2JKVA

Structure of human phosphogluconate dehydrogenase in complex with nadph at 2.53a
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
482
structure length
482
Chain Sequence
b'AQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
publication title Structure of Human Phosphogluconate Dehydrogenase in Complex with Nadph at 2.53A
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 182
structure length 482
sequence length 482
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2jkvA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2jkvA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2jkvA01
2HJSA 3OIFA 5DDIP 2O3QA 2PZJA 3TN7A 2HUNA 4FB5A 2RCYA 4J7CA 1NP3A 4OMUA 5A3JA 2BELA 3AOEC 1XKQA 4FJ0A 3QVTA 4GAEA 3NTOA 3ZGYA 5AVOA 5JAIA 3B6ZA 3R1IA 1XGKA 3RAJA 4AJIA 4E5NA 1D1SA 4WPGA 2P91A 2E82A 4LK3A 3H9QA 3GR6A 4PG6A 3ZI0A 5G4KA 4CLXA 5L40A 1SEPA 4PG8A 4BNIA 3RUIA 2PD3A 3DONA 4LVCA 4E2WA 4NFSA 3MWDB 1F0YA 1R4MA 3DBRA 4ZQFA 1HDCA 4DQVA 4FC6A 2CDAA 3WQSB 4R5HA 4Y6RA 3TDKA 4AICA 3B1KA 3AI3A 1IPFA 1Y7TA 2O7SA 3F1KA 3FTPA 3I9NA 4FSHA 4FW8A 4IMPA 1NFFA 2ZQZA 1GCOA 3NX4A 2VYVD 2PTGA 1J6UA 3KOUA 1X7HA 1WPQA 4PG4A 4J6FA 3NTRA 1ZMTA 3ANMA 4CMEA 4I8XA 3OQBA 1O0SA 1LC3A 4D3FA 1JLLA 5I7EA 5L95A 4NHEA 2OO5A 4WUVA 5F21A 3D4NA 2IRWA 2X0JA 3UCEA 5CDYA 2B0JA 5F5LA 2EGHA 4JJFA 3RBZA 2AQ8A 5FI5A 3GNQA 5DF1A 3CIFA 2NADA 4WOKA 2X9NA 3COSA 3AM3A 1LXCA 3HG7A 2YHUA 4XJSA 3WFIA 4JBIA 1R4NA 2C29D 4LISA 4IPTA 1NQ5A 2YJZA 4CM8A 5CDSA 3Q3CA 1LLQA 5IJZA 1I24A 4CMJA 4ALLA 1QLJA 3DEYX 8LDHA 3TJRA 3ZNOA 2EKQA 3RC9A 4D46A 5B37A 1E1MA 1UZNA 1DFGA 3E03A 4CV1A 1Q7GA 1NVMB 3P5SA 3QWFA 4M54A 4W6ZA 1ISIA 5T6BA 3OECA 3GT0A 3ZU4A 3O8QA 1LSUA 3HSKA 1YKFA 2EKPA 1GAEO 4MIEA 4B7XA 4DBVO 3OFSA 1BXGB 4J7UA 3BMCA 3UCFA 2FHSA 1GU7A 4P4NA 4I08A 3H3JA 5THQA 1Q7CA 1I2CA 1XCBA 4D44A 4CUJA 3C7DB 3GH3A 4FOOA 2OP0A 3PJFA 2B4QA 3RUCA 1IHYA 3VPFA 1GPDG 2WYVA 3K6JA 3BYZA 3FR7A 2W2KA 3K30A 3BTUA 3LK7A 1O9BA 5T8KA 3L6EA 3RC2A 2PLAA 3LQFA 1ZXLA 4J9VA 5CG1A 2YDXA 1R66A 4UEKA 3SX2A 3H2SA 5BSHA 4TRRA 2RIRA 5IDQA 2DUUA 1PSDA 1MG0A 2C2XA 2D5CA 4QTZA 3H5RA 2B5VA 3HUDA 1T2DA 2PWZA 4U7WA 2VOJA 1HZZA 5JCJD 4WNIA 2NSDA 4PFJA 3GEGA 5EQFA 3QJ5A 4CM3A 3RUAA 3MCVA 2Y68A 1R15A 4Q3CA 3BMQA 1YXMA 1P1FA 1KETA 2DM6A 2ZJ0A 4XD2A 3E48A 4TWRA 4PZCA 4CLEA 1B3RA 5BNFA 3U62A 3UOGA 2BGKA 4B8ZA 4CR8A 1SB8A 3ZWNA 5F3RA 1SB9A 3SLGA 4PLYA 3P19A 3ZWCA 1OFGA 4QO7A 3Q0EA 2HRBA 1U28A 4HKTA 4L4RA 3CUKA 3O26A 3PHGA 3PP8A 2VHZA 2ZB3A 1SOVA 5FFFA 4TZTA 3TZHA 3Q9NA 4K6FA 4RQUA 4JP3A 1Q7BA 4L8VA 2ZKLA 1FXSA 2WMDA 4FBGA 4MVJP 2Z1MA 3GG9A 1T4DA 5CDGA 2H9IA 1AXGA 1R0SA 2ZCUA 1T1SA 5KVQA 4CV0A 3TOXA 3EZYA 3S8MA 5DBGA 2R6JA 2NU6A 3LT0A 2D59A 4Z9XA 1O89A 4IINA 4I5DA 5HRUA 3UUWA 4BS9A 4W82A 4TSKA 3WGTA 5G0VA 1XEAA 4CV3A 3UF0A 2ET6A 4KTTE 3LLSA 5C7OO 2G0TA 2VNSA 2V6MA 3KSUA 4NK4A 5TSDA 3E18A 1B0AA 3KZVA 3WBBA 1VC2A 5HBRA 4B4OA 3DBHB 4NI5A 5JMWA 4IBOA 5B4TA 3BTVA 4E2YA 2HO5A 3LSYA 2C59A 1Y8RB 4AG3A 2NVUA 3WQRA 5IFLA 3DZJA 3JQCA 3CXRA 4NU5A 3TQHA 4BKPA 1C1XB 4TVOA 5AOVA 2JD2A 4J43A 3LC1O 3DOJA 2DTEA 4Z3KA 2PKQO 5JO0A 3ANNA 4BGVA 4H16A 2NVBA 1EUCA 1LBEA 4IDFA 4OO3A 1SBYA 1P77A 4AL4A 3OIGA 5IZCA 1PZHA 2AW5A 2TMDA 2Q2QA 1BRMA 1PZEA 5TS3A 4NJMB 3N7UA 4IIUA 1CYDA 3BTSA 2ZTVA 2E6UX 3NJ8A 1M67A 5CEEA 1U9JA 3NJ4A 4FJ1A 4CQMA 4B8WA 1PJSA 5F1KA 3AI1A 4GPD1 2OUIA 3UVEA 4OXYA 2JAHA 1E3LA 1MP0A 1RWBA 2YQ4A 4HWKA 2FR0A 3QV1A 4QECA 1L7EA 5EIOA 3DB2A 4YT4A 1H6BA 3ZHYA 3G49A 4F45A 1VPDA 1NNUA 1JDJA 1PWZA 1IPEA 2QRKA 3E8XA 2W8ZA 2Y67A 4L73A 1EQUA 2I9PA 3OMLA 4E13A 4E30A 3V2GA 1O95A 3AWDA 3GVPA 4OSPA 4WGGA 1E1KA 4RF5A 1FDTA 2HMVA 1WVGA 1E0DA 4LRTB 2I5PO 2WE7A 4PLPA 1GFSA 2C5EA 1HDRA 3U9LA 1UZMA 4XQEA 3B20A 2E37A 4XEHA 3JQBA 3TF5A 5JAMA 1ZMOA 3M2TA 4MP3A 4MO2A 1H5QA 3WGYA 3DHYA 3E1KA 2AQKA 3SC4A 1LA2A 1E7RA 3R0IA 1QSGA 1DIAA 4ZA2A 2I6TA 2UDPA 1ZEMA 4WLFA 4Z9FA 3S55A 5ADHA 1SNYA 3DZGA 3GFGA 5I9NA 1Y8QA 1VJ1A 4ID9A 3QSGA 5LDGA 2O4CA 2DT5A 2QIOA 1O6ZA 3F47A 5GZ3A 5IDXA 1NTOA 2P9CA 2ZQYA 4XB1A 3V8BA 1M2WA 1JKFA 1ULUA 4E5YA 1XU7A 2WJPA 3ASUA 3U4CA 3GK3A 4J0FA 1T25A 1EVIA 1Z7EA 3IUPA 4MKXA 5JBIA 1VJ0A 1RYEA 2VRCD 1E5QA 3INGA 3PZRA 3DXFA 4J91A 3FCOA 3LF1A 3D64A 2GZ3A 4BUCA 4II2A 4BNYA 5K0ZA 3C1OA 5ILOA 3IS3A 2H63A 6ADHA 5BNTA 3KUXA 4UVGA 3AOGA 3LLVA 4RPLA 3AY6A 5KOIA 1GYPA 3EMKA 3JYLA 4IQ0A 2I66A 1LDGA 5C7LO 4CR6A 5CAEA 3VKUA 1SEVA 1T1RA 5EL0A 4IDEA 3PDUA 2Q1UA 2CVZA 4LN1A 4DIOA 5A9SB 4A7PA 4WLUA 3RKUA 4J16A 4EGFA 3RJ5A 4YJFA 1V0JA 1HF3A 4E5MA 3CMCO 5IDYA 4YEDA 4YJGB 1U3TA 3VPGA 3JQ9C 5EESA 3MJCA 1DRVA 3KYDA 1E7WA 3PWZA 3INRA 4GGOA 1Q1NA 4G65A 3NKLA 4YJHA 2JL1A 5HA5A 2QW8A 3WMXA 3A4VA 4W7HA 4CLHA 1ISGA 3ROMA 3NAQA 2JCXA 4RPGA 2VWGA 3ZWAA 2GASA 4JN6B 1VE9A 2ZTMA 2EEZA 2VWQA 5CPFA 4B4UA 4DIBA 3L4BC 2AQHA 1A5ZA 3PVZA 2O4UX 3S2IA 2PH5A 2FY8A 4UUMA 5U9CA 4IDDA 3K31A 1VKNA 2QYTA 3C3XA 3GN1A 4EDFA 3OJFA 2B35A 4BO0A 4PLHA 4YAEA 2FZWA 3LC2O 5BSFA 3HE3A 4RVSA 2EW8A 4URFA 4QFCA 1YDEA 1HSZA 2QG4A 1GTMA 3WSVA 1QG6A 1BG6A 1VJTA 3EDMA 3GF4A 5A9RA 2BGLA 3KHUA 5IN4A 2Y1CA 2YV3A 1QMGA 2NLOA 1P0FA 2FPIA 2R2GA 4JP2A 4YB8A 2VWHA 1PIWA 2DFDA 1MFZA 3FBGA 2DFVA 2HCTA 4I5FA 4Z6KA 1TLTA 2UYYA 4Z0TA 3FTNA 2H5LA 3IL2A 3T7EA 3IJPA 3GUCA 4QXMA 2EKLA 4WLEA 3CTMA 3OICA 4KMSA 2FRDA 3FWZA 3NDJA 3WG9A 4I1IA 4BO1A 1NQAO 3RI3A 2YDYA 3VVCA 2P5YA 2SCUA 3ZV6A 4CMHA 5EN4A 4B3HA 3GNTA 3FPLA 3AU8A 4F6CA 1J0XO 4GLLA 1X7DA 2WD7B 4OOEA 4ND5A 3HQ4O 1JKIA 5G4LA 3TPCA 4OM8A 2OZPA 1ZKMA 4DREA 3CEAA 4FC7A 4HNHA 5ITWA 1LRLA 3VH2A 4BGEA 1DRWA 3G79A 5COQA 4G5HA 3OSUA 3JQAA 3VZSA 4YR9A 3QWBA 2CMDA 5C37A 2ZB7A 3EAGA 1QYCA 1FDSA 5TRTA 3VPXA 1V9LA 1VKOA 3DZKA 4PCVA 1T2AA 4CM4B 4OKIA 2NTNA 2PY6A 4RLSA 5FWNA 2DBRA 3FF4A 4Q39A 1UP7A 5IDWA 3ZWBA 1CIVA 4BNXA 1IZ0A 1HKUA 3GOHA 3D5TA 1PJBA 4ROSA 1S6YA 3A28A 1EE2A 4GSLA 2QYSA 5KVCA 5DBIA 1OZAA 3SC6A 5I8ZA 5FI3A 3I9MA 1HLPA 4XZ3A 5I7VA 1IY8A 3GVIA 3HZZA 4GBJA 5JDIA 3ZCXA 3EYWA 3DAPA 4GVLA 1MLDA 1B16A 2DVMA 1HDXA 2E49A 2CVQA 2NM0A 3LT1A 4ZVVA 1MG5A 1IULA 1XWFA 5A4DA 2DLDA 4B3IA 1ULSA 2DQ4A 4HXYA 4GKVA 1NPYA 3RU9A 1Y5RA 2O3JA 3MJEA 1ZJYA 3AM4A 4WCFC 2HSDA 1ADGA 3K73O 1T26A 1L7DA 4RCVA 5L7YA 1ZK3A 1V35A 2PH3A 4MOWA 3FSRA 5G0TA 5DCUA 3BMOA 3L6DA 2EP5A 2HKIA 5HM8A 4MINA 1P0CA 4YT8A 1T2EA 2GN9A 2HK8A 3HFSA 4CMGA 4E6PA 4JBHA 3JQ8B 4PLZA 3D3WA 5DN9A 4D41A 5B4VA 4HX5A 3D1LA 1BHSA 1P3DA 3GDOA 1U1IA 4HP8A 3DO5A 1ZK0A 1DRUA 1NYTA 3QWHA 1JWAB 2VT2A 4IJWA 4BV9A 5EMHA 5KWEA 1SCUA 4AJHA 4XRGA 1PL8A 5DT9A 4YYZA 1PL7A 1OBFO 1D1TA 3VZPA 3WGGA 1T24A 2D5AA 4B3JA 3KYCB 4E21A 2ILTA 2VYNA 5GZ6A 1X13A 3WX0A 5IF3A 5J23A 1DOHA 4MDHA 2FR1A 1LTHR 3JQGA 4RVHA 1E7MA 3DMYA 1HRDA 4OSOA 1UXHA 4RPKA 3IUSA 3RIHA 1PGOA 4PVDA 3KEOA 4U8GA 1PJTA 4RL6A 1P33A 2YYYA 4IS3A 6LDHA 3RUDA 1DBVO 2OBNA 2OBYA 2VHWA 1OX3A 3CMMA 2EXXA 4HNGA 1LDYA 4RVUA 1QXSA 3NEPX 1BXZA 4QT0A 1BXKA 4AJPA 1KYQA 4CM7A 3WIEA 1ZZEA 5K6AC 2Y93A 2RH8A 3VAZA 4FQ8A 2W2LA 4OJNA 5JYDA 4IY1A 3E9NA 3M6IA 3K2BA 3RBXA 1B14A 2Y1DA 3OHSX 1J49A 1UR5A 2GSDA 2PFGA 2X5JO 4J3FA 1C1DA 1C3VA 5DZSA 2V6GA 3PJEA 3UXYA 3H65A 3UCXA 3OJ0A 3HB4X 4KDEA 5U4QA 3W4KA 3WGZA 1ZIDA 3A1NA 2AA3A 4PZEA 5DBFA 1EVJA 2P9GA 1GL3A 5ES3A 5JLAA 1H2HA 1H2BA 2VOEA 4Z0PA 4D0SA 2A4KA 3RSHA 2Y1OA 1SMKA 2YY7A 4KTVE 2GN6A 3H8VA 2F00A 3MEQA 4GI2A 1P31A 4BNJA 3JQFC 1TEHA 4AJEA 5KKCA 2J3IA 1I36A 3D5QA 4OIMA 4RVGA 1YGYA 3JYQA 4ZGWA 4Y98A 1E7SA 3PLNA 5JCJA 4R51A 3I4FA 1SC6A 4NR0A 3LDHA 2W4QA 2TMGA 3RUFA 3S2GA 1LUAA 1N9GB 2O2YA 2Q99A 1A7KA 1UAGA 3WS7A 1X1EA 4ND1A 3OBBA 4UREA 1QRRA 3GVXA 4NJOA 4QQRA 4FFLA 5BT9A 1NPDA 3KLPX 2I3AA 4R4JA 4BO6A 2Q4BA 5JDCA 3Q6IA 1F8GA 1JW9B 1RM5A 4CLRB 5I7SA 3QWAA 2X8LA 1N2SA 3LF2A 3MOIA 2OP1A 3AW9A 4ZRMA 1D4FA 1P1RA 1F12A 3SVTA 3OA0A 1LDMA 3UGKA 1HE5A 1LU9A 3LT4A 4WEQA 5FEUA 2VRBA 1ENPA 4IGEA 3TFOA 3GHYA 3STHA 3KXDA 4YAJA 4RJTA 4AJ2A 3RQSA 5KKAA 4DBZA 1ZCJA 3D4OA 5A9TA 3I5MA 3KBOA 2YZ7A 4WLNA 1UH5A 7ADHA 3ROQA 3X2FA 3PEFA 1NR1A 2EIHA 4EI2A 5BR7A 3GN2A 4NG5A 1I33A 2I67A 4D0RA 4R1SA 3DMTC 3O03A 1EBFA 4JX8A 5T64A 4I9NA 1LX6A 4HY3A 3HDHA 1V3UA 1DJQA 3K9QO 3OETA 4CQLB 2X1HA 3VDRA 5LCXA 4PIVA 4BHTA 1A9YA 1W6UA 3SJUA 4BNMA 4P22A 1YL5A 4XX0A 3TRIA 4BO4A 5KNLA 1ZEJA 1PJCA 4ZJUA 3ADPA 1LLCA 4MP6A 2Y1GA 5GZ1A 1E3JA 3FNFA 1DC3A 3UH1A 3FN4A 4P4GA 3HWRA 3QP9A 4R9RA 1KC3A 2D3TA 4AFNA 2YFQA 4IJKA 2Y0DA 1CDOA 3OEYA 5HS4A 3C7AA 1QYWA 5DNAA 1GCUA 4Q3EA 3QE3A 3ZNPA 3P2YA 3VH3A 4J1QA 4CM5A 4CMBA 4LVUA 3C7CB 1WZIA 3I52A 1E92A 3GHHA 4JJIA 1CERA 2D0IA 1EQ2A 2AEFA 4DPLA 2NQTA 3ZWXA 4IIVA 3WWYA 4YT2A 5U1PA 5KVVA 5IXYA 1IZ9A 3LYLA 3ROKA 4PLCA 3WIDA 4BKOA 3IC5A 4BO7A 2J8ZA 5A05A 3OF2A 4S1VA 4E32A 4XR9A 1Y1PA 3K5PA 4DMLA 4MJLA 3HDYA 1P1JA 1BXGA 4IDCA 1R0KA 3TL2A 3LU1A 3JV7A 1BVUA 2DTXA 1MC5A 1M6HA 1GZ6A 4NDNE 3RVDA 2FPPA 1ZUD1 3RKRA 3PI7A 1YBMA 3R3SA 4RF2A 4CR7A 4TKLA 2GGSA 2GUGA 3ONDA 5BQFA 2PK3A 4EEXA 3K92A 2JCVA 3OJLA 1X1TA 3F4LA 1MX3A 1MGOA 4IZHA 1EEHA 2Q3EA 5HWSA 4CJXA 4UEJA 2PGJA 4ND4A 2CFCA 2CVOA 1GV1A 4ALJA 4RDIA 4UVDA 4LSWA 4MIOA 3RC7A 4GMGA 3UW3A 5G2OA 3C24A 1DIBA 1Y81A 4JJGA 4BNVA 1I2BA 4FFOA 2Y1EA 1UP6A 5T8KC 3C85A 3DZFA 4YPOA 2GNAA 3W1VA 5KIAA 3VC7A 3PZBA 1K5HA 5AXAA 1DC4A 4L9RA 2BMAA 1IE3A 1BDMA 3ZNNA 3TL3A 2Y0CA 4RQTA 2XXBA 3WNVA 2GO1A 3BXXA 4ALNA 5AYVA 2AEJA 2Q45A 3ZHXA 5I7FA 2AG8A 2PD4A 3IP3A 2V6FA 1R16A 4JK3A 2EW2A 4TRMA 3DOOA 3L4SO 1LRJA 3S2FA 1DC6A 1Q0QA 4IXWA 3ITKA 2O3RA 1ZSVA 3I9KA 1DJNA 3F3SA 3GVCA 4GSKA 4OXKA 1L1FA 3TZ6A 2X0RA 3LC7O 1ZSNA 3BTOA 2DUWA 4XYBA 2X5OA 3ICPA 4YXFA 4NBVA 3MTJA 2O23A 1ISMA 3VZRA 1FDWA 1UXKA 5ENDA 5TC4A 4I5EA 3K8ZA 4W9NA 4BNWA 2G76A 1YBVA 3PFFA 1DIHA 2OHXA 1IL0A 4KQWA 2R00A 2W98A 3VTFA 3RWBA 4BO2A 1A72A 1T4BA 3WJ7A 2DPHA 3H9EO 1A71A 3GDFA 4ILKA 5ICSA 4XYLA 3E9QA 5L53A 5TF4A 2VHVA 3DR3A 4YQZA 4Q3NA 4MP8A 3L6OO 3DBHA 1RYDA 2DC1A 2O3UA 3Q2IA 1OMOA 4C7JA 1ADFA 5I9MA 4DC1A 4CODB 3H9GA 1XSEA 1Y8RA 1MC4A 1YS4A 4FFRA 3JTMA 4KOAA 1A4UA 2E4AA 3QHAA 1B7GO 3WWZA 1C1XA 2IXBA 3PK0A 4A03A 1QR6A 1YB1A 4D7AA 1DLIA 2DTDA 3WB9A 5JAQA 5B12A 1N1EA 3I4CA 2LDBA 3VKVA 3GQVA 4PLVA 4NJMA 1ONPA 4PRKA 1JN0A 2DKNA 1W4ZA 4OL9A 3EUWA 4BO3A 3RUHA 3MWEB 4JQCA 3S1LA 2C2YA 2W90A 4XYGA 3OA2A 3M1LA 4MVJH 3DHEA 1YQDA 2BFPA 1JTVA 3QY9A 2EG9A 3AFNA 3PHJA 4OAQA 4AJLA 4YRDA 1PJLA 4QFDA 4RZHA 1N8KA 1ZXBA 4NFYA 4DA9A 1IB6A 5IZCC 1H6CA 2NWQA 1FK8A 4QO8A 1E6WA 3S2EA 2J3KA 4FS3A 1C0LA 1ZH8A 1P1KA 3V2UA 5IXSA 4GX1A 4R41A 5H82A 2V7PA 1NVGA 3SLKA 3O9ZA 3DZIA 1TI7A 2DBQA 2GZ1A 2X9VA 2QZ9A 2AEMA 4UVHA 2J3HA 2VWPA 4IJUA 5AXDA 3MJSA 3A14A 3WGOA 4ZQEA 2YHIB 3OEWA 3ZWVA 4J4BA 1LJ8A 4TVBA 1YWGO 4FN4A 4Q3AA 4DYVA 5JPIA 3PGXA 3OM9A 3PDJA 1GQ2A 2BI7A 1NQOA 4BNFA 3FPCA 1DPGA 3GGPA 4QEDA 4YVFA 3CINA 1JA9A 1PS9A 4GVXA 3RD5A 4DWVA 4PLWA 4PG5A 4WASA 3ITDA 2A9FA 4O59O 4M86A 1PQUA 2VUUA 3JQBC 3T4XA 1EUZA 1KIFA 4BKRA 1YJ8A 4FOSA 4Y8VA 1UUFA 5BSGA 4Y67A 4TKMA 4CMIB 4YTEA 4XDYA 1KOLA 4E5PA 2YW9A 1TA4A 3GRKA 1QV6A 5H81A 3GRPA 1E6EA 1HDZA 1HLDA 1F17A 4ALKA 2JAPA 1PEDA 1WDMA 2P68A 1HE2A 1K6JA 3ENKA 2OORA 2B4RO 4QX6A 3QVOA 1HYEA 4M49A 3DDNA 1UDBA 5A5FA 4L76A 2BFOA 3V5NA 4YRBA 3RROA 4N5LA 4BNKA 3GY0A 4H3VA 1GYQA 1K0UA 1R0LA 4INAA 5A9SA 3PJDA 3PRJA 5JE8A 1HETA 3QQPA 3ENNA 4KWHA 4E3ZA 3E6AA 2XF8A 5DULA 3H3FA 1KEPA 3ICCA 3NV9A 4PLTA 1GQYA 4FGWA 4PN3A 1E3WB 2BGMA 4YJGA 1BW9B 1LRKA 4DUPA 5TT0A 3KVOA 3TWOA 3GZNB 4OH1A 2HJRA 4K1LA 4FFNA 1ONNA 3OJOA 1XDWA 1ZNQO 2H1SA 3NUGA 1P45A 2EHDA 1P74A 1GEEA 3ROPA 3W4JA 4R9SA 1I32A 3DBVO 2NV6A 1DXYA 1ZBQA 4Q9NA 5L3ZA 3WYEA 3GAFA 5ER6A 1ZW1A 1AHIA 4P4LA 1R37A 1WMAA 3OQ1A 4XKJA 3I9OA 5ICMA 4BB6A 1W8DA 3NYWA 3RC1A 2GYYA 2AMFA 3DZHA 1LSSA 1W73A 2DU8A 4B7UA 3W4IA 4WLVA 1DAPA 1O5IA 1BDBA 2LDXA 3L4BA 3L9XA 2O3SA 4F3YA 3GA0A 1K6XA 2BRUA 2ZTUA 3JQDA 3CKYA 4U6SA 3U4HA 3WBFA 4NFHA 3E5MA 3I9JA 3BHIA 4WK6A 3UAGA 1YE3A 2JCYA 1DFIA 4KZPA 1NWCA 3I6IA 3MZ0A 1YO6A 1E1NA 4AJ4A 1A27A 4IUYA 1BMDA 5CHEA 4CLDA 1RPNA 2AQIA 2DBVO 2J5QA 4XIJA 4E12A 2BFAA 1Z7BA 3UICA 4YACA 1JVBA 1U8FO 1HTBA 2O50A 2G1UA 1BWSA 5A03A 1OOEA 4H15A 4JCOA 4XB2A 1ZO8A 4YJDA 5KJEA 1ISHA 1ZSYA 4A27A 1X15A 5BNIA 1HSOA 1HYGA 2JD1A 1Q2XA 2FPGA 4J7XA 3G1UA 1WAMA 4WCDA 4MPDA 3CSDA 2WD7A 4D3SA 2HK9A 3RFVA 1HDYA 2C07A 4J1TA 4LCEA 1S7CA 4Q3DA 4BVAA 4YDRA 1V6AA 3KETA 1PZGA 1MV8A 4DL9A 1CQJA 2WDZA 3U3XA 1TB4A 1OC2A 3WXBA 2OGUA 3L9WA 1XHLA 4BNHA 2HMUA 1ONOA 1PU2A 1I3MA 5I8WA 1V3VA 3HB5X 1P9LA 2GRAA 1UP4A 3L0DA 3ORFA 4NBRA 3F9IA 3EZLA 4E5KA 1IOLA 5L4NA 4MVJF 3W8FA 1N92A 3WGQA 4CM4A 2FZEA 3H5AA 3RUEA 1JVSA 2GDZA 4HFRA 4YCAA 2XOXA 1ARZA 1FDUA 1PJ3A 3JYNA 4FFPA 4GMFA 4RPHA 3VOSA 5DOZA 3UFXA 3Q11A 9LDBA 3PYMA 5EPOA 3EHEA 4EEZA 1PQWA 1IHXA 3WYCA 2I65A 2OFPA 2YV1A 3QVSA 3ON5A 2HU2A 4MVJM 4R69A 2IE0A 1ZK1A 2ZJ1A 4B4WA 5L4LA 3CZRA 1EK6A 3IMFA 4TRNA 2I99A 3CPSA 3EC7A 1KS9A 4NIMA 4K28A 1EZ4A 2GERA 1KVSA 3AJRA 3H4VA 1DDOA 3JCZA 2WSBA 4M8SA 4FJ2A 3PQDA 3O4RA 2XAAA 1YB5A 4NPCA 2NTVA 4BNNA 2ZATA 1KY5A 5JDIC 1Y6JA 1JU9A 3DFZA 3H7AA 4S3MA 3TSCA 1B15A 3JQ8A 5CEFA 4BNUA 1LLDA 3BA1A 2NVWA 3INTA 5GMOA 5KCZA 2X9GA 1AXEA 1E3EA 4WCFB 3UHAA 4OHUA 5JC1A 3KM0A 5JSFA 1V8BA 2VYVA 4PGFA 1KERA 1U7TA 3C1AA 4EJ0A 3CZMA 2GPTA 4OQZA 2PZKA 3GMSA 4IGFA 4N7RA 5JW6A 2IYOA 3F5SA 3F6YA 3KYCA 3U4IA 2IZ0A 4FIZA 3QWIA 1EUDA 2P2SA 5JNLA 2P4HX 2A35A 1LI4A 1H6AA 2HMSA 4RLHA 1KVQA 2YV2A 2G5CA 3D0OA 5TJHA 1U8XX 1EVZA 2NU7A 2Q1TA 3PTZA 4Z9YA 2Q46A 4LMRA 3ZWMA 3PGJA 3BHJA 5JCXA 5EERA 2E48A 4MVJD 1D7OA 1QV7A 2X58A 5IN5A 3JQ7B 2C5AA 3ZV3A 1AGNA 3Q9UA 1HXHA 1PR3A 3HN7A 3RJ9A 3JSAA 4NNJA 2DAPA 4D43A 1F14A 3FD8A 5JO9A 2FN7A 1U5AA 2GCGA 4CLOB 2UVDA 2D1YA 1ID1A 4AVYA 3Q1LA 4IMRA 3RBVA 4K9DA 4UVEA 4OGWA 4XQCA 3BAZA 3EK2A 5CPBA 2ZYAA 4I9HA 4YA6A 4ZD6A 2IEDA 4N5MA 1MUUA 2PR2A 3A06A 4O63O 1NFQA 1GY8A 1YQGA 3TOZA 1E77A 8ADHA 1DAOA 4R01A 4WE3A 1JWBB 3GZ4A 5K6AA 3AM5A 3D3EA 4K26A 3ZU5A 5CDTA 3ZHBA 1TT5B 4P38A 2IEBA 4GGPA 4DPMA 3ZNQA 4BIIA 1I10A 2FMUA 5L7TA 1C14A 4WEOA 3SXPA 2X5KO 2ZB4A 3IIEA 1N7HA 1U3VA 3DBLB 3M2PA 5TT1A 4YAIA 3B70A 5TX7A 5F1PA 5CG2A 4E4YA 1EDOA 5L4SA 3RFXA 3ZWWA 4KUEA 3VTZA 4YRAA 1Z74A 1LEHA 1QORA 1WWKA 2C54A 1UJMA 4GQAA 1N9GA 1U2GA 1LC0A 3W6ZA 2QQ5A 4Q3BA 2BD0A 1UXIA 1CRWG 1GUYA 1U4SA 3NGLA 4ZU3A 3SEFA 3NT2A 1WZEA 5DP2A 4C4OA 3AUSA 1BSVA 3DOCA 4R54A 1E5LA 1I0ZA 3ZH2A 5LDHA 1YOVB 1FF9A 1UDAA 2WM3A 3U09A 4DMMA 5DOVA 4MVJI 4CLRA 2A94A 2X6TA 1GPJA 4U0KA 1K89A 1NASA 3BMNB 4M55A 5THKA 4IZIA 2CZCA 5I9LA 2B83A 3V1YA 4CUKA 4FDAA 4KP7A 3VDQA 2BI8A 4AJJA 2FSVA 4BV8A 1VSVA 2PZMA 1DIGA 2P5UA 3DC2A 4J4TA 2D2IA 1CETA 3AOEA 4UUOA 3KRTA 2VHYA 5KTKA 3WGHA 1PGJA 1D8AA 3DAGA 4A2CA 3U0BA 3VZQA 1NVTA 3QVXA 4EUHA 1KEWA 2V6BA 1W0CA 2B5WA 4MKZA 3PQEA 1P1HA 1NWHA 1ORRA 5L7WA 3PYXA 3EGOA 1OI7A 3IDSA 3KYBA 3NRCA 4RPJA 5ENVA 2QZZA 3B1JA 3TZKA 3WTCA 3GEMA 1M6WA 2GLXA 4CQLA 1PJQA 3IP1A 1O94A 3EY4A 4EITA 3MJTA 2X0IA 4B7CA 3E82A 2JKVA 3BIOA 5T67A 5JFOA 4LCJA 2GD1O 3VVBA 1GUZA 3DMTA 1ZVMA 4IDAA 1DIRA 4KWIA 2AE2A 1NR7A 2J3JA 4N18A 1U3UA 3HDQA 2Q1SA 4CUZA 4OYRA 4KUGA 5KJ6A 4GKBA 2JJYA 5T5QA 2IODA 5G4KB 1YL6A 3WQQA 3R3JA 1ZFNA 4OKNA 4W4TA 5JS6A 4QSMA 1SZJG 3GPDG 4B4VA 3F5QA 2EP7A 1RM0A 1QP8A 2D8AA 3RFTA 4YQYA 1R4MB 1Z73A 2Q2WA 3DBRB 4CM1A 2F1KA 4R3NA 5JMPA 2OXIA 3FNHA 1FJHA 2UAGA 1RM3A 4CMEC 5EJ2A 3WMWA 5G0WA 1LSJA 3DHNA 2BFMA 4E33A 3H2ZA 3AY3A 4WNCA 3H5NA 3PWSA 4XGKA 3GLQA 4ZQHA 3AFMA 3A9WA 4EBFA 2BH9A 3UKOA 3NDIA 5IG2A 1WP4A 4BKQA 5TJ9A 3ZN2A 2AXQA 2EJWA 4UUPA 2VYND 4Y9DA 1WLYA 5C3MA 3JYPA 1NAYA 3MJVA 2B37A 2AHRA 4YAKA 2PV7A 1YDWA 4BB5A 2CD9A 5MDHA 4PVCA 2O3TA 3G3EA 2CF5A 4R1TA 1M76A 1VI2A 1XIVA 2GN8A 3NT4A 4EJ6A 4ND3A 1HEUA 2Y99A 2JFFA 4RZIA 2I3GA 5JY6A 3DZBA 1HYHA 4GX5A 1EFLA 2EV9A 1E3IA 5BSEA 1R4NB 1GD1O 1K6IA 4PZDA 5AXCA 4R1UA 4CM8B 4GH5A 2EGGA 4A0SA 1PS8A 3I23A 3WR5A 4YBZA 3K96A 3JYOA 1NHGA 3TZQA 2Y05A 3I1JA 1MA0A 1VL6A 1XU9A 2RBEA 3V2HA 4M87A 3PLRA 2CY0A 1DLJA 2FSSA 1NM5A 1NQTA 4UULA 3DFUA 3AUAA 1HE3A 4HFJA 3O8QB 2JFHA 2W2LD 4XIYA 1YJQA 3PYLA 5ITVA 3WLEA 1LDNA 2VUSA 4CMCA 4ZN6A 1U7HA 4HFMA 2OOSA 3BMCB 3IKVA 2PA3A 4DQUA 5A1TA 4RV9A 1HDGO 1GQQA 1KC1A 4NBWA 4XDZA 3NGXA 3U4DA 2IZZA 4UAGA 1B8PA 4OXNA 4J90A 2W2KB 3JD4A 2P4QA 3LT2A 3ZW8A 2VRCA 2VTEA 2CUKA 3OH8A 1H94A 3GC6A 4E2ZA 3H9JA 3GPIA 2O2SA 4WKGA 3VPSA 1LQUA 5B4UA 1MXHA 4UVIA 1VL8A 3ZZNA 1N1GA 3QA9A 4XQGA 4R3WA 2PKRA 4YWJA 3ZV5A 4BNZA 1JAXA 4U6QA 4ZQBA 5JAZA 1AE1A 1NX6A 1NFRA 4XGIA 4IM7A 1PZFA 2WE8A 5G0SA 4CM9D 4Z0HO 4BO8A 4L74A 1HE4A 1WW8A 4MIYA 1E1LA 3BMQB 5CEJA 4J2OA 5EINA 3WTBA 4XJTA 2CF6A 4IQ8A 2PZLA 4MKRA 1WDLA 1NPTO 1VLLA 4DIFA 5JY1A 1Q0LA 4IS2A 2FR8A 4TQGA 3UN1A 4GX0A 3ZWYA 5T57A 2VTDA 1Y9EA 1B8UA 1ADBA 5A3VA 4W9NC 1GZ3A 1ZK4A 2WWRA 3PHIA 4BNGA 4HV4A 1K2WA 1PJ2A 3QLJA 2JFGA 4KDFA 3T4EA 3AI2A 1QYXA 1P1IA 3KTDA 2R00C 3PFWO 2PGDA 4AJOA 3WNQA 4M89A 1A9ZA 2IDZA 5KJFA 1QLHA 2QRLA 2RHCA 4ZQGA 5GY7A 1YONA 1CEQA 2X86A 3DL2A 1N7GA 1ISJA 3HNPA 4HFNA 1G0NA 1DO8A 2QHXA 1KBZA 2GN4A 1YBAA 5K9ZA 3WYBA 4G81A 4J9UE 4LRSB 1GEGA 3ST7A 5MGBA 2ZYDA 5TNXA 1KY4A 3VHRA 5A02A 1AA0A 4R1NA 1IUKA 2HLPA 2Z95A 4JXKA 4PLGA 3T7CA 3OIDA 3PIDA 1E3SA 3KLMX 3PIIA 3GUYA 3HDJA 1R12A 2VQ3A 1ENZA 2C7GA 3X2EA 1CWUA 1WNTA 4UEOA 4D79A 4DVJA 3OQ6A 1Y9AA 4NQZA 5C7IO 2IYPA 3K2EA 2NVUB 4E31A 2RHRA 1KVUA 2C0CA 2HMTA 2VT3A 3C1TA 2J6IA 3VPHA 2YQ5A 1YB4A 3ZU3A 3TFQA 4TRJA 3QIVA 4HADA 4R68A 4WLOA 2C20A 4ITUA 1O8CA 1EVYA 1SOWA 3KSZO 1SAYA 4BNLA 3DAFA 3OJEA 4BL5A 4CL8A 3OP4A 2WYUA 5L51A 1QYDA 4P8RA 2GR9A 3TZCA 2YHIA 3FNGA 1M66A 5AQ1A 3GGOA 2UV8A 3VH4A 1RM4A 2EF1A 3KV3O 4XYEA 3FI9A 4AJNA 2X4GA 4CQMB 1CF2O 1X7GA 2VZ8A 1TXGA 3EVNA 4CMAA 3H6KA 1EFKA 3ASVA 4BGIA 2GF2A 3ZDFA 3LZ6A 3QW2A 5TGDA 1NBOA 1GR0A 4ND2A 2G82A 2Q49A 4EUEA 2C82A 3RCBA 4OOFA 1UZLA 3F1LA 5A06A 2FWMX 3ZU2A 4CMIA 2BLLA 1ML3A 4TMFA 1V3TA 3F4BA 1GV0A 2NACA 1B26A 4KUHA 2HQ1A 2XPCA 1I3LA 2FP4A 1TVEA 1PTJA 2QRJA 3WJAA 1TT7A 2VZ0A 1B2LA 3KO8A 4DLBA 1EE9A 3G17A 5FYDA 1ISFA 1U5CA 1U4OA 4ONEA 3AU9A 4ZRNA 4A73A 2Q2VA 5CDUA 1I3NA 2VCYA 1DSSG 4LW8A 2D4AA 2PD6A 4XYMA 4DYDA 4ALIA 4CL3A 3WDSA 1Y8QB 1NAIA 1ENYA 3KEQA 4ESOA 5L45A 3SBOA 4IQGA 4NK5A 3JQ6A 2CDBA 5H83A 1YL7A 4M1QA 5FF9A 1I30A 1M75A 4DTIA 1E3WA 4X54A 4PG7A 1BW9A 4CV2A 4YT5A 1LSOA 2NTJA 2NU9A 1JQBA 3JD0A 2G17A 4LMPA 3GZNA 3L07A 2CNBA 5EQDA 2EWMA 4FR5A 3DWFA 1H9AA 1VL0A 4O5OA 4BMVA 3NT5A 4E2XA 3ADOA 1F06A 4ZICA 3IKTA 3JQ9A 1B8VA 2WD8A 5ILGA 4A5OA 3ANLA 1PGQA 3FWNA 1KVTA 3AY7A 4JBGA 4DLAA 1H6DA 3P2OA 1EK5A 4XWYA 3WSWA 1E6UA 2ZTLA 1I8TA 3JD3A 5IAAA 5JC8A 1YVEI 1I3KA 3I6QA 3HJAA 2JHGA 4U5QA 2HK7A 3E9MA 4FPXA 4FFMA 4KQXA 4J1SA 1XQ6A 4L75A 4HUJA 5COAA 2WTBA 2J5RA 4YJFB 1Z45A 1PQPA 4NH4A 4G2NA 3G1TA 2I76A 3U49A 4A10A 4NU6A 4J2HA 3U5TA 1Z6ZA 1Y5MA 1WMBA 3IOYA 4MVJA 5DP1A 3KYDB 1U3WA 1YQXA 4R16A 3CH6A 5TQVA 4NBTA 4YJHB 5ER9A 4GLOA 1OAAA 3V1TC 4DC0A 2WEKA 1BGVA 5A5EA 4XGNA 5L9AA 2VUTA 2DBZA 5B1YA 4A26A 1Q0HA 1UXGA 1LNQA 2YFHA 4B79A 1J4AA 4J1NA 5JXWA 5JYEA 2ZK7A 4O1MA 4JLWA 4Y6SA 3BZUA 1I5RA 1RKXA 2P9EA 4I9UA 4RORA 3DTTA 3GGGA 4J0EA 3WGIA 1MXFA 2X23A 1HT0A 4NBUA 1DC5A 5CFZA 9LDTA 1XG5A 2ZCVA 2OMEA 3CE6A 4D42A 4IJVA 4BO9A 1SPXA 2V65A 2C7VA 3AUTA 1XYGA 1H93A 3DQPA 4CQMD 1HWYA 4D3DA 1AUPA 2Q4EA 2A92A 1KVRA 3IAHA 5TLSA 2ZB8A 1NXQA 4WJZA 4DXHA 2IXAA 4DPKA 2VNAA 1YRLA 1BVRA 1XA0A 1H0KA 1LQTA 1PR9A 3R6DA 3NDRA 4NMHA 3FR8A 5DCWA 1XQ1A 3I9LA 5LC1A 4CMKA 1HL3A 2Y0EA 3ABIA 4ZHSA 1A7AA 1VRWA 2RH4A 4EUFA 3GVHA 1GZ4A 1R6DA 1ZJZA 2B4TO 3KB6A 4DGSA 1FDVA 4DRYA 3CTVA 3GAZA 1I2ZA 1PGPA 1XELA 3PHHA 2UUPA 1PGNA 4W99A 1JKJA 1K3TA 1PJ4A 3P7MA 1C0PA 1PS0A 1D3AA 3MTGA 3RU7A 3I83A 1UDCA 2BHLA 7MDHA 1G0OA 3ZWOA 2OL4A 3FRJA 1MB4A 3HN2A 1T2FA 3ONEA 1MFPA 5A04A 4WOJA 2NU8A 1H9BA 3JQAB 3Q2KA 1X0VA 4EZBA 1G6KA 2CDCA 3JD1A 4PRLA 4L0QA 3M1AA 1KEUA 4RO0A 3WOHA 1WXDA 4GWKA 3AK4A 3O38A 4HBGA 2IZ1A 5HTOA 3IJRA 4N54A 3FHLA 4JNKA 4TZKA 1Z82A 3ETGA 4BKUA 1N5DA 2X7HA 1LLUA 5F1OA 1E7QA 4RVFA 3HHPA 3VH1A 4O6VA 2ZIZA 2Q50A 1XLTA 3WICA 2ZYGA 2FOIA 3PJGA 4WCFA 1BTOA 2PNFA 3HADA 3QVWA 4EW6A 4RDHA 1EBUA 2BKAA 2VZ9A 4IDGA 3RASA 3ULKA 1QKIA 3ZV4A 1VSUA 2UUOA 3GDGA 4BOYA 4JROA 5KJ1A 4EYEA 2VN8A 3D4PA 4D45A 2DPGA 2Q1WA 2HRZA 3MOGA 4GL4A 1NHWA 5HS6A 4CM6A 3H9UA 4MVJG 4II3A 3WFJA 2VHXA 3GFBA 5C5IA 5G0UA 1WDKA 3MJ4A 3W8EA 1ADCA 4R5MA 2YUTA 4U0JA 1Z75A 4LSMA 4BMSA 1LDBA 4EJMA 1VM6A 3W8DA 2HDHA 3BMOB 1FMCA 4K6CA 3V1UA 1UAYA 2Y66A 3JQ7A 3B1FA 3D3WB 4BGUA 1RJWA 4JGBA 1YH3A 4YAGA 4OQYA 1IYZA 3FBTA 4RF3A 3SJ7A 1EDZA 1HZJA 1P44A 1U2DA 4JIGA 1AVYA 4CLOA 5TIIA 3ETEA 4J49A 3GG2A 4RVDA 3IQDB 1A4IA 1PL6A 1C0KA 3PHLA 2Z1NA 5IZ4A 1XR3A 1B3BA 3W6UA 3C8MA 4O0LA 1DB3A 3JD2A 3JQGB 5DCYA 4BNTA 4FGSA 4AJKA 1AHHA 4GWGA 2HMWA 3ZWPA 1HDOA 1TT5A 3E5RA 4L4SA 4XA8A 5KVSA 2AG5A 4FCCA 1CQIA 4RF4A 2EJVA 4AJ1A 4F46A 4TROA 2CSUA 4QUKA 4I5GA 3JQEA 3ZW9A 4CPDA 3N58A 1I01A 2XXJA 1CJCA 1GADO 4F6LA 2HAEA 3DBLA 4J4HA 4C7KA 1J5PA 2JD0A 1DHTA 4IDBA 1LDEA 2O48X 3F46A 3EVTA 3ETDA 1SO8A 3BHMA 1GDHA 1JAYA 4BQRA 2NUAA 4Y6PA 4MVJE 5KJCA 4FD3A 4ALMA 4BO5A 3QRWA 4BMNA 3DTYA 4E0BA 3JQFA 3N74A 1X0XA 1C1DB 1DFHA 3PWKA 2AE1A 2WYWA 3HFGA 1AN9A 1G1AA 1YOVA 1NAHA 4GX2A 4XR4A 1OC4A 1GYRA 1X14A 4XCVA 4IXTA 4XRRA 3L77A 1C0IA 2NNLD 2PGLA 2RAFA 3LVFO 5CP8A 3BMNA 1EMDA 1PWXA 1T2CA 4Z3DA 3NTQA 5AXBA 1DEHA 3GNSA 2B69A 3AUUA 2POQX 4RGBA 2X22A 1GUFA 3GEDA 3JQAD 4H7PA 5COBA 3TNLA 2PKQP 2X0NA 3FNEA 3GMDA 3G0OA 4L4XA 4PLFA 4W7IA 3ZHZA 2NQ8A 5F5NA 4N5NA 3WLFA 1ENOA 4BQPA 1E7YA 3ONFA 4NZ9A 2H6EA 1UXJA 2J5KA 2EERA 2Y1FA 2JHFA 2Z5LA 3PQFA 3D7LA 4LGVA 2QX7A 3PPIA 4WECA 3KSDO 3PXXA 2B36A 1KEVA 1F8FA 3EW7A 1ZK2A 4XQ9A 4DQXA 2GZ2A 5JDCC 4CM9A 2O7QA 4UUNA 1PX0A 3I3OA 1QYVA 1DHRA 2BF7A 4DLLA
chains in the Genus database with same CATH superfamily
3BXZA 3L3BA 1LS1A 3I2IA 4J7CA 4H0LD 3AOEC 3NTOA 1BYUA 3L73D 3LVBA 3COWA 4WIAA 4E5NA 2ZRLA 3L0OA 1L0LE 3H9QA 2LVBA 5G4KA 4JL6A 4C3VA 1VCNA 3V4LA 3LPLA 2UZ4A 4FC6A 4KR2A 1Q1AA 3ZG6A 3EFGA 4ZCMA 2HF2A 2JZOA 5DNEA 1JPVA 1EA5A 1JLLA 4CKBA 5DXAA 2P1JA 2WP8J 5CDYA 3D4BA 1SKBA 1K66A 4YLGA 1ZJJA 1AD2A 3LL4A 1HGZA 2X9NA 4C2BA 3PUVA 4DLTA 2POHA 2QN1A 1QLJA 1UQTA 4ENQA 3KUKA 3RVNA 3SJCA 1Q7GA 1SOAA 3AXTA 5GONB 3S68A 3O8QA 4RU1A 5C8YA 5JSYA 2IFMA 2Q3FA 5HZHA 1P8JA 3AJDA 3M4XA 5THQA 4ZCQA 1CUFA 3H0KA 1FP4A 1GPDG 2WYVA 3BYZA 3BTUA 1ZCZA 2ZTSA 3T5PA 3LQFA 1XAHA 4WBNB 4FWTA 1CQZA 5HGJA 3H2SA 1I14A 4X20A 2BC9A 3AHGA 1M1NA 1QRTA 3I73A 3AV3A 5REQB 4CM3A 3EOZA 3TW8A 2X77A 4M1SA 2G3AA 5CB4B 1DEOA 2FMHA 1NOJA 2Q5LA 1CZOA 1PZXA 1V8DA 3JSVC 3R7WB 1EDLA 2P6MA 5J2TF 1Z0AA 2HA0A 5B1EA 4TZTA 2V8BA 1PT5A 1VL2A 2FR8C 4C6TA 5FB3A 3X44A 3T3GA 3K05A 3AINA 2CMHA 3WLMA 2DYKA 2H2AA 3L1UA 2UWJE 2B4KA 4BC1A 1P8AA 4YBRA 4RH3A 1DKOA 4JWTA 1XPUA 2IVFA 4BWFB 4L3WA 2V0CA 3DOJA 1UINA 4JIMA 1K4YA 2AWOA 2WD9A 1PZHA 5CEEA 3AI1A 1QRDA 3R74A 2QTVB 3DF7A 3OMXA 4RA6A 4QECA 2YWXA 3OM0A 2VXOA 1HLGA 1P81A 3PQ2A 3OLYA 4EJ2A 3HUFA 4K9RA 1N36B 4OSPA 3UOWA 3MMSA 3W2HA 4ERNA 3FJOA 5IHXA 3RWMB 2I5PO 3AR4A 1GG8A 4Y1FA 4XEHA 3BCCD 3KJNA 1T8UA 3L2OB 3C1LA 3K9WA 3MWGA 1NKTA 5ALSA 3TX6A 4OQDA 2P9CA 1JKFA 4LHXA 3QTTA 3OTQA 1Z7EA 3IUPA 1RYEA 2C9YA 1J0EA 1NTKK 1WKBA 2C2OA 2GZ3A 3PF8A 5K0ZA 2H63A 3EGVA 4IOJA 1IK9A 4BX9A 1LK5A 1OXSC 1LDGA 1XDDA 3LJKA 2BMFA 2W42A 1Y1RA 3DJYA 3FYUA 5DHTA 3Q8WA 2A1UA 3N39C 4WY5A 1IEVA 4RHFA 3BASA 4WK2B 4YJHA 3D6HA 4ZT7A 2GCPA 3A4VA 2P7HA 1WZ2A 1U0GA 4CHTA 5KNBH 4EJSC 2GJ4A 1L5KA 3LFUA 3CT4A 5CPFA 3D5EA 2R4UA 2A45I 4N1AA 4KPFC 3C3XA 4PFSA 4DDVA 3MK31 4R8RA 4JOBA 2L82A 2QG4A 1PNOA 3S3TA 2D74A 3MWKA 4LJ4A 2DFVA 2J45A 4YRCA 3CTMA 3SEAA 4A8TA 2XEXA 5JMTA 2GPYA 4XB6B 2XRFA 4IP0A 1UEIA 4AXBA 3ZK9A 4ND5A 5BSWA 1SQVE 2RN0A 1TUBB 5COQA 1QVVA 2J67A 4P82A 2RI0A 5TRTA 2P10A 4IIBA 2PUDA 1CIVA 4BNXA 1BO6A 1B73A 3D5TA 3VM6A 3AC0A 5BN5A 4LY0A 1SCBA 3TJZA 3F3MA 3EYWA 1B16A 1HDXA 2DVMA 3AVQA 2O54A 4N0MA 4IOKA 5KEIA 2AN3A 4XUCA 5BUZA 4A1FA 1RAAA 2WIJA 4D9NA 2GN9A 1D0VA 1FQWA 5DN9A 1PV4A 1H2FA 3WIBA 1MNAA 1CX9B 1FB5A 3SDBA 4QPDA 4YYZA 1T24A 3KYCB 1M1YE 3P26A 3SSAA 4BMOB 4X3OA 2OFFA 2HWXA 4W8HA 1NI4A 1U2DC 3CWZA 2XWPA 4IS3A 2R6GA 3TLCA 1Y4ZA 4PW0A 4FKBA 4OFWA 4N3NA 1Z07A 1BXKA 3WY9A 4ZOEA 1ZZEA 3QEMB 3AVYA 3IE2A 1KQNA 2ADMA 3M6IA 3K2BA 2QJPC 3PJEA 4NENA 3L5OA 2F67A 3SICE 5U4QA 2V8OA 2CVHA 4KMMA 1SQPJ 4UMEA 1FRQA 4EHBA 5KKCA 5J63A 1IHDA 2EATA 3AZQA 4KCGA 3UENA 3B53X 2PH7A 3OQIB 1LTSC 1PI3A 3ZJUA 3PXBA 2UXCB 1CZQA 1UAGA 2R66A 4M7OA 5JDCA 3AJEA 2OILA 1KZYC 4CG0A 3QWAA 4HLUC 1N2SA 4OFXA 3MOIA 5KQSA 1AO0A 3OA0A 5FEUA 3QPVA 3P0RA 3GHYA 4RV5A 4M1WA 1R6TA 1BDDA 1ZCJA 1UH5A 3IKMB 4IL6E 3OZEA 5B2FA 3X2FA 5ALVA 3GN2A 2PSJA 4FZ3A 2J7KA 4DWWA 4C29A 3E1GA 3MTUE 3HDHA 1DJQA 2W8BB 3JXEA 4BNMA 5CU7A 1Q0RA 1BE1A 3FNFA 2XCLA 1DC3A 1NYQA 1Y8CA 2OCAA 1EB9A 4A0FA 2Y0DA 5HS4A 4OV6B 1IRIA 5DSZA 3TO5A 1QYWA 3G2MA 3KEGA 4KPUB 1M3SA 5EXDA 5HIAA 3WKBA 1IOZA 4A6EA 3ZWXA 4D9GA 5EMNA 2O20A 4AUKA 2QOEA 1PZNA 5HE9A 4D6PA 2IU0A 2Z4EA 1NT4A 4DMLA 5D3KA 1S1CX 3DV2A 1RBMA 3QMPA 1VI5A 5ALOA 1U0BB 4F5WA 3M6VA 1QHSA 4ZHQF 4AKHA 4EG8A 1A98A 3EQ2A 4IQFA 2G9RA 5BQOA 3RJTA 3FXEA 4R7TA 1MEJA 1U7OA 3BZWA 3TG8A 1QLED 4L9RA 1D03A 4JVOA 4MUNA 4NTZA 3AXSA 1HZZC 4DHWA 5JAPA 1LH0A 5BVGB 2CV2A 2H7VA 4KQGA 4FHFA 4HNVA 2X5OA 3ICPA 3LUKA 3Q88A 4RCYA 3MWLA 2O23A 3VZRA 4MMZB 5TC4A 4M1OA 1OCEA 3ER6A 5FEMA 1DIHA 3BT7A 5IK2A 2FSGA 3AI7A 1XZPA 2W2OA 5L53A 3UKDA 3BORA 4DG8A 3IBCA 3Q2IA 4AY4A 1O77A 1ADFA 4CODB 1KQLA 1A4UA 1Q16A 3ODPA 4QA9A 2YINC 1RXUA 1T2UA 2UZ1A 2PRSA 3HH8A 4PLVA 3AWIA 3HZOA 1O6BA 3OZBA 1LW6E 3DHEA 2H5EA 1YQDA 1QFMA 3DEJA 2AL7A 3P4UA 1IB6A 4MYHA 3Q1KA 1YS7A 3IUQA 2ZE6A 5EKUA 1T5LA 4R41A 4XI9A 3DLIA 2J3EA 3E3AA 1K7SN 3UC9A 4FK8A 3H1BA 3ZWVA 5FTMA 4IAOA 1NIJA 3PDJA 1GQ2A 2IY7A 3WKEA 3CH4B 5BN4A 4HZUB 2ZQ5A 1PS9A 4PLWA 2A9FA 5LFAA 3NIWA 4M86A 2NNWB 2PYIA 4NCIA 1DQPA 3VAYA 1K27A 5J9FA 4A36A 1HTTA 3I6YA 1UAAA 4DDUA 3B2EA 1NZDA 3K16A 5HUHA 1K6JA 4C01A 5F9MA 2P1DA 3PSAA 3DDNA 3OT5A 1UPXA 2VXCA 4OSEA 4KDRA 4H3KB 1XBTA 4ZOCA 5IT9A 5A9SA 4LDAA 3GCWA 2PZGA 1PK9A 1DQYA 3HN6A 1QGYA 3GZNB 2GBPA 1JDUA 4YTPC 4TTIA 2ZPAA 2NV6A 3I9OA 3C4QA 3IIJA 4UBKA 3L9XA 2O3SA 3AR7A 4QUJA 2F1IA 4NFHA 3BULA 5E9AA 4P53A 3GD5A 3NNSA 1TM7E 1F2UB 3CNHA 3P71T 2IDMA 1E1NA 2NXCA 1T0IA 2R2AA 2RGAA 4LSZA 2J4CA 1SQXE 4PQFA 4J8PA 4MLZA 1BWSA 1JAZA 4BVEA 1I4LD 2PYDA 1TF7A 1F0NA 4V3BA 3WGJA 4EMSA 4C0JA 1J2JB 4MPDA 1NU1E 5CFLA 3CRMA 4LZNA 1Z6PA 2ON6A 5M34A 5GP1A 1OC2A 3WXBA 2OGUA 4Z4GA 1BE3J 4KPGA 1EAMA 5LP6C 2MINA 3AEXA 1DPFA 3K94A 1V96A 2FX3A 1PK7A 5K3FB 3IODA 2Y9YA 3G0BA 4FFPA 5E79E 4GMFA 1OZGA 3KQNA 3CO5A 1HUQA 3EHEA 3DOHA 1VCMA 3DNPA 1YRQA 4WY2A 4BWVA 1TIBA 1M33A 1ZXGA 1AK1A 3DPIA 3OM8A 3P2EA 2JFPA 3QVUA 4Y2TA 2FEAA 1KSGA 3WL8A 1JDPA 3BA1A 3PBKA 1WTCA 1AXEA 2WQYC 4FT2A 2OSVA 1UC4B 3VC1A 2DH5A 6REQA 3K0AB 5CJ4A 3F6YA 4BU1A 4NMMA 1INLA 2NU7A 3ZWMA 4UTNA 4G0OA 4LJ6A 3ETLA 2X58A 3P9IA 3P0JA 5LLDA 2A30A 1P4GA 1N9KA 3FE2A 2FEPA 4K6KA 3IP7A 4OQXA 4D57A 1BHO1 2QQ0A 2GCGA 4CLOB 3OJCA 1L7PA 1U6JA 3EK2A 1OLXB 3PD1A 4YA6A 5D01A 1NSYA 4M22A 1NFQA 4HSGA 2Z98A 3CEMA 4MARA 2ZR0A 2WSSH 2FPLA 1BH2A 4P38A 3DS8A 4UJ3A 3A4TA 1I10A 5AW4B 5KCMA 2CLIB 3IYLW 3M2PA 1DJPA 1KOJA 5DX8A 3H86A 3TKAA 3L7KA 1WZEA 4NQRA 3EGDB 3HYTA 5LDHA 1KSJA 4UHHA 2ZYUX 3FPFA 2X6TA 1K89A 5JVDB 3T0FA 4HF7A 1RHRA 4A3SA 4MRSA 4UUOA 3L0SA 3DAGA 1BQ4A 3DWGA 2VK8A 3G13A 2RGUA 2E74B 3GRVA 4YY3B 4K87A 4RPJA 3HLTA 2VBIA 2W43A 1H4VB 4UJ5A 3Q2YA 2ACKA 2X0IA 2GA1A 1JFSA 4NJEB 2QRVA 2Y2UA 2Q1SA 4YJ2F 4EP1A 3D7NA 3WQQA 4OKNA 5SYNA 3O7WA 4KODA 1F38A 3WYDA 3NIFB 4TL9A 1PD0A 1FP6A 1KXJA 3QYPA 4OGQD 1ZP6A 1DJMA 4FP9A 3H8SA 1HT3A 5DEIA 2B9VA 4HRXA 2BYTA 4HMOA 4DJFC 5ALYA 3F7NA 5BU8B 1ZHFA 2CF5A 5KMGB 1AN0A 2QLJA 2A1IA 4YUXA 3QKWA 4YMHA 1K6IA 2PRIA 2IEAA 5LL6P 4P31A 1IOVA 4M87A 3PLRA 3MSXA 4M60A 3OLXA 1NM5A 2V9ZA 1UMDB 4UU1A 2JFHA 4HAVA 1W30A 5BRAA 2FN4A 2AS0A 4O29A 4IUCS 1Q7TA 2XCTB 4DMFA 1GQQA 2W6AA 1A97A 2IZZA 4RHTA 5MF6A 1ZY2A 1K04A 2I4TA 3FTQA 4H1HA 2FG6C 1VL8A 1P4JA 5P21A 5G0SA 3G2IA 1E1LA 2ZRKA 4CT5A 2IOQA 5EOVA 4S35A 4RFSA 2JIZA 4R7ZA 4N6OA 1ZK4A 2OCBA 1K2WA 2Y9MB 1P1IA 4N0DA 3PFWO 2P30A 4UTPA 3L8HA 4DR3B 3OPVA 4AMBA 1TKCA 2I7TA 1HYQA 1NRWA 2VTVA 3TBKA 1N0VC 3LC0A 3H4TA 4AP5A 2P1RA 4OXRA 4HUQB 3L01A 2PM8A 3K2EA 4Z8XA 2NVUB 1MAHA 3RU2A 1CBUA 5APWA 5CIYA 1EVYA 1VLQA 2QT9A 2UV8A 4EW2A 3QFSA 1GTG1 3EVNA 1S96A 4M21A 4C0WA 4HEA6 1L0BA 3KQTA 4EUEA 4L0CA 1E79A 3ZU2A 5C8ZA 2VHEA 4HB2A 1V3TA 5FP0A 2HQ1A 2QLFA 3EDOA 3MAJA 1WXQA 1FFAA 2Q2VA 3ZVRA 3GF3A 4CG3A 4IEFB 4Y7CA 1NXXA 1ZQ9A 2IHZA 3ESBA 1N5IA 1LQ2A 1YL7A 2VPZA 4LHYA 2WUDA 1U7MA 4Q3OA 3CEJA 3H83A 5I8PA 4BY9E 5K05A 2CNBA 5EQDA 3DWFA 1B42A 1VQOP 2IBMA 2KS1B 3NAMA 3EXAA 2VUIB 2WF6A 3K32A 1ZLXA 5IAAA 4C3OB 4EABA 3CC4P 3ZDZB 2V0NA 4X61A 2SBTA 1EBBA 3J81A 1Z45A 1C9YA 2EX4A 2WJYA 4ADSG 4ZEWA 5DWVA 4QRDA 2RK6A 4ZJZA 4YRSA 3VTAA 4E88A 2WC1A 3F71A 2VQFB 3SQXA 4X92A 1T3HA 1MXFA 1ZD9A 3QE9Y 1BZYA 1YR6A 2O8DB 5TARA 3I2FA 3DDOA 2BGRA 4I1OA 4UNNA 4GU5A 2OQQA 5TF0A 2GCNA 3N53A 2ES4A 1GZ4A 1R6DA 1HURA 1XMIA 3CFYA 4KFSA 2X8JB 2BHLA 1L5SA 4DCPA 1PQ4A 1MB4A 1VXOA 4GWLA 3OE1A 5A04A 2NU8A 3Q2KA 4FHDA 2IPMA 3MVEA 1SQBK 3R0XA 3BGSA 4PBRA 4MQEB 1KU6A 2MMGA 1LBHA 2CHVA 5FAKA 4HQNA 3EVEA 5CK4A 4BKUA 2YFKA 3AL2A 1Q0ZA 1FNDA 3O8NA 5B1DA 1GVHA 3HADA 4OWFA 1CCWA 2IHYA 3GMTA 3HYLA 3RASA 1VSUA 4BOYA 5FHQA 2JP3A 1CSBA 3R3HA 4RTPA 3WFZA 3W8EA 1NUQA 3HM2A 2HWYA 4YK7A 4BMSA 1P7WA 1VE1A 3KE8A 3WRXA 4AKEA 4D25A 2G8NA 1EDIA 4FQ7A 1QU2A 2REBA 5D7NA 3L7JA 2DCUA 4W7YA 5IZ4A 3FG9A 4O0LA 2JFNA 4CG1A 4RM2A 2VHUA 2ZT9D 2EJVA 2D2CD 3GJ3A 1H05A 3C16C 3DYIA 1DQRA 5CRIA 1DHTA 2A0UA 2PGNA 2IXTA 2J85A 4YQEA 2P3SA 1XMXA 4KMRA 4UFPA 1M6YA 3QFHA 4GLJA 4E0BA 4I19A 1KJYA 4UQLA 1CIJA 1KPHA 4F7DA 1GYRA 3CZPA 5SZIA 3L77A 5CP8A 4KL8S 5AXBA 2CSXA 1U2GC 5COBA 3IQXA 4WOBA 4TKUA 4US1R 5DNDA 2K87A 3SSNA 3Q5SA 1NU6A 4IVRA 2QBYA 4B7ZA 4UUNA 1PX0A 5KAIH 3I3OA 1A5TA 2M1ZA 2CZGA 5DDIP 6AT1A 2O3QA 5A3JA 5JFGA 2C9OA 2JFXA 4Q15A 1OYVA 3OOHA 4NV0A 1Q74A 3RAJA 4BVBA 4G5SA 3WK7A 2W6BA 5IVKA 4PG8A 4BNIA 4NFSA 1U9ZA 4LOAA 3TDKA 2NAFA 2QMEA 2YS7A 4CF5A 1XZEA 3PFGA 4IIJF 4NESA 1FFBA 4DIUA 1F9EA 4PR3A 4HOYA 2BJVA 5EHGA 5L95A 4MAMA 4G1MB 5F21A 2IRWA 1ZC3A 1NLUA 2QUJA 3SWYA 3EE6A 4OQEA 3M4NA 2H2DA 1QDLB 3M83A 1PPJE 2GDJA 2C29D 2OCDA 2ZSDA 3U1CA 1GGJA 1E1MA 3TSYA 4EKYA 3GT0A 4I4IA 3SKXA 3CX5I 4LYDA 4ZNCA 5ELXA 3LW5J 4ZVRA 3GH3A 4AB1A 2W2KA 1GU0A 5EIHA 2PLAA 4J9VA 3IERA 4Z7QB 3SX2A 5BSHA 1EG2A 4OK6A 1C7RA 4Q9JA 1GHTA 3N8DA 2B5VA 2ZITA 1L4HA 2FK7A 3VZDA 1SU6A 3V4RA 4YUVA 4W80A 3WLSA 1T5OA 2ZRAA 4YP6A 4TWRA 1FMFA 1B3RA 4B8ZA 3ZWNA 4KV9A 3UT6A 1EE1A 5JADA 2R6CA 2P90A 3EWNA 1DV1A 2O8CA 1A8PA 2ZVOB 2VK4A 4GXQA 2M6LA 3SDZA 1NVEA 1IXZA 3ZOKA 2ZCUA 3EA4A 1G20B 1RZUA 1FVOA 3S8MA 3H2HA 5EJGA 3L7DA 4WB4A 2L5GB 4KTTE 2FSPA 4Q21A 2FMXA 2ZR8A 4C6RA 2ZW9A 4E2YA 3V8PA 4ZXFA 1VMAA 4OHZA 3H1FA 2JD2A 1DTEA 1E89A 4Z3KA 1L7MA 3QEAZ 2H1RA 2ORYA 4ZO8A 3I5YA 2ZTVA 4P4SA 4EKDA 4WZAB 3UVEA 1AQTA 1RHMA 3T7SA 2DUJA 1W5BA 1M8OB 1CE8B 1JDJA 1E2DA 3CGWA 5JASA 2EGUA 4LG1A 2KZIA 1E1KA 1PVOA 1S8OA 5SY4A 3B36A 4F2DA 3FFWA 5KPJA 2D1RA 1XF9A 1FUIA 1RWWA 4ZA2A 1R7RA 4LEIA 4U9HS 2R6ZA 2PU5A 1H3NA 1ORIA 3TI7A 4DR7B 5BRJA 1Z5WA 5LXTF 1OY1A 1JSRA 1T3TA 2FX2A 3IS3A 3A0HH 3AKYA 3LLVA 4RPLA 1XQVA 4AMZA 3EMKA 4PNHA 2QI9F 5FWXA 2NZWA 4QGAA 3W3ZB 2Q1UA 2CVZA 5AO9A 1GFWA 3R75A 4I55F 4P1ZA 3U1AA 1KMHB 4YJFA 4AWXA 4K7JA 2QU7A 1XEWX 3D7MA 3MJCA 1DRVA 2XUKA 2B3DA 4GGOA 4EBBA 2WSMA 3P5BA 3N2YA 3BWXA 3ROMA 3NOOA 1H8ED 1KAGA 2VWQA 1BGYG 1ZRHA 3L4BC 5D5HA 2R84A 2FY8A 4IDDA 5KTOA 5BQXA 4YAEA 2DLCX 3F8WA 4IVNA 3KUUA 2OM6A 4YV0A 2YN2A 3CNBA 3J7TA 4X8MA 3KV1A 3DPUA 3IJPA 1RF0C 5ISMA 4LV8B 1HFJA 2C3OA 3KU1A 1SKYB 1N2CE 2BL4A 3VYUB 1KZUB 3DD1A 4GLLA 3K53A 1JY2P 3TIFA 1DZ3A 1ZH4A 2C2ZA 5FUQA 3WSTA 3V1LA 5JJLA 4YR9A 4G24A 2Q2NA 4OP1A 1R4ZA 3FWHA 4CM4B 4XTCS 3RUPA 3I9V1 3ZWBA 1BKSB 2H0QA 4H13D 1KJJA 2FG7C 2QYSA 5I8ZA 2DF8A 2DPYA 1Z0UA 4EAAA 3ZCXA 2XUGA 4ZVVA 1IRXA 4HXYA 4OLAA 5HIMA 1Y5RA 4IZ6A 1LZLA 2JIPA 1NVOA 1XLTC 1ZGAA 2FA9A 4WOPA 1RF1B 2WWFA 2L18A 4YRFA 1THMA 4JB2A 1XK6A 2JR8A 1SP4A 5EXSA 2FZ5A 4L72A 1KR2A 4IJMA 5HOQA 5KWEA 4PHTA 2D5AA 1QJ4A 5TVKA 2HPCA 3DEFA 5JCPA 2Q5QA 3USSA 4GDFA 1LTHR 3GD7A 1HRDA 3LPCA 3ZDYB 4RPKA 3IUSA 4E1BA 1AKVA 3KUCA 1USWA 5LQUA 1FS5A 1KI2A 5HCIA 3EJ6A 1YC5A 1KZ7B 4IY1A 2G5GX 2XKKA 3DO6A 3LDAA 1Z5UA 1HNNA 3P0EA 4X8LA 5LUAA 3A1NA 3CNLA 1IZ8A 3IT0A 2QDKA 3WB1A 3RSHA 1L5LA 2X0KA 2G9UA 3EQ7A 1TIPA 4R4LA 3NGMA 4QYXA 4QKQA 4L6CA 2Z5GA 4ZGWA 4BEWA 3EXFB 1E7SA 4PZ9A 2QORA 3MJFA 4G5GA 4OBBA 4HVLA 2ZZNA 2WNSA 2BEQD 4FFLA 3U0VA 3WYFA 3RAEC 2YHBA 4G4GA 3ERCA 1D4FA 1JTEA 1U2TA 3TIIA 4IIEA 2QLNA 2VP3A 1K8YB 1HGXA 3E23A 2F62A 4I66A 1I33A 1EBFA 3L1KA 1L8AA 3ZYZA 1R3DA 5JTUA 4MV9A 1C3OA 4LYJA 2OC4A 4DN6A 1G8KA 1BWQA 4ZJUA 1P84I 2R1ZA 3C8VA 3FN4A 5K0CA 4R9RA 1KC3A 1EFVB 3Q98A 5J5AA 2J9RA 3N4XA 3QE3A 4CM5A 3QI7A 3C3CA 1NTMG 3UM9A 3CX5E 4NS1A 3UJDA 3MLBA 4ZZ0A 5JBNA 1KYIA 2J8ZA 2ISSD 4PBSA 1IO4A 1ZV8A 3D31A 2HJGA 1N6HA 3F5FA 3BL5A 2BMEA 4WNAB 4D9CA 4ICIA 3PS9A 4D0LB 2CNWA 4JBYA 5AW1A 1P4SA 2ZBDA 3D2BA 5M2QA 2V1XA 4LSWA 2PUBA 4V1CB 2CUZA 5CBPB 2I2FA 2D5BA 1UP6A 1N7SD 3W1VA 2V9CA 2C7PA 2AOWA 4ZVLA 2PUFA 1SBTA 4CEJB 4X62B 1F1BA 3KJHA 1QK4A 4Z86A 3BEOA 3ZHXA 3O7MA 4BTVA 2E5WA 1R16A 4GICA 2Z09A 4PS0A 1ZSVA 1WUYA 1W4AA 1PKEA 3L71D 3O3OB 4Q9LA 5K0NA 2WQ6A 4B3XA 2DPHA 1EA7A 2PN1A 5LA6A 3P9RA 3OE7D 4AY2A 3T5AA 3EX7C 2G8YA 5I9MA 3H9GA 5D85A 2V5AA 3JTMA 1VYUA 1B7GO 5KKNB 1JXOA 5D84A 2JGEA 2DTDA 3WB9A 5B12A 2E21A 3H1IG 1ZUWA 2OK7A 5AJTA 3RRYA 4GYWA 3T0GA 2Q41A 3CCEP 2F7SA 4M37A 2X1VA 5F2OA 1BCRB 5IZCC 4QO8A 1CFJA 3SLKA 2WKPA 5AOCA 3ODGA 4ZODA 1CEEA 5JS7A 3KYQA 3GJSA 4I6MC 3ABOB 4FN4A 2Q6QA 2XIQA 4ZJPA 1FW6A 2YXQB 2BKUA 2FNAA 3GGPA 4EGJA 4G0ZA 1YJ8A 2X5XA 5GTIH 2JH8A 5EWJA 4MQMA 3AE1C 2BFBA 3K1AA 2B8NA 4II7A 2FMTA 2WYHA 3CTPA 2C5HA 4DDMA 1CP3A 3L8GA 2RBKA 2MYNA 1I6KA 4ZZIA 2D5IA 2JLZA 1ZI9A 4PN3A 4YJGA 1VBMA 1BW9B 3FHTA 2QA4P 3KR2A 3N8NA 2P5TB 4DQLA 4OH1A 1C29B 4ZEMA 4Y99C 1GEEA 1G8JA 2J9FB 4Q9NA 4ABYA 4CKZA 3WQHA 3KJIA 3OQ1A 2Z56A 4MQBA 1SUDA 3L7LA 2BI4A 2DXIA 1K6XA 3CKYA 3UAGA 3WMM0 3A6PC 4QXOA 4AJ4A 1ECPA 3FOAA 4KREA 1WZNA 2OCGA 1O8BA 1MTZA 3FB4A 1HTBA 3ICWA 5TQ0B 3AHIA 1MVLA 1ZO8A 1PT6A 4J7XA 1ZIPA 4HAIA 4L8FA 4RKRA 1H5NA 5EJ5A 5IBQA 4A15A 1P3JA 2J0QA 2WDZA 1LP1B 5I8WA 4Z7NB 3KSAC 1F1JA 4UE3S 1M2VA 1EWKA 3M6AA 2O8FB 4ZGGA 2RG1A 5DOZA 4RABA 4F85A 4RJ2A 3ON5A 3D6MA 1U90A 4BMCA 4DGQA 4TRNA 2LE0A 1KILD 3E84A 1KI6B 4M1MA 2AXTH 4LNAA 3KZXA 5AVTA 3MHPA 3O0DA 3CVVA 2BEKA 2HODA 4K03A 1FXUA 4K1XA 4C9BA 3QQ5A 1QQ6A 3H2IA 1NNLA 3RGUA 3TH5A 2ZIWB 4WMLA 1WVIA 2FEXA 2YIJA 2ZAEB 1OX6A 4AIRA 5K8VA 1QE5A 1IZ7A 4HAOA 3LZDA 2GETA 2IU6A 2VUHB 4FYHA 1ZOLA 5JG7A 4MQUA 1QGAA 1AB6A 1WY7A 2CL5A 1HBWA 4BKMA 4DUGD 2PANA 4B32A 3KLBA 1L0NG 3TNDA 3JSAA 3GRCA 4QOSA 1MOQA 3IT1A 4AVYA 3Q1LA 3OQVA 3I9FA 2ZSBA 1CW2B 3ZXYA 2YOFA 1SCIA 4QXQA 2Y76A 1JWBB 3EXIA 4L22A 1SGWA 2X76A 2W58A 4G56A 1PR0A 2VAPA 2HWKA 2QJPB 2I6QA 5JD4A 2WSEH 3ZPXA 3PNVA 2XV5A 2Z3WA 4BBJA 1FEZA 3ZWWA 1J7KA 2ERYA 5IBRA 2I8CA 5FORA 3EYAA 5J58A 3RRBA 2FYUK 3PQ7A 4XWGA 4G1VA 1NASA 3K3PA 1OH8A 2CXTA 1NYHA 4ECEA 3T7DA 4FFBA 4AJJA 3RHTA 4QYTA 1GSHA 2Y0BA 1CETA 4PX5A 4C06A 1K86A 4KDCA 1P84E 2QZZA 1ZA2A 3U44A 3M6MD 5EVJA 2M8RA 4RBNA 2X6RA 1UIMA 3E22A 4CU2A 1E60A 3E82A 1L5HB 1GUZA 1ZVMA 4HN9A 1DIRA 1HY3A 1U3UA 2J3QA 2GJ8A 2AH5A 4OUKX 1L4AA 4MW7A 5TQ2A 1GK4A 2XZTA 1KORA 3M82A 4X0EA 3FNHA 3Q3GE 3II6A 4KQKA 1QO0D 1KJWA 5F7OA 1XZLA 1SIOA 1IPHA 1DEEG 3UKOA 4BV3A 1NATA 4Y2XA 2R68A 1NGMB 5C3MA 1DMSA 3MJVA 4PV1C 1OKKD 5CNMA 3VNBA 3JWEA 4UNQA 3R6TA 3M8KA 3QYFA 3TNYA 3GDHA 5ALLA 2GHRA 4DQKA 3JYOA 4HCJA 2CY0A 4EOGA 3AE3C 1DLJA 1MQSA 2JH9A 4MGIR 3CIOA 1VJGA 3WZMA 2QLBA 5AW9A 1V3QE 4CMCA 3FDZB 5K03A 1RYZA 3O90A 1U1GA 4PNPA 1FZCC 3O8OB 4MR7A 3JD4A 4B43A 5EXPA 3T7IA 4XIGS 1UC9A 3FXDA 2V7XA 1WJGA 1IZZA 4QPZA 3ZUPA 4M0PA 2BKEA 1XTUA 1EG7A 1GLVA 2N42A 1VLLA 2LXCB 4LPKA 1Q0LA 3FKQA 5BV2P 5IW8A 4DZOA 3CN7A 5A62A 2OXEA 3GI1A 4L8GA 1P17A 1I4DD 1CQWA 1LVHA 3M5CA 2HLNA 2JKYA 2RHCA 4IV0A 1YONA 3SVLA 3STWA 1G0NA 1NTZD 1ZGHA 4MA0A 3WYBA 1MQ8B 1KMMA 4R1MA 4ETIA 4JC4A 2D7JA 3VHRA 3ZZTA 3CCBA 2ODTX 1JMBA 2EEPA 4R40A 2YNMA 3KLMX 5F2NA 1UBUS 4D79A 3IN6A 1TO2E 3WIVA 4N5HX 1JFFB 2ZJ6A 2Y3IA 2VT3A 4D6YA 3R8CA 3PQ4A 2PVCA 2KM1A 3EAFA 1QYDA 2GR9A 2GBLC 5AQ1A 3UB2A 2O2CA 1ZH6A 4FLFA 4E1VA 2ZXFA 3Q3JB 1EB8A 3F4KA 4QHYA 1H0HA 3GRFA 4LE0A 3HU3A 3RCBA 3QLEA 5LYJF 4NEQA 1YQQA 3T99A 1RZRD 3NHWA 1PLLA 5EHIA 2F43A 1J07A 1ZZGA 1I3NA 1XTGB 2BGIA 1YHZA 2WJGA 4M0CA 1M75A 1EGVB 4PG7A 5CVVA 3QOWA 2W6QA 2OORC 1WXWA 2AEEA 4Z51A 2SHKA 5AM0A 1M2OA 1X39A 3W77A 1L8QA 2OYCA 4IHAA 2OCKA 2ZBVA 1DRKA 2ZIAA 2QGZA 1TIKA 3L6BA 1A02J 3Q7PA 3WRYA 2EQAA 1RJ9A 2C4NA 4NZMA 4YLEA 3SPXA 2RB5A 5FO1A 4FB4A 1Q57A 5ER9A 3E3OA 2GJ9A 2Q5JA 5JAOA 1BGVA 4KNVA 4Z4CA 5L9AA 1TZBA 3WWEA 1IFXA 2XA9A 1VGVA 3MWJA 4RH1A 3JSXA 2JAXA 3TTXA 1U2ZA 4WADA 2B8EA 3KPVA 1KJQA 1XG5A 2ZCVA 4K9NA 4NYMQ 4C14A 4B76A 4IGKA 3OEHD 3IPCA 1G4UR 2IXAA 1JF8A 2YO2A 3HGQA 2UUCB 1D09A 3KAQA 5JANA 4L6IA 4CMKA 2Y0EA 1ODSA 1WP9A 5LP6B 1KZ1A 2B4TO 1N34B 4OYLA 1NTMJ 3U37A 2UVQA 3WMGA 1C0PA 1NVKA 5ESRA 3QK7A 1UFRA 3HN2A 2WT9A 2PX5A 1X0VA 4ARZB 1IQPA 4F1WA 4F4FA 5CDHA 4JBXA 1YIAA 3HUEA 1Z82A 3VH1A 5A4AA 4W8GA 3B5NC 5KJ1A 4J0GA 1W0KD 3HE4A 4HNAB 2DHEA 2RGEA 1WPRA 1F48A 1WMSA 4KQEA 2LKCA 1ESCA 2YUTA 3Q7SA 2Y66A 3JZIA 2PKYX 4YJ3A 4PN7A 4XCQA 3SJ7A 3V4ZA 1JY3O 3QG5A 2Q07A 2AV6A 3ETEA 5E4FA 1SCUB 3EN0A 1C0KA 2HCRA 3OP1A 1T10A 1TW3A 3C8MA 1L4UA 3JWIA 5IT0A 5FUMA 1TT5A 4O8CA 4PZLA 2G4VA 1CS0B 1OR8A 3ZKWA 2Q0XA 3ZW9A 2A9QA 1EJ0A 4CPDA 2BFFA 1VG8A 3TCKA 4OAOA 1UXOA 4MGZR 5FI0B 1XEFA 2NUAA 3W2TA 2Y27A 1EWQA 5AVUA 2AE1A 2J7PD 3H1IJ 3H2KA 4XCVA 4RY2A 1R9GA 4CW7A 4JLVA 4KQFA 1W2BO 2GBIA 3GGCA 2AZ4A 4N49A 1ND6A 2POQX 2QM7A 2NO7A 1A4RA 2J5KA 3D7LA 5BWNA 1G8AA 2JI9A 3PXXA 5THXA 2R65A 2GZ2A 1TQ6A 3LCRA 4Y1EA 5CYPA 5KHOC 3VU1A 4C1NA 5FFNA 4YV7A 3OLQA 4F38A 1M9NA 1AVTA 4OMUA 4ZYVA 1P2GA 2ZI5A 1WQ3A 1U2RA 3CMEP 3W2FA 1PP9D 4Y18A 3BE4A 2PX3A 4XE5A 3C3MA 3T9CA 5AM5A 3U19A 4BQSA 5FUYA 4ME6A 4AICA 4FSDA 2X4IA 4M8KA 3I9NA 2F1HA 4REOA 4LBZA 1PNVA 2WIFA 5TPZD 2PZFA 4YONB 4GPTA 4DV3B 3TGUD 4I8XA 5ALPA 3ZBPA 1CY4A 1NLFA 4XX0B 4BMPB 4HQ6A 3EG9B 2G72A 3P4YA 3UCEA 3UAZA 4HTFB 5F5LA 4C6SA 2PZAA 1CK4A 4CU5A 5LZ7A 3CCUP 3CGGA 3AKDA 3IPRA 1RI3A 2OC9A 4D46A 2ZXEB 3A1EA 1H1TA 1UZNA 3OPXA 2JS7A 4UB8H 4W6ZA 1KZ4A 3KC2A 1GU4A 4JX9A 4B3CA 1VG1A 5IULC 2GYUA 4YV2A 4KJXA 4ZANA 2P35A 4HB1A 3LK7A 5APUA 4ZMBA 1ZXLA 5CG1A 5I7UA 2BDUA 4TYNA 4TS3A 4KQ6A 3D8BA 2OSBA 1IN1A 4QTZA 1GZ7A 2CWWA 4QDXA 5EFWB 3KEFA 2NSDA 3R9XB 2ZSKA 4JBLA 4C6HA 3FPKA 3V2RA 4XPZA 1GRCA 1JDBC 5K8JB 1ZVKA 4FTWA 2DM6A 4JOQA 4CR8A 5F3RA 3EDCA 3OQHA 2IPLA 4TN1A 1U28A 3L0CA 5IJXA 1SOVA 5FFFA 3TZHA 3Q9NA 1T9KA 4MUBA 1E94E 3RRNA 3FRHA 3QU7A 3CLUD 1MB2A 4EY8A 1SWWA 3H1GA 3N87A 1J2EA 1R2QA 2R6JA 4HO1X 4GT1A 4DXDA 4AO7A 2WWYA 4JJEA 4BE7B 1DMRA 3VYVA 4J0DA 2BDTA 5C81A 5FUXA 4X5OA 5CFPA 2OYIC 4TSFD 4BKPA 4U7JA 3FIUA 1RCUA 5PNTA 3UXHA 1IIRA 2IHTA 1U63A 2PKQO 4R1LA 4TOIA 4B0OA 1JFLA 1YE5A 1RAFA 1C9DB 4I4TF 4IIUA 2BKXA 4O4JA 4GPD1 4G0NA 5ERGB 4JPZB 3ZHYA 3RNOA 3IDFA 2FEKA 1UOQA 5AQEA 4HYYA 2HMVA 4L0DA 3MGGA 4PLPA 4G0MA 3LRTA 3U9LA 4QNRA 5IKEA 2QN8A 1L0NJ 2V7QJ 2I87A 2ZR9A 2JEEA 4BRZA 2H59A 3HXLA 2J33A 4YGYA 5DHPA 4TMXA 1PTJC 1DAEA 3F47A 3LSTA 4PO3X 3BWYA 5KSZA 2WJPA 3P0IA 1M1YA 2A86A 1QAQA 1E5QA 2ONCA 3GPBA 3FVTA 2VRNA 3C39A 3EW9A 4QHTA 3AY6A 3LA8A 4LOKA 1SEVA 1ACLA 5BWCA 1TM1E 4PYKA 2OV3A 4QJBA 2NG1A 3RKUA 4N39A 2WJZB 5JRDS 4B86A 3CT6A 4E7OA 5ECGC 4G65A 2C77A 3NKLA 2ONJA 1JT2A 1XDGA 3WMXA 3LIPA 2HV9A 5MN6A 1ZRMA 2EEZA 4XOIA 4UUMA 4G09A 3M3HA 1T1EA 3T1NA 2BH2A 4DLWA 5DNCA 2O2IA 2Z9CA 1HSZA 1VPLA 3HA5A 2RD2A 4P6VF 2A06G 1C8BA 1ZX1A 2KS6A 5D3ZA 4FX2A 3LCUA 2VPQA 2JJ2A 1OWNA 3CLSC 3AEQA 4BO1A 3CUUA 2I34A 1NQAO 4M0FA 3AU8A 3LH5A 1E2PA 4KO4S 5I7OA 2CMKA 3DLBA 1ZM3A 2AOTB 2GUVA 4B83A 2FYUE 3HB9A 4C89A 3JQAA 3M1YA 5JSHA 4W8OA 1KEEB 2CMDA 2ZUFA 3OTWA 2C9CA 1TUEA 4F6RB 2ZSAA 1TA0A 1YR3A 3IIMA 2ORWA 3E53A 5KVCA 3K0FB 3SC6A 5FI3A 1FMTA 1S2DA 4H1TA 3LT1A 5I9BA 3HD7C 1QO9A 3L72G 2OV1A 2GLUA 5DWDA 1DAGA 2DZDA 5AW7B 3SYRA 3NO4A 3VJRA 1E5XA 1N3IA 4PLZA 1AKTA 4C30A 3PE4A 3LQ2A 4CTJA 3V4FA 2EW1A 1DRUA 2WUWE 4ZU6X 2R1TB 1KAOA 2N0SA 1J8DA 1XYVA 4RK4A 1X13A 2Q6TA 4QJ5A 3VMZA 3DMYA 3LNCA 3S2ZA 4I0WB 4FMCB 3KZ1E 4PS1A 4X1KA 1K8AQ 4J0HA 4AN0A 4E3WA 1DBVO 2I3DA 2YIUC 4XX1A 3F2VA 1GLGA 4WH0A 5LQSA 1KDRA 2C9ZA 2WSLA 4W1PA 1XZNA 2Y93A 3VAZA 1CVIA 4M46A 1R5JA 4ZVPA 5EFOA 2NRGA 1OFTA 2AX4A 2BUBA 4H08A 1BDJA 1DO2A 1NJ1A 5ILQA 1ZIDA 3L74D 4KNWA 1H2WA 3FKSD 3QX3A 1X1SA 3PFIA 1P31A 3RVJA 1P2FA 3KKPA 1JDTA 4FCTA 2Q99A 1JBKA 2QMOA 1TEVA 4Q9KA 5JRJA 1VBFA 1QRRA 4UREA 3B3AA 3BDAA 4GIFA 4R4JA 4P33A 3L7BA 3LZCA 3LF2A 1NBAA 1X94A 4IWXA 4UDNA 2BGNA 3UGKA 2B9BA 4MV8A 1QC5B 1M2EA 3RF7A 2CFIA 3KXDA 2X2EA 3PC8C 1YASA 4DBZA 2BGWA