D5TA 4TRRA 3WGQA 1NHWA 1XA0A 3AU9A 2B4RO 3F47A 1DAOA 5G2OA 5KCZA 5AXAA 5ICSA 1R4NB 4URFA 5KOIA 1IB6A 4JXKA 1E1KA 1CYDA 1HDRA 3VH1A 3MCVA 1GEEA 2BFOA 4YAEA 2C5EA 3BTVA 1C0IA 3H9JA 4R68A 1ENZA 1VSUA 3JQFC 4J1TA 3KHUA 2VWPA 2IE0A 4TZKA 3O8QA 2P9GA 2RHCA 1DIRA 2ZB8A 3HDHA 2AQHA 4WEOA
chains in the Genus database with same CATH superfamily
3A1CA 4PN7A 1V5GA 2HDNB 3LX4A 3D8TA 4ZI7F 1NH4A 4A16A 2HPCB 3W6NA 4D9GA 4DZZA 1H6DA 3HLTA 3SWWA 2GJ9A 3FPAA 4M54A 3F3YA 1X9HA 2Q0XA 1SQPG 1N0UA 1O6ZA 2DHEA 2W70A 3S2UA 2ZT9C 4TM7A 3TZQA 2X3FA 3P8CD 3RK3B 5DM70 5JS2A 3AI7A 3T7JA 4NARA 1L5VA 5LLTA 4HAWA 3QE9Y 2VSFA 4OY3A 2AA3A 3CH7A 4WA7A 3T41A 3IODA 1R6BX 1CQWA 4MUFA 3U7GA 2LRHA 2G1AA 3PA8A 3RWBA 4XAQA 2IYSA 1SQPK 5EZ6B 4J0CA 4TWIA 5JZ9A 1APBA 1LCIA 2RJNA 1IU9A 1REQA 3AOGA 3BZWA 3E58A 3JARA 3MCAA 5GONA 3WYBA 4OGQD 4HDRB 2GSWA 1ZIXA 2FR0A 1M34A 3D4IA 3G7SA 3EXIA 4TMZA 4DBVO 5C2JB 5F98A 1IHDA 3E9EA 4U5QA 3FM9A 4GOLD 1RKXA 4P98A 4K26A 1VL1A 1NUHA 2QZ9A 1JIVA 2RKBA 2JA2A 2CXQA 3IT0A 1PUJA 3KKOA 4QXPA 3O5AA 2O0KA 3AZQA 5A2GA 1YONA 3LCCA 3P9CA 3OLWA 3WLMA 5BMVF 2AC4A 3W79A 2FYUK 4UM9B 2Q6OA 4JB3A 4D9FA 2QVGA 5HK8A 1N5DA 2JI4A 2PKQP 4IXNA 1Z33A 1ZFNA 5IRCD 1G41A 4HDAA 3B1VA 2I9KA 1RM3A 4KKXB 1I4OA 1II8A 3AF4A 4MPTA 3UOAB 2Y92A 3Q6NA 1JLKA 3VM6A 2L42A 1M2KA 1QDLB 2M8RA 1Z5WA 1C9YA 2PM8A 1VBKA 3B3AA 3BICA 3DLTA 4AQYB 1A0OA 3QQPA 4YIKA 2QORA 5T41A 1ISGA 4RMJA 3F7MA 3UCFA 2VXOA 4D9EA 1G8KA 1NVWQ 2QV7A 3DOFA 5CXSA 2QJKB 1HLGA 4MA5A 4UBLA 3LHIA 5E1MA 4LBWA 5ARDA 3OG9A 4D9MA 4TMFA 2IDKA 1QQ6A 2ET6A 1L8XA 2ORIA 5F33A 3ZHRA 1S01A 4DPLA 5FI5A 4RJJA 2VRSA 2Q2QA 2C97A 1D2CA 1NW7A 1Z25A 1SQVE 3H0KA 4BNFA 2Q3CA 4NK4A 1YKFA 3AHCA 2H1LA 1YDWA 1NNLA 1YIDA 1OSNA 3L73G 3PS9A 4UU0A 2QSUA 5FI3A 3V8NA 4N65A 1ZUHA 4CIDA 4EB3A 4YYZA 2I55A 4MLPA 1FTGA 3SWYA 3UIAA 2J9ZB 4Z5XA 4W1QA 2OQ2A 3KVVA 4HBGA 4QAQA 1NBME 3SZGA 3WI7A 3ZN2A 2XQJA 2B9VA 5AVXA 2OGUA 1QTRA 3OO1A 3L71D 2IT1A 3SJAA 4C6HA 4KXYA 2NSJA 4PFSA 1SKYE 2Q7XA 4HEQA 4JUCA 1IN1A 1AK1A 1H0TA 3N0WA 1W5FA 4V0KA 5ITZA 3U09A 2RH0A 2FFDA 1IOLA 1SULA 2G9QA 4F2PA 4FI3C 3QF4A 3ZNPA 1CUHA 1ZMXA 3VTFA 4PZZA 3VVCA 5JI3E 2WWGA 1MGPA 3HADA 2WQ7A 4C5CA 4K9RA 4F9GA 1J5XA 1QYVA 1S7GA 2VKTA 3VOSA 1FE6A 3ENKA 1ZY2A 3LRTA 4KXLA 2PS3A 4GOEA 2IPOA 3D6JA 4TQAA 5AJWA 1O94C 1OH6A 3WGHA 3I6IA 1BX3A 3L4EA 4JLPA 1RF0A 1DBRA 2O5RA 1QK3A 1D1SA 5TC4A 3RTDA 3MIWA 3NRCA 2QLTA 5DX1A 3IJEB 4AY3A 4ZVQA 4CF3A 3M6WA 2H43A 1FRVA 3G2KA 2GZ3A 4Q3KA 3WLIA 2H5LA 3FPKA 4WVZA 1O89A 1T9KA 5IBQA 2H1FA 2Y2VA 3F5DA 2R84A 2B20A 1Z5VA 2Z98A 1M2FA 3KLPX 3MB8A 3KDPB 2NSLA 3CCEP 1GFSA 4GEGA 4LW8A 1L4NA 1QX8A 1DMSA 2VTKA 5AVOA 3N87A 2H4XA 4LYAA 3ZHUA 4EG3A 4IUDS 3ZVKA 5FYDA 3I5AA 4JZKA 1QTIA 3C45A 1MT3A 1U8ZA 4U3FJ 3CCMP 2CCJA 3RYFB 1XZPA 5IJZA 1Q7EA 1Q6ZA 3D6YA 3NIBA 4R4JA 5IPFA 3AVUA 2OMEA 2IPXA 2FPPB 4F4FA 3ZLBA 5BUCA 5EP1A 2W5UA 4A26A 3W5VA 1JNYA 1Z22A 3FWNA 3R24A 5KTSA 4PSAA 3KQNA 2ZJOA 1UJ6A 1ZXLA 3ACBA 3NNSA 3EH1A 4NJMB 3HDVA 4DLVA 3IV7A 3RDPA 4PZPA 3E8XA 5GQSA 5JH7B 1W46A 1L5OA 4FGKA 4N8DA 2G71A 3N8IA 1IK4A 1SUPA 2GZSA 2ODTX 4N3CA 5B53A 1YQGA 4NMMA 4TXNA 1S5LH 1YBMA 1LWOA 1JLMA 2OENG 3M6AA 3FTQA 2HUPA 1N5IA 1OILA 4BIMA 3SK0A 1CEYA 3K5BA 3CSSA 5TGDA 3WMWA 4WFKA 4YJFB 4ZQEA 4C43A 4C20A 1F0YA 3V2PA 3IERA 2G1UA 4AZVA 4E2ZA 5REQA 3NYRA 1YASA 1XTPA 2CSUA 1UP7A 3LW7A 4UDOA 2ZSFA 4X94A 1MA3A 3IDZA 4DLKA 4DJAA 1OTHA 2IXEA 4UC0A 5K3BA 3DVAB 2C5AA 3ZQ4A 5GM2A 1YIAA 2LDBA 4X6YA 4AY4A 5IJWA 1NBOA 2WTMA 1E3LA 3PEWA 2OR3A 3IILA 5JS6A 2MKVA 3DTTA 2CVQA 1M10A 4RIHA 5FBZA 4UFNA 1JECA 3ZTYA 1R16A 3WB9A 2C29D 2WMDA 2H7XA 4HH2A 2NU6A 4RCVA 5KINB 3KQHA 2G28A 1JA1A 1RSZA 1VC2A 4RENA 1DRKA 3RTGA 2VPTA 4UB6H 3HFSA 4MQ5A 2QN8A 3QELA 1WPQA 2IPNA 1F14A 2RKWA 3ZHVA 2MYPA 2P78A 2AXTH 1RS0A 4E5SA 3TCKA 3K3PA 3T1QA 4OPMA 2P5UA 2BMEA 2XNDA 2JJLA 2IK8A 1VXOA 4EVIA 3A05A 3RK2B 1O54A 4M55A 4PC7A 4U00A 3ETHA 1LI7A 2HHHB 4HAIA 5CXQA 3EIFA 4RGQA 1DKRA 1R0KA 1U2GA 7ABPA 3HABA 5K03A 1DJPA 3PYXA 4GBJA 1VKHA 3B7WA 3DB2A 1L7QA 1RRCA 2IZ6A 4LTDA 4FILA 4CCYB 1ULAA 1VG9B 5DHRA 4RM3A 4RFLA 2Z2KA 1HEYA 1Q2UA 1IPFA 2DB3A 4F3YA 2HBRA 3HVHA 2N75A 1NONA 2X4DA 1SPXA 4FONA 4LHWA 3UK2A 5CLLA 4INZA 2C4NA 1GA6A 1SBIA 5CD9A 1MMFB 4JT8A 1IZ9A 1Q7YQ 2OA0A 1Q1BA 3AO0B 5TRTA 1QG2A 1X22A 4ZKUA 3MA0A 3AEBC 5FX2A 5AI6A 4FCCA 3L7IA 4PZUA 4Q1VA 4BQIA 4AS2A 1KEEA 4EZEA 2HK6A 3D3QA 2NUTB 4P4LA 3N0XA 1Q11A 2AW5A 4KYUA 5ECWA 3CCFA 2ZIUB 2WSYB 3GJ8A 4NMXB 2XDWA 1KP9A 1SEVA 3M1LA 3SF0A 2HU8A 4DG5A 5A4KA 3HVIA 3UGJA 1CUXA 4DIMA 3QEBZ 2YFQA 4FGWA 3OZAA 4MO9A 3W8NA 3GLIB 4ZPJA 1UQRA 2R87A 3TJRA 1ZLLA 2CMHA 3DOIA 3F74A 4I6JA 4KNVA 3UTDA 1TM2A 4V0LA 2RARA 4F06A 3OZEA 3USCS 3WNQA 5C3UA 5JHGB 1FTNA 4QOSA 2VJCA 1GLVA 1T2UA 2H18A 2QL7A 1RQNA 3BYZA 5JUWA 4CTNA 1TECE 5E79H 1BD3A 2C78A 2E74B 1R10A 2CHVA 3KFLA 3QVGB 2QZZA 4IDPA 4GVXA 2CLCX 5EQTA 1SBYA 1M6VA 3GMSA 5FB3A 1TZCA 2D00A 3I05A 5JQGF 5KNBA 1KH2A 2WPDD 1E5DA 4C76A 1WZNA 5BT9A 4E1AA 1KC3A 3MOSA 4V0QA 4YLEA 4BFZA 4CQMB 1XPOA 4W6QA 2FZKA 1NTKE 1PJZA 2X4IA 2DBVO 3ZBQA 5EWJA 2I5PO 3ZH2A 3ZDEA 5KVCA 1RWWA 1HVVA 1XZBA 3IIMA 2Q1TA 3NNDA 3O6VA 3P27A 1POXA 2ARKA 5D3MA 2VNIA 2VXCA 1QO7A 1U7TA 1CRLA 2P6PA 3LVFO 4QIHA 4AT1A 4M0EA 3WP1B 4W1SA 5B30A 4LJ4A 3GPCA 3HCRA 4WK4B 4AZTA 2M5AB 4UTNA 5SZHB 4YK7A 3ORFA 3ETJA 1ZAKA 1ZAYA 3PHLA 2YHUA 3GCWA 4W1RA 4JMPA 3T0IA 2JB9A 5L3SB 3AEYA 2PWYA 3CT6A 3E9DA 4UTRA 2AXQA 4AJOA 2FSFA 5IN4A 3CMMA 2JP3A 3L41A 3O03A 5ALIA 1KJIA 3LLUA 1OR8A 3OAKA 3A4TA 3DCJA 2DC1A 2E87A 2D1QA 2J85A 1DL5A 1UBMS 4OKNA 1UPAA 3RT1A 1L2TA 4FKZA 2P7HA 4Q12A 1VQLP 2IX3A 2JJMA 4WIAA 3DAOA 2W4MA 4QGHA 4CL2A 1U0TA 2FGKA 4IV8A 1G21B 4GDOA 1KNQA 4XX0B 5CVVA 4J9UE 1GR1A 1QNLA 3Q9NA 4L9RA 5A4MS 3N8HA 3BSFA 4ITUA 2REBA 3NDPA 3TEFA 3BRWD 2PGLA 1YSCA 4LG1A 5IT0A 2ZAOA 3N3BC 4NJOA 2KPOA 5AUNB 4MVJP 3BCRA 1HBWA 2VQDA 2WUWE 3MQ4A 3ISVA 2IYLD 2HL6A 4HHEA 4Y6RA 1Y1KE 4AM8A 1ZIOA 3PLNA 3IPCA 4WLOA 1W9MA 4PX5A 5C7YA 2IBZD 2D4AA 3MTAA 1WEKA 3DKVA 1M6NA 2QB5A 2X0KA 3NKFA 1DUVG 2I71A 5JO0A 3U4QA 1XZJA 3KIPA 4MKZA 4RU1A 2XY4A 4YCSA 4JIGA 3LUDA 4R6XA 3WNZA 3OX3A 2QTCA 1UADA 3P45A 1JY2N 1AHPA 4BTEA 5K8UA 1WCXA 4TS4A 4Z4QA 1BXRB 3DV2A 1J1EC 4UBKA 1NO4A 4MUHA 5CITA 2ZSAA 1EXWA 4EUFA 1EFKA 4ZICA 5L3SA 4WFJA 2IPLA 3TGUJ 1HDXA 2OK8A 1YFZA 4WCFC 1MH1A 4O29A 5IT5A 3IURA 3GLIA 2CJWA 4D92A 5T4BA 2PX6A 4UW9A 1PVOA 3FR8A 1PV1A 2HSGA 2QN6A 3LTEA 4H7HA 1K2WA 1QLWA 2GPBA 5I7UA 3Q8MA 2TMKA 3PB3A 3AYXB 3R5JA 5AVRA 2ZJ4A 4NU0A 2I3GA 1H9CA 1U1CA 1I2MA 4MYCA 5EHXA 4QWWA 2A59A 1L5HA 1DX7A 1P5JA 2ZIEA 2RGEA 2XH8A 1QVGO 3PFHA 5B1EA 3U81A 1GPDG 1TO6A 3F78A 4WCDA 3HLYA 1SQQJ 1SQXD 5FL3A 2A9QA 2OUIA 2V7UA 5I7OA 1BG6A 5F3WB 1WA5A 1K75A 3IUYA 3C7TA 3DHVA 1E4OA 1EDJA 1E2MA 5B1DA 3UPDA 1EDBA 3HVJA 4RYLA 2F00A 2HBYA 5JLAA 3AFNA 3OKCA 1J0AA 1F2DA 4RH0A 5DN6A 4E07A 4IZIA 1D9ZA 1M6YA 2VHTA 3UZUA 3LCJA 1YZGA 2R5WA 2ZI5A 3FB4A 4FT4A 4DNPA 1J8MF 2CF5A 2DBZA 3T3IA 2CL5A 4QPDA 1EEHA 5CVCA 1IFJA 1VCHA 5FTLA 1GDDA 2Q99A 4Q18A 1URQC 3FETA 4ME6A 3ZE0B 3IMCA 4IX1A 2XIJA 3IO5A 2A30A 1ZGAA 4LOLA 5GV7A 1KB9D 3U37A 3OJXA 4GMGA 4FMCF 4KAAA 1VL5A 2C0XA 4MV1A 2UU9B 3SYNA 3IF4A 3ENZA 4QUIA 1ZW0A 2QRMA 1UMDB 2EJBA 3IQEA 2GA8A 1PS9A 3W2TA 2Z8XA 3V1TC 4RV4A 2ECFA 1R37A 2FP4B 2IZ1A 3CHYA 4P5PA 5MFZA 5KSZA 4PC3A 5FWXB 2VHZA 3ER9A 3JXEA 3T7DA 3TBFA 1SAYA 2ZRBA 4D6TE 1XVTA 2OBLA 1FE8A 1GYPA 1JRLA 1AXGA 1NA5A 2OV1A 3TD9A 2ZU0C 2A45H 4F85A 1ZRHA 1T13A 1CY0A 4AKEA 1SIBE 3T0GA 5LP1A 2HPCA 1G8AA 4KIJA 1QH9A 3GWGA 4ZK2A 4P7KA 2DKFA 5ALQA 4MV7A 5I45A 4E5MA 2P90A 2OHXA 4KXUA 4QGGA 4BMCA 3NIGB 3WDLA 3ZJVA 1XKTA 3VDQA 2IFMA 5CVDA 3N0TA 5JSHA 2OZPA 1V8PA 1M2WA 1NSFA 4YJ3A 3SOZA 3L0CA 3TGLA 1V25A 3EDQA 1SFCA 3CU5A 3T5TA 3VJLA 4ALJA 621PA 4QPZA 3W6ZA 3KPEA 3WWEA 4YCLA 5ENDA 1P4JA 1V3UA 3UK0A 5HCNA 4MO2A 4BE7B 1JMMA 1PQPA 3CX3A 3ZR4B 1KMQA 4RABA 1C7ZA 4JVMA 4URYR 4AJ9A 1KOFA 1KQGA 3SMQA 4Y9UA 1N34B 4YP1A 1XZFA 2VNSA 1QVRA 3K73O 4XPIA 5C8DA 1YS4A 1U7HA 4ATNA 1LY1A 4UNPA 3ETNA 2JS7A 1TCAA 4RA6A 2XNSA 3C3XA 4ITVA 3RV3A 3AJDA 2J59A 2ZRKA 1N4DA 5I8WA 1WCWA 3P2JA 4U2CA 4U63A 5JDCA 4MVJG 1P39A 2AFRA 2EG9A 3AONB 4JLAA 1IJDB 2HFED 1TOAA 4MIYA 1T0BA 3UNXA 3W6OA 2WYOA 3T5PA 2BCCD 3MLBA 1NWCA 1E79H 4TRJA 4X3OA 4B80A 2X23A 4DY4A 2DR2A 3SF8B 4CW7A 4BMZA 1F7UA 2B61A 1QPGA 3DTYA 3TMAA 5B7PA 3V2QA 1B43A 1ODCA 3VR3D 2VNKA 2D8MA 2R3SA 3GJRA 5K3AA 3T95A 3O4VA 2POHA 3V3KA 2YVKA 4CMEC 4IJ6A 4PIPA 1G19A 4CIXA 2XQIA 1LBSA 4O4LA 2EDAA 4G0ZA 3QH4A 4G63A 3A06A 1ZLXA 1E9EA 3FGPA 5AKIA 5HDQA 4CG3A 2H1HA 3TNDA 1Z29A 4LMBA 4CM7A 4C08A 2V59A 4WFQA 4EYEA 1A7JA 5IM4A 3L7KA 4U6NA 3D3KA 1IUNA 4HK4A 5D7BA 4DDVA 2OV6A 1YA6A 4FP9A 4FFWA 5C1DA 4YMTA 4CMBA 1AGYA 3BB4A 4DZRA 4F4HA 1ULZA 4UFPA 4LC9A 1V8BA 2BEWB 4FE4A 4KNWA 3TDKA 2SECE 3ISJA 1RPJA 4MW5A 5G3ZA 1IWOA 3UHJA 4K8RB 5FWAA 1KAQA 2Z6UA 4ZI3A 1O5IA 1ZOOA 3OKAA 1CU1A 2RH4A 4YXWA 3LC2O 1R27A 3W9UA 5LLDA 1L8LA 1L0NK 3JD4A 4BLWA 2L69A 1XU9A 6Q21A 4B3RB 3S2SA 1M2OA 4IICA 3UYLA 3MJEA 3CWBJ 4FFBA 1E4EB 4HH3C 4EM6A 1N3BA 3DAFA 1T8ZA 1DG1G 3U3ZA 2MJLA 3KZVA 1KIAA 5H4GA 5JZSA 1W88A 1JN0A 3I8OA 3OJFA 1WBJB 3Q11A 5AVYB 1KSHA 4B7UA 2D0DA 5IT9A 2WWHA 4AKSA 4MQLA 3DZ8A 1UDRA 5IKPA 4ZVMA 2Q3BA 5AW3A 4W9MC 2V6JA 2X5XA 5YASA 1DIGA 5I51A 3K9FC 3NVKI 1JH9A 2IIVA 1THTA 1NBEA 3VKUA 1FVFA 2HSWA 5LU9A 3VSDA 4Y0AA 3IT1A 4LYJA 1SRRA 2E7ZA 1MQSA 3NHPA 4I19A 2BFFA 3AIMA 5DASA 3K96A 1M2EA 3OU2A 2NTVA 1U2TA 4GOJA 4HGRA 2GB4A 4G25A 3JATA 2ZBEA 2JL1A 4WASA 5IDYA 3EMKA 4LNAA 1CR0A 3LRPA 1H2RS 3Q15C 4ZOAA 2WB4A 3G9TA 5ESXA 4QUBA 1CI6B 3GLGE 4GG1A 1ID8A 3OZSA 1X7XA 3RAPR 3E3LA 1AXEA 3UWMA 3DLHA 1PV3A 4ZCMA 1Y5LA 4RZ3A 2JFWA 1KU6A 1W85B 4L8LA 3GVHA 1AHHA 2AI2A 3CXHI 1PVDA 1SK8A 2GX6A 2Z08A 3CRZA 4QVIA 3R5XA 3UXEA 1M2VA 1Z37A 3B5NB 3REQB 4BVJA 3LJKA 3PZRA 4OK6A 3TNJA 1MC8A 3UAZA 4CVNA 1L0BA 5CTJA 1GIAA 1LT9B 2WF7A 3HD7D 2B2XA 1BE3G 2FPIB 3AHEA 3LP6A 2PL5A 3K2EA 4Q4AA 3TM5A 3AR2A 3QX9A 1B8PA 2DFKB 3BWYA 4IH9A 2BJVA 2JFUA 1V8ZA 2QTBA 3FMFA 2BFEB 2HGZA 4DILA 1U5AA 2V45A 5DBHX 1SU8A 4KAFA 5ER6A 3D6NB 3DTVD 3R9XA 4HAZA 1P0CA 3RLFA 4URVR 3HRKA 4OQZA 2P0YA 1XQ1A 4MARA 4RY8A 5KLVK 3WGTA 4BTLA 4RKWA 4ZDKA 3OAAA 5A4JA 5KWIA 2I1VB 1DV2A 2QPTA 2PS9A 3RIGA 2E5TA 1Z8NA 2IUFA 2JATA 2P2ZA 2Q2OA 4DIKA 3UHAA 4F9EA 4YTEA 1X0XA 3R6GA 3MP7B 1UC8A 1XHEA 2GD1O 3ECCA 3LBAA 3AGPA 3PNVA 4NFHA 4H16A 4AKGA 2Q27A 4B17A 5JNVA 4QEDA 1YVEI 3Q87B 4K9MA 1XUOA 4UCWA 3RARA 4EJMA 4KFCA 2IVZA 2GN1A 2IL1A 4O2AA 4BFVA 4COKA 4C4XA 3L70G 3F5QA 3OOWA 1XZDA 2Y66A 1JDBC 1T6BY 2VP0A 3R3WA 3H0EA 3INNA 3NYWA 4YUZA 4DREA 4KEAA 4R1LA 4QMAA 4KLRA 1EI9A 5IK2D 3WYDA 4LZNA 2QUIA 3JRXA 4G9EA 4HAVA 3VTPC 1YZHA 1HMYA 4UMVA 4ZAGA 4M9CA 3L4JA 4OYHA 2GF2A 2W6NA 4D6TD 4EATA 1XPUA 3F5HA 3SQMA 1LK0A 2XRFA 1RE1A 3IB3A 4NPDA 4HFMA 4NBNA 4BCCA 2EYQA 3ND8A 2P9TA 1NU1E 4LE1A 1DO8A 1V3QE 3S0JA 3W78A 4DV5B 5IAJA 2ZCUA 3G5UA 4IDBA 2F1KA 5KOHB 3RTCA 3DE5X 5EXDA 3NTLA 4UHKA 2YIDA 1BHSA 1G1JA 2R32A 2EW8A 4LOHA 3NRJA 4GWKA 4YECA 2YZNA 4YV2A 6YASA 1WZCA 3R9XB 4HWPA 2ZJ5A 3EWAA 5K0BA 4DSOA 4DJ5X 3GLRA 4OBWA 3ZBTA 4A23A 3AIIA 2GAJA 5AI5A 3U80A 4KREA 1MF7A 2PSSA 4MIEA 3HTXA 2PWPA 3UJCA 4HT3B 4PZYA 2XQFA 5K8JB 3W9SA 4IOKA 5LUAA 2H1VA 3WU2E 1PZMA 1CB0A 4QU8A 2BASA 4KHZA 5DXFA 3CF2A 1THGA 3N5KA 3GIDA 4GMHA 3CX8A 1Z0SA 4BLVA 5I7WA 1OYVA 2XWJI 1XSEA 4QU9A 1X3LA 3QPDA 1E77A 1MNQA 3L8GA 1L7OA 2H5JA 3ZU4A 4DQ0A 1KYWA 2GXAA 2E2WA 5B7QA 4M7WA 4YI3A 4D3ZA 4QRIA 3Q5SA 1KDOA 1GGKA 1NJSA 2ATEA 2I3BA 3DE4X 3G9QA 3GCXA 4Y2TA 1T43A 4BB6A 3Q3DA 2R751 1T5IA 4JX8A 5ALNA 4JGBA 3PNMA 1LLUA 4JLMA 3H1LJ 2AI1A 2WITA 1ZK0A 3BF8A 4ND5A 3QWOC 1L5LA 3KLBA 1UC9A 1E2HA 4MMYB 5AP9A 2YRWA 3L8YA 1VE1A 1I4DD 4H44B 3ANTA 4HZUA 3UH1A 4MUXA 1W93A 2FN3A 4LWPA 5K0TA 3V4VB 4Z3DA 3B60A 4M8NE 2FEKA 5L7WA 1Z0IA 5CYPA 4NPFX 1P17A 3THOA 1X1BA 1YQEA 3HACA 3NXSA 2Z3VA 1JY2O 2Q29A 2ZETA 3EXIB 2FUCA 4WHMA 3K70C 1P4HA 2I2FA 3SIWA 4A5SA 3WYEA 1TEZA 3IRUA 4FIDA 2M6KA 2G1PA 4WWHA 4ES6A 3TOCA 3NV7A 1JDSA 3D54D 1TIKA 1UT6A 5D3KA 2ERYA 2LDXA 1BWRA 4C0XA 1EUZA 1ZMBA 3GT4A 3I4CA 2WQ6A 5JXJA 1LTJA 1X42A 1PP4A 2H48A 2Z43A 4UMEA 1PK8A 4AP5A 2C0QA 1FNNA 2J7KA 3IAS1 1BVRA 2O3QA 3PJEA 3WAKA 3EXFA 3UICA 1VQNP 1YR3A 2ZRLA 3QIVA 4LYEA 4DQDA 1AQLA 5JYEA 1XC7A 3QYFA 3D6MA 1HT1E 3CTPA 4ABYA 3U1AA 4MPPA 1RHUA 3M89A 3MSCA 4I55A 4ZMSA 4B86A 5E9WA 3L70J 1N5JA 1G98A 2BKXA 2OSVA 1PJ8A 2FH5B 4P9NA 2VLIA 1JALA 5FPHA 2C99A 1KBOA 2BTQB 2NO6A 3C4JA 1Y42X 4LISA 4WA8A 4YTPC 1HWTC 3PXBA 4M3LA 3K9LA 5J5AA 3CCSP 1FDRA 3E1SA 3WMFA 3FPBA 5KUTA 4L0QA 5LWQA 3CZPA 2QG6A 1L1EA 3SQNA 4B2YA 4ZTUB 1RT9A 2XUJA 3LOQA 5CBPA 3KLOA 3RC2A 3ZWQA 4EENA 3QXXA 2ONZA 4IKOA 1X1AA 5E3JA 3REFA 1SK9A 3Q5PA 2GNAA 3CLRC 4FR5A 1I3OA 4IIUA 3CR7A 3I9NA 3N6XA 4LDPA 4D8WA 4QG7A 3QLJA 1OW3B 2KYRA 4JR0A 1ZNZA 2X2EA 4OA8A 1YQQA 2GVDC 4QYXA 3N76A 2IITA 5KBYA 2JLWA 4IWNA 1MAHA 3JD2A 2WJ4A 5FOUA 1ISPA 1OZHA 3AL2A 4DMGA 5LOVA 1A4RA 2GWHA 1GNRA 1Z0ZA 2A14A 4FTWA 2HDHA 1T2DA 1C3LA 5A5EA 4M49A 5CCBA 1G4AE 5LQRA 5CVJA 1HMPA 3ZV6A 3MS4A 2RE8A 2BGIA 3NI2A 4IOIH 2YBEA 2VLBA 1OROA 1JCCA 1Z83A 4LGYA 1ZW6A 2A5GA 1T9AA 4HNAB 5AHWA 5LYYA 1QANA 2Y0EA 5ALFA 1RJGA 3BHIA 1P84D 4A0QA 2V9CA 4FNOA 4JPZB 3C3KA 1JR3E 3HNRA 3N39C 3L7BA 2ZWOA 2WJ6A 2PWZA 1PJLA 2QD1A 4NX2A 4XGKA 3ZIUA 2HW8A 3P20A 5KSOA 4LTNA 4BEWA 4KTTE 3T99A 3UJ6A 1U5BB 3K6JA 4Y1EA 3HXKA 2D2CB 1XX6A 4OQYA 1XOIA 4DDMA 1I4LD 3OCYA 4G41A 4MYUA 3TLXA 2WWIA 3T7TA 3PX2A 4PAQA 5IDWA 3RCBA 1P75A 1YZLA 4CKZA 2CF6A 1KQFB 4CE6A 1FJGB 2Q28A 4KO8A 4YJFA 3FF1A 4ZXFA 4WZZA 4DLPA 3SG0A 4EPWA 1GQQA 4EHNA 5L6LB 3FVQA 4WH0A 3FOZA 1M7LA 3ITKA 1EUYA 2R9VA 1NJ2A 2AJBA 3KL4A 4JLJA 3KQWA 2EXXA 1OBFO 4K8OA 2O3TA 3G8DA 4R2MA 3NGXA 5EZQA 4JBXA 2IBZG 1X1RA 3GNSA 3PPIA 4GECA 4WOCA 2X8JB 2W2KB 2PKXA 2YXLA 3LX5A 1CKEA 4R6WA 1WETA 2GRJA 2HSZA 3V9AA 3LPLA 1DD4A 3V7UA 2H8KA 4KR3A 4PICA 3X2SA 4YPOA 2EZ8A 4H13D 4QOEA 2ERCA 2JVIA 3P2EA 1GQRA 1LBTA 3B70A 1DKQA 1NATA 3ML1A 2NU6B 3OZUA 1K5PA 4Q3DA 1LLQA 4WZBB 5B5EH 3EPLA 1T9CA 4JJAA 4UZFA 4AN0A 1SG0A 1KI6A 4DQKA 2WM9B 4FM9A 1OHHA 1WSWA 3CZ5A 3QVOA 2V55B 2QJYB 1ZR2A 5C8YB 3U5ZB 1NV9A 1UP6A 3QX7A 3H2ZA 1DO2A 2JJ8A 4NHEA 5CUQA 4YRCA 1BDMA 1P2FA 3WXMA 4B32A 3U1BA 5T8KA 4AS1A 3H1HG 5E9AA 2BLNA 3W3ZB 3H1LE 2R62A 5AW0B 2VPYA 3EQZA 4II2A 2GK7A 2HBZA 3S68A 1J1IA 5BSFA 2V3WA 1NF3A 2XQGA 1I1NA 3H9EO 1CY6A 4BDSA 4DYVA 1CFZA 2EBFX 2JGNA 1CUIA 1FPQA 1XDSA 2EGGA 4GC9A 3AJ8A 3HY3A 3PXCX 1EDLA 4YR7A 5F3RA 1S3GA 3A6ZA 3KZCA 5EMKA 1C80A 4WY4B 3OBBA 4MI9A 1CY4A 1DAMA 4FDLA 2AQIA 2Q3LA 3TLYA 2HEIA 1VP9A 4LAFA 4G0QA 4TROA 1FB5A 1LS1A 2CUKA 5CCHA 2JAPA 4WJKB 5KTMA 1U9YA 1R9MA 2HXYA 1S4QA 1D1TA 3QBTA 3QGMA 4NOLA 5I7FA 2O8DA 3GPDG 3KTDA 1SBCA 3GJTA 3EARA 2C8KA 4J0JA 1OWAA 1S9KE 5EYPB 2W2KA 3H65A 3SEFA 4C6TB 3FOWA 2BEVB 4ZJUA 1MZVA 3ILSA 3Q5DA 3VR2D 2ZWIA 4IZOA 2VUHB 3MXOA 2ADFA 3BE5A 5H81A 4DSUA 1UR5A 3H5VA 2XEDA 4RHTA 4FU0A 1EVIA 3L6BA 3CQ9A 4HQNA 1VMAA 1R8SA 4L5YA 1LFAA 4R81A 4EW6A 3MGBA 1JHMA 3UUEA 1YJXA 2O48X 3CRNA 1Y4SA 3L6CA 1DEAA 4JUAA 3DTNA 5CBKA 4K3AA 4F4DA 3GFGA 3AUJB 4FHCA 1T0HB 3BD6A 3U7QA 5GONF 2UDPA 3H1IJ 1N2DC 3ZTWA 4E5PA 4EOGA 3VMFA 1TYDE 2OORA 3AEFC 1WMDA 1DBWA 2AV6A 1L0LK 2VYNA 3ESXA 3NHZA 4YRLA 2IDZA 3L7NA 4YPCA 2YMYA 2DLDA 2YH2A 1WXIA 2TMGA 3H5NA 1UBSB 3NANA 1F12A 2YXRB 1N8NA 4Q37A 5I6DA 4D79A 5ERXA 3IV9A 3OZGA 4TXJA 3DFUA 1KEPA 2OD2A 3NOVA 1XNRB 1G8MA 2W6ZA 1DOHA 5A9SA 1AS3A 3IQWA 4IIDA 4QJ4A 5D87A 4DOJA 3H1AA 3KXKA 3N2EA 4R71A 3GGDA 1KK1A 2J46A 2OB1A 4J16C 2AC2A 2A5JA 3TR5A 3C7CB 1U6JA 4F45A 5K09A 3F6SA 4DOMA 2ZJSE 1ZL0A 4ALLA 4XKJA 2DJ5A 3OFJA 3S2ZA 3TIXB 3FR7A 1KZ1A 3BRSA 3EVEA 1JQ5A 4GI1A 4JYBA 2BFBA 2O2ZA 3DVSX 2GASA 1C14A 1XU7A 1K98A 2P68A 4NV0A 1L5ZA 4W6ZA 2JDID 3K53A 4OP3A 3IP6A 4CFSA 1B2LA 4JYAB 3C1OA 1G20A 1H23A 4E6EA 2XUGA 3BMOA 3C8HA 4JI6B 3IKLA 2WILA 4C6TA 3NTUA 4YLYA 1SCKA 2FPMA 3ASVA 2UVPA 3KR1A 4W4TA 2P79A 1PWXA 2OC9A 3KT3A 1E9SA 2XDAA 2JAXA 3A27A 2E76C 3D6UA 1P33A 2VDNB 4L75A 1G6OA 1EGAA 4YXDC 1K6JA 3L71E 2P35A 2R66A 3OM8A 4LMAA 5CG2A 5CBOA 1CEQA 4IV0A 1TD1A 1GL9B 2YFHA 4OEHA 1NDUA 3SP1A 4DM3A 2YMPA 1XG5A 4JUFA 2FDCA 4J2HA 4GAEA 2CC2A 5KLIB 3JYNA 3R44A 4HDQB 3H87A 2VRCD 3P0IA 1N3YA 4GLOA 1JA0A 2QM8A 1KMIY 2PTGA 3CO0S 1UJNA 2AFHE 2D2CC 1ZD4A 4RPHA 4ACAA 8ATCA 1T15A 3H2KA 2DTDA 1SQVD 4AF7A 2P6RA 3T3OA 4DIUA 1YCGA 1T4CB 3VTAA 3TD2A 3ETEA 1P44A 2IJGX 2E4AA 4HS4A 4P58A 2W2MA 2AK3A 2X8AA 1E63A 1U4NA 4IJQA 1ZH6A 1B8NA 3ESBA 4HB3A 1CF4A 3KKEA 4HRXA 3LCRA 3CPWO 3L7CA 4KQFA 1PRYA 1XTJA 1H9BA 1Q19A 4S1OA 2WWVD 5C4IA 2R68A 1GXSB 4HWOA 1G1MA 3A0RB 4UBNA 1ZV8A 4JSYA 1NV8A 5ETJA 2VH1A 2IHKA 3O4GA 4CPDA 3ZWCA 4P8RA 4J7XA 5CT8A 5IZCA 2CDNA 5KJ7C 3WKEA 4WSOA 4D9BA 2IU3A 4LY6A 5G40A 2C2WA 3IBGA 1V41E 4GZMA 1GL6A 5B6JA 1H2AS 1ZD2P 7YASA 3TLEA 5AVWA 5JJCA 2C1XA 2WC1A 3CA8A 4M0DA 3OCZA 2JI9A 1QU3A 3IPRA 3IEVA 3AEDC 2ZRHA 3NEJA 4LDNA 4NY1A 2D1FA 2ZB7A 2E89A 1AXRA 4DJGA 3ZYCA 4AECA 1NTOA 1TMKA 1VCMA 2A5FA 1JT2A 4DWVA 3DNMA 3GB9A 4YV1A 4OSEA 4S04A 3M4ZA 4DLBA 1I14A 1U7MA 4ZODA 4LFCB 4C01A 4J1NA 3QPUA 3U7QB 2P9FA 3NWEA 5ALPA 2H16A 2J31A 2W6QA 2XCQA 4MB2A 4N7BA 4QOIA 1VBFA 3G2QA 2O7NA 4OKIA 3Q1KA 5BN4B 5F2OA 5JNWA 1L4LA 2L18A 1PFUA 3JD1A 3P0RA 1XN4A 3NTNA 3PUVA 1ZQ1A 4G89A 1H2EA 2OD7A 1IJKA 3DCIA 1V16B 1RTTA 5KI6A 2G7MC 4ALKA 2VPWA 1M2JA 2Q5OA 2ZSJA 2WKRA 3R20A 4E2FA 4PVCA 3ESDA 1U0GA 5AVUB 2YZ2A 4LV5B 2XB2A 2NUTA 4CKEA 4GRDA 1DUSA 3F6PA 5C7OO 1V4BA 3OCCA 3T4PA 1NRXA 1I0IA 1T5DX 2NT4A 3DW1X 3UAOA 3EX7C 2YQZA 5B3AA 1MTOA 3A1DA 2C9ZA 4LMRA 3W5SA 4D8VA 3WGKA 4YACA 3HO6A 1NMXA 5KOJB 3F2VA 4B5KA 3C1TA 5AKLA 4L51A 3IEKA 3GHGC 5THKA 3SEAA 3GOHA 2FCRA 1JL3A 4N5IX 3WMRA 4I9FA 3IUEA 4D56A 4BU1A 1OB5A 2GA9A 2FZLA 3GDGA 3QMVA 4E1VA 4X92A 2C2ZA 3DV9A 1BTOA 3D4PA 4L5BA 3BXZA 1EVKA 4RM2A 3JZIA 4TMWA 1NJ8A 1VF5D 3BASA 3BWMA 4I4TB 2PGIA 4KTVE 2BJWA 3AUKA 1IE3A 4RIEA 3ZOZA 1GPYA 4AG6A 5C5EA 4CLRA 5BVZA 2V98A 1FW6A 5F9FA 3MQFA 3RVMA 2C7PA 4K88A 4DR4B 2JGEA 2J3HA 2YY7A 1NASA 2DR3A 1NKVA 2EATA 1JQEA 3GJ3A 2H63A 1VPVA 1M5UA 3I6BA 3VPAA 2ORYA 1LDGA 2OMKA 2O0HA 4RKEA 1ZL2A 3ABRB 3QOYA 1VA4A 3CKYA 1E9CA 1DMRA 1JAZA 4WLEA 3AW8A 5ALXA 4G65A 2B6NA 1C3JA 1JQ3A 1DSSG 1I8TA 1Q0LA 2Q1UA 4JJZA 1OVGA 1Q1EA 3DDOA 4OQMA 1FX1A 2OCKA 1YDHA 4KRYA 1YUBA 3SLKA 4EUKA 1EFTA 1FUUA 1WTAA 3G1TA 5K6TA 2J9GA 5E6SA 2J5UA 3CEHA 4EFKA 2J5QA 4C7NA 4C3OB 2QQ0A 3UB3A 2D2EA 2XV1A 1GR0A 3K1TA 4G2TA 2XXBA 3DXXA 4OQ4A 4K40A 3AE5C 1YHQP 4XWTA 5FUWA 4KSCA 1SXHA 4LMPA 4IPTA 4R1NA 1XLUA 1J6UA 1ZI8A 4MS4B 5LUBA 2RGBA 1RJ9A 4R41A 1SD5A 3VBCA 2VBFA 1KYOD 1P5ZB 4W7IA 1QGDA 4ZT2A 4KR7A 1LUAA 5HBRA 1RWPA 4JOQA 2CW5A 2ZJ6A 3WIVA 4L50A 4X84A 4ZAZA 1VJGA 3SSUA 4UBJA 3RRZA 5ADHA 2FG6C 3LD9A 3CH4B 4M99A 2IHUA 3U13A 3TH5A 5CDFE 3EVDA 2IU6A 5G02A 2P30A 2QTVB 1SPBS 2DLNA 1V7CA 3BWBA 1TZMA 4JY7A 4KXVA 3WNCA 1DP4A 2Q4TA 4INJA 2YWXA 4MV8A 1GILA 3DA8A 3NBKA 1WQ3A 2V7EA 1K8AQ 3E5RA 3FSGA 3NBUA 1BN6A 2ASVA 3NPMA 3QMMA 1T6YA 2EV9A 4URXR 4Q3EA 1XZQA 4MJ3A 2A7XA 3F8TA 4HXYA 2QE7H 2ZJFA 4BV2A 4L4YA 1YJAA 4MRNA 3GLHB 3WBBA 1YQTA 1NVTA 2FQWA 2V6FA 3QWHA 3ROGA 4KPUA 4EKEA 4TSKA 3NC0C 4QGAA 5B2FA 1FZFA 2OXFA 3R4YA 3QU9A 1QHXA 4K6CA 4TQUS 5DBGA 3HKCA 4ND8A 3KQTA 4HPWA 5LZ8A 3I2KA 4AJLA 4QUGA 5JXWA 3ZD7A 1U0FA 2OBYA 2FPPA 1GDTA 1SVLA 2P5YA 2WA1A 3CLUC 3THSA 1ZG3A 3HB5X 3Q3IA 4HGOA 5J5CA 4D74A 2Q5UA 3UA3A 5DW3A 1W94A 1HF3A 3C43A 3AR7A 3UFXA 4YREA 4F5WA 2ZULA 3AVQA 3SEQA 3EASA 2R6ZA 3DC7A 3ND6A 4AI6A 1DFIA 4K3VA 1EIWA 4NS1A 3GH3A 2ZUUA 1CP2A 1TAGA 4DFDA 2ZTVA 1UXOA 3H5AA 3U5TA 4PBTA 5FRDA 1A88A 3V42A 1N2XA 3OQMA 1W8DA 1YRAA 3OMLA 1XYGA 2AF3C 4DB2A 2UZAA 4ZANA