5KLVJ

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
61
structure length
61
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
total genus 18
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 5klvJ00
3TGUJ 1KB9I 3L73J 1BGYJ 1NTKJ 2FYUJ 3H1JJ 1PP9J 1BCCJ 1P84I 1L0LJ 3L70J 1SQXJ 3H1LJ 5KLVJ 3BCCJ 3L72J 3L75J 1L0NJ 4PD4I 1SQBJ 3L71J 1NU1J 1NTZJ 4D6TJ 1EZVI 1SQVJ 4U3FJ 3H1IJ 2IBZI 3CXHI 1BE3J 3L74J 1KYOI 3H1HJ 1SQQJ 1NTMJ 2BCCJ 3CWBJ 3CX5I 3H1KJ 1SQPJ
chains in the Genus database with same CATH superfamily
3AEAC 4UB6H 1J2JB 3L37A 1SQXD 2B9BA 5TISE 1HTLC 1Y8AA 1X79B 4IOIH 3CWBJ 1AVOA 2QM7A 3PLNA 1VQ7P 1FDMA 2GUSA 2A06G 3F5HA 3VMYA 5E79E 1JM0A 5H2FE 4NPDA 4PD4I 2R32A 1SQXE 2Z5HA 1OFCX 4JYCA 2FFDC 1GU4A 3V2QA 2FYUG 4Y28J 4ZKPA 3A0HH 1RQVA 2P58A 1L0NK 2ZVOB 2PP6A 1L2PA 3L75G 3AEGC 4D6TJ 1KFMA 3CCRP 1OVRA 3A7OA 1PP9J 2WPQA 1EZVD 2IZ1A 1AJYA 1SP4A 1K8AQ 3VTPC 4RKUJ 1SQPJ 2NPSD 2RMZA 1M57D 2HODA 1QGKB 1DD4A 2Y0CA 1J1EB 1OW7A 3JC22 1SQBJ 1SQQD 1VL2A 3L35A 3U1CA 3W68A 3WUTA 1EZVE 3M0AA 1J1EC 2K3RA 2HYNA 2FY8A 1KYOH 3CMEP 3Q2YA 2IYOA 5KLVD 1L0LJ 1NVOA 1JY2N 1Q90D 4WWIA 5KAFE 1NTMK 5AW4B 1JUNA 3H1IJ 1MZ9A 3CXHI 2NPSA 2O01H 2A06D 3BASA 4BRYB 4OGQB 2N1TD 2POHA 1BDDA 4GOEA 1SQQE 4OGQC 2P2UA 3AE4C 2JKVA 2V7QH 1DX7A 1KN7A 3L36A 5KLVE 5AVUB 2OQQA 1AQTA 1HUCA 3H1LD 4EYYQ 2KUBA 1NHLA 2A06E 3IFMA 2B89A 2C9NY 1VQ6P 3AEFC 4OWFA 2BCCD 1NU1J 2N1TA 4NPEA 2XNDH 3M91A 1ZV8A 1M90Q 4W80A 2OYIB 1JEKA 3FWNA 1L4AB 3RL0g 1IK9A 1L0LG 4M3LA 3A5TA 2FYZA 1PZQA 1L4AC 4NPFX 3H1LE 3GF3A 3AEEC 2PFXA 2W6AA 1PGQA 2H8PD 2FXOA 2BCCE 1SLQA 2YKQA 1S5LX 1PGJA 2J59M 3VMZA 1NJIQ 3K5BA 1QLED 3M9HA 2OYHB 1FZBA 3HD7D 1KTMA 1BGYD 3GHGC 1CI6A 3S4RA 1NGMB 3B8EB 4H13C 2H7HA 1S5LH 1SQVD 1RF0A 5K5GB 4YTPC 1MFTA 1JTHA 2AXTE 3ABVC 4PJ0H 2UWJE 1M7LA 3V2PA 2IDBA 2ZFCA 2C0WA 2O1KA 2Z5IA 2L91A 1BCCG 2WSEH 3E1IA 1OZHA 2VRSA 3CMAP 1BGYE 2AEJA 2E42A 4UB8H 2WSSH 3Q1MA 1NTZJ 3HD7A 3BVHA 1KYOI 2KIKA 1HF9A 3S1KA 1RE3C 1JOCA 5AW3B 1HJBA 3AE7C 2MJZA 4I7ZB 1SQVE 2FYNB 4CPGA 2Q6QA 1IC2A 2IFNA 4H44D 1LTJA 5EFWB 2IBZD 3L70J 1U57A 4YPCA 2WTYA 1NAYA 3OA7A 4I7ZC 1YJ9P 4ZKUA 2CK3H 1KILB 2KS1B 4RESB 4W7YA 4DT0A 2ITAA 5CJ4A 4JPZB 1FOSE 1KILC 1VQ9P 3HUSB 4WY4B 3CCVP 1Q7YQ 2W83C 1LT1A 3WMM0 1NYHA 2E75D 2QIWA 3Q5PA 3HUSC 1KQLA 2IBZE 2M3EA 3MIWA 1HH0A 1NTKK 4WY4C 4ASVA 1U7MA 2GUVA 1L0ND 3B5ND 2A45H 3HE5B 3FXEA 2FBWC 5AVQB 2Q9IA 1M1JC 3H1HG 2A45G 3FX0A 2Q3EA 2WPVB 5B66H 2W90A 1UIIA 2KSEA 2WSFH 2E5TA 3N4XA 2M5AB 2RKLA 1QEXA 1RH5B 1L0NE 4PD4H 2N1TB 3L73J 3CPWO 3B5NA 3H1JJ 1Q2NA 3TGUG 3BCCD 2Y9ZA 3L72D 3RL0B 3G4SP 5B5EH 4IL6X 5AVRB 3H32A 3RL0C 1RE4C 5AVSB 1LT9A 3E7KA 1FDIA 1NTMD 4N78D 4TLFA 4I2LC 4IL6H 1Q82Q 3BCCE 3OAKA 3L72E 1VQMP 1RHZB 1EQ7A 3A2AA 2XZRA 5KJ7C 3KHUA 4UB8E 1N7SB 1IO4A 2LXBA 3L71J 3I5CA 1SQQJ 1N7SC 1HBWA 3AE5C 2ZVNB 3RGUA 1Y9BA 3L73G 1S2EA 1NTME 4N78E 3H1JG 4WVZA 5AVVB 1W2EA 1VQKP 4HYTB 5KLVJ 2IFMA 1H8AA 3H1HD 1VQ4P 4BXLA 3EFGA 3IAOA 5AW1B 3CXHH 4KT0J 3C9IA 5APXA 3H6PA 2P7JA 4GODA 1G2CA 5CCHD 1EDLA 2K9YA 2DW3A 2KZIA 4O9BA 4LGDE 2ZXEB 1OXZA 1TU3F 3KZIH 5AVYB 2PRRA 3RK2B 2ZYDA 2QJKC 1MUUA 4PD4D 3H1HE 2A45I 1NTKG 3IR9A 3M06A 4ASWA 3G6EP 2HPCB 3H1LJ 5KLIB 3RK2C 1VPCA 3CC7P 2QSIA 1X9VA 4U3FG 4H13D 2BCCJ 1PPJG 2ZT9B 5KLIC 3BRTB 1X0TA 1YTZI 5B66E 4R4MA 5CCHA 3HTKB 3U59A 1L0LK 2R3SA 2G8YA 1YJWP 4H44B 2ZT9C 3PH0A 2E76D 2OTJP 4PD4E 2I1KA 1LWUB 2XNXA 2H43A 3PRJA 5KKZB 4A7PA 4L75A 1OIPA 2YKPA 3GHGA 1LWUC 1EDIA 4C46A 4AQRD 3T97A 3AECC 3V4QA 1LTBC 3WU2H 1T3UA 2D2CB 2PGDA 3L74G 2LXCB 3ZDMA 2WQYC 5DJUB 3KYQA 1RF1B 2I1JA 1BGYJ 3OW2O 1GTWA 1JY3N 3Q5SA 2D2CC 2JWAA 3RK3B 3KDPB 3D70A 3PTZA 4EI2A 2W8ZA 4AYCA 1NU1K 1RF1C 4PV1D 3II6A 1SQVJ 1QX8A 3CCMP 3RK3C 2HR3A 3MP7B 1FZAA 3H1KJ 2XDJA 4LC1A 3CWBG 1KZUB 2E74D 1T2KC 1H88A 5AW0B 4OVNF 1LP1B 1R5LA 3VMAA 3CXHD 5GTIH 3QWOC 1KFNA 5DJTB 3D6ZA 4K35A 1JNMA 1ZLLA 2L5GB 1NTKD 3ITKA 4MN4C 1LTTC 3JCUH 1EZVI 2OARA 4GDOA 4D6TG 3PJSK 3CXHE 3O6QA 2CPSA 1MFZA 1U7JA 1FZCA 1R5SA 3NTNA 1VF5B 1S9KD 1PFIA 1JCDA 4B86A 1PP9G 1NTKE 2KK7A 1VF5C 5AW6B 1LTSC 3P7KA 1BE3J 1IFDA 4XA4A 3PP5A 1YI2P 2ZYGA 2FYUD 4UB6E 4I6MC 1X22A 1SQPG 2KLVA 4C7NA 2K9JA 4EOTA 1ZW0A 1HWTC 2ZAEB 3LW5J 1NKZB 1QL2A 3L75D 1URQB 1MV8A 5CJ0A 1VDFA 1NTZK 1FU1A 2AEMA 2KXPB 1SQBG 3MUDC 2QEXP 1S9KE 1URQC 1GL2D 2J58A 1KB9I 5CMZA 4Y99B 1ZR2A 5CCGC 2WSCJ 3V5BA 1N73A 2FYUE 4XFJA 2OYIC 3VYIA 3TNUA 3H1IG 3L75E 3M0DC 3AE1C 3CX5H 3A0HE 3CC4P 1EC5A 2V4HA 1H0TA 3F89A 3TSIA 3L72J 3EQ2A 1NKNA 5CHXA 3R4YA 1DEEG 1GL2A 4GIFA 1BE3G 2JO1A 1KD1Q 2YXRB 2OYHC 1P84I 3G9RA 2KNCA 1KYOD 1SFCD 3VP8A 1NU1G 1QVGO 1PGPA 4YXDC 4N6JA 2Q3IA 3G3ZA 5GTIE 2Q5UA 2QA4P 1W2BO 4H0LD 3BATA 3A3YB 4WB4A 3HE4A 1N2DC 1KYOE 2RH0A 3SWKA 5M1BA 1SFCA 2FXPA 3JCUE 2HODB 1GU5A 1KQSO 1NWQA 3HRNA 1PIXA 2W27A 1YIJP 2KP8A 2FYNC 2YO3A 3AE2C 1EDKA 4YXWH 1JY3O 1L0LD 5APUA 1VQOP 1J1DB 1OMIA 3CCUP 1IFIA 2YKOA 2I8DA 5AVZB 2C0XA 1IZNB 1J1DC 2XKMA 1E79H 4L73A 3B4SA 2NPSB 2LKMA 3A0BH 2P1JA 4HJGH 1GW3A 1YQ4C 3CD6P 2Q7CA 4JF7A 5APTA 1SQXJ 4C7RA 2XU6A 2YNYA 1QVFO 2QJYB 3TF5A 1SQQK 1L0LE 3M9QA 2Y0DA 5APYA 3SWFA 2ZXXA 1NTZG 1HGVA 1JMMA 3IN6A 1BSNA 1OVVA 2QJYC 1DEBA 2OYOA 1LNQA 1ZXGA 3CCSP 1JY2O 1SVFA 2FFDA 2WWWA 1NU1D 3L70G 5TISH 1GMJA 2HG5D 4KHXA 3CX5I 2M8RA 3SSUA 1BCCD 2JEEA 3LIEA 2E43A 1SS1A 1KV4A 2N1TC 3KXDA 2WVRA 5E79H 1VQPP 5H2FH 3CCJP 1Z56A 1RQUA 2IZ0A 3AE9C 1VQNP 1IJDB 1NU1E 1DD3A 5AW2B 3WUUA 4DCKA 1BDCA 1T8ZA 1S5LE 2QJPB 3RBXA 1SQXG 3PHLA 1BCCE 2WPRA 4PJ0E 1CW5A 2Q1KA 1JCCA 4OGQD 2QJPC 2QG4A 1CI6B 2WT7A 1EXIA 2KNCB 2K88A 4Z1MH 1S72P 1JTHB 5KAIH 1GZLA 1OVUA 1RF0C 1NTZD 4BRYA 3NXSA 2B87A 1JB0J 4HH2A 3HD7B 1UIXA 1L4AD 1CSBA 1KORA 1IK7A 4GKGA 2AEFA 1X8YA 3HD7C 4I1LA 1JMBA 1LTIC 1LTJB 4DZOA 1EZVG 3AEDC 5KAFH 2QRXA 3EFFK 2Y0EA 1SQPK 3P32A 1AQ5A 3TGUD 1LTJC 1NTZE 1YHQP 2FYUJ 1NAFA 3V4WA 2Y9YA 5GTHH 2SPZA 2WPSA 2KSJA 3GG2A 1OW6A 1SQBK 3L75J 3L71G 1VQLP 1YBKA 2KLUA 1ZP0C 1SQQG 2RN0A 2NRGA 1T6AA 1FC2C 1L4AA 4OH8B 4TT3H 4W7ZA 3M0DA 1FZGA 1KB9H 3TGUE 4RO0A 5KLVG 3SWYA 3D6YA 1USEA 4H44C 3TYYA 2N9BA 1ZR4A 3N7NA 2H88C 1ZN5A 1JY2P 1NH4A 3VOPA 3G71P 5KKZC 1IFJA 2OYHA 1AFOA 2ZYAA 5B5EE 2FFDB 1FOSF 5L8RJ 2JJLA 3L73D 2E75B 5AW7B 3H1JD 2CPBA 3Q3DA 4EIJA 5CBNA 3Q5RA 2OGUA 1G1JA 1KMIZ 3AEBC 4IFMA 1K73Q 3VMXA 2E75C 3FXDA 3B5NB 2HLOA 5BVZA 3H1LG 1P84H 2R5BA 2B88A 2P10A 4IL6E 1LTGC 1KILD 1FZEA 2YXQB 1S1CX 3B5NC 3C8VA 2BCCG 5AW8B 1RE3A 3H32B 1HGZA 2O01J 5KTBA 2BASA 4WY4D 3L73E 3H1JE 1LT9B 3D71A 2K1AA 3UIAA 2GA1A 1ZOYC 5KAIE 3L4FA 1E5WA 2AXTH 2KZJA 3SFEC 1LT9C 3B71A 1LTAC 3NFQA 2V7QJ 1KILE 2IX7C 5AW5B 4R4LA 3CCQP 3CCEP 3L71D 2WMMA 1KILA 4U3FD 1HVVA 3E1RA 2WT7B 1PPJD 2KS1A 2KYVA 1N7LA 1VQ5P 2YMKA 3V2RA 1ZRTD 1YJNP 1H89A 3HUSA 4U7JA 4HB1A 1BGYG 4WY4A 3TK1A 2Z4EA 1W5CE 3W67A 2QVAA 3KZIE 1IFPA 1KB9D 3M9BA 4ZMDA 1CZQA 3C1LA 1RY3A 1SQVG 4K3AA 3L71E 3H1KG 1FBMA 5GTHE 4U3FE 2B87B 1M1JA 1M8OB 2FXMA 2MKVA 3HE5A 1PPJE 2IYPA 1ZRTE 3RL0D 1L0NJ 1G2CB 3L74D 3CC2P 4GT1A 2GM4A 2JP3A 1WT6A 5AVXB 1YTZT 5APQA 1KB9E 2M5AA 2O1JA 5APSA 2R3CA 3AE3C 5TJHA 2C9LY 1LGHB 2IBZG 4Y99C 4WBAA 3CWBD 5BU5A 4GOFA 3KPEA 1P84D 5KJ7D 3O8ZA 4L76A 2WZ7A 5AW9B 1YQ3C 1ZMEC 3L74E 5CBOA 1BCCJ 1RE4A 1N7SD 4ZNCA 3WU2E 3BCCJ 4RJTA 5C39A 1IFNA 1MKMA 3LIDA 4XE5B 2YO2A 2WSEJ 3LW5H 5CCHC 1GK6A 1NO4A 1SQXK 3CWBE 2R44A 3SFDC 1R8EA 1P84E 3GHGB 4D6TD 1L0NG 5KJ7A 3T97B 1K9MQ 2WITA 2WSCH 3CL3D 1AV1A 1NTMJ 3V2NA 4H13B 1PP9D 1VQ8P 1WRGA 2W6JH 4N3YB 2G3AA 2O3JA 1N7SA 1WMKA 2O01N 1Y47A 1YYCA 3U1AA 2R5DA 4IFDK 2E76B 3H1KD 1SQPD 5BU8B 2FKWB 3RBZA 2M3BA 1BSHA 3RK2D 2E76C 3MTUE 3V6IA 4D6TE 1SQBD 3EWKA 3CLQA 3P8CD 3BCCG 3GF7A 1PP9E 3L72G 3I56P 3I55P 1K04A 1Q81Q 3NMDA 3H1HJ 1FDOA 2ZT9D 2E5YA 3AE8C 2N9YB 1PGOA 3QH9A 3BRVB 2QE7H 3H1KE 1FZFA 1NOHA 2PAJA 1SQPE 2M0BA 1XTGB 2AXCA 1HJ0A 3GLMA 3GW6A 3H1ID 4PV1B 4DOJA 2WSFJ 1NTMG 5APVA 1SQBE 1FJPA 3TGUJ 1GK4A 3P8CE 2E74B 4PV1C 2HPCA 3O6QB 1M56D 4JBZA 1OWAA 1FJKA 1FZCB 5AVTB 3CX5D 1BE3D 1AVYA 1KQFB 2E74C 2NPSC 2IPPA 2D2CD 2IBZI 1S4XA 3JSVC 3HTKA 1FZCC 1GDTA 3VN0A 2K37A 1D7MA 2ZJSE 1OX3A 1DH3A 3H1IE 2JR8A 3RK3D 4C7NB 3R2PA 2K9JB 2OTLP 5KLVK 1M1JB 3S9OA 1T2KD 1LWUA 2JDIH 3P8MC 1N8RQ 4IFFA 3USSA 1S3JA 3CCLP 2YMYA 3CX5E 1BE3E 3CI9A 1T3JA 3VP9A 3MHVA 1N73B 2HFED 1RF1A 3RK3E 2YIUB 2BEQD 2FYUK 1JO5A 3TNUB 3IF4A 3WUVA 1N73C 1PL5A 1K05A 4DJGA 2YIUC 1EDJA 4JYBA 1QL1A 2KB7P 1H0TB 3MD0A 2KOGA 4EDFA 1LP1A 1GL2B 1YITP 2XV5A 1VF5D 3MZWB 4AUWA 1GL2C 1AA0A 1A02F 3GMAA 1IFMA 2KI7B 1PV3A 2QM8A 2JWDA 3FWLA 3TDKA 3KQGA 5AVWB 4QMAA 1N86A 1NTKJ 1M1KQ 1FAVA 1URQD 1GD2E 1GW4A 1XTCC 4JQ0D 3OJAB 5CCGD 4LLHA 4U3FJ 4KJMA 1DIPA 2J5UA 3HE4B 1KQGB 3L70D 3MGNA 2P67A 4BWNA 1OW8A 1SFCB 2BEZF 1SQVK 1A02J 2NZ2A 4L74A 1FS0E 1SFCC 3A0BE 2OTKE 3MUDA 1URQA 1JY3P 4HKZH 2LR2A 1USDA 2H89C 5CCGA 4H0LB 3AE6C 2QJKB 1KC8Q 3FGAD 3H25A 1G1IA 3L70E 3L74J 1LJ2A 2W6BA 1FE6A 2OYIA 1EXJA 4H0LC 5APWA 1Q86Q
chains in the Genus database with same CATH topology
3TGUJ 1KB9I 3L73J 1BGYJ 1NTKJ 2FYUJ 3H1JJ 1PP9J 1BCCJ 1P84I 1L0LJ 3L70J 1SQXJ 3H1LJ 5KLVJ 3BCCJ 3L72J 3L75J 1L0NJ 4PD4I 1SQBJ 3L71J 1NU1J 1NTZJ 4D6TJ 1EZVI 1SQVJ 4U3FJ 3H1IJ 2IBZI 3CXHI 1BE3J 3L74J 1KYOI 3H1HJ 1SQQJ 1NTMJ 2BCCJ 3CWBJ 3CX5I 3H1KJ 1SQPJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TGU J;  1KB9 I;  3L73 J;  1BGY J;  1NTK J;  2FYU J;  3H1J J;  1PP9 J;  1BCC J;  1P84 I;  1L0L J;  3L70 J;  1SQX J;  3H1L J;  5KLV J;  3BCC J;  3L72 J;  3L75 J;  1L0N J;  4PD4 I;  1SQB J;  3L71 J;  1NU1 J;  1NTZ J;  4D6T J;  1EZV I;  1SQV J;  4U3F J;  3H1I J;  2IBZ I;  3CXH I;  1BE3 J;  3L74 J;  1KYO I;  3H1H J;  1SQQ J;  1NTM J;  2BCC J;  3CWB J;  3CX5 I;  3H1K J;  1SQP J; 
#chains in the Genus database with same CATH topology
 3AEA C;  4UB6 H;  1J2J B;  3L37 A;  1SQX D;  2B9B A;  5TIS E;  1HTL C;  1Y8A A;  1X79 B;  4IOI H;  3CWB J;  1AVO A;  2QM7 A;  3PLN A;  1VQ7 P;  1FDM A;  2GUS A;  2A06 G;  3F5H A;  3VMY A;  5E79 E;  1JM0 A;  5H2F E;  4NPD A;  4PD4 I;  2R32 A;  1SQX E;  2Z5H A;  1OFC X;  4JYC A;  2FFD C;  1GU4 A;  3V2Q A;  2FYU G;  4Y28 J;  4ZKP A;  3A0H H;  1RQV A;  2P58 A;  1L0N K;  2ZVO B;  2PP6 A;  1L2P A;  3L75 G;  3AEG C;  4D6T J;  1KFM A;  3CCR P;  1OVR A;  3A7O A;  1PP9 J;  2WPQ A;  1EZV D;  2IZ1 A;  1AJY A;  1SP4 A;  1K8A Q;  3VTP C;  4RKU J;  1SQP J;  2NPS D;  2RMZ A;  1M57 D;  2HOD A;  1QGK B;  1DD4 A;  2Y0C A;  1J1E B;  1OW7 A;  3JC2 2;  1SQB J;  1SQQ D;  1VL2 A;  3L35 A;  3U1C A;  3W68 A;  3WUT A;  1EZV E;  3M0A A;  1J1E C;  2K3R A;  2HYN A;  2FY8 A;  1KYO H;  3CME P;  3Q2Y A;  2IYO A;  5KLV D;  1L0L J;  1NVO A;  1JY2 N;  1Q90 D;  4WWI A;  5KAF E;  1NTM K;  5AW4 B;  1JUN A;  3H1I J;  1MZ9 A;  3CXH I;  2NPS A;  2O01 H;  2A06 D;  3BAS A;  4BRY B;  4OGQ B;  2N1T D;  2POH A;  1BDD A;  4GOE A;  1SQQ E;  4OGQ C;  2P2U A;  3AE4 C;  2JKV A;  2V7Q H;  1DX7 A;  1KN7 A;  3L36 A;  5KLV E;  5AVU B;  2OQQ A;  1AQT A;  1HUC A;  3H1L D;  4EYY Q;  2KUB A;  1NHL A;  2A06 E;  3IFM A;  2B89 A;  2C9N Y;  1VQ6 P;  3AEF C;  4OWF A;  2BCC D;  1NU1 J;  2N1T A;  4NPE A;  2XND H;  3M91 A;  1ZV8 A;  1M90 Q;  4W80 A;  2OYI B;  1JEK A;  3FWN A;  1L4A B;  3RL0 g;  1IK9 A;  1L0L G;  4M3L A;  3A5T A;  2FYZ A;  1PZQ A;  1L4A C;  4NPF X;  3H1L E;  3GF3 A;  3AEE C;  2PFX A;  2W6A A;  1PGQ A;  2H8P D;  2FXO A;  2BCC E;  1SLQ A;  2YKQ A;  1S5L X;  1PGJ A;  2J59 M;  3VMZ A;  1NJI Q;  3K5B A;  1QLE D;  3M9H A;  2OYH B;  1FZB A;  3HD7 D;  1KTM A;  1BGY D;  3GHG C;  1CI6 A;  3S4R A;  1NGM B;  3B8E B;  4H13 C;  2H7H A;  1S5L H;  1SQV D;  1RF0 A;  5K5G B;  4YTP C;  1MFT A;  1JTH A;  2AXT E;  3ABV C;  4PJ0 H;  2UWJ E;  1M7L A;  3V2P A;  2IDB A;  2ZFC A;  2C0W A;  2O1K A;  2Z5I A;  2L91 A;  1BCC G;  2WSE H;  3E1I A;  1OZH A;  2VRS A;  3CMA P;  1BGY E;  2AEJ A;  2E42 A;  4UB8 H;  2WSS H;  3Q1M A;  1NTZ J;  3HD7 A;  3BVH A;  1KYO I;  2KIK A;  1HF9 A;  3S1K A;  1RE3 C;  1JOC A;  5AW3 B;  1HJB A;  3AE7 C;  2MJZ A;  4I7Z B;  1SQV E;  2FYN B;  4CPG A;  2Q6Q A;  1IC2 A;  2IFN A;  4H44 D;  1LTJ A;  5EFW B;  2IBZ D;  3L70 J;  1U57 A;  4YPC A;  2WTY A;  1NAY A;  3OA7 A;  4I7Z C;  1YJ9 P;  4ZKU A;  2CK3 H;  1KIL B;  2KS1 B;  4RES B;  4W7Y A;  4DT0 A;  2ITA A;  5CJ4 A;  4JPZ B;  1FOS E;  1KIL C;  1VQ9 P;  3HUS B;  4WY4 B;  3CCV P;  1Q7Y Q;  2W83 C;  1LT1 A;  3WMM 0;  1NYH A;  2E75 D;  2QIW A;  3Q5P A;  3HUS C;  1KQL A;  2IBZ E;  2M3E A;  3MIW A;  1HH0 A;  1NTK K;  4WY4 C;  4ASV A;  1U7M A;  2GUV A;  1L0N D;  3B5N D;  2A45 H;  3HE5 B;  3FXE A;  2FBW C;  5AVQ B;  2Q9I A;  1M1J C;  3H1H G;  2A45 G;  3FX0 A;  2Q3E A;  2WPV B;  5B66 H;  2W90 A;  1UII A;  2KSE A;  2WSF H;  2E5T A;  3N4X A;  2M5A B;  2RKL A;  1QEX A;  1RH5 B;  1L0N E;  4PD4 H;  2N1T B;  3L73 J;  3CPW O;  3B5N A;  3H1J J;  1Q2N A;  3TGU G;  3BCC D;  2Y9Z A;  3L72 D;  3RL0 B;  3G4S P;  5B5E H;  4IL6 X;  5AVR B;  3H32 A;  3RL0 C;  1RE4 C;  5AVS B;  1LT9 A;  3E7K A;  1FDI A;  1NTM D;  4N78 D;  4TLF A;  4I2L C;  4IL6 H;  1Q82 Q;  3BCC E;  3OAK A;  3L72 E;  1VQM P;  1RHZ B;  1EQ7 A;  3A2A A;  2XZR A;  5KJ7 C;  3KHU A;  4UB8 E;  1N7S B;  1IO4 A;  2LXB A;  3L71 J;  3I5C A;  1SQQ J;  1N7S C;  1HBW A;  3AE5 C;  2ZVN B;  3RGU A;  1Y9B A;  3L73 G;  1S2E A;  1NTM E;  4N78 E;  3H1J G;  4WVZ A;  5AVV B;  1W2E A;  1VQK P;  4HYT B;  5KLV J;  2IFM A;  1H8A A;  3H1H D;  1VQ4 P;  4BXL A;  3EFG A;  3IAO A;  5AW1 B;  3CXH H;  4KT0 J;  3C9I A;  5APX A;  3H6P A;  2P7J A;  4GOD A;  1G2C A;  5CCH D;  1EDL A;  2K9Y A;  2DW3 A;  2KZI A;  4O9B A;  4LGD E;  2ZXE B;  1OXZ A;  1TU3 F;  3KZI H;  5AVY B;  2PRR A;  3RK2 B;  2ZYD A;  2QJK C;  1MUU A;  4PD4 D;  3H1H E;  2A45 I;  1NTK G;  3IR9 A;  3M06 A;  4ASW A;  3G6E P;  2HPC B;  3H1L J;  5KLI B;  3RK2 C;  1VPC A;  3CC7 P;  2QSI A;  1X9V A;  4U3F G;  4H13 D;  2BCC J;  1PPJ G;  2ZT9 B;  5KLI C;  3BRT B;  1X0T A;  1YTZ I;  5B66 E;  4R4M A;  5CCH A;  3HTK B;  3U59 A;  1L0L K;  2R3S A;  2G8Y A;  1YJW P;  4H44 B;  2ZT9 C;  3PH0 A;  2E76 D;  2OTJ P;  4PD4 E;  2I1K A;  1LWU B;  2XNX A;  2H43 A;  3PRJ A;  5KKZ B;  4A7P A;  4L75 A;  1OIP A;  2YKP A;  3GHG A;  1LWU C;  1EDI A;  4C46 A;  4AQR D;  3T97 A;  3AEC C;  3V4Q A;  1LTB C;  3WU2 H;  1T3U A;  2D2C B;  2PGD A;  3L74 G;  2LXC B;  3ZDM A;  2WQY C;  5DJU B;  3KYQ A;  1RF1 B;  2I1J A;  1BGY J;  3OW2 O;  1GTW A;  1JY3 N;  3Q5S A;  2D2C C;  2JWA A;  3RK3 B;  3KDP B;  3D70 A;  3PTZ A;  4EI2 A;  2W8Z A;  4AYC A;  1NU1 K;  1RF1 C;  4PV1 D;  3II6 A;  1SQV J;  1QX8 A;  3CCM P;  3RK3 C;  2HR3 A;  3MP7 B;  1FZA A;  3H1K J;  2XDJ A;  4LC1 A;  3CWB G;  1KZU B;  2E74 D;  1T2K C;  1H88 A;  5AW0 B;  4OVN F;  1LP1 B;  1R5L A;  3VMA A;  3CXH D;  5GTI H;  3QWO C;  1KFN A;  5DJT B;  3D6Z A;  4K35 A;  1JNM A;  1ZLL A;  2L5G B;  1NTK D;  3ITK A;  4MN4 C;  1LTT C;  3JCU H;  1EZV I;  2OAR A;  4GDO A;  4D6T G;  3PJS K;  3CXH E;  3O6Q A;  2CPS A;  1MFZ A;  1U7J A;  1FZC A;  1R5S A;  3NTN A;  1VF5 B;  1S9K D;  1PFI A;  1JCD A;  4B86 A;  1PP9 G;  1NTK E;  2KK7 A;  1VF5 C;  5AW6 B;  1LTS C;  3P7K A;  1BE3 J;  1IFD A;  4XA4 A;  3PP5 A;  1YI2 P;  2ZYG A;  2FYU D;  4UB6 E;  4I6M C;  1X22 A;  1SQP G;  2KLV A;  4C7N A;  2K9J A;  4EOT A;  1ZW0 A;  1HWT C;  2ZAE B;  3LW5 J;  1NKZ B;  1QL2 A;  3L75 D;  1URQ B;  1MV8 A;  5CJ0 A;  1VDF A;  1NTZ K;  1FU1 A;  2AEM A;  2KXP B;  1SQB G;  3MUD C;  2QEX P;  1S9K E;  1URQ C;  1GL2 D;  2J58 A;  1KB9 I;  5CMZ A;  4Y99 B;  1ZR2 A;  5CCG C;  2WSC J;  3V5B A;  1N73 A;  2FYU E;  4XFJ A;  2OYI C;  3VYI A;  3TNU A;  3H1I G;  3L75 E;  3M0D C;  3AE1 C;  3CX5 H;  3A0H E;  3CC4 P;  1EC5 A;  2V4H A;  1H0T A;  3F89 A;  3TSI A;  3L72 J;  3EQ2 A;  1NKN A;  5CHX A;  3R4Y A;  1DEE G;  1GL2 A;  4GIF A;  1BE3 G;  2JO1 A;  1KD1 Q;  2YXR B;  2OYH C;  1P84 I;  3G9R A;  2KNC A;  1KYO D;  1SFC D;  3VP8 A;  1NU1 G;  1QVG O;  1PGP A;  4YXD C;  4N6J A;  2Q3I A;  3G3Z A;  5GTI E;  2Q5U A;  2QA4 P;  1W2B O;  4H0L D;  3BAT A;  3A3Y B;  4WB4 A;  3HE4 A;  1N2D C;  1KYO E;  2RH0 A;  3SWK A;  5M1B A;  1SFC A;  2FXP A;  3JCU E;  2HOD B;  1GU5 A;  1KQS O;  1NWQ A;  3HRN A;  1PIX A;  2W27 A;  1YIJ P;  2KP8 A;  2FYN C;  2YO3 A;  3AE2 C;  1EDK A;  4YXW H;  1JY3 O;  1L0L D;  5APU A;  1VQO P;  1J1D B;  1OMI A;  3CCU P;  1IFI A;  2YKO A;  2I8D A;  5AVZ B;  2C0X A;  1IZN B;  1J1D C;  2XKM A;  1E79 H;  4L73 A;  3B4S A;  2NPS B;  2LKM A;  3A0B H;  2P1J A;  4HJG H;  1GW3 A;  1YQ4 C;  3CD6 P;  2Q7C A;  4JF7 A;  5APT A;  1SQX J;  4C7R A;  2XU6 A;  2YNY A;  1QVF O;  2QJY B;  3TF5 A;  1SQQ K;  1L0L E;  3M9Q A;  2Y0D A;  5APY A;  3SWF A;  2ZXX A;  1NTZ G;  1HGV A;  1JMM A;  3IN6 A;  1BSN A;  1OVV A;  2QJY C;  1DEB A;  2OYO A;  1LNQ A;  1ZXG A;  3CCS P;  1JY2 O;  1SVF A;  2FFD A;  2WWW A;  1NU1 D;  3L70 G;  5TIS H;  1GMJ A;  2HG5 D;  4KHX A;  3CX5 I;  2M8R A;  3SSU A;  1BCC D;  2JEE A;  3LIE A;  2E43 A;  1SS1 A;  1KV4 A;  2N1T C;  3KXD A;  2WVR A;  5E79 H;  1VQP P;  5H2F H;  3CCJ P;  1Z56 A;  1RQU A;  2IZ0 A;  3AE9 C;  1VQN P;  1IJD B;  1NU1 E;  1DD3 A;  5AW2 B;  3WUU A;  4DCK A;  1BDC A;  1T8Z A;  1S5L E;  2QJP B;  3RBX A;  1SQX G;  3PHL A;  1BCC E;  2WPR A;  4PJ0 E;  1CW5 A;  2Q1K A;  1JCC A;  4OGQ D;  2QJP C;  2QG4 A;  1CI6 B;  2WT7 A;  1EXI A;  2KNC B;  2K88 A;  4Z1M H;  1S72 P;  1JTH B;  5KAI H;  1GZL A;  1OVU A;  1RF0 C;  1NTZ D;  4BRY A;  3NXS A;  2B87 A;  1JB0 J;  4HH2 A;  3HD7 B;  1UIX A;  1L4A D;  1CSB A;  1KOR A;  1IK7 A;  4GKG A;  2AEF A;  1X8Y A;  3HD7 C;  4I1L A;  1JMB A;  1LTI C;  1LTJ B;  4DZO A;  1EZV G;  3AED C;  5KAF H;  2QRX A;  3EFF K;  2Y0E A;  1SQP K;  3P32 A;  1AQ5 A;  3TGU D;  1LTJ C;  1NTZ E;  1YHQ P;  2FYU J;  1NAF A;  3V4W A;  2Y9Y A;  5GTH H;  2SPZ A;  2WPS A;  2KSJ A;  3GG2 A;  1OW6 A;  1SQB K;  3L75 J;  3L71 G;  1VQL P;  1YBK A;  2KLU A;  1ZP0 C;  1SQQ G;  2RN0 A;  2NRG A;  1T6A A;  1FC2 C;  1L4A A;  4OH8 B;  4TT3 H;  4W7Z A;  3M0D A;  1FZG A;  1KB9 H;  3TGU E;  4RO0 A;  5KLV G;  3SWY A;  3D6Y A;  1USE A;  4H44 C;  3TYY A;  2N9B A;  1ZR4 A;  3N7N A;  2H88 C;  1ZN5 A;  1JY2 P;  1NH4 A;  3VOP A;  3G71 P;  5KKZ C;  1IFJ A;  2OYH A;  1AFO A;  2ZYA A;  5B5E E;  2FFD B;  1FOS F;  5L8R J;  2JJL A;  3L73 D;  2E75 B;  5AW7 B;  3H1J D;  2CPB A;  3Q3D A;  4EIJ A;  5CBN A;  3Q5R A;  2OGU A;  1G1J A;  1KMI Z;  3AEB C;  4IFM A;  1K73 Q;  3VMX A;  2E75 C;  3FXD A;  3B5N B;  2HLO A;  5BVZ A;  3H1L G;  1P84 H;  2R5B A;  2B88 A;  2P10 A;  4IL6 E;  1LTG C;  1KIL D;  1FZE A;  2YXQ B;  1S1C X;  3B5N C;  3C8V A;  2BCC G;  5AW8 B;  1RE3 A;  3H32 B;  1HGZ A;  2O01 J;  5KTB A;  2BAS A;  4WY4 D;  3L73 E;  3H1J E;  1LT9 B;  3D71 A;  2K1A A;  3UIA A;  2GA1 A;  1ZOY C;  5KAI E;  3L4F A;  1E5W A;  2AXT H;  2KZJ A;  3SFE C;  1LT9 C;  3B71 A;  1LTA C;  3NFQ A;  2V7Q J;  1KIL E;  2IX7 C;  5AW5 B;  4R4L A;  3CCQ P;  3CCE P;  3L71 D;  2WMM A;  1KIL A;  4U3F D;  1HVV A;  3E1R A;  2WT7 B;  1PPJ D;  2KS1 A;  2KYV A;  1N7L A;  1VQ5 P;  2YMK A;  3V2R A;  1ZRT D;  1YJN P;  1H89 A;  3HUS A;  4U7J A;  4HB1 A;  1BGY G;  4WY4 A;  3TK1 A;  2Z4E A;  1W5C E;  3W67 A;  2QVA A;  3KZI E;  1IFP A;  1KB9 D;  3M9B A;  4ZMD A;  1CZQ A;  3C1L A;  1RY3 A;  1SQV G;  4K3A A;  3L71 E;  3H1K G;  1FBM A;  5GTH E;  4U3F E;  2B87 B;  1M1J A;  1M8O B;  2FXM A;  2MKV A;  3HE5 A;  1PPJ E;  2IYP A;  1ZRT E;  3RL0 D;  1L0N J;  1G2C B;  3L74 D;  3CC2 P;  4GT1 A;  2GM4 A;  2JP3 A;  1WT6 A;  5AVX B;  1YTZ T;  5APQ A;  1KB9 E;  2M5A A;  2O1J A;  5APS A;  2R3C A;  3AE3 C;  5TJH A;  2C9L Y;  1LGH B;  2IBZ G;  4Y99 C;  4WBA A;  3CWB D;  5BU5 A;  4GOF A;  3KPE A;  1P84 D;  5KJ7 D;  3O8Z A;  4L76 A;  2WZ7 A;  5AW9 B;  1YQ3 C;  1ZME C;  3L74 E;  5CBO A;  1BCC J;  1RE4 A;  1N7S D;  4ZNC A;  3WU2 E;  3BCC J;  4RJT A;  5C39 A;  1IFN A;  1MKM A;  3LID A;  4XE5 B;  2YO2 A;  2WSE J;  3LW5 H;  5CCH C;  1GK6 A;  1NO4 A;  1SQX K;  3CWB E;  2R44 A;  3SFD C;  1R8E A;  1P84 E;  3GHG B;  4D6T D;  1L0N G;  5KJ7 A;  3T97 B;  1K9M Q;  2WIT A;  2WSC H;  3CL3 D;  1AV1 A;  1NTM J;  3V2N A;  4H13 B;  1PP9 D;  1VQ8 P;  1WRG A;  2W6J H;  4N3Y B;  2G3A A;  2O3J A;  1N7S A;  1WMK A;  2O01 N;  1Y47 A;  1YYC A;  3U1A A;  2R5D A;  4IFD K;  2E76 B;  3H1K D;  1SQP D;  5BU8 B;  2FKW B;  3RBZ A;  2M3B A;  1BSH A;  3RK2 D;  2E76 C;  3MTU E;  3V6I A;  4D6T E;  1SQB D;  3EWK A;  3CLQ A;  3P8C D;  3BCC G;  3GF7 A;  1PP9 E;  3L72 G;  3I56 P;  3I55 P;  1K04 A;  1Q81 Q;  3NMD A;  3H1H J;  1FDO A;  2ZT9 D;  2E5Y A;  3AE8 C;  2N9Y B;  1PGO A;  3QH9 A;  3BRV B;  2QE7 H;  3H1K E;  1FZF A;  1NOH A;  2PAJ A;  1SQP E;  2M0B A;  1XTG B;  2AXC A;  1HJ0 A;  3GLM A;  3GW6 A;  3H1I D;  4PV1 B;  4DOJ A;  2WSF J;  1NTM G;  5APV A;  1SQB E;  1FJP A;  3TGU J;  1GK4 A;  3P8C E;  2E74 B;  4PV1 C;  2HPC A;  3O6Q B;  1M56 D;  4JBZ A;  1OWA A;  1FJK A;  1FZC B;  5AVT B;  3CX5 D;  1BE3 D;  1AVY A;  1KQF B;  2E74 C;  2NPS C;  2IPP A;  2D2C D;  2IBZ I;  1S4X A;  3JSV C;  3HTK A;  1FZC C;  1GDT A;  3VN0 A;  2K37 A;  1D7M A;  2ZJS E;  1OX3 A;  1DH3 A;  3H1I E;  2JR8 A;  3RK3 D;  4C7N B;  3R2P A;  2K9J B;  2OTL P;  5KLV K;  1M1J B;  3S9O A;  1T2K D;  1LWU A;  2JDI H;  3P8M C;  1N8R Q;  4IFF A;  3USS A;  1S3J A;  3CCL P;  2YMY A;  3CX5 E;  1BE3 E;  3CI9 A;  1T3J A;  3VP9 A;  3MHV A;  1N73 B;  2HFE D;  1RF1 A;  3RK3 E;  2YIU B;  2BEQ D;  2FYU K;  1JO5 A;  3TNU B;  3IF4 A;  3WUV A;  1N73 C;  1PL5 A;  1K05 A;  4DJG A;  2YIU C;  1EDJ A;  4JYB A;  1QL1 A;  2KB7 P;  1H0T B;  3MD0 A;  2KOG A;  4EDF A;  1LP1 A;  1GL2 B;  1YIT P;  2XV5 A;  1VF5 D;  3MZW B;  4AUW A;  1GL2 C;  1AA0 A;  1A02 F;  3GMA A;  1IFM A;  2KI7 B;  1PV3 A;  2QM8 A;  2JWD A;  3FWL A;  3TDK A;  3KQG A;  5AVW B;  4QMA A;  1N86 A;  1NTK J;  1M1K Q;  1FAV A;  1URQ D;  1GD2 E;  1GW4 A;  1XTC C;  4JQ0 D;  3OJA B;  5CCG D;  4LLH A;  4U3F J;  4KJM A;  1DIP A;  2J5U A;  3HE4 B;  1KQG B;  3L70 D;  3MGN A;  2P67 A;  4BWN A;  1OW8 A;  1SFC B;  2BEZ F;  1SQV K;  1A02 J;  2NZ2 A;  4L74 A;  1FS0 E;  1SFC C;  3A0B E;  2OTK E;  3MUD A;  1URQ A;  1JY3 P;  4HKZ H;  2LR2 A;  1USD A;  2H89 C;  5CCG A;  4H0L B;  3AE6 C;  2QJK B;  1KC8 Q;  3FGA D;  3H25 A;  1G1I A;  3L70 E;  3L74 J;  1LJ2 A;  2W6B A;  1FE6 A;  2OYI A;  1EXJ A;  4H0L C;  5APW A;  1Q86 Q; 
#chains in the Genus database with same CATH homology
 3TGU J;  1KB9 I;  3L73 J;  1BGY J;  1NTK J;  2FYU J;  3H1J J;  1PP9 J;  1BCC J;  1P84 I;  1L0L J;  3L70 J;  1SQX J;  3H1L J;  5KLV J;  3BCC J;  3L72 J;  3L75 J;  1L0N J;  4PD4 I;  1SQB J;  3L71 J;  1NU1 J;  1NTZ J;  4D6T J;  1EZV I;  1SQV J;  4U3F J;  3H1I J;  2IBZ I;  3CXH I;  1BE3 J;  3L74 J;  1KYO I;  3H1H J;  1SQQ J;  1NTM J;  2BCC J;  3CWB J;  3CX5 I;  3H1K J;  1SQP J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...