2JKVA

Structure of human phosphogluconate dehydrogenase in complex with nadph at 2.53a
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
482
structure length
482
Chain Sequence
AQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
publication title Structure of Human Phosphogluconate Dehydrogenase in Complex with Nadph at 2.53A
rcsb
source organism Homo sapiens
total genus 182
structure length 482
sequence length 482
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2jkvA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2jkvA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2jkvA01
4IJKA 4FB5A 4P22A 4E2XA 1NFFA 3PWSA 4WCFA 1HYEA 3VC7A 4GWGA 4BKQA 1MC4A 1A72A 1WLYA 3ZNOA 3JQ8A 1PL6A 4C4OA 1YKFA 1KVTA 2XXBA 2BLLA 3PHJA 4DBZA 3LSYA 3B1FA 1YB5A 1Q0HA 2Q2VA 4CLRB 2CDBA 2F00A 4R1SA 4FN4A 1DHTA 3IUSA 1IOLA 1EBFA 5AXAA 1ONNA 1Y8QB 2Q1UA 1P74A 3NT4A 1PR9A 3AOEC 3MJEA 3PZRA 1I3NA 1LLDA 3RKRA 1XCBA 4QUKA 5KNLA 3ADOA 1ZO8A 1SB8A 2IZ0A 4UVDA 6LDHA 4BNHA 4QFCA 4J1QA 1EEHA 4ZRNA 2W4QA 3AJRA 5THKA 1UXGA 1C0PA 4XGKA 4DPLA 3GZ4A 2VYVD 1LLCA 3F46A 1ZVMA 3ULKA 2Q1WA 4IMPA 3RBVA 2Y93A 4CMEC 1YDEA 1IZ0A 4RVUA 5JAMA 2ZJ1A 2YV3A 3KEQA 4JBHA 4MOWA 1GQ2A 3UKOA 2P9GA 3RUIA 2IODA 3DDNA 1EDZA 1NHWA 2OOSA 3ZCXA 3GHYA 1HE2A 2Y68A 3P19A 2RH8A 1R15A 1Z75A 2O4CA 2HRBA 2NACA 4PG8A 4QQRA 3OSUA 1AGNA 4P4GA 1KC1A 1V6AA 4EJMA 2GASA 4CV1A 3OICA 2IEDA 3N7UA 4ZRMA 3I9MA 3UUWA 1UZMA 4JNKA 2I76A 3A1NA 3ANLA 5DBFA 1PJBA 2Y1OA 1R4MB 4BNGA 4LMPA 4PCVA 3D4OA 3SC4A 3UICA 4CLDA 2BI8A 4BNXA 3JCZA 4XYMA 5IDYA 3GPIA 1GUYA 3RKUA 2H1SA 2W2KB 4YRAA 3PWKA 4IINA 3BIOA 5I7FA 4RPHA 3DEYX 1QR6A 3ZV3A 3OIDA 2CDCA 4EJ0A 3GA0A 5L95A 1AA0A 1QORA 4W99A 3LC7O 1EQUA 4CMGA 2GLXA 1DAPA 3BMOA 3GEMA 4JBGA 3GNSA 4NBUA 4CQLA 5ILGA 3ZH2A 3NJ4A 5CG1A 1E3WB 1R0SA 1NM5A 5COQA 3IKVA 1E1KA 1DPGA 1I10A 1QSGA 2AMFA 5DULA 7ADHA 3B6ZA 2PWZA 4XQ9A 1UDAA 5F1KA 2AXQA 2X86A 3QVWA 5JAQA 1BSVA 2JJYA 2BHLA 1LRLA 2Y1GA 1PR3A 2VWHA 4YJGA 3CKYA 3FI9A 4H7PA 3DZGA 2DAPA 3PQEA 5BSHA 1RM0A 5G0VA 3KYDB 1U28A 1GTMA 2J3KA 4HFMA 5F1OA 4CMIA 3IP3A 5EERA 3GZNB 4YJFB 2NU8A 4BGEA 1BVRA 3CEAA 3I23A 3CZMA 1VL8A 4I8XA 2G1UA 3PYLA 4LK3A 3E48A 3V5NA 2HMVA 4QEDA 2JFFA 1C1XB 4B3IA 4IDAA 4CJXA 1FDTA 5IZCC 3S1LA 1UUFA 4J7UA 1E7QA 5L45A 4A10A 2PA3A 3HE3A 1NHGA 1PZHA 3JQGA 2FR8A 2VWGA 1PQUA 1Q7BA 4G81A 1VRWA 1BWSA 1EMDA 1ZK3A 1B7GO 1ZJZA 2H9IA 2HO5A 1PIWA 1TT7A 1OC4A 4ILKA 4J90A 4GLOA 2W2LA 2VNAA 4U5QA 3ZHYA 3OFSA 1MP0A 3V8BA 1U3VA 1GQQA 3SEFA 2YHIA 3FF4A 4RVGA 3HQ4O 4E2WA 1XELA 1ISFA 1VPDA 4BNTA 1LC3A 1P1JA 1E5QA 2Z95A 1MA0A 1PS0A 3EGOA 3I9OA 4TVOA 4MIYA 1G0NA 4A2CA 4HP8A 1IUKA 3KYCB 1U5CA 2XPCA 5KKCA 1SAYA 1I36A 1A9YA 4BNMA 3U4DA 3LC2O 1U1IA 2G0TA 4J43A 3ROPA 3DMTC 5U4QA 1ZUD1 1LDMA 4XB1A 1N2SA 3TFOA 4Q3EA 2ET6A 1PJTA 3AOGA 4XYEA 3K2EA 2EEZA 2WE8A 1Y9EA 3BMCA 3K6JA 4GPD1 1X7DA 4EEXA 2HAEA 3INGA 3WIDA 3L4SO 1WPQA 3A4VA 2BD0A 4CM9D 1LI4A 5ER6A 3RC7A 3D4NA 2XF8A 3S2GA 1UDCA 3OECA 2YFQA 2QQ5A 1H0KA 4BUCA 1FK8A 4WASA 3ZV6A 1Y6JA 1RKXA 2UYYA 4U8GA 3H9QA 2X0RA 2X1HA 3V2HA 3H5AA 1I2ZA 4R3WA 4F6LA 2VZ0A 1LQUA 1CERA 4CUKA 1PJ2A 4D43A 3EMKA 4A26A 3JQFC 1H2HA 1VC2A 2D59A 4Z3DA 4ALIA 1ZMTA 3GEDA 3LYLA 1Q2XA 3C8MA 4K9DA 1UXIA 4U6QA 1EK5A 1T2FA 4GGOA 3JQAB 4TSKA 4CODB 4YB8A 4JXKA 3PHIA 3DBHA 3S2FA 4Z0HO 1HSOA 3ZV4A 3WMWA 1U2GA 1ZK1A 4GVLA 4OJNA 3VH1A 2Q99A 3ITKA 3K73O 2NVUB 4N18A 4YXFA 4B3JA 3I5MA 2FP4A 3SBOA 1ULSA 3JQBC 5TGDA 4ND2A 4JP2A 4XRGA 1NAYA 1IHXA 1MXHA 3HSKA 3HG7A 4MP8A 3PIIA 5U9CA 4QX6A 3CINA 4OXYA 3VOSA 4E5MA 4RDHA 5JE8A 4FR5A 2UUPA 2AQKA 3PIDA 3RC1A 4OM8A 2Y67A 1ENPA 3ZU4A 4NR0A 4NHEA 5THQA 3Q3CA 2IXAA 1DEHA 3WLFA 2JL1A 4M49A 4MVJH 1JAYA 2VWQA 4R9RA 3C1AA 1AXGA 3DAFA 1T4DA 4DA9A 1LQTA 5I7SA 3F3SA 3ASUA 3GPDG 3GVIA 3HDQA 1ZXBA 4DYVA 2QRKA 1ZBQA 5IF3A 1YOVB 3TZKA 2B35A 1R4NA 3CPSA 4BO7A 2CY0A 5KIAA 5KCZA 2OGUA 3JD2A 4OGWA 5BNTA 2EKQA 1N1GA 3OJOA 1VI2A 5JAIA 3ITDA 3E1KA 1XDWA 1F12A 1LDNA 3KO8A 3ST7A 2GPTA 3RSHA 2BI7A 2PD4A 4J1SA 1HLDA 2GCGA 5JPIA 1VKOA 3IP1A 1HEUA 1DRUA 1S6YA 1P77A 3FPLA 1LJ8A 4GQAA 2PV7A 2VRBA 4OAQA 3U62A 4LISA 4RJTA 1BDBA 4NQZA 4RQTA 4YT4A 1I0ZA 4CLHA 4PLPA 2X9NA 3VPSA 1YGYA 2J6IA 2Y05A 2UAGA 1O8CA 4N5NA 4A03A 4TWRA 1T26A 3H9EO 2YQ4A 3JTMA 2O50A 4CV3A 4JN6B 3EYWA 4YAIA 4K1LA 3ANNA 1R12A 3QW2A 3VZSA 4O6VA 4L4RA 4ZVVA 2WEKA 3H3FA 4FIZA 4IM7A 5TT1A 2VZ9A 2HRZA 3P2OA 1NQAO 2P91A 5ITWA 1O0SA 1A27A 4Y9DA 4WLFA 4A7PA 4B3HA 3WYEA 5BQFA 1K6JA 4Q39A 4XIYA 4H3VA 3TRIA 1NQTA 4HFJA 1LDEA 3JSAA 1NVGA 1IL0A 4ZJUA 3AWDA 4RZHA 1WP4A 1U5AA 3H5NA 1XR3A 2DT5A 4CMJA 4BNYA 1CF2O 3AK4A 1XWFA 3ENNA 4MJLA 3ZWOA 2FZWA 4I5GA 5HWSA 2DC1A 1LDYA 5B4UA 5TSDA 2ZQZA 4HNGA 3D7LA 1MXFA 1P1RA 3CZRA 3AFNA 1A4UA 5DOVA 3WJAA 4PZEA 2Q46A 3GT0A 3GG9A 4IY1A 1ZK4A 1GR0A 3WLEA 2Z5LA 3FHLA 2P68A 4MVJF 1DLJA 3E5RA 2PY6A 1A7AA 1X1TA 3Q11A 5EMHA 5F5LA 2O3QA 3DBVO 3NT5A 5L40A 1YXMA 3AOEA 5BSEA 3KB6A 1K3TA 2EGHA 5FI5A 4FFLA 1HE3A 5LDGA 2Y1DA 3DBLA 1QXSA 3GY0A 2HJSA 4D44A 4YR9A 3M2TA 3WBFA 2VYNA 3PWZA 4CMEA 2YJZA 3LT2A 5H81A 1MG5A 4DIFA 1ORRA 2LDBA 4RPKA 1NAIA 4W9NC 5JCXA 2X9VA 3Q9UA 1B8VA 3WYBA 4YRDA 4CR8A 4JK3A 3NGXA 1GUFA 1C1DA 1FXSA 4MIEA 5EQDA 3L77A 4B7CA 2NU7A 3GG2A 3U4IA 1XIVA 2C54A 2Q1TA 4M1QA 4O0LA 3GC6A 1Y7TA 3I52A 1Z7BA 4BO6A 3W8FA 3KV3O 1W4ZA 4YAGA 2PR2A 4O59O 2AG5A 2D5CA 4AJNA 2Y1EA 1LSOA 3ZWXA 2NQ8A 4J1NA 2JFHA 3ZW9A 4D46A 9LDTA 1MGOA 2I3AA 3E9QA 4IXTA 2RAFA 3GNQA 1PTJA 3PGJA 1TVEA 3R0IA 4RZIA 2P4QA 2AEMA 3VDQA 3S2EA 2Y0DA 3AY6A 4Y6PA 4CUJA 3VVCA 4QT0A 2AEFA 2PGLA 3VH4A 2DFDA 3D64A 2JHGA 4RLSA 1HYHA 4RVFA 3UN1A 4BL5A 5JY1A 1EFLA 1M67A 2D1YA 3RUDA 4CLEA 5DZSA 4FC6A 4BGUA 3T7EA 1O94A 1SEVA 3HN2A 1T1SA 4KZPA 3GNTA 3OF2A 1SMKA 1U8FO 4NMHA 3GGOA 4WGGA 4TRRA 2OP0A 1B15A 4M87A 3PFWO 3FD8A 3WQRA 5L4SA 3OJFA 3QWFA 4A73A 3C7CB 3KSZO 5CEFA 4XYGA 1OFGA 3WFJA 3FNGA 5IXSA 1XG5A 1YL5A 3FWNA 1VJTA 4IBOA 3U5TA 3WQQA 5DBIA 2JD0A 3PGXA 2JAHA 1R66A 1PJ4A 3F4BA 3RAJA 1P9LA 1P45A 3TQHA 1U4OA 1DLIA 2X0JA 1GADO 5IG2A 1CDOA 3BHMA 4DQXA 3ASVA 5JLAA 2ZYGA 2CFCA 2XXJA 2GDZA 3W8EA 4CQMA 4NJMA 4BO5A 4PFJA 3E9MA 1BG6A 1XEAA 2DUWA 2GO1A 4PLCA 2OXIA 2D8AA 4EEZA 4RLHA 3WMXA 4DWVA 2X5JO 3ANMA 4FFPA 3PTZA 2NTJA 1DB3A 1HDGO 4MKXA 4Y6RA 3VZQA 4XJTA 2O7QA 1AUPA 1DIBA 1GY8A 4IDGA 4LSMA 2PGJA 2C7GA 1MFPA 2DBZA 3HADA 3K30A 3DHYA 4ND5A 5DN9A 4TRJA 5CDSA 4WCFB 3WWYA 1G6KA 4QO8A 5HA5A 1GPDG 1LEHA 4Z6KA 3X2FA 3CMCO 1M6WA 1DJNA 1Z82A 1DIHA 3G3EA 3L9WA 2HMWA 3E82A 3PHHA 4RVHA 2Y1CA 3BA1A 1XYGA 3H3JA 3SJ7A 1HDZA 5IN5A 1ZNQO 2VUTA 1XQ1A 4GX0A 2ZKLA 4J4TA 4ZQHA 1NP3A 2ZTUA 3EDMA 2WYUA 2WE7A 2OZPA 5L53A 4OQYA 1ZH8A 3QWAA 3JYPA 3U4HA 2Z1MA 4PLWA 3F1KA 2VOEA 3BMNA 3C24A 4MVJE 1UH5A 2D3TA 3RBXA 3ZNNA 3D5QA 3FNEA 4FGWA 3SC6A 1Y81A 4BO9A 1HF3A 3BZUA 1W73A 3AI3A 1HSZA 4DIOA 4U6SA 5A03A 1P31A 3LU1A 2BKAA 3Q9NA 4URFA 1B8UA 2IZ1A 3D3EA 1UZLA 5JSFA 5KVVA 4JLWA 1P33A 4NFSA 2C59A 3ZV5A 3X2EA 1WW8A 4HNHA 1SZJG 4J4BA 3UXYA 3U0BA 2W8ZA 2CSUA 3A9WA 5BSFA 3WG9A 3EY4A 3UCFA 1E5LA 1QRRA 3DOOA 4HUJA 4YBZA 5F5NA 3TFQA 3HHPA 5TJHA 4FFRA 4PLTA 4J3FA 4XZ3A 1JA9A 4GL4A 3OQ1A 3RFTA 1HYGA 1NFQA 1E7WA 3ICPA 1E6EA 4W7HA 4HXYA 3MJ4A 4WE3A 3ETEA 1I3MA 3JYLA 4A0SA 5CG2A 1BVUA 3SXPA 3DBRB 3DXFA 4RV9A 3KETA 5KJFA 3QE3A 3D3WA 4ONEA 4GMGA 1A9ZA 4BNNA 5GMOA 1B3BA 3LT1A 1Z6ZA 4I9HA 3BMOB 3HN7A 1ISMA 4RGBA 3MCVA 1LNQA 4CQLB 2OUIA 2ZB8A 5COAA 1M2WA 2PLAA 3VDRA 3LT0A 4GH5A 1PJCA 2VWPA 2C5EA 1ISJA 1E7RA 3ZWMA 3ZGYA 4IQGA 1PWXA 2OBNA 3FPCA 3ICCA 4BMNA 1UXHA 2ZYDA 1EVYA 2OMEA 1DC3A 2J5QA 1LLUA 2J5KA 3JQ6A 4YJGB 3WDSA 4LVCA 1XSEA 4UEOA 4II2A 4XQGA 2GN6A 4E4YA 1GYRA 2IYOA 1G1AA 1XKQA 1P1FA 1WAMA 3CXRA 3U9LA 1HDXA 3C7DB 4CMIB 1TA4A 2Q4BA 3DFUA 1JQBA 4E2ZA 3DTYA 1I33A 1NX6A 3LLVA 4TRMA 4PG4A 1P0CA 3B1KA 4NNJA 4NU6A 3GH3A 3WWZA 4BNJA 2Y0EA 1I24A 1P3DA 4NBWA 2B36A 1W0CA 3RUHA 4ZICA 1PGQA 5TLSA 1FDSA 2GZ2A 2HMSA 4J91A 2OORA 2PTGA 1ISIA 2AE2A 3OEWA 5JC1A 1YWGO 3JQGB 1E7MA 1EDOA 2DVMA 5B12A 5EIOA 4F46A 2OP1A 4QO7A 3COSA 1E3IA 1EQ2A 2DUUA 4DPMA 3BMQB 1MLDA 4NFYA 3ZZNA 3CUKA 4O63O 2YHIB 3HB5X 5IFLA 2JAPA 2WDZA 4E13A 4YAKA 1FDVA 2GNAA 3IJPA 4Y6SA 1BGVA 1HT0A 2VTEA 2Y0CA 3VKUA 1V3VA 4L9RA 4KTTE 4BMVA 2I99A 5KOIA 5AXCA 2YV1A 3CTVA 2CUKA 2O23A 3QLJA 3ZHBA 3FCOA 3UHAA 4UUPA 2DLDA 3JQ7A 3Q2KA 1L7DA 2WD8A 2PKQP 2P2SA 1GAEO 1GFSA 4JCOA 3KZVA 2WYWA 5KVCA 1CETA 1WMAA 1LU9A 4UVIA 4D79A 3FNFA 2C82A 1LDBA 2JCVA 4WOKA 5A9SA 3OQ6A 3LF1A 4BNVA 3G0OA 3VVBA 5A02A 3WTBA 1IPEA 3IQDB 3QVXA 4KUHA 2RBEA 3GVXA 1NPYA 4BO3A 2DTXA 3ONEA 3WBBA 3BTVA 2VYVA 2O4UX 2W90A 3BMCB 4CM6A 2E37A 3W4JA 3SLGA 3NTOA 2DPGA 2EP5A 1PJSA 9LDBA 2OL4A 5CFZA 1AVYA 3PPIA 3T4EA 5JC8A 4E12A 5I7EA 4HX5A 4YTEA 3TWOA 3JQ9C 5I9NA 5L3ZA 4G5HA 1EVZA 3SX2A 2C0CA 4IIVA 3STHA 5A9TA 3NKLA 1CYDA 1E92A 1V35A 2C07A 1RJWA 1UP6A 3AM4A 1Q0LA 1WNTA 5G4KA 3IKTA 2POQX 3I9JA 4IJVA 1YQGA 5DBGA 1OMOA 3PYXA 1KVQA 1X7GA 4J49A 3I6IA 3ZWVA 1L1FA 1YBAA 4AJJA 1PS8A 3HJAA 4MVJI 3RIHA 4BV8A 1WMBA 1RM3A 3TOZA 1BDMA 1NYTA 1LC0A 3AU8A 3DBHB 3KTDA 3S2IA 4BO2A 3GAFA 2VHYA 1J49A 3KLMX 4XYBA 4YAJA 4K28A 2YUTA 2FWMX 1QG6A 3OA2A 3MTGA 3LDHA 4YQYA 3PP8A 4R1NA 1NBOA 1YVEI 3O03A 3KHUA 4EGFA 3FBGA 5KJ6A 4YWJA 4YCAA 2B4TO 4OH1A 2ZTVA 3EZYA 4OMUA 3R3JA 4FSHA 2DBRA 3JYQA 5DCWA 1ZEJA 4II3A 4Z9YA 3ZWBA 4GVXA 3ZWWA 3W6ZA 1NQ5A 1R4MA 2AEJA 4CM4A 4DC1A 3ZHZA 4GI2A 1A7KA 5FI3A 4DIBA 5CDGA 4NU5A 1P44A 2AHRA 1E3SA 1E77A 1O6ZA 3VZPA 3KUXA 2W2KA 1KYQA 1GV0A 4YPOA 5EJ2A 2PGDA 1EUDA 1R4NB 1YBMA 3QQPA 4FPXA 3E6AA 3PJFA 3EK2A 2ZTMA 3G1UA 5JNLA 3ZNPA 1ARZA 5DT9A 1U9JA 3ZDFA 1ISHA 4C7KA 2Q45A 4OIMA 1OX3A 3H7AA 1AN9A 1FDWA 1HKUA 2B69A 3VPFA 4CV2A 3ETGA 1E7YA 1CEQA 4ZU3A 1BXZA 4AJPA 1QV7A 5ICMA 1ENYA 3WSWA 1DIAA 1K89A 4RQUA 5I8ZA 3PJDA 4YT2A 1BXGA 3W4KA 3ZI0A 5A5FA 1JU9A 3AUSA 5JMWA 4M8SA 4Z3KA 4GGPA 1C0LA 3K2BA 3RVDA 8ADHA 2WD7A 3WB9A 2AQIA 3TZQA 2J3JA 3OIGA 4N5LA 4EZBA 4ITUA 4MPDA 4WLOA 1XHLA 2DBQA 3FRJA 3TN7A 5ENVA 1RWBA 4JX8A 4IDEA 1HETA 4ZN6A 1JKIA 3E9NA 1PGOA 1A4IA 2B0JA 2DFVA 3L6OO 1DAOA 4YJFA 1SOVA 4BS9A 4R41A 5JDIC 5L7WA 2EERA 4RF4A 2E49A 1HE5A 3EZLA 4QECA 4E30A 5A04A 3PRJA 3JD1A 2PZKA 3MWEB 3PDJA 1N9GA 4AJ4A 2B5WA 3WIEA 2DU8A 1LA2A 4XDYA 5DF1A 3P5SA 4BGVA 1VL6A 3VPXA 4RF3A 4MKZA 1CJCA 5TF4A 4B8WA 4W6ZA 1JLLA 4CLXA 1DJQA 1H9BA 5T5QA 4ID9A 1X7HA 1PL8A 4CM7A 2PH3A 3UF0A 4YT8A 5DCUA 2FMUA 4WCFC 4DVJA 4ND1A 4PGFA 2GN8A 4HV4A 5IDXA 3I9LA 1PU2A 2AG8A 4RDIA 5T67A 3ZNQA 1WZEA 4CM9A 1K5HA 2GERA 3WGIA 1LRKA 4J2HA 5FFFA 1EE9A 2O3JA 2CVOA 1U7HA 3JQDA 3ON5A 2GN4A 4PRLA 3QHAA 1UR5A 2PKQO 3JQAD 2GRAA 3LLSA 5ITVA 3QJ5A 1D1SA 5TRTA 4KMSA 4XB2A 5AYVA 5T6BA 2X22A 1PJLA 3D0OA 2BF7A 1LX6A 3FNHA 2C20A 4CM8B 3HDJA 3KYCA 4FD3A 1I32A 1P1IA 4LRSB 1I8TA 3JD3A 2ZB7A 4L73A 3WICA 4FJ2A 4HKTA 3MJSA 5HS4A 5KTKA 3WGQA 2X23A 4EDFA 3H2ZA 1WXDA 1X1EA 2W98A 4MVJD 4ZHSA 3MOIA 5L51A 3HDHA 3PEFA 2FHSA 1GEGA 1NPTO 2E82A 4WLNA 1M6HA 4IIUA 5F3RA 1BXKA 4AL4A 1X14A 2NU9A 2VCYA 3JD4A 3H9UA 4JJFA 3QV1A 4DPKA 3AUUA 1JWAB 4J6FA 2VHZA 2QRLA 3AY3A 5I8WA 1U3WA 3C7AA 2ZB4A 4Q3NA 4GX2A 4Q3BA 1F8GA 2HK9A 4LCJA 4S1VA 1EBUA 4MP6A 3VKVA 3V2GA 4PG7A 2YYYA 2O7SA 3ADPA 1YDWA 2D4AA 5TX7A 1IULA 3UCXA 5G2OA 1JN0A 4OXKA 4BNUA 1IYZA 1C1DB 3MZ0A 3UFXA 3WGHA 1ADGA 4E5PA 1BW9A 4FOOA 1J0XO 2V6GA 2HKIA 3NJ8A 3VZRA 1ONOA 4J2OA 3H4VA 1EK6A 3M1AA 4I5EA 4M89A 3GVHA 3WS7A 3DAPA 3WGGA 5K6AC 3GEGA 3K5PA 4AJOA 2A4KA 4D7AA 1TI7A 4B79A 3FTNA 5K9ZA 4M55A 1QYWA 5GY7A 4QFDA 3ROMA 1D1TA 1WVGA 4DMLA 4DUPA 4UULA 4AICA 2NVUA 2VTDA 4CMKA 3D1LA 3MEQA 5DP2A 1BMDA 2IXBA 4BNKA 4CL8A 3GRKA 1GL3A 2NNLD 4JJGA 4Q3CA 3U3XA 4NK5A 3OA0A 5CPFA 4B4UA 1E6WA 4MIOA 4DREA 3BAZA 3TDKA 3KM0A 2VRCA 3BYZA 1OC2A 4L75A 1DDOA 4FC7A 1MB4A 2BFMA 1H6AA 1ZCJA 4U0KA 4INAA 4RPJA 3DONA 2EIHA 1LDGA 4M86A 4D0RA 3FBTA 2AE1A 3L4BC 5DP1A 4IGFA 2DPHA 2FR1A 5TS3A 5KJ1A 2G76A 2A35A 2QRJA 4DGSA 3UAGA 3ZWCA 4B7XA 5A06A 1DC5A 2J5RA 5IAAA 3PXXA 4AJLA 2BGMA 1D3AA 4YVFA 1J6UA 1U2DA 1UAGA 3WGTA 2O3SA 3NYWA 3O9ZA 4E5YA 4HFNA 1DFGA 4D0SA 4RVDA 4MINA 3GHHA 2RHCA 4J0FA 1Y5RA 4ALJA 1UXKA 4E31A 4WEOA 1ZW1A 4W82A 1JVBA 2C29D 4Y98A 3TZHA 1YL7A 4MP3A 5IDWA 2CZCA 2IZZA 2RHRA 2JCYA 4CQMB 3JQCA 4NI5A 2V6MA 1VE9A 4GSLA 4K6FA 2B4RO 3TOXA 1EUZA 4L76A 3RU9A 2QYTA 1SC6A 3A28A 3EVNA 1A5ZA 1GEEA 4N5MA 3ZWNA 1DSSG 4ZQEA 2D0IA 4P38A 5ER9A 3NUGA 4XEHA 2I6TA 1P0FA 4RF2A 2JD1A 2FRDA 4J7CA 4YJHA 5A3VA 4AJKA 5FWNA 3BTUA 3H9JA 1GCUA 2FZEA 5C37A 2I9PA 1SBYA 2I65A 4L4SA 4NZ9A 2YV2A 5EPOA 3QVSA 4TZTA 1ADBA 2VQ3A 4EI2A 1YQXA 4E5KA 1LRJA 4EITA 3QIVA 3KSUA 3MWDB 3ORFA 4PLFA 1HRDA 3BHJA 2EW2A 3I3OA 5A3JA 5MGBA 3GF4A 2YDYA 4PZCA 1I3KA 2C2XA 2VT2A 3QVTA 1BHSA 4RVSA 3DL2A 2NLOA 3U4CA 2IE0A 2FN7A 4RF5A 1DO8A 2RCYA 1YH3A 4FGSA 1IE3A 3P7MA 2FY8A 5AXDA 5JY6A 2YHUA 3RQSA 4Q9NA 2OHXA 3L6DA 2EHDA 3BMNB 4BQRA 1DFHA 2OFPA 5JFOA 2GZ1A 3UW3A 1RM4A 1Q1NA 3AW9A 2EV9A 2EW8A 2YFHA 1I3LA 1H93A 1ZK2A 1ZKMA 2J8ZA 3OETA 1V3UA 2P9EA 2NADA 2O48X 3U49A 2G17A 4DBVO 5A4DA 1TEHA 1IB6A 3FR8A 5EL0A 4QTZA 5T64A 2VHXA 4B8ZA 4IJUA 3HDYA 4UREA 1NQOA 1KEPA 2FPGA 1YL6A 3QWIA 4U0JA 1R0KA 4TQGA 2YW9A 5JDCC 2ZQYA 3RBZA 4BKPA 3NDRA 5JYEA 3WGZA 3OJEA 3C85A 3Q1LA 4DLBA 1GZ3A 2R6JA 1F0YA 5T57A 4OOEA 4FOSA 4NH4A 4CMHA 4OXNA 1MC5A 3ENKA 1ADFA 4CM5A 3IMFA 5CDTA 2CF6A 3OP4A 4O1MA 4AVYA 4JROA 2VNSA 1PGJA 5HTOA 2OBYA 5IZCA 3DZBA 5ILOA 3K96A 1DHRA 2EKPA 3DOJA 3B70A 1JWBB 2D5AA 4R4JA 3D3WB 4R9SA 1MG0A 3QA9A 5IXYA 4J0EA 4OSOA 3DR3A 5KJEA 1NR1A 3NDJA 3V2UA 2B5VA 1T2EA 1UP4A 1HWYA 1PEDA 3JQ8B 4XIJA 1T1RA 4CV0A 3WSVA 4J16A 4IZHA 3O8QA 4BO8A 1Q0QA 2HSDA 4BKUA 5C7LO 3Q0EA 4TROA 4P8RA 4IDFA 3PQDA 1VLLA 4OQZA 4ZQGA 1I01A 4WNIA 3CH6A 2EWMA 4L4XA 4KQWA 1Q7CA 4OYRA 1B8PA 3IUPA 3BTOA 4R68A 4CUZA 1YB1A 2JD2A 3OEYA 1GCOA 1JTVA 3UH1A 4DRYA 4OO3A 4BNWA 2BFOA 2E6UX 1HXHA 3DMTA 4LW8A 5TIIA 4FJ1A 4BNLA 5G0TA 3DZFA 3S55A 3SJUA 1GU7A 3ROKA 1C0KA 4IXWA 4R01A 3RWBA 5JCJD 2YY7A 2Z1NA 4R51A 5IZ4A 5K0ZA 4GBJA 5BSGA 1ZMOA 4NBVA 1LTHR 3B20A 1GUZA 3IJRA 1YS4A 3TJRA 3OIFA 1ID1A 1KEVA 1FDUA 5COBA 3VAZA 2O2SA 2O3UA 4PG5A 4B4VA 4TZKA 3W4IA 1SNYA 3ZN2A 4DLAA 1M66A 3B1JA 3RFVA 4JQCA 1XU7A 3VTZA 1YQDA 1EE2A 2JHFA 1LLQA 1RM5A 4AFNA 1MX3A 1G0OA 4DC0A 1ONPA 5T8KC 2WWRA 5L9AA 4F6CA 5TNXA 4IQ0A 4BHTA 4WLEA 2BFPA 2J3IA 3IC5A 2X9GA 3GRPA 1H5QA 1SOWA 3NTQA 3IDSA 3ZU5A 1DOHA 1HZZA 4IS3A 3NT2A 2QIOA 1VJ1A 4LSWA 1YRLA 3JQFA 1ADCA 4GMFA 4IJWA 3WTCA 2Q2QA 1PSDA 4ND4A 4PVCA 1ZEMA 4HWKA 2O3RA 1GV1A 2V6FA 4RPLA 3ZWAA 2JCXA 3F9IA 3JQ7B 4HY3A 4X54A 5G0WA 4RPGA 4R3NA 3GN1A 3M6IA 3HB4X 5EESA 1PJQA 1F17A 3VHRA 4Q3AA 1V8BA 1QLJA 5F1PA 2VHVA 3GFBA 5JDIA 4WCDA 5A9SB 3KEOA 4IUYA 2I3GA 3PI7A 1U3TA 4BQPA 1X0VA 3JQBA 4BKOA 2BH9A 3VH3A 3H6KA 4FQ8A 5KKAA 2NSDA 4XQEA 5C5IA 3N58A 4CR7A 4MDHA 1KS9A 2O2YA 4Z0TA 1JVSA 1RYEA 2BRUA 3DZKA 4AJ2A 2EF1A 4UAGA 1DRWA 1VSUA 2I66A 1J4AA 1N5DA 4WK6A 4CLOA 2P5YA 5BNIA 1KEWA 1PX0A 1QKIA 3DO5A 2QG4A 4MVJG 5JS6A 2R00C 4NBRA 5G4KB 3TZ6A 4PLHA 1P1HA 2VHWA 2V65A 3MTJA 5L7TA 4WPGA 4WLVA 1SPXA 3QSGA 4ALKA 1R16A 3GR6A 4KP7A 4TKLA 2A9FA 1O5IA 3V1YA 3N74A 4DQVA 2ZCUA 4NG5A 2XAAA 5TT0A 2Q4EA 3DHEA 2A94A 4GX5A 4OKIA 4Q3DA 4XYLA 3G1TA 4LRTB 1T2DA 3LF2A 3WXBA 1Y8RA 3DHNA 1TT5A 2GUGA 3AY7A 1CQIA 2VUSA 4F3YA 3FSRA 2FPIA 1X15A 4PN3A 2GR9A 3PJGA 1C0IA 2UV8A 1QMGA 3KBOA 5EQFA 4P4NA 4A27A 5A05A 5HBRA 4E5NA 5GZ3A 2HMTA 1YJQA 3BTSA 5CPBA 4NPCA 2WMDA 3PJEA 4IS2A 5B4TA 3NEPX 2GSDA 1XU9A 1E0DA 4D3SA 1W8DA 4PLVA 7MDHA 1K6XA 4ALLA 2IYPA 1EVIA 1YBVA 4KUEA 3F5QA 5ES3A 4XJSA 3RUEA 4CM3A 1YB4A 2PD3A 4KWIA 1E1MA 3TZCA 5FEUA 1NTOA 4Z9FA 4CM4B 4D42A 3A14A 4UUNA 5CDUA 4ZD6A 2C7VA 3ONDA 5GZ1A 1VL0A 1Z45A 3ZU2A 1UAYA 4AJEA 2ZATA 4DQUA 4GAEA 1BRMA 4OHUA 4KDEA 5K6AA 3IAHA 2PK3A 3DBRA 1CRWG 4FS3A 4H16A 4UVHA 1R37A 3L6EA 4WNCA 4NFHA 2W2LD 1NR7A 3GK3A 4ZQBA 3VPGA 2EG9A 3GVPA 4OSPA 1HLPA 3OHSX 3KYBA 5ENDA 3WR5A 1N92A 5G4LA 3R3SA 1JDJA 4IPTA 1KIFA 2A92A 3NDIA 4N7RA 4MVJP 5DCYA 4YEDA 1BXGB 3GMSA 2WTBA 4F45A 1I2BA 2TMGA 3QWHA 1E3EA 4OOFA 1IHYA 2GN9A 5HRUA 1PGNA 4R16A 2WD7B 4KDFA 4CLRA 4DL9A 3U09A 3T4XA 2PD6A 3WX0A 2UUOA 2X7HA 5CEJA 1Y8QA 5CP8A 4Y67A 3PHLA 1GYQA 1V3TA 2BGLA 3C1OA 3L4BA 3PVZA 3SVTA 3DZIA 4WEQA 4I9NA 4GX1A 2CVQA 3MJVA 3GN2A 4N54A 2NWQA 4TMFA 4PVDA 3H2SA 3ROQA 3FN4A 1OBFO 3HFGA 5ADHA 2Y99A 1OOEA 1JKJA 3QVOA 4BNZA 3DOCA 5CAEA 3CMMA 2CDAA 4KQXA 1N9GB 4HADA 4BKRA 2FSSA 3WNQA 2VN8A 4XA8A 1KEUA 4BVAA 2R2GA 3RUAA 2X0NA 1D4FA 2P9CA 4CPDA 2X58A 4BOYA 1E3JA 1MV8A 5DNAA 1KOLA 2DM6A 5G0UA 5A9RA 2X4GA 2X5OA 2P4HX 3H8VA 5H82A 1U3UA 1P1KA 2CMDA 1ZK0A 3GOHA 1B2LA 4WJZA 4FFOA 4W9NA 3WYCA 4WLUA 1Y1PA 3FWZA 3LK7A 4FFNA 1EVJA 4BB5A 1Q7GA 3BMQA 5I7VA 2H63A 1LXCA 2NM0A 3NX4A 3AI2A 3WGOA 5B4VA 3SLKA 4AJ1A 4ROSA 3GDOA 4LCEA 1LSUA 2CF5A 3Q6IA 4QSMA 3JYNA 3R6DA 2IEBA 3INTA 8LDHA 1T2CA 4R5MA 2UDPA 4Z0PA 3ZWYA 2SCUA 3PLNA 5A5EA 1U4SA 5G0SA 4HBGA 1WDLA 3EUWA 3RC2A 1E1NA 2G5CA 5CHEA 1ISGA 1L7EA 3OBBA 2WJPA 1B16A 5DDIP 4JGBA 1HL3A 4ZQFA 3Q2IA 1F14A 1H2BA 5L4LA 1JAXA 1E1LA 1V9LA 3FTPA 2ZK7A 1E3WA 1HDRA 4B7UA 2AW5A 3GLQA 1PZGA 3LQFA 2H5LA 2HLPA 4WUVA 1Z73A 3A06A 4A5OA 1PQPA 1XQ6A 2DKNA 4CMAA 2UVDA 1K0UA 2J3HA 1EFKA 2GF2A 3KYDA 4PLGA 2Y1FA 3AM5A 2HU2A 2QYSA 4FFMA 1KVSA 5BNFA 3GZNA 5JDCA 3O38A 4UEKA 4WOJA 5TJ9A 3TL2A 4Z9XA 1BW9B 1DIRA 3F1LA 5HM8A 4RL6A 1PS9A 3T7CA 1DXYA 2C2YA 4IDDA 2HDHA 2HJRA 1C1XA 2FOIA 2GZ3A 3QRWA 4H15A 4ND3A 4CR6A 4PZDA 1UZNA 2NVBA 4XGIA 2X6TA 4S3MA 4XR9A 3ONFA 1PJ3A 3JQEA 4CM1A 3GUCA 4BV9A 2CD9A 3KXDA 3GUYA 4D41A 3ZWPA 4I9UA 1NVMB 4YJDA 1BTOA 2HQ1A 2HK7A 1UDBA 3H9GA 5JO9A 4CL3A 2WSBA 3DFZA 1NAHA 3DWFA 3DAGA 1KBZA 3GDGA 3PZBA 4MVJM 2YDXA 5FYDA 1WWKA 5DOZA 3DQPA 1KY5A 3ETDA 1MFZA 3RUFA 5J23A 1YO6A 1T4BA 2EP7A 1H6BA 1UJMA 4M54A 4CMBA 3L07A 4WKGA 1LSSA 4YQZA 4BO1A 2PZMA 3I9KA 5AOVA 2ILTA 3KVOA 4UVGA 2O3TA 4BNFA 3QP9A 2QX7A 3IS3A 2PZJA 3KOUA 4EUEA 2QHXA 2VUUA 3R1IA 4LN1A 5L7YA 2NTVA 1F06A 4L8VA 5HS6A 3L9XA 1DRVA 1LBEA 1U7TA 1LSJA 4I5FA 4IDBA 1QYVA 3I6QA 3NRCA 1WZIA 3DBLB 3OMLA 2IDZA 4PLYA 5F21A 4EW6A 3PDUA 4E6PA 2NTNA 5LDHA 3D4PA 3KSDO 4GSKA 1UXJA 1X13A 3OJ0A 4LMRA 3K92A 1O89A 4BGIA 3DC2A 3TNLA 3C1TA 2PKRA 1IZ9A 2E4AA 4FJ0A 2VRCD 1KVRA 3MJTA 4XGNA 1ENZA 1DC4A 5LCXA 4B4WA 2EGGA 1B14A 1KC3A 3IL2A 1KVUA 3PYMA 5TC4A 2G82A 4AJIA 4U7WA 1GYPA 1WDMA 4YJHB 1M75A 3AM3A 3GDFA 4C7JA 3W6UA 4G65A 1I2CA 4NK4A 2H6EA 5T8KA 1EZ4A 3TSCA 2CNBA 1GZ6A 4LVUA 4XKJA 5C7OO 4YA6A 1DIGA 1RPNA 5IJZA 4XWYA 1TB4A 1ZFNA 3JQAA 5B37A 4XQCA 2FSVA 5L4NA 2DTEA 3ABIA 2PH5A 4E2YA 3KRTA 2VYND 1KERA 1WDKA 3EW7A 1HTBA 4OKNA 1HDCA 4J1TA 2DBVO 2X0IA 4K6CA 2RH4A 4ESOA 3NTRA 4MVJA 1A71A 3KLPX 4KOAA 4GKVA 1Z74A 2F1KA 4TKMA 4YACA 5JBIA 4BO0A 5I9MA 2NU6A 2PNFA 4Y8VA 1SB9A 1O9BA 1NFRA 1N1EA 5JXWA 1EUCA 2VOJA 4XCVA 3O26A 3MJCA 1T24A 4NJOA 4TVBA 1Z7EA 3GFGA 2NUAA 4PLZA 1PGPA 4E32A 3WQSB 3HWRA 3M2PA 3EC7A 1DBVO 3K8ZA 3WFIA 4PG6A 5EINA 3PHGA 3WJ7A 5ICSA 3I1JA 3BHIA 1B0AA 2GGSA 4I1IA 4YDRA 1XLTA 3AUTA 2GYYA 2ZTLA 5H83A 4IZIA 1PL7A 2R00A 4NDNE 2HK8A 3S8MA 1YOVA 1ML3A 4J9VA 4XDZA 3IIEA 4KWHA 3HFSA 1KETA 4CM8A 3ZW8A 1ZZEA 2VZ8A 5EN4A 4ALNA 4NJMB 2Y66A 2TMDA 1Y5MA 1NASA 6ADHA 4G2NA 2DTDA 5CDYA 1N8KA 2YQ5A 4PIVA 1CIVA 1H6DA 1O95A 4I5DA 3GAZA 5GZ6A 5U1PA 1PQWA 4YAEA 2EKLA 4IDCA 3W8DA 1SEPA 3W1VA 4FCCA 3CE6A 4BIIA 2AQ8A 4FBGA 3I4CA 4RCVA 2NQTA 4D3DA 2HCTA 3WGYA 4R69A 1HZJA 2WM3A 3O8QB 1B3RA 1D8AA 4GLLA 1JKFA 1QYXA 2NVWA 3G79A 3GGPA 3OQBA 4E3ZA 4XX0A 4RORA 4IQ8A 4I08A 2P5UA 3V1TC 3E03A 4LGVA 1YONA 2ZYAA 1C3VA 2EJVA 2HUNA 4IMRA 1C14A 1SO8A 1XGKA 3NV9A 4HFRA 2Q2WA 4J9UE 3K31A 3RI3A 1TXGA 3CIFA 4AG3A 3FR7A 1FJHA 1T25A 3RC9A 4CQMD 4EUHA 3F47A 3H5RA 4UUMA 3HNPA 4D45A 3CSDA 5AQ1A 4J4HA 3HZZA 1E7SA 1AE1A 1ENOA 5JO0A 5BT9A 5JAZA 1W6UA 2HMUA 2GD1O 3LVFO 2JKVA 3O4RA 4TRNA 4L74A 4P4LA 4XR4A 3VTFA 4EBFA 5KWEA 3EHEA 1NXQA 3NGLA 1ZIDA 1UP7A 2BELA 3VPHA 4EUFA 3E8XA 3PQFA 4L0QA 1QLHA 3JQ9A 5KVQA 3RJ9A 1R0LA 3F5SA 5AXBA 3PLRA 1FMCA 1AHHA 1ZJYA 1JW9B 1ZSNA 4JP3A 4R1TA 3UCEA 3TL3A 4E33A 4MO2A 4DMMA 2E48A 5LC1A 5KVSA 4XRRA 1GDHA 3JYOA 4GKBA 4NBTA 1VKNA 2ZJ0A 3NAQA 1K2WA 1NWCA 3MOGA 5B1YA 4FDAA 1AHIA 3TPCA 3EVTA 5JMPA 4DTIA 1IY8A 1GD1O 1NWHA 1R6DA 2XOXA 3AFMA 2EXXA 3L0DA 1VM6A 2NV6A 1I30A 2I5PO 2ZCVA 4BMSA 2ZIZA 3UGKA 4W4TA 1RYDA 1HDOA 3F6YA 3JD0A 3OH8A 5TQVA 3GVCA 1S7CA 5AVOA 2CVZA 4ZGWA 1J5PA 5C3MA 4KUGA 3RCBA 2VT3A 3RUCA 4KTVE 1HDYA 2EJWA 2DQ4A 3CTMA 1E6UA 1PZFA 1VJ0A 3ZU3A 1TLTA 1OAAA 3F4LA 1SCUA 4UVEA 4R5HA 4CMCA 2FR0A 2Q49A 4WECA 1T2AA 2AQHA 3D5TA 1MUUA 3WNVA 1OZAA 4EYEA 4R1UA 1KY4A 1N7GA 4DXHA 5JW6A 2FPPA 2Q3EA 2X5KO 3OM9A 3AUAA 4UUOA 5IN4A 3QY9A 4PRKA 4OL9A 2RIRA 3GQVA 2LDXA 2PZLA 1H94A 4FW8A 4CLOB 1HE4A 3VH2A 3TF5A 5I9LA 4DYDA 3LC1O 4YYZA 1ZSVA 5C7IO 4QXMA 4E21A 1IPFA 3C3XA 5IDQA 2BFAA 2QZZA 2C5AA 1GPJA 4XD2A 4EJ6A 1QYCA 2QW8A 5A1TA 4MKRA 1OI7A 3E5MA 3I4FA 3G17A 2Q50A 3DTTA 3G49A 3EAGA 2WYVA 4ZA2A 3INRA 1ZXLA 1VSVA 3RJ5A 1NPDA 1H6CA 5KJCA 3V1UA 3RROA 1YE3A 4DLLA 1PWZA 1Y8RB 1M76A 1D7OA 2ZB3A 4UEJA 1TT5B 3RASA 1I5RA 4W7IA 4GWKA 2PFGA 1ULUA 3I9NA 3P2YA 1DFIA 3RD5A 1X0XA 1B26A 1Y9AA 2BMAA 4JJIA 1DC6A 1FF9A 1PZEA 1V0JA 2I67A 2V7PA 2OO5A 3H65A 3PK0A 1U8XX 4IGEA 2B37A 4NIMA 3WOHA 2AA3A 3BXXA 3DZJA 3PFFA 1YJ8A 1NNUA 2X8LA 3K9QO 2QZ9A 4J7XA 3IOYA 3GGGA 3HUDA 2BGKA 3GMDA 4BB6A 1GZ4A 4O5OA 1H9AA 4JBIA 2B83A 3RU7A 4JIGA 4E0BA 4B4OA 1QV6A 1ZSYA 1GQYA 3ZHXA 3M1LA 5MDHA 3E18A 2YZ7A 3UVEA 2JFGA 5CEEA 4BO4A 1K6IA 3AI1A 4BNIA 5BR7A 3AU9A 3OJLA 5JYDA 1QP8A 1F8FA 3I83A 1CQJA 1XA0A 2B4QA 4D3FA 3RFXA 4YRBA 1AXEA 1LUAA 4YT5A 3JV7A 2D2IA 4RO0A 3DMYA 4AJHA 1N7HA 1NVTA 2IRWA 3LZ6A 3UOGA 1CWUA 4ALMA 2V6BA 2Q1SA 4R54A 1QYDA 3DB2A 5JCJA 3QWBA 1E3LA 4K26A 3DZHA 3LT4A 5FF9A
chains in the Genus database with same CATH superfamily
4TV8F 4YRZA 2QLBA 1KK3A 4GWGA 4YRCA 1O3YA 3IYLW 4LDPA 2F00A 1U57A 1EBFA 2Q1UA 1USIA 4R2LA 3NT4A 3AOEC 1ZA2A 2WSFJ 4Q15A 1SB8A 1VSQA 4C76A 4BNHA 4UPVA 3UAYA 5C46F 2VDNB 2QW1A 3L7JA 2VYVD 3ULKA 2QN8A 3KJIA 4RFSB 2KZJA 3G2HA 2BJVA 2VO1A 9ABPA 2HRBA 2NACA 4PG8A 2VLIA 4CHTA 3OICA 1AQTA 2H31A 5AM0A 4W6QA 1GUYA 3RKUA 1OWMA 1FTNA 1VF5D 3WLNA 2FFJA 5KSOA 2YMKA 1NI4B 2G8NA 5KNBH 1DIPA 4W9MC 4JBGA 5B3KA 4OVNF 4OQQA 2R60A 2H8KA 4EARA 4PZPA 1BS9A 1DPGA 1QSGA 5EKXA 4PE5B 4NOMA 2J0VA 4BDSA 1JHAA 5B2FA 1NF8A 3R3XA 3OLZA 3AF2A 3DE2X 1GMJA 5T6MA 1GTMA 3E3LA 2GTIA 4KSBA 4KE6A 3KQLA 1A9XB 3GZNB 1M34A 3ZCRA 3PU6A 4AW9A 1G8FA 2LUOA 4LK3A 1LV8A 2QM7A 1OVGA 2AFIE 1ZONA 1XZGA 5FOSA 1I9GA 1SP4A 3HUUA 1XHFA 3GLHA 3JQGA 3SZOA 2O8FA 1B7GO 1ULTA 3R3ZA 3UAWA 2E85A 4J2TA 3OFSA 2H3EA 5CVEA 3AWIA 1SULA 1VPDA 1AURA 4UM8B 4H0FA 4C4ZA 4M88A 4YMWA 5EJ9A 5AHWA 2PJRA 4NYIR 3G2PA 2PAAA 4INPA 4XYEA 3J7AC 4WN3A 2NU9B 2HZ7A 1K7XB 1ORDA 2WTXA 2PS0A 3L4SO 2PUCA 2A45I 4B4KA 1MVOA 3D4NA 4JOBA 4DAOA 4JOQA 2FFAA 4C22A 1A5AB 3ZV6A 3P32A 3V2HA 1D4ZA 1O6CA 3TRKA 3BB3A 1H2EA 4K35A 2EZ4A 4Z3DA 3R6LA 1JIXA 2OHVA 3LYLA 4JODA 4UBKA 1PYOA 4MLPA 4CODB 5KKZC 4WBNF 5DJTB 3ID6C 1U2GA 4HI0E 5A0TA 4ZKUA 3G0GA 3IQEA 1CUFA 2CK3H 4XFDA 3JQBC 3IAM1 1NRJB 1EFVA 3FETA 3HG7A 3PIIA 1TM3E 2C4VA 5EJ7A 4OM8A 3PNMA 1SQVE 1JLMA 1DEHA 3ZHCA 4ZXFA 1KJJA 2QW0X 2PO7A 2OORC 3P9QA 1P3Y1 4PQRA 5BNTA 3TSZA 3K6SA 1LDNA 5K7SA 1VXOA 2IHYA 3DSRA 4OUDA 3HJBA 1P77A 3I01A 4X3OA 4LISA 1NIPA 1J56A 1I0ZA 1ZZGA 4C4SA 2ZE5A 5ALJA 1CLEA 1QU2A 1G66A 5MN4A 2XUHA 4IM7A 2VZ9A 4N6GA 3TRIA 4HFJA 5CJ4A 1IL0A 4FXPA 3QXXA 4CMJA 1S2GA 4I5GA 4DCSA 3C3DA 3C45A 2K1AA 3AFNA 3ABOB 3FHLA 4GPEA 4DABA 1YNOA 1H8HA 2LV8A 1VF5C 1QIKA 1KPGA 1QTRA 4U7HA 3AOEA 4X97A 3CLHA 2IF0A 4OB6A 5BR4A 1IEWA 2JFBA 2H2IA 2CNWD 3A37A 1D6MA 5CT9A 2JI9A 2HJSA 4CBVA 1AA6A 2XXAA 2GK4A 3MFYA 1HFJA 1MC1A 2HJGA 5JJLA 1B8VA 4RX1A 2P2UA 1GUFA 5K3FB 5A7HA 3CRNA 3CNOA 5EQDA 3K70D 3TGUG 3O8OB 1YZQA 5AVYA 2PR2A 2QTGA 2NQ8A 3ZWXA 2L69A 1KZHA 2PIAA 3CUTA 4TT3H 2CB9A 4WK2B 1NQXA 2Z04A 3PGJA 1HOTA 4KDRA 3LFTA 2FYUE 3GFVA 5CLFA 2HIMA 3U3KA 1GQOA 4HNAA 1H4VB 4FC6A 4LDJA 1J22A 4ZO4A 4Q16A 4MV6A 3NXSA 3QPVA 5CEFA 3FNGA 3UWSA 1EZZA 2H17A 3PGXA 3KIPA 4B84A 4DSZA 1JSCA 3HVUA 4HTFB 2JGEA 2OPBA 5KU1A 2QX9A 5JLAA 3ZLJA 1TNDA 2Q28A 2B34A 3BXZA 5B1SA 3K8QA 4FMPA 4LSMA 1UFQA 4BQNA 3WWYA 1J1DB 3RG2A 4IH4A 3K0BA 2H7HA 4RFVA 1AKYA 4DG5A 1MB2A 1IUPA 2FI1A 3FLMA 5JZBA 4O8CA 3EVFA 3C8VA 3BMNA 3GPCA 2D3TA 5K0JA 5KYVA 4BECA 2IHJA 4KYUA 4MGYR 2KXPB 2GD2A 3O5AA 5KVVA 1XQWA 2Z2ZA 4MUNA 4KT0J 4MUYA 3WKEA 3W67A 1BU5A 2XE7A 2V1UA 3JARB 4YBZA 5KLIC 1HYGA 1M7LA 3SM3A 1ZCZA 2FW0A 1BVUA 5DYGA 4RV9A 3DGEC 1NBHA 4ZEXA 1A9ZA 4JL5A 3LT1A 3T9AA 3MCVA 3STUA 4BXOB 1V9SA 2IXDA 1S8FA 2N47A 1PJCA 3T1QA 2P9TA 4IQGA 3H5VA 4WY5A 3ICCA 3AEQB 3TAXA 5JASA 5AW1A 1T13A 3KZCA 3LLCA 4Q7MB 3CXRA 3OPNA 4CMIB 1WAMA 2I8AA 2L5GB 5DNEA 1NMZA 2NN3C 2JCSA 4FS8A 6GPBA 1C9MA 1FDSA 2OORA 2PTGA 3QELB 1P7CA 2R7NA 3WHLA 3JR7A 1AV7A 2FRDC 3EJWA 1M9NA 5BUQA 2E7ZA 1CY0A 1WQ3A 1DTWB 4R2MA 3I9V1 3U4QB 1UMDA 1IMJA 4PHFA 4R2JA 4IMIB 5KYNA 3P2IA 1CETA 4R98A 3AR9A 1LDBA 2QNIA 1SQGA 1NONA 4R6WA 4EW2A 2VYVA 3TW8A 1ES9A 3CJTA 4R8SA 3N2GA 3PQ8A 2YW2A 3WRVA 3RGWS 2O7VA 3K6RA 4EKYA 2ZQ5A 3B9RA 2JZCA 2ZRJA 3V8QA 3TLMA 3K70C 1JHRA 2DRIA 3BD9A 3QX3A 3KSAC 3ZKAA 1YBAA 3HXLA 2KS6A 2G4CA 1PR0A 3AU8A 3T95A 4BRYA 2IYSA 3LDHA 2C0WA 1JDUA 1P9RA 2RJOA 2WSYB 3G5AA 5EAIA 1XVTA 2AT1A 4OH1A 2C7OA 1JI0A 2PBRA 5D5PA 2AXCA 1HNWB 2ZYSA 3L75D 2W0SA 1DXHA 4OV6B 3TG2A 4FR2A 1KI7A 4MYSA 2Z6AA 1IVNA 1AT1A 2JIRA 4FPXA 1UPFA 3VXKA 3ZOKA 1IG0A 2Q45A 3HVJA 3NHKA 3VPFA 4ER3A 2V5AA 5AKHA 4GXRA 1P7PA 2YUIA 5EVJA 1G8AA 5HEKA 3NB0A 1C0LA 1XNHA 3AE5C 1C7JA 3WB9A 3FROA 1PDWA 1QIMA 3EIEA 3VN0A 1SUCA 1HETA 2P9FA 1FRZA 4HN4B 4JB3A 1S01A 1AH2A 2ILVA 4TWIA 3ZJ5A 2HSEA 2DU8A 1P62B 4WXHA 3QXGA 1UBKS 3K20A 5C34B 1VL6A 3N2KB 1HQCA 2H2AA 3I09A 1IOVA 1CJCA 5DYTA 2UVQA 2GN8A 3QBJA 1YASA 1LRKA 3G9TA 5FFFA 2BEUB 4Q02A 4PRLA 3PG5A 4PO8A 3QHAA 1MABB 10MHA 3QJ5A 2I4LA 4XB2A 1Q1AA 2I2AA 2PGXA 2AG6A 1DJPA 4NE7A 3PFHA 1I8TA 3JD3A 4UW9A 4F5ZA 1H0TA 2UZIR 4JI7B 1HTTA 1TKRA 3PNVA 3DO6A 2BL4A 1GEGA 2XT0A 2VSYA 4KAFA 2VCYA 1ZU5A 1U11A 3CPHA 1GLVA 1QUEA 3D02A 4HEA6 3SC2A 1Q14A 1XEWX 1IULA 2JGLA 5F4ZA 3CT6A 1KILD 1EK6A 3KJXA 3WGGA 4K8RB 4AJOA 5F77A 2C7PA 1YK0A 5JQWA 1PNOA 4AICA 1D2NA 2QS9A 1NYHA 2XLBA 3LHDA 4BE4A 1E6WA 3T3GA 3R9WA 3BYZA 1J8DA 4MJ7A 3H99A 3MT0A 1V1RB 1ODCA 4DC9A 4IGFA 4AS1A 4OJQA 3EGDA 4UB6E 3HUSC 3U37A 5IMSA 2Y92A 5IAAA 1ZQ9A 4R0VA 4H6PA 3H1KE 1TIPA 3T7JA 1YRYE 2HQSA 1Y5RA 5LZ8A 5J4LA 3DZDA 1WDTA 4KFUA 2JCYA 2DPXA 3I1YA 3OKAA 3ZEAA 2WJ3A 3IQFA 3FZGA 3TOXA 4KV7A 4G9GA 5DE3A 1XWIA 4NARA 2FRDA 3H9JA 3F0TA 4G4GA 2Z5GA 1LRJA 3BXGA 3L37A 4PLFA 1G1IA 4PZCA 5AVQB 4D02A 2W70A 3DL2A 3WAJA 5JQGA 3P7MA 2L19A 2EHDA 1NTZK 3PNKA 4BQRA 3BDVA 1O96B 1COWD 221PA 2CNWA 4HQKA 2GK7A 1EGQA 1KYOH 4IL6E 2HIHA 4TWAA 3A2AA 3NU1A 1O97D 3WHIA 4POAA 1J2YA 3O84A 2W6MA 1RS0A 1V47A 4NPDA 2ARKA 3FVVA 1NU6A 1YA4A 2VNSA 1X7YB 4LDRA 3K96A 5C81A 2QTVA 3ZK9A 2RDMA 3V2UA 1OHHD 3BCCJ 2HU8A 3K4HA 3KK0A 1CUHA 2FEPA 5BWNA 3QF4A 2N42A 1CUGA 4G0QA 3HR4A 3Q2OA 4IDFA 5AW3B 3J81A 4QREA 4M0CA 1I01A 4KQWA 5LQMA 3IIJA 3V4ZA 5FWDA 3KQKA 3HD7B 2ODQA 1N0UA 3OZRA 5D2CA 3GUZA 1R8XA 4GBJA 3VGPA 4MW9A 4EB6B 1BHJA 2BUBA 3B1JA 4JQCA 1NZDA 1II8B 5BN4B 1EE2A 1RM5A 3STVA 1ONPA 1U1FA 4MRMA 4BHTA 1SOWA 1KP3A 2Q3MA 3WY9A 1GVNB 4RPLA 4PYRA 2P90A 1XDSA 4DTCA 3RS4A 1U9YA 1Y7LA 3EULA 3R9XA 5AD1A 4QTXA 2IOHA 3KELA 3KQOA 4ZOCA 4YPFA 1RABA 4B7ZA 1RYEA 1Z34A 1VMKA 1YQ3C 1HA3A 2N9BA 1L4MA 4R8RA 1KILC 3IP7A 2PP6A 5HCIA 5TT0A 4ENWA 4Q3DA 3LF2A 1GCAA 3GLIA 2AN3A 4B75A 1NYLA 1VHDA 3I0MA 3PGLA 4LTMA 4GOXA 3WRYA 1IVSA 3AONB 3SG0A 4DB2A 2WMDA 2IPOA 1P80A 1NU1G 4LZNA 1P91A 4CF6A 3P97A 5TPWB 2NZUG 1YB4A 3PITA 4G1EB 3ZUGA 1NTOA 4Z9FA 5G3YA 4D9JA 1ZIXA 3SYNA 4XUCA 2IYVA 1UAYA 3VR1A 4H17A 1BRMA 1EUDB 2ZROA 3IAHA 5KX5F 4TWZA 3RREA 2KBEA 3WR5A 5BWMA 2TRSB 4IPTA 3CO0S 4N7RA 4MVJP 2WTBA 5BRJA 3EQ6A 5BXYA 4G1CA 3RVJA 4I1UA 2GN9A 5BR1A 1JEQA 3A9SA 3A6GA 3U09A 4R71A 3F8TA 3HUSA 4CNQA 4BLSA 1S4QA 4AN4A 2I1WA 1I3OA 5EKUA 3KUUA 2WUWE 3BL6A 1YI1A 2WJWA 4BOYA 3IT1A 2YNMD 1O0CA 2X4GA 3N5CA 2FEKA 4AC9A 1GK6A 4WXMA 2HHHB 3AF4A 4Q9DA 1O97C 4UBJA 1JIJA 4ENVA 2AMJA 4C4TA 2ZYTX 2PQ2A 3RC2A 4QU0A 1L7EA 4REOA 4P4UA 2ZIFA 1H2BA 2HODB 4RS4A 5AM2A 2QPLA 4Q4HA 1OFIA 4P83A 4A5OA 5B7GA 1KNQA 1D9XA 3U7QA 2VRSA 3AM5A 1P5FA 4LBYA 2DR3A 5BNFA 3GLGE 2J9FA 2QDKA 4CR6A 2EU8A 2I4OA 5KJ7D 4YCSA 5B1DA 3ER8A 1DT3A 1YTZI 4GM4A 3OM8A 2PBZA 1GZ7A 4LVNA 4EL5A 2AK3A 1UDBA 3ACDA 4UBMA 2VHUA 2ONKA 2FXMA 1LI5A 3DQPA 3IEMA 1TEXA 3ZGZA 2HDOA 3KUDA 4K5QA 4BNFA 3LYAA 4BLWA 1RRPA 4DY6A 2JGDB 4Z9BA 1RBYA 4AQDA 2NTVA 2M3EA 1E2KA 2A5DA 2BKLA 2IDZA 4PLYA 1GW4A 5FBHA 5APWA 3JSXA 4J0HA 1SK9A 2H7YA 2WNHA 1SIBE 1O89A 3OFVA 3QVKA 5REQB 2YWCA 1P18A 2FCRA 1QPGA 1I4DD 3PYMA 2G82A 2PZBA 3F78A 3Q8XB 1EZ4A 3OOSA 4IIEA 3PDIB 3HYNA 1ECBA 1KFKB 3LUPA 3PUJA 1SQVG 3H4IA 2RGRA 1E1CA 1MPTA 2HHCA 2NUTA 5CLGA 3H5TA 1USUA 3VUEA 3A3YB 2EFGA 2YC4C 3VNQA 4FOLA 1A71A 4O4JF 1VLQA 1NFRA 1Q0PA 1EUCA 1IBCA 3IHTA 1Z7EA 3UA4A 3KQMA 3SZGA 2YYAA 1KMHB 1GKKA 5ICSA 1FEZA 5AW0A 3JPWA 1ZOOA 1KILA 1FNCA 3W3AD 1W5BA 4MWZA 3OEHD 1Z6TA 1NASA 4FYHA 5JZOA 2CCJA 4G2NA 3Q7PA 1CIVA 4IDCA 2G0NA 3KJEA 1W85A 1SEPA 3CE6A 3M33A 3I4CA 4KKVA 2C78A 3THOA 1JEOA 4LNUB 3AR3A 5BT8A 3ZEIA 2WM3A 1XZEA 3KT8A 4TTPA 4FZVA 4DMCA 3A9RA 1NY6A 2C2GA 4IMRA 5A4JA 3FOAA 1ABBA 3FR7A 2HU7A 2ZXXA 4G09A 4D45A 1JMKC 3L7LA 5DGXA 4MA5A 4FHCA 3EFHA 1Q6ZA 5CXXA 2YMQA 1T3LA 2YNMC 4EB0A 5D00A 5CCXA 1RPJA 3RJ9A 3B6MA 5AUPB 1L5MA 1ZJYA 2BBSA 2VTVA 3LUKA 3E7KA 2RH0A 2ZJ0A 4MYCA 4R9NA 4Z1OA 2XWBF 3S7ZA 4OQLA 3AFMA 3L0DA 3VSCA 1RWVA 1HDOA 1KZ4A 3HL0A 3QXSA 4KUGA 1FFEA 2ZFCA 2DQ4A 2HA7A 2VXBA 1XYVA 2GJ8A 2KSEA 4LJRA 2OM2A 1COWA 3D5TA 1L0NK 1VHWA 2Z3VA 2B25A 3ZKWB 1KY4A 1R8JA 2ERCA 3LQKA 4PGMA 3ZK7A 3HU1A 4BP8A 5KOYA 4X6YA 3C6MA 1GPJA 5BWBA 3SN6A 5DGTA 2Q50A 5KJ7C 1P19A 1QIJA 5EFOA 1YE3A 2O8DB 1PX2A 1M76A 3RASA 3ANXA 4GWKA 1TZMA 4AURA 3CQ9A 1Y9AA 2FPIB 5ALIA 4IH1A 3SYLA 3DZJA 1OHHA 2X8LA 4P5DA 1R6TA 4KN8A 3RK1A 3QPWA 1Z47A 3DDSA 5F51A 1N6HA 2YOFA 1XC7A 1QV6A 1MT0A 3O1LA 3E18A 3IDOA 2M3BA 3HE5A 4YRBA 1RF1C 1QS0A 2XMGA 3JV7A 3QEKA 4AJHA 4TSRA 4RV5A 2NZYA 4YDQA 2B8NA 1Q95A 5MN5A 1XRRA 2I4TA 1UKZA 1KDRA 4AUNA 1ZD4A 3K6KA 4E1VA 2BEJA 5J3JA 3EBOA 1WBBA 1G17A 1YB5A 2IIBA 1JKXA 1Z26A 1NNI1 3R24A 4WDRA 4UVDA 4QFCA 2W4QA 3AJRA 4JENA 2Q1WA 5C52B 3TCXB 1FFDA 3IVGA 1OZFA 2B3DA 4OI4A 4V2IA 1M8JA 3KQYA 4DCTA 1QHIA 2I3DA 2WR8A 2FG6C 3OSUA 2ZRHA 4IXDA 1AGNA 4DLVA 3DMNA 5KQMA 1YR8A 4ON9A 5FORA 2J33A 4LMPA 3SXUB 2O1WA 3T3EA 2J67A 4D6YA 2FMXA 1GTZA 4MKGA 1PTJC 2HPAA 4HEQA 4IRXA 1YA8A 5L3QB 4UE6A 3GNSA 4B2IA 3PSAA 5F4BA 3TAHA 2VF2A 2AXQA 2A3NA 2BHLA 5DW0A 1YIAA 5EVCA 2HBYA 1MOSA 2VWHA 1FP6A 3Q8KA 2QTCA 2E5LB 1T3HA 2BKXA 3TGLA 5KQPA 1HX7A 3DUFB 2JFFA 3JQPA 3S1LA 4NZZA 1XZBA 3TLJA 4ZMBA 1E2LA 4EB8A 2R5BA 1ZK3A 2VAXA 2NG1A 4ILKA 3UFBA 4HQLA 5FHRA 1U3VA 3BSSA 2OXFA 1BVHA 3T9FA 1I94B 2VPIA 1HT1E 2H1OA 3UHFA 3EFOB 3QUTA 1X38A 1P2UA 4HP8A 1DCKA 1IUKA 4U39A 2OTJP 5KKCA 1CY2A 3O8CA 1U1IA 2KWIA 3RARA 2OC4A 2WIFA 4ZQIA 4ZO6A 5D8DA 4ZZ3A 3HZOA 3X1DA 5EMJA 3O4FA 3RJMA 1CNFA 3WIDA 1RT9A 2CDNA 4ISCA 4B85A 1IG3A 2AJDA 2XF8A 3IOMA 3W0LB 3WL7A 2YNMA 1ISSA 3I01M 4L6AA 4F04A 4HB3A 1HJ0A 5CR9A 1XL1A 3GFOA 4W1SA 3WMFA 5KLVD 3WLQA 1UXIA 2Y6VA 3R40A 4OJNA 1DEAA 3K73O 1A9SA 2WMMA 4O4HA 3AKCA 3SBOA 1M7BA 5APYA 1O9GA 3TRDA 1U5BB 4FR5A 2ZVOB 3FUWA 3Q88A 3L72G 3UJ8A 5AKLA 2Y67A 1ENPA 4L6CA 1NLZA 5ECDA 1N4DA 3RH0A 4HUTA 4C06A 1S3GA 3GD7A 2PRYA 2WVGA 2IYNA 5KJ7A 5C39A 1N5JA 3KO8A 1FZCC 4RQAA 4J1SA 2EQAA 2DKOA 2CLCX 1M1YE 4L50A 4ZK2A 2HUPA 5JAUA 2VP4A 4CLHA 5EZQA 2P30A 2ST1A 3ELYA 3MS4A 4LLHA 3L18A 2WT7A 3TTSA 4DANA 1CI6B 3NTLA 1RBZA 1A76A 3H04A 2Q6VA 1M5RA 1RF1A 3TRFA 1N2CB 1U0EA 5BQFA 4XIYA 3DEKA 3Q9SA 1NVGA 4LDNA 2I1QA 3AK4A 2V3VA 5BQXA 3L1UA 2A1UA 3N8HA 1KI3A 1FPQA 1OMIA 1TPZA 1QGOA 3WJAA 2JLZA 4QKQA 4MR7B 1F5NA 2V7BA 2EYUA 2O3QA 1WZUA 3MELA 4FFLA 1HE3A 2Y1DA 4H6XA 4TKUB 4DCNA 4QU8A 3IVMA 3OWOA 1MG5A 5AO9A 4DIFA 4U4AA 2R6FA 3LWBA 2HBQA 2MYTA 1DAIA 2WFAA 4XPIA 1H22A 3U81A 1XCJA 2H0RA 4O0MA 1JHVA 3KV3O 5ADWA 1WXHA 2JFHA 3IJEB 3TXYA 3QLUC 1PTJA 3AVQA 1DWOA 1TVEA 1V16A 3R0IA 3VDQA 3OEHA 3H1KG 1OREA 2Q5HA 3URKA 3GBSA 5IX8A 4Q4DA 1SEVA 2C4KA 1ZL0A 2P11A 3K5BA 4A73A 3PC7A 1IM5A 1PVVA 1G98A 3G0DA 4MQ5A 4UXJA 3VVMA 3G5LA 2PUBA 1WCXA 2Q3HA 2X0JA 3PEUA 3ASVA 3MMNA 2GDZA 2IEAA 1EP2B 1GVHA 3MGGA 2GO1A 2D8AA 2NTJA 3NYIA 1ZJ6A 4AYWA 1YJAA 4WNAA 1RD4A 2XIJA 3QVGA 4DNXA 4QG7A 1Z8DA 3PHHA 4RVHA 1RJDA 2QD2A 3H3JA 4WBXC 4O33A 5IN5A 4GX0A 2QLNA 3V2PA 2H2WA 1Z3IX 1OGJA 3SC6A 2HM7A 5EMMA 1E9SA 1VFPA 5A4MS 1XTZA 3VBCA 3V97A 3EH2A 3U0BA 1NN3A 4PZZA 5GIOE 3TFQA 1C3LA 1M83A 4UMEA 1HQKA 4WOBA 2CFTA 1APBA 3OQIB 2FYNC 2R66A 3KDSE 3QE3A 2W48A 1RKVA 4D56A 2Z2XA 2WSCH 1JILA 3T0FA 3CRQA 1CUAA 4G0YA 4ZYWA 2C5EA 1M2NA 3H5WA 3QJYA 2EBWA 1SBTA 1DC3A 3N05A 3GJ3A 3DQQA 4GNKA 1XSEA 4KN9S 4DJTA 1HL7A 3PJRA 4P7BA 3L6BA 1HDXA 2UVPB 1EH5A 2ZDGA 2GI4A 4NNJA 3B1KA 2SKEA 3VRHA 4M1TA 5J59A 1LGHB 1IZ8A 4AKSA 4KCGA 5B12A 4PX5A 1FZCA 4P5PA 2I2WA 4FT4A 3WKDA 1MLDA 4BBZA 2ACWA 3AFIA 4BB0A 4JQSA 4OHFA 4WXPA 1HRKA 5KOIA 3ZPXA 2ETVA 3I0ZA 1QFJA 2IBTA 2VP0A 3NZEA 3UB2A 1GAEO 4MICA 4MV9A 3LF1A 1Z6YA 2LRHA 2WSIA 5AKXA 1ODTC 3ILXA 3DE4X 5GTHE 2O2ZA 3LQYA 4UB6H 3LW5J 2NXNA 2HR3A 3JQ9C 4Q21A 5FA8A 5HE9A 3IKJA 1CYDA 1MD9A 3LKDA 4UAUA 2XYPA 3I9JA 1YIDA 1OMOA 1LPAB 3IMEA 3ZE6A 4MQFA 4JT4A 2P40A 2BM0A 1WMBA 3TOZA 4B9EA 3DE1X 3KTDA 5DSTA 2WV7A 2P35A 4N9QA 3IRVA 1R9JA 2VNHA 3IXMA 2JK1A 5AI9A 1E61A 3MTGA 1XZIA 1ZHOA 4YJKA 3AUXA 2GYWA 3FBGA 1QX4A 4B86A 2JAXA 3IVRA 4EG7A 1RQVA 3AG6A 3HWWA 3AE6C 2AEJA 5H5JA 1EM8A 3ZHZA 4Y99C 3ESBA 3QQPA 1SIUA 3EK2A 3ITNA 4R1QA 1ZDMA 4IL6H 3KP1A 2ZLBA 3QLUA 2I2FA 5J4YA 4NCKA 2Q29A 1DIAA 1MT3A 1MTOA 1P60A 2H89C 3UWMA 3E3MA 3WO1A 3T34A 3A58B 3W2HA 4MPDA 1OY1A 6YASA 3QEMA 1OE0A 4GR5A 2YWFA 1FMFA 4EGAA 3L1HA 4PANA 2JW5A 1XE3A 3I62A 4RYDA 3WMGA 3G88A 3UQYS 4FOPA 3ZZ0A 2H4XA 1M2VA 2XIQA 1J99A 2D1TA 4NULA 2CFRA 4NBSA 1YE5A 3PA6A 4UKDA 4NNOA 1SKYE 2EFCB 4B83A 5TRTA 3CW8X 1N2BA 3I92A 4XWAA 2BF7A 2AJBA 4CM8B 4KO1S 2GEKA 1JQ5A 1VKJA 3WGQA 3OM1A 4ZEWA 3CB4A 3HDHA 3PEFA 1E89A 5LP6F 1FDIA 3PB3A 4BUZA 1L4LA 1CR6A 3DCJA 4D9FA 4J6FA 2XCUA 4Q3BA 4HDCA 1QFYA 2DCMA 4BNUA 2AMLA 5CX4A 2ZVJA 1FJGB 4LG1A 4BU1A 4QBKA 1P4RA 3JASA 3FTNA 3IAUA 1QYWA 1O95D 2Q4DA 3O75A 3JVIA 3B48A 2ZUCA 4LUCA 4PYQA 3AG5A 3OA0A 2JO1A 1KD1Q 3KM0A 3O83A 4TTRA 3PT5A 4M86A 1U0BB 1USEA 5TS3A 3UAGA 3JU3A 4D9BA 3UAVA 1KI4A 1JY3P 3ADCA 1XMJA 2CXOA 4ZO8A 3GHHA 1UQUA 1XTIA 1EI9A 2CZCA 3QBDA 2BFCB 1ZR2A 5LDDC 4M0PA 5DI9A 4C7NA 4N5MA 1LBSA 4Z4EA 1AD2A 2HFJA 4B8YA 3DXXA 3QVSA 3BHJA 4TV9A 3ILHA 3DWEX 1BHSA 1E0SA 1E1QD 3RKSA 1RP7A 3TTWA 3LXMA 4GP7A 4L07A 1Z4MA 4V0OA 3MWFA 3VDXA 3AXTA 2ZVNB 4MQUA 3HKDB 1TEHA 5EL0A 4P93A 3R7LA 5AI6A 2W6JH 1P0IA 4OVKA 2CMFA 3OJEA 1Y98A 4B9AA 1W48A 2J1LA 4OXNA 3S2YA 1L2TA 3IMFA 3E4CA 1JR4A 1YQEA 1TU3A 3CG4A 1PGJA 2BT4A 2ABWA 2I54A 2MMGA 1U2GC 2D5AA 1NP6A 4R9SA 3INNA 3D2BA 1TYEB 4LBWA 3UQZA 1XROA 3FPHA 4UTNA 3WSVA 4BKUA 3Q0EA 2QYOA 3PEYA 3K0HA 4HDSA 3E1RA 1ZH4A 4OLHA 1P5RA 1JL3A 1MH9A 2D62A 4WKOA 2GZSA 2WU4A 5TGZA 4L3VA 4UTOA 4DRYA 2XWJI 3W9YA 4FJ1A 2D74A 3RWBA 4IXWA 1QO7A 1H2FA 3TOVA 3UK1A 4EATA 1C50A 3CPJB 2DYKA 4TZKA 1L0LE 3C3BA 4RTKA 2JHFA 2BTQA 2YJTD 2YO2A 3AM1A 1BQ4A 2IPPA 1H5QA 3HEAA 3ER6A 4R2KA 1T2UA 3IEXA 1G9TA 1GGEA 1ZH2A 1IIBA 4TN1A 1BEUB 5EESA 2VHVA 5A9SB 2R1TA 1LQ2A 4DDWA 3RRZA 5IJ0B 3VH3A 3SEZA 3QMWA 5TVKA 4ZTBA 5C5IA 4CGZA 4Z0TA 1DCFA 3LHSA 4D97A 4AJ2A 1J4AA 2FQ1A 2Q0SA 3SQWA 2R00C 4PLHA 2B94A 3WK8A 5LA6B 1LP1B 3D31A 4UBOA 5EHGA 3U4GA 2ZCUA 3DHEA 2YXBA 4QXOA 3G1TA 1VPEA 2GCOA 5H59A 2YWRA 1VQKP 3WIUA 1QO9A 2OAEA 3PKIA 2Q4RA 3OESA 4A27A 4V0KA 4B80A 2FE4A 2AX4A 2WSEJ 4NCIA 1ZCBA 2VBGA 3VPAA 1H3FA 5CBKA 4PFKA 5DYWA 4CM3A 1ZRMA 5EJIA 2QU8A 1LS6A 1U90A 3B3FA 3KR0A 3Q4GA 2PBLA 5TMBA 2FJ0A 4WVLA 4KDEA 2TECE 2FOLA 1JG6A 1NOJA 2P67A 4LMAA 4XA4A 1W4BA 1LX7A 3OOYA 4J94A 5JSHA 4C3OB 3DD5A 1E3EA 2I2BA 3OHPA 2EBUA 2O0HA 4U2BA 2RHTA 3NIGB 2ZSFA 5B3JC 1CE8B 1V11A 2R68A 1KH1A 1V3TA 3C1OA 3ONWA 1YC2A 3MG9A 3FXAA 4GX1A 3ZH9B 3O8DA 4CIVA 1ICEA 1YTZT 2CDAA 1RY3A 3C8DA 2X0NA 2RKLA 4YUVA 3YASA 3O95A 1EZVD 4IIYA 2NMVA 3BMQA 3GP5A 5JIBA 2Y4NA 3GB9A 3PLNA 1X80B 3DKKA 3RANA 2Q5QA 1PUJA 1XMPA 1XRJA 2XGMA 4UMDA 2HADA 2OO5C 5BSVA 3FDXA 3UO8B 1Y7HA 3LE8A 2J07A 4WUVA 2OVFA 4GIBA 2ZXEA 4IFDK 2J3HA 2VTBB 4XM2A 4QQKA 3AT1A 1T8TA 3W5CA 5HJ2A 4H2DA 4B6SA 2FDCA 1P5JA 1C3XA 3GUYA 3IGFA 4I50F 5EZYA 3CVJA 2ZYHA 3TM5A 2OD9A 1NAHA 3VOAA 3DAGA 1FMJA 5DOZA 5DPMA 4OAPA 5AOVA 3EX7C 1WKVA 1VCIA 1TUGA 3T15A 3V80A 3OLWA 3IS3A 2H2GA 5FX2A 1NJGA 3CN9A 1ORIA 4A6EA 1VG1A 3H6HA 5ALEA 1MF7A 3Q8WA 2CXQA 1TDJA 1RJFA 4I1VA 4K9OA 1C3EA 1X13A 1OX4A 4HQNA 4JMPA 1LTKA 5B5SA 4MMZB 1OBVA 4HZIA 2G0AA 2EGGA 3W1EA 2OFWA 4AJIA 1WDMA 4BVBA 1OXXK 3AM3A 2F6RA 5LZ9A 3GDFA 1I2CA 3VI4B 2H6EA 1FFCA 4BNDB 3U4MA 4O2AF 3TSCA 2WMNB 2VDVE 3DV0A 1TB4A 4AO7A 3BL5A 4A8TA 1QK4A 4K03A 3K9GA 3H1GA 1XPUA 1RQNA 1HTBA 1HDCA 1QHGA 2OR3A 1NGSA 2XUIA 2IFTA 1WKCA 1QVFO 4LGYA 5CTAA 4I3HA 1FQOA 1UKAA 2WPVB 5GONA 2V97A 3FWHA 3PPWA 2R00A 1QDLB 1E2BA 4IEIA 3IIEA 3KL4A 2WTNA 4LI3X 4PZ9A 4GXNA 2ORED 3BF8A 1W9MA 1NQVA 3IP5A 7REQB 3NLLA 1O95A 3GAZA 1Q92A 1SVWA 3TUZC 1BCSA 5BU8B 3GI1A 1B3RA 1MX1A 5LWHA 2C4TA 2QG6A 4XX0A 4DV0B 3VOTA 4MS4A 1KSJA 3DKPA 1CUWA 1A4RA 1SO8A 5EFWB 2Y9MB 3PR3A 4IYJA 3CSDA 4KGZA 5GINE 2HHLA 2VJMB 1XAHA 1JH9A 2G36A 3N8IA 4IEEA 2XSZA 4CNBA 3ML1A 1JO5A 2XMQA 1ZSNA 3TL3A 2R6AA 4XRRA 1GDHA 5J2TB 2EZ9A 5B3JA 4PSVA 2OZEA 5FEMA 1OH6A 4DRZA 1R6DA 5EJ5A 4RAOA 1F2UA 2NIPA 3NP7A 1E1QA 3RCBA 1L7NA 4EHHA 5JV5A 2NUPB 1M0EA 1AUXA 1OAAA 1SCUA 4R5HA 5TPZD 2V7GA 1I1NA 1GPAA 4RSGA 3EFEA 1N7GA 1LVHA 1RRGA 2FPPA 2Q3EA 1HI9A 3GP3A 4CLOB 2H65A 1BXRB 3LC1O 1QZUA 1CXZA 4LHWA 4QXMA 4KR3A 2WF7A 4S0ZA 3IQGX 5JEDA 4LX0A 2ZWAA 3HCFA 3BKWA 2ZB3A 5SYNA 1PJRA 1E6KA 3PR2B 2R79A 1PZEA 4G0XA 1AMOA 2OO5A 1NVEA 4WD3A 3C3AA 2CC2A 5AVUA 1JEKA 5L8RJ 3TDMA 4UTPA 5BVHA 4BB6A 3H32A 5AW5A 4HDNB 1JEEA 1TGYA 1V1MB 1QQTA 3M1LA 4UQOA 5CEEA 1K6IA 3NFQA 4ZVTA 1F8FA 1VLHA 2GN2A 4PO9A 1M0WA 1H8AA 1VYHA 2OQIA 4KN5A 4NOLA 3UPTA 1TC1A 3LGSA 5BSMA 4DIMA 1DAKA 4BJ6A 2Y9YA 3AW8A 2B88A 4WCFA 1NFFA 3KFVA 1YI0A 3PWSA 1HYEA 3DLPX 1RI2A 4E14A 4QC2A 5P8WA 5FUQA 2BLLA 4XFJA 3E7WA 1JAZA 4ZZIA 4MEAA 4ZWNA 4CLRB 4GM1A 3U1TA 1RMQA 2QL5A 3UXMA 3MJEA 2G5PA 3VR4D 4X71A 5THKA 4I8IA 1KMCA 2AI3A 1YDEA 3PHBE 3CBGA 3FWKA 3JXEA 2IODA 3DDNA 3L46A 3NATA 1YMQA 1VA5A 2Y68A 1T2KD 1B73A 1NJ8A 4BVGA 3UM9A 4CV1A 1BE3J 3N7UA 1UZMA 1TM7E 4IICA 2GJKA 2WB4A 3D4OA 3UICA 1CPYA 3SYKA 3USZA 1DKOA 3GPIA 4I55B 2PUHA 4O1IA 1ZJ4A 3SXJA 1ZWLA 1S1CX 1RLMA 1KEZA 1AA0A 3GGJA 4H7FA 3DJYA 5CGZA 1KKLA 2QGNA 3L5KA 5ILGA 4JEUA 1R0SA 4PZLA 5GV7A 3DOHA 4FDLA 2JFPA 3B5JA 4KXFB 2X86A 4BPBA 1ZP6A 1RHKA 2CV2A 1PR3A 3PP5A 3UJDA 5D7BA 2XHZA 3HC7A 3ZDQA 4JI4B 5ALNA 2JFYA 5F1OA 4BGEA 1ILWA 1K4KA 1GGKA 3I23A 3PUWA 3H84A 2NPOA 1C1XB 1TM2A 1PI3A 3RC8A 1W47A 3DKIA 4PXSA 2BVNA 3CUEF 1XK7A 1PT7A 3LY7A 4FYWA 2ZDHA 1N5LA 3RLFA 3SEFA 1IDN1 2QN3A 2BFDA 5AI8A 3NHWA 5G1OA 1Z2AA 3QK7A 3EQ9A 5D5HA 2ZR7A 3L0BA 3KYCB 4EO9A 3FWLA 3U80A 3QE4A 3P9PA 4C0QC 1PD0A 1KO7A 4MW6A 1KAOA 2C61A 2VPXA 5IT4A 5IYZF 2CUZA 1LI4A 5TVGA 5LQRA 1QGYA 1BD4A 1U7JA 1RKXA 3C3PA 1N2JA 1QK5A 3OZGA 2CV1A 1U80A 1PJ2A 4D43A 2D59A 2NX2A 2IYWA 3WGJA 1EK5A 3RYHA 3JQAB 1T15A 3K0KA 3EDQA 4ZC8A 1XL0A 1VSTA 4I1RA 3VH1A 5D3ZA 4N18A 2FP4A 4ZAWA 3U6BA 2YKOA 1WCWA 1NAYA 4X94A 2ADFA 1OFHA 3EGCA 1UCFA 4EJFA 2YWXA 1L7PA 2RGGA 1C81A 3NWPA 3VPBA 3Q3CA 2UXDB 4M49A 1YYCA 4R9RA 4J76A 4PM4A 4D6PA 1ZXBA 2MJZA 5JG7A 5KIAA 1Q0ZA 4BKMA 4TMWA 1N1GA 3PFIA 4KLCA 3W9BA 4D2IA 1P84I 3ST7A 3I2KA 1OZ0A 1AZWA 3RSHA 1V2HE 1H0RA 1E2MA 4WZBE 3KS9A 4MS1A 1WB4A 1Y4AE 1D1QA 1RKUA 3WRYC 4GS5A 5GAJA 2QPAA 2X9NA 4GU5A 1NTZJ 4ZCSA 1CVRA 1N9KA 1O8CA 1Z6GA 3IVXA 4TWRA 2HCBA 3NNDA 3ANNA 3OZBA 2MOKA 1BN7A 2WWWA 3H3FA 4X7BA 5IUNC 1OVUA 4R9VA 4FINA 1S4XA 1NQTA 1GTL1 3T3DA 3AWDA 4RJJA 1T2KC 1SVKA 3TRHA 1H3EA 3AQ4A 4RGQA 4YHBA 4IP0A 1W5TA 1A4UA 3E2IA 1O6GA 1ZN2A 4CGYA 1YXMA 1VP3A 3VR2D 4BWFB 4B6OA 2OBXA 5H81A 1NTKE 1Y8ZA 3OEED 2DWUA 4HGNA 1KY3A 5HNKA 5CK4A 4BP1A 3K8YA 4K46A 3TLGA 1SXHA 4UHBA 3I52A 3U44A 3GJXC 4JOSA 4YRQA 5GTHH 4O59O 1JJVA 2JLRA 1KMMA 4KREA 2IELA 3HB7A 1Z6PA 3CI9A 3FOFC 3WVNA 1T43A 4IHQA 5JNSA 1VRCA 2VSOA 5FD8A 5BYBA 1FSSA 3FYSA 3KUKA 1AVTA 3HU2A 1M8KA 4X1OA 4G0NA 1VJDA 4BEVA 1QIFA 3CLTD 2R44A 1BMTA 3KVYA 2B9BA 3PFWO 2LR0A 4EJ2A 4MGHA 4A1FA 3JAMA 4IBOA 1HE1C 3PPXA 4L9WA 3JQRA 3DCIA 4LYGA 3D3KA 1QCZA 3QVUA 3OZUA 2TMKA 4DQXA 3W8EA 3E9MA 1IPHA 4NVRA 5TF0A 1SD2A 2GTPA 1KDZA 3GROA 2PGJA 1ITZA 1G6Q1 5CDSA 1K97A 4MQEA 3L8YA 1WF6A 3E82A 1ZKDA 4LK2A 4QGBA 4G1UC 5F9HA 1ECPA 3OQVA 3H1TA 3L82B 3F1KA 5AW2B 4BJHB 5ECGC 5EZSA 4FGWA 1MIOB 1YR6A 2HF7A 4B31A 3Q3IA 3ZV5A 4RS3A 4AZ0A 5TPZA 3ZYCA 3H1LD 1KR2A 3VKHA 1C7QA 3DOOA 4HUJA 4ZYXA 1VECA 2PLNA 1DIOB 2H1LA 5JR3A 4WBAA 1A9PA 3CV3A 2DW3A