5KLVJ

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
61
structure length
61
Chain Sequence
b'VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 18
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 5klvJ00
3L71J 1NTMJ 3BCCJ 5KLVJ 1SQVJ 2IBZI 3CWBJ 1NTZJ 3H1HJ 4D6TJ 1SQPJ 2BCCJ 1BCCJ 1BGYJ 2FYUJ 1BE3J 3H1LJ 3L74J 1NTKJ 3L75J 1KYOI 1SQBJ 3CX5I 1PP9J 1NU1J 1L0NJ 4PD4I 3H1JJ 1EZVI 1P84I 3L72J 3TGUJ 3H1IJ 1KB9I 1SQXJ 4U3FJ 1L0LJ 3H1KJ 1SQQJ 3L70J 3CXHI 3L73J
chains in the Genus database with same CATH superfamily
1JM0A 2A06D 1S4XA 3H1KG 2W8ZA 1KQSO 1NKNA 3SWYA 3L72E 1IFDA 4GODA 3RL0C 5AW4B 4W7YA 4JYBA 5KAFE 3G71P 4GT1A 3RK2D 3NTNA 1L0LD 2KB7P 2BEZF 4WVZA 2QJYB 1M90Q 2E74D 3IN6A 2Q3IA 2MJZA 5CCHA 2BEQD 2H89C 2HPCA 1HF9A 1DD3A 2QE7H 3AE6C 3PJSK 4U7JA 1SQPE 4ASVA 1JO5A 2IBZI 1RQUA 3AEGC 4NPDA 3W68A 2I1JA 3RGUA 2RN0A 1OZHA 1OMIA 3WUTA 2NZ2A 4OWFA 1BE3G 4WY4C 3L70D 2W83C 1KD1Q 3L71D 1EZVG 2N1TA 1DEEG 1AVOA 1FOSF 4U3FG 1X0TA 2KI7B 3C1LA 2OARA 1L4AA 1FZGA 1PP9J 3VN0A 1S2EA 1K8AQ 2JEEA 3L72G 1DIPA 5CCGD 1FAVA 2O3JA 2A45G 1X79B 2AEMA 4HB1A 1KILB 1GW3A 2KNCA 4EYYQ 1GDTA 2J59M 1DH3A 4H0LC 2WQYC 1USDA 1L0NK 1VQNP 2K88A 1LGHB 2KS1A 2Y9YA 3SWKA 1BGYD 4EOTA 4I7ZC 1JEKA 1SQPG 3LW5H 3AE8C 1GTWA 1T3UA 3B8EB 1SQQD 2L91A 3CCEP 3JCUH 3HRNA 1LTJC 4L76A 1CI6B 3VP8A 1QL1A 1GZLA 4IFMA 3MUDC 2WPQA 1KC8Q 3CXHE 1FDOA 3P32A 3U1CA 1AFOA 3CPWO 3BCCD 1GL2A 1S3JA 1BCCE 3PP5A 4UB6H 1VQ6P 3EFGA 3CLQA 3V4QA 2QJYC 1SQBD 3M0DA 3AE5C 2OYHB 4LGDE 2Q9IA 3CC7P 3G4SP 1NTMJ 1OW6A 3MGNA 3Q5RA 1LTBC 4B86A 1NTKE 1M8OB 2Q6QA 2N1TB 1FDIA 1KB9E 2PAJA 1SQXE 3B5NB 3V6IA 5CCHD 4L74A 2WT7B 1X22A 2KXPB 3GG2A 1S9KE 1RF1A 5AVVB 3WU2H 1ZRTD 4H13B 1UIXA 5DJUB 5AVTB 2WPVB 2UWJE 1X8YA 2K1AA 2KNCB 4A7PA 5B66H 3AEAC 1HGZA 1XTGB 3Q5SA 4L75A 3OAKA 3M06A 2HFED 3Q1MA 2LXBA 1OW8A 1JCCA 1KILC 3M9QA 1VQ8P 2C0XA 2AEJA 1L4AD 1BCCG 1KILE 5AW8B 2KLVA 4JPZB 1D7MA 3L73D 3WMM0 1QVGO 3T97B 1G2CA 2QIWA 2OYIA 1NTZJ 4PD4E 3KPEA 1KYOD 1SQBJ 4XA4A 1PFIA 3TNUA 4OGQB 1T6AA 1T8ZA 3VYIA 2B87A 3MD0A 1NTKG 4ZMDA 3ZDMA 1IFPA 1OWAA 1KYOH 1M1JA 1SQXG 4PV1C 3TDKA 2XNDH 2FYUK 5B5EH 2NPSA 3L75D 1S5LH 3G3ZA 3F5HA 3P7KA 1NGMB 5H2FE 1IFNA 5BU5A 4M3LA 3V2QA 1NTMK 2HODA 2WVRA 1KORA 1S1CX 1U7MA 5GTHE 1VF5C 1T3JA 3RK3C 1FZCB 2XU6A 3RL0g 3JC22 4NPFX 3L74J 2IZ0A 1FE6A 1BGYG 2E5YA 2IBZE 5C39A 1CZQA 1EXJA 2OYHC 2PP6A 3R2PA 1SQVD 1CW5A 4DT0A 4L73A 1NU1E 5AW5B 1GL2D 1RF1B 1S72P 1Q82Q 3CMEP 2QA4P 3B5NC 2E75B 1PPJE 2Z4EA 3H1HE 2XKMA 2YMKA 4N78E 3H1LE 3CCVP 4BRYB 4YTPC 3C9IA 4H13C 1FS0E 2JWAA 3QWOC 2P1JA 3H1JD 5KLVE 5APVA 5KTBA 1SS1A 4TT3H 2M5AA 4GIFA 2B9BA 1RF0A 1KN7A 4LLHA 2WSCH 3Q2YA 4Y99B 1YJWP 3CWBD 4H44B 1SFCA 2H88C 3BATA 1NTZK 2Y9ZA 2LKMA 2ZT9B 2OTKE 3E1RA 1L0ND 1SQBK 5CHXA 3HUSC 2VRSA 1GU4A 1VQOP 1JNMA 1MV8A 2I8DA 1K05A 1JY2N 1IFMA 3CX5E 3A0HH 2BASA 2IBZG 1M1JB 1HWTC 4C46A 1K9MQ 2E76B 3KDPB 3N4XA 4O9BA 5CCGA 3RBZA 3VMXA 4EI2A 1USEA 1ZV8A 4OVNF 4C7NB 1NU1G 4WB4A 1SQVJ 3GLMA 3A0BH 1OVUA 5KAFH 1PPJG 5CBOA 1YIJP 3V5BA 1JTHA 3H32B 3H1HG 2IFMA 3H1LG 2G3AA 1AQ5A 1N7SB 4HYTB 1N86A 5KLVG 3CC4P 2IPPA 2WSCJ 3L35A 1FZCC 2O01H 2NPSD 1AQTA 1YJNP 5APYA 3MP7B 3EQ2A 1JB0J 4DCKA 5AW0B 3CWBJ 4KJMA 2YKOA 3PHLA 1L2PA 3KZIE 4WY4D 5KKZB 1BE3J 1PP9D 1HJ0A 1LP1A 1NWQA 4EIJA 1IZNB 1AA0A 4U3FJ 4OH8B 2Q3EA 2B88A 1N73C 2FXPA 5KJ7C 3D6ZA 5AW2B 2PRRA 1KV4A 1FZFA 5E79E 3A7OA 1URQC 2H7HA 4I2LC 2WSSH 3CCQP 4N3YB 1H0TA 1BDDA 3O6QA 1Q90D 4Y99C 1RHZB 1SP4A 3TGUE 2OTJP 1FZEA 1U57A 2FBWC 1NO4A 1UIIA 3H1ID 3LIDA 2ZT9C 3F89A 3TF5A 4PJ0E 4D6TE 1EQ7A 1IFIA 1SQVK 3D70A 2O01J 1MKMA 1SQPJ 4K35A 1SFCD 2Q1KA 5KLIC 2M3BA 1W5CE 1YBKA 1FU1A 2E76C 3GHGA 2E42A 1JTHB 3IF4A 2LXCB 5AW7B 4KHXA 4GDOA 3AE9C 4GOFA 2ZXXA 2FYUD 1YTZT 2E43A 3HD7C 3HTKA 2FYNC 1CSBA 1NTMD 3EWKA 5CBNA 3WUUA 1FOSE 1JY3O 3EFFK 1R8EA 1N7SC 1LTTC 1U7JA 1KYOI 2ZYAA 3AEBC 2QRXA 2A06E 1GMJA 5CMZA 2WMMA 1LP1B 2MKVA 2V4HA 1FZAA 3W67A 3TGUG 2ZYDA 1DEBA 2N9BA 1NJIQ 1KB9H 2R5BA 2Z5IA 1LWUA 1Q7YQ 5KAIE 1L0LE 4D6TG 4NPEA 2WITA 3H1IJ 2GM4A 2JWDA 1LT9A 2IYPA 4JF7A 1J1EB 5APTA 2K9JA 1H0TB 3O6QB 4UB8H 1RE4A 2N9YB 1EDIA 2FFDA 3USSA 1PGOA 1HBWA 2AXTH 2HPCB 1Y47A 2FKWB 3BRVB 5DJTB 1NTZD 1QEXA 1SQPK 1BCCJ 2FYUJ 3AE3C 3L70E 2H8PD 3L71E 3G9RA 1ZMEC 3JSVC 3VP9A 3WUVA 2J5UA 1OW7A 4PD4H 1OX3A 3FWNA 2KIKA 4KT0J 4IOIH 4I6MC 3OJAB 2A06G 1NTKJ 2WWWA 1PGJA 5AVXB 1NH4A 1L4AB 4PV1D 2M3EA 1SQXJ 5GTIH 3A3YB 1FJKA 5AW9B 4DOJA 1DD4A 2YKQA 2YO2A 3BASA 1L0LG 1NAFA 3E1IA 4GOEA 1HVVA 2WZ7A 1W2BO 3L74D 2YMYA 2XV5A 5H2FH 1KQGB 4HH2A 4IL6E 1OIPA 4IL6X 2P7JA 2Y0DA 1VL2A 1VF5D 3RK3D 2HG5D 1YQ4C 2JO1A 1R5SA 3C8VA 4WBAA 1DX7A 5GTHH 1BGYE 4GKGA 3BVHA 1MFTA 2WPRA 2KS1B 1SQQE 1MZ9A 2YNYA 1YTZI 2YIUB 2KYVA 3NMDA 1FC2C 2V7QJ 1LT9B 4TLFA 2QSIA 1ZR4A 3L70G 3GW6A 4UB6E 3L71G 3S4RA 3D6YA 3S9OA 4JQ0D 4HJGH 3BCCE 1HGVA 3KXDA 1LTSC 4JBZA 1SLQA 1G1JA 4ASWA 4H13D 1ZOYC 1T2KC 3V2RA 2FXMA 1SQBE 4ZNCA 3U1AA 1GL2B 1J1EC 2O1JA 3P8MC 3P8CD 1KQLA 2RKLA 1QL2A 1PGPA 5APUA 3M9HA 2ZFCA 5CCHC 2Y0EA 1YQ3C 1GW4A 5AVUB 4WY4A 2BCCD 4RJTA 3Q3DA 4MN4C 1NTKK 3IAOA 1ZRTE 3H1KD 1PL5A 1SQXK 3CX5H 4W7ZA 1SQQG 5CJ0A 2FXOA 1NU1J 2N1TC 2OYOA 3U59A 4AQRD 1IFJA 2P2UA 3CCMP 3CCUP 5TJHA 4AYCA 1L4AC 3OW2O 1ZLLA 3VMZA 1BSHA 5AVRB 5TISE 3H1HJ 3BCCG 2HLOA 4R4MA 3FGAD 1KTMA 2QG4A 1ZXGA 3L73E 1HTLC 2W6JH 5AVZB 1VQ5P 1SQBG 2Q5UA 3HE4A 5KLVJ 2HR3A 4RESB 1RE3C 1KYOE 2CK3H 1AVYA 5AVQB 1BE3D 3CL3D 3M9BA 1LTJA 4Z1MH 1G2CB 1EZVD 5B5EE 1P84D 2OYIB 3L4FA 3MIWA 3PLNA 1EDJA 4U3FD 2P10A 3MUDA 3TNUB 2D2CD 1VQPP 3SWFA 1P84H 4N6JA 1JMBA 2B87B 3L75E 2YIUC 3KZIH 2C9NY 3AEEC 2BCCJ 1Z56A 2W6AA 3L72D 2NPSB 5KJ7D 3H1KJ 4WWIA 3FWLA 4OGQC 1YJ9P 2W6BA 3CCSP 1M1KQ 3RL0D 2A45H 1URQD 1A02F 4Y28J 1FDMA 2HODB 3CD6P 1QVFO 3CMAP 4WY4B 5AW3B 1FZBA 4DZOA 1GL2C 1SQVE 3KHUA 1A02J 1K04A 1KB9I 1R5LA 2KZIA 1JY3P 2JP3A 2ITAA 3M0DC 3VOPA 5APQA 4IFFA 1SQPD 3L73G 2ZT9D 2POHA 1NU1K 1OXZA 3V2NA 5APWA 3RK2B 1ZR2A 1FJPA 1N2DC 2PFXA 1J1DB 1JY2P 1WMKA 3H1JE 2E74B 2E76D 3VTPC 1RF1C 1HUCA 5EFWB 3CWBE 1M57D 1KILA 3L75G 3E7KA 5KLVK 2E75C 1NAYA 2M5AB 1MFZA 2K3RA 5L8RJ 1PV3A 3HD7D 1L0NE 3SFDC 1SFCB 2IDBA 4PD4I 1H89A 3L72J 1VQ4P 1EDLA 1LTJB 1EXIA 4H0LD 3GMAA 1SQVG 4H44C 5AVSB 2RH0A 3A0BE 1IC2A 4BXLA 3TYYA 3IFMA 3TGUJ 3AE7C 2IFNA 2OYIC 2H43A 1CI6A 3KYQA 2KP8A 2JDIH 3TK1A 5KAIH 4D6TJ 3AEFC 3L37A 3CCLP 3AE1C 4C7RA 2SPZA 2M8RA 4LC1A 1M1JC 3CXHD 3AE2C 2P58A 3H1JG 2O1KA 2NPSC 2C9LY 2YKPA 2OYHA 1Q2NA 1NHLA 2JKVA 1BCCD 1XTCC 3CXHH 1KQFB 3CWBG 2XNXA 2B89A 1TU3F 2KUBA 3V2PA 1YHQP 2ZAEB 1KFNA 1GK4A 4YPCA 1L0NG 2RMZA 3B5NA 1PP9E 1OVRA 2C0WA 3FX0A 1VQ7P 2WT7A 3VMAA 1NTKD 1IK9A 3PTZA 3HE5A 1KB9D 1SQXD 1AJYA 3CCRP 1RH5B 3RK2C 1NYHA 1S9KD 2ZXEB 1E79H 5CJ4A 2I1KA 1RE3A 1J1DC 1JY2O 2E74C 1VQLP 5KKZC 1L0LJ 1KMIZ 3UIAA 1VPCA 3N7NA 3HUSA 2QM8A 1BSNA 1N7LA 3H1IE 3NXSA 1HJBA 1JOCA 1RF0C 4IL6H 3CX5I 3PH0A 3T97A 2DW3A 4PV1B 2FYZA 1SFCC 1M56D 2CPSA 1KILD 1WRGA 1YI2P 4CPGA 3VMYA 3S1KA 1GU5A 2V7QH 4PD4D 2OTLP 1RQVA 2P67A 2ZVNB 4RKUJ 4QMAA 2JJLA 2PGDA 2WSEH 2OQQA 1VF5B 3RK3B 2WSFH 1PP9G 3L70J 3L71J 2FYUE 3M91A 3GHGB 1OVVA 2GUSA 2QM7A 5CCGC 3O8ZA 3FXDA 1VQ9P 3ABVC 5AW6B 3I55P 1NTME 4RO0A 1T2KD 1G1IA 1M7LA 4XE5B 1FZCA 3HTKB 1VDFA 2KZJA 4EDFA 1JUNA 3AE4C 2AXCA 1EZVI 1P84I 3PRJA 3RBXA 1SVFA 3HE5B 3H1IG 4I1LA 2IBZD 2M0BA 3LW5J 3JCUE 2QJKB 1BGYJ 2QVAA 1N8RQ 1N73A 1NU1D 5KJ7A 1LWUB 4UB8E 1JCDA 2QEXP 2HYNA 1H8AA 1E5WA 1ZN5A 2A45I 2XZRA 1L0LK 1FBMA 4BRYA 1SQQJ 1PIXA 4BWNA 2R3CA 3IR9A 1OFCX 1URQA 2AXTE 2IZ1A 1PPJD 5AW1B 2O01N 4ZKPA 2N1TD 3H1HD 2WSEJ 3K5BA 2YXQB 2GUVA 1Y8AA 1MUUA 4N78D 3B5ND 3H1LD 3HUSB 2WSFJ 3H25A 1KFMA 1NVOA 2FYUG 2K9JB 3B71A 1YITP 1AV1A 2R44A 1NTZE 5KLVD 2FFDB 3BCCJ 5TISH 3BRTB 1PZQA 2CPBA 2W90A 1NTMG 2QJPB 4K3AA 2IYOA 1ZP0C 4ZKUA 2LR2A 1X9VA 2Q7CA 2L5GB 2ZJSE 1LJ2A 5GTIE 1EC5A 1LTGC 1HH0A 1QLED 1VQMP 1Y9BA 3WU2E 3L36A 3AECC 2KLUA 3CX5D 4C7NA 3ITKA 2NRGA 1VQKP 2KSEA 2YO3A 5B66E 2Y0CA 3KQGA 3HD7A 5AVWB 3L74E 1WT6A 2XDJA 3H32A 1W2EA 1NOHA 2WPSA 3GHGC 2K9YA 1BDCA 3RK3E 2YXRB 4OGQD 1N7SA 1IO4A 3A5TA 3MZWB 2KK7A 4YXDC 2IX7C 1QGKB 2D2CB 2K37A 5APXA 1Q81Q 3H1LJ 1QX8A 1NTZG 1LTIC 3I5CA 2GA1A 1GK6A 1N73B 1RY3A 3G6EP 1SQQK 3L73J 2R32A 2J58A 3RL0B 3R4YA 1URQB 3CCJP 3SFEC 2QJKC 1JY3N 3II6A 2KSJA 1PGQA 1S5LE 1LWUC 1S5LX 2JR8A 3CXHI 4DJGA 4IFDK 1LT1A 3NFQA 3P8CE 3GF3A 1LNQA 1LT9C 2ZVOB 3AEDC 3L75J 3MTUE 2E75D 2KOGA 3L74G 2BCCE 1K73Q 3B4SA 1RE4C 3I56P 1GD2E 2FFDC 4AUWA 5KLIB 5E79H 3H1KE 2QJPC 3TGUD 3CC2P 3CI9A 1NKZB 3D71A 2G8YA 1YYCA 4H44D 3SSUA 3TSIA 4HKZH 5M1BA 2E5TA 4XFJA 3QH9A 1KZUB 4D6TD 3A2AA 2R5DA 3HD7B 2FYNB 2AEFA 4W80A 4JYCA 1EDKA 1H88A 1LTAC 3V4WA 4PJ0H 2FY8A 4H0LB 2ZYGA 2W27A 2Z5HA 3LIEA 1J2JB 3H1JJ 5BU8B 3H6PA 4YXWH 5K5GB 2R3SA 2OGUA 4R4LA 1JMMA 5AVYB 3FXEA 1BE3E 3GF7A 1EZVE 1P84E 3OA7A 1Q86Q 3HE4B 4I7ZB 1IJDB 5BVZA 2D2CC 4U3FE 3A0HE 3M0AA 1L0NJ 2BCCG 1ZW0A 5APSA 3MHVA 1IK7A 3Q5PA 2WTYA 1N7SD
chains in the Genus database with same CATH topology
3L71J 1NTMJ 3BCCJ 5KLVJ 1SQVJ 2IBZI 3CWBJ 1NTZJ 3H1HJ 4D6TJ 1SQPJ 2BCCJ 1BCCJ 1BGYJ 2FYUJ 1BE3J 3H1LJ 3L74J 1NTKJ 3L75J 1KYOI 1SQBJ 3CX5I 1PP9J 1NU1J 1L0NJ 4PD4I 3H1JJ 1EZVI 1P84I 3L72J 3TGUJ 3H1IJ 1KB9I 1SQXJ 4U3FJ 1L0LJ 3H1KJ 1SQQJ 3L70J 3CXHI 3L73J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L71 J;  1NTM J;  3BCC J;  5KLV J;  1SQV J;  2IBZ I;  3CWB J;  1NTZ J;  3H1H J;  4D6T J;  1SQP J;  2BCC J;  1BCC J;  1BGY J;  2FYU J;  1BE3 J;  3H1L J;  3L74 J;  1NTK J;  3L75 J;  1KYO I;  1SQB J;  3CX5 I;  1PP9 J;  1NU1 J;  1L0N J;  4PD4 I;  3H1J J;  1EZV I;  1P84 I;  3L72 J;  3TGU J;  3H1I J;  1KB9 I;  1SQX J;  4U3F J;  1L0L J;  3H1K J;  1SQQ J;  3L70 J;  3CXH I;  3L73 J; 
#chains in the Genus database with same CATH topology
 1JM0 A;  2A06 D;  1S4X A;  3H1K G;  2W8Z A;  1KQS O;  1NKN A;  3SWY A;  3L72 E;  1IFD A;  4GOD A;  3RL0 C;  5AW4 B;  4W7Y A;  4JYB A;  5KAF E;  3G71 P;  4GT1 A;  3RK2 D;  3NTN A;  1L0L D;  2KB7 P;  2BEZ F;  4WVZ A;  2QJY B;  1M90 Q;  2E74 D;  3IN6 A;  2Q3I A;  2MJZ A;  5CCH A;  2BEQ D;  2H89 C;  2HPC A;  1HF9 A;  1DD3 A;  2QE7 H;  3AE6 C;  3PJS K;  4U7J A;  1SQP E;  4ASV A;  1JO5 A;  2IBZ I;  1RQU A;  3AEG C;  4NPD A;  3W68 A;  2I1J A;  3RGU A;  2RN0 A;  1OZH A;  1OMI A;  3WUT A;  2NZ2 A;  4OWF A;  1BE3 G;  4WY4 C;  3L70 D;  2W83 C;  1KD1 Q;  3L71 D;  1EZV G;  2N1T A;  1DEE G;  1AVO A;  1FOS F;  4U3F G;  1X0T A;  2KI7 B;  3C1L A;  2OAR A;  1L4A A;  1FZG A;  1PP9 J;  3VN0 A;  1S2E A;  1K8A Q;  2JEE A;  3L72 G;  1DIP A;  5CCG D;  1FAV A;  2O3J A;  2A45 G;  1X79 B;  2AEM A;  4HB1 A;  1KIL B;  1GW3 A;  2KNC A;  4EYY Q;  1GDT A;  2J59 M;  1DH3 A;  4H0L C;  2WQY C;  1USD A;  1L0N K;  1VQN P;  2K88 A;  1LGH B;  2KS1 A;  2Y9Y A;  3SWK A;  1BGY D;  4EOT A;  4I7Z C;  1JEK A;  1SQP G;  3LW5 H;  3AE8 C;  1GTW A;  1T3U A;  3B8E B;  1SQQ D;  2L91 A;  3CCE P;  3JCU H;  3HRN A;  1LTJ C;  4L76 A;  1CI6 B;  3VP8 A;  1QL1 A;  1GZL A;  4IFM A;  3MUD C;  2WPQ A;  1KC8 Q;  3CXH E;  1FDO A;  3P32 A;  3U1C A;  1AFO A;  3CPW O;  3BCC D;  1GL2 A;  1S3J A;  1BCC E;  3PP5 A;  4UB6 H;  1VQ6 P;  3EFG A;  3CLQ A;  3V4Q A;  2QJY C;  1SQB D;  3M0D A;  3AE5 C;  2OYH B;  4LGD E;  2Q9I A;  3CC7 P;  3G4S P;  1NTM J;  1OW6 A;  3MGN A;  3Q5R A;  1LTB C;  4B86 A;  1NTK E;  1M8O B;  2Q6Q A;  2N1T B;  1FDI A;  1KB9 E;  2PAJ A;  1SQX E;  3B5N B;  3V6I A;  5CCH D;  4L74 A;  2WT7 B;  1X22 A;  2KXP B;  3GG2 A;  1S9K E;  1RF1 A;  5AVV B;  3WU2 H;  1ZRT D;  4H13 B;  1UIX A;  5DJU B;  5AVT B;  2WPV B;  2UWJ E;  1X8Y A;  2K1A A;  2KNC B;  4A7P A;  5B66 H;  3AEA C;  1HGZ A;  1XTG B;  3Q5S A;  4L75 A;  3OAK A;  3M06 A;  2HFE D;  3Q1M A;  2LXB A;  1OW8 A;  1JCC A;  1KIL C;  3M9Q A;  1VQ8 P;  2C0X A;  2AEJ A;  1L4A D;  1BCC G;  1KIL E;  5AW8 B;  2KLV A;  4JPZ B;  1D7M A;  3L73 D;  3WMM 0;  1QVG O;  3T97 B;  1G2C A;  2QIW A;  2OYI A;  1NTZ J;  4PD4 E;  3KPE A;  1KYO D;  1SQB J;  4XA4 A;  1PFI A;  3TNU A;  4OGQ B;  1T6A A;  1T8Z A;  3VYI A;  2B87 A;  3MD0 A;  1NTK G;  4ZMD A;  3ZDM A;  1IFP A;  1OWA A;  1KYO H;  1M1J A;  1SQX G;  4PV1 C;  3TDK A;  2XND H;  2FYU K;  5B5E H;  2NPS A;  3L75 D;  1S5L H;  3G3Z A;  3F5H A;  3P7K A;  1NGM B;  5H2F E;  1IFN A;  5BU5 A;  4M3L A;  3V2Q A;  1NTM K;  2HOD A;  2WVR A;  1KOR A;  1S1C X;  1U7M A;  5GTH E;  1VF5 C;  1T3J A;  3RK3 C;  1FZC B;  2XU6 A;  3RL0 g;  3JC2 2;  4NPF X;  3L74 J;  2IZ0 A;  1FE6 A;  1BGY G;  2E5Y A;  2IBZ E;  5C39 A;  1CZQ A;  1EXJ A;  2OYH C;  2PP6 A;  3R2P A;  1SQV D;  1CW5 A;  4DT0 A;  4L73 A;  1NU1 E;  5AW5 B;  1GL2 D;  1RF1 B;  1S72 P;  1Q82 Q;  3CME P;  2QA4 P;  3B5N C;  2E75 B;  1PPJ E;  2Z4E A;  3H1H E;  2XKM A;  2YMK A;  4N78 E;  3H1L E;  3CCV P;  4BRY B;  4YTP C;  3C9I A;  4H13 C;  1FS0 E;  2JWA A;  3QWO C;  2P1J A;  3H1J D;  5KLV E;  5APV A;  5KTB A;  1SS1 A;  4TT3 H;  2M5A A;  4GIF A;  2B9B A;  1RF0 A;  1KN7 A;  4LLH A;  2WSC H;  3Q2Y A;  4Y99 B;  1YJW P;  3CWB D;  4H44 B;  1SFC A;  2H88 C;  3BAT A;  1NTZ K;  2Y9Z A;  2LKM A;  2ZT9 B;  2OTK E;  3E1R A;  1L0N D;  1SQB K;  5CHX A;  3HUS C;  2VRS A;  1GU4 A;  1VQO P;  1JNM A;  1MV8 A;  2I8D A;  1K05 A;  1JY2 N;  1IFM A;  3CX5 E;  3A0H H;  2BAS A;  2IBZ G;  1M1J B;  1HWT C;  4C46 A;  1K9M Q;  2E76 B;  3KDP B;  3N4X A;  4O9B A;  5CCG A;  3RBZ A;  3VMX A;  4EI2 A;  1USE A;  1ZV8 A;  4OVN F;  4C7N B;  1NU1 G;  4WB4 A;  1SQV J;  3GLM A;  3A0B H;  1OVU A;  5KAF H;  1PPJ G;  5CBO A;  1YIJ P;  3V5B A;  1JTH A;  3H32 B;  3H1H G;  2IFM A;  3H1L G;  2G3A A;  1AQ5 A;  1N7S B;  4HYT B;  1N86 A;  5KLV G;  3CC4 P;  2IPP A;  2WSC J;  3L35 A;  1FZC C;  2O01 H;  2NPS D;  1AQT A;  1YJN P;  5APY A;  3MP7 B;  3EQ2 A;  1JB0 J;  4DCK A;  5AW0 B;  3CWB J;  4KJM A;  2YKO A;  3PHL A;  1L2P A;  3KZI E;  4WY4 D;  5KKZ B;  1BE3 J;  1PP9 D;  1HJ0 A;  1LP1 A;  1NWQ A;  4EIJ A;  1IZN B;  1AA0 A;  4U3F J;  4OH8 B;  2Q3E A;  2B88 A;  1N73 C;  2FXP A;  5KJ7 C;  3D6Z A;  5AW2 B;  2PRR A;  1KV4 A;  1FZF A;  5E79 E;  3A7O A;  1URQ C;  2H7H A;  4I2L C;  2WSS H;  3CCQ P;  4N3Y B;  1H0T A;  1BDD A;  3O6Q A;  1Q90 D;  4Y99 C;  1RHZ B;  1SP4 A;  3TGU E;  2OTJ P;  1FZE A;  1U57 A;  2FBW C;  1NO4 A;  1UII A;  3H1I D;  3LID A;  2ZT9 C;  3F89 A;  3TF5 A;  4PJ0 E;  4D6T E;  1EQ7 A;  1IFI A;  1SQV K;  3D70 A;  2O01 J;  1MKM A;  1SQP J;  4K35 A;  1SFC D;  2Q1K A;  5KLI C;  2M3B A;  1W5C E;  1YBK A;  1FU1 A;  2E76 C;  3GHG A;  2E42 A;  1JTH B;  3IF4 A;  2LXC B;  5AW7 B;  4KHX A;  4GDO A;  3AE9 C;  4GOF A;  2ZXX A;  2FYU D;  1YTZ T;  2E43 A;  3HD7 C;  3HTK A;  2FYN C;  1CSB A;  1NTM D;  3EWK A;  5CBN A;  3WUU A;  1FOS E;  1JY3 O;  3EFF K;  1R8E A;  1N7S C;  1LTT C;  1U7J A;  1KYO I;  2ZYA A;  3AEB C;  2QRX A;  2A06 E;  1GMJ A;  5CMZ A;  2WMM A;  1LP1 B;  2MKV A;  2V4H A;  1FZA A;  3W67 A;  3TGU G;  2ZYD A;  1DEB A;  2N9B A;  1NJI Q;  1KB9 H;  2R5B A;  2Z5I A;  1LWU A;  1Q7Y Q;  5KAI E;  1L0L E;  4D6T G;  4NPE A;  2WIT A;  3H1I J;  2GM4 A;  2JWD A;  1LT9 A;  2IYP A;  4JF7 A;  1J1E B;  5APT A;  2K9J A;  1H0T B;  3O6Q B;  4UB8 H;  1RE4 A;  2N9Y B;  1EDI A;  2FFD A;  3USS A;  1PGO A;  1HBW A;  2AXT H;  2HPC B;  1Y47 A;  2FKW B;  3BRV B;  5DJT B;  1NTZ D;  1QEX A;  1SQP K;  1BCC J;  2FYU J;  3AE3 C;  3L70 E;  2H8P D;  3L71 E;  3G9R A;  1ZME C;  3JSV C;  3VP9 A;  3WUV A;  2J5U A;  1OW7 A;  4PD4 H;  1OX3 A;  3FWN A;  2KIK A;  4KT0 J;  4IOI H;  4I6M C;  3OJA B;  2A06 G;  1NTK J;  2WWW A;  1PGJ A;  5AVX B;  1NH4 A;  1L4A B;  4PV1 D;  2M3E A;  1SQX J;  5GTI H;  3A3Y B;  1FJK A;  5AW9 B;  4DOJ A;  1DD4 A;  2YKQ A;  2YO2 A;  3BAS A;  1L0L G;  1NAF A;  3E1I A;  4GOE A;  1HVV A;  2WZ7 A;  1W2B O;  3L74 D;  2YMY A;  2XV5 A;  5H2F H;  1KQG B;  4HH2 A;  4IL6 E;  1OIP A;  4IL6 X;  2P7J A;  2Y0D A;  1VL2 A;  1VF5 D;  3RK3 D;  2HG5 D;  1YQ4 C;  2JO1 A;  1R5S A;  3C8V A;  4WBA A;  1DX7 A;  5GTH H;  1BGY E;  4GKG A;  3BVH A;  1MFT A;  2WPR A;  2KS1 B;  1SQQ E;  1MZ9 A;  2YNY A;  1YTZ I;  2YIU B;  2KYV A;  3NMD A;  1FC2 C;  2V7Q J;  1LT9 B;  4TLF A;  2QSI A;  1ZR4 A;  3L70 G;  3GW6 A;  4UB6 E;  3L71 G;  3S4R A;  3D6Y A;  3S9O A;  4JQ0 D;  4HJG H;  3BCC E;  1HGV A;  3KXD A;  1LTS C;  4JBZ A;  1SLQ A;  1G1J A;  4ASW A;  4H13 D;  1ZOY C;  1T2K C;  3V2R A;  2FXM A;  1SQB E;  4ZNC A;  3U1A A;  1GL2 B;  1J1E C;  2O1J A;  3P8M C;  3P8C D;  1KQL A;  2RKL A;  1QL2 A;  1PGP A;  5APU A;  3M9H A;  2ZFC A;  5CCH C;  2Y0E A;  1YQ3 C;  1GW4 A;  5AVU B;  4WY4 A;  2BCC D;  4RJT A;  3Q3D A;  4MN4 C;  1NTK K;  3IAO A;  1ZRT E;  3H1K D;  1PL5 A;  1SQX K;  3CX5 H;  4W7Z A;  1SQQ G;  5CJ0 A;  2FXO A;  1NU1 J;  2N1T C;  2OYO A;  3U59 A;  4AQR D;  1IFJ A;  2P2U A;  3CCM P;  3CCU P;  5TJH A;  4AYC A;  1L4A C;  3OW2 O;  1ZLL A;  3VMZ A;  1BSH A;  5AVR B;  5TIS E;  3H1H J;  3BCC G;  2HLO A;  4R4M A;  3FGA D;  1KTM A;  2QG4 A;  1ZXG A;  3L73 E;  1HTL C;  2W6J H;  5AVZ B;  1VQ5 P;  1SQB G;  2Q5U A;  3HE4 A;  5KLV J;  2HR3 A;  4RES B;  1RE3 C;  1KYO E;  2CK3 H;  1AVY A;  5AVQ B;  1BE3 D;  3CL3 D;  3M9B A;  1LTJ A;  4Z1M H;  1G2C B;  1EZV D;  5B5E E;  1P84 D;  2OYI B;  3L4F A;  3MIW A;  3PLN A;  1EDJ A;  4U3F D;  2P10 A;  3MUD A;  3TNU B;  2D2C D;  1VQP P;  3SWF A;  1P84 H;  4N6J A;  1JMB A;  2B87 B;  3L75 E;  2YIU C;  3KZI H;  2C9N Y;  3AEE C;  2BCC J;  1Z56 A;  2W6A A;  3L72 D;  2NPS B;  5KJ7 D;  3H1K J;  4WWI A;  3FWL A;  4OGQ C;  1YJ9 P;  2W6B A;  3CCS P;  1M1K Q;  3RL0 D;  2A45 H;  1URQ D;  1A02 F;  4Y28 J;  1FDM A;  2HOD B;  3CD6 P;  1QVF O;  3CMA P;  4WY4 B;  5AW3 B;  1FZB A;  4DZO A;  1GL2 C;  1SQV E;  3KHU A;  1A02 J;  1K04 A;  1KB9 I;  1R5L A;  2KZI A;  1JY3 P;  2JP3 A;  2ITA A;  3M0D C;  3VOP A;  5APQ A;  4IFF A;  1SQP D;  3L73 G;  2ZT9 D;  2POH A;  1NU1 K;  1OXZ A;  3V2N A;  5APW A;  3RK2 B;  1ZR2 A;  1FJP A;  1N2D C;  2PFX A;  1J1D B;  1JY2 P;  1WMK A;  3H1J E;  2E74 B;  2E76 D;  3VTP C;  1RF1 C;  1HUC A;  5EFW B;  3CWB E;  1M57 D;  1KIL A;  3L75 G;  3E7K A;  5KLV K;  2E75 C;  1NAY A;  2M5A B;  1MFZ A;  2K3R A;  5L8R J;  1PV3 A;  3HD7 D;  1L0N E;  3SFD C;  1SFC B;  2IDB A;  4PD4 I;  1H89 A;  3L72 J;  1VQ4 P;  1EDL A;  1LTJ B;  1EXI A;  4H0L D;  3GMA A;  1SQV G;  4H44 C;  5AVS B;  2RH0 A;  3A0B E;  1IC2 A;  4BXL A;  3TYY A;  3IFM A;  3TGU J;  3AE7 C;  2IFN A;  2OYI C;  2H43 A;  1CI6 A;  3KYQ A;  2KP8 A;  2JDI H;  3TK1 A;  5KAI H;  4D6T J;  3AEF C;  3L37 A;  3CCL P;  3AE1 C;  4C7R A;  2SPZ A;  2M8R A;  4LC1 A;  1M1J C;  3CXH D;  3AE2 C;  2P58 A;  3H1J G;  2O1K A;  2NPS C;  2C9L Y;  2YKP A;  2OYH A;  1Q2N A;  1NHL A;  2JKV A;  1BCC D;  1XTC C;  3CXH H;  1KQF B;  3CWB G;  2XNX A;  2B89 A;  1TU3 F;  2KUB A;  3V2P A;  1YHQ P;  2ZAE B;  1KFN A;  1GK4 A;  4YPC A;  1L0N G;  2RMZ A;  3B5N A;  1PP9 E;  1OVR A;  2C0W A;  3FX0 A;  1VQ7 P;  2WT7 A;  3VMA A;  1NTK D;  1IK9 A;  3PTZ A;  3HE5 A;  1KB9 D;  1SQX D;  1AJY A;  3CCR P;  1RH5 B;  3RK2 C;  1NYH A;  1S9K D;  2ZXE B;  1E79 H;  5CJ4 A;  2I1K A;  1RE3 A;  1J1D C;  1JY2 O;  2E74 C;  1VQL P;  5KKZ C;  1L0L J;  1KMI Z;  3UIA A;  1VPC A;  3N7N A;  3HUS A;  2QM8 A;  1BSN A;  1N7L A;  3H1I E;  3NXS A;  1HJB A;  1JOC A;  1RF0 C;  4IL6 H;  3CX5 I;  3PH0 A;  3T97 A;  2DW3 A;  4PV1 B;  2FYZ A;  1SFC C;  1M56 D;  2CPS A;  1KIL D;  1WRG A;  1YI2 P;  4CPG A;  3VMY A;  3S1K A;  1GU5 A;  2V7Q H;  4PD4 D;  2OTL P;  1RQV A;  2P67 A;  2ZVN B;  4RKU J;  4QMA A;  2JJL A;  2PGD A;  2WSE H;  2OQQ A;  1VF5 B;  3RK3 B;  2WSF H;  1PP9 G;  3L70 J;  3L71 J;  2FYU E;  3M91 A;  3GHG B;  1OVV A;  2GUS A;  2QM7 A;  5CCG C;  3O8Z A;  3FXD A;  1VQ9 P;  3ABV C;  5AW6 B;  3I55 P;  1NTM E;  4RO0 A;  1T2K D;  1G1I A;  1M7L A;  4XE5 B;  1FZC A;  3HTK B;  1VDF A;  2KZJ A;  4EDF A;  1JUN A;  3AE4 C;  2AXC A;  1EZV I;  1P84 I;  3PRJ A;  3RBX A;  1SVF A;  3HE5 B;  3H1I G;  4I1L A;  2IBZ D;  2M0B A;  3LW5 J;  3JCU E;  2QJK B;  1BGY J;  2QVA A;  1N8R Q;  1N73 A;  1NU1 D;  5KJ7 A;  1LWU B;  4UB8 E;  1JCD A;  2QEX P;  2HYN A;  1H8A A;  1E5W A;  1ZN5 A;  2A45 I;  2XZR A;  1L0L K;  1FBM A;  4BRY A;  1SQQ J;  1PIX A;  4BWN A;  2R3C A;  3IR9 A;  1OFC X;  1URQ A;  2AXT E;  2IZ1 A;  1PPJ D;  5AW1 B;  2O01 N;  4ZKP A;  2N1T D;  3H1H D;  2WSE J;  3K5B A;  2YXQ B;  2GUV A;  1Y8A A;  1MUU A;  4N78 D;  3B5N D;  3H1L D;  3HUS B;  2WSF J;  3H25 A;  1KFM A;  1NVO A;  2FYU G;  2K9J B;  3B71 A;  1YIT P;  1AV1 A;  2R44 A;  1NTZ E;  5KLV D;  2FFD B;  3BCC J;  5TIS H;  3BRT B;  1PZQ A;  2CPB A;  2W90 A;  1NTM G;  2QJP B;  4K3A A;  2IYO A;  1ZP0 C;  4ZKU A;  2LR2 A;  1X9V A;  2Q7C A;  2L5G B;  2ZJS E;  1LJ2 A;  5GTI E;  1EC5 A;  1LTG C;  1HH0 A;  1QLE D;  1VQM P;  1Y9B A;  3WU2 E;  3L36 A;  3AEC C;  2KLU A;  3CX5 D;  4C7N A;  3ITK A;  2NRG A;  1VQK P;  2KSE A;  2YO3 A;  5B66 E;  2Y0C A;  3KQG A;  3HD7 A;  5AVW B;  3L74 E;  1WT6 A;  2XDJ A;  3H32 A;  1W2E A;  1NOH A;  2WPS A;  3GHG C;  2K9Y A;  1BDC A;  3RK3 E;  2YXR B;  4OGQ D;  1N7S A;  1IO4 A;  3A5T A;  3MZW B;  2KK7 A;  4YXD C;  2IX7 C;  1QGK B;  2D2C B;  2K37 A;  5APX A;  1Q81 Q;  3H1L J;  1QX8 A;  1NTZ G;  1LTI C;  3I5C A;  2GA1 A;  1GK6 A;  1N73 B;  1RY3 A;  3G6E P;  1SQQ K;  3L73 J;  2R32 A;  2J58 A;  3RL0 B;  3R4Y A;  1URQ B;  3CCJ P;  3SFE C;  2QJK C;  1JY3 N;  3II6 A;  2KSJ A;  1PGQ A;  1S5L E;  1LWU C;  1S5L X;  2JR8 A;  3CXH I;  4DJG A;  4IFD K;  1LT1 A;  3NFQ A;  3P8C E;  3GF3 A;  1LNQ A;  1LT9 C;  2ZVO B;  3AED C;  3L75 J;  3MTU E;  2E75 D;  2KOG A;  3L74 G;  2BCC E;  1K73 Q;  3B4S A;  1RE4 C;  3I56 P;  1GD2 E;  2FFD C;  4AUW A;  5KLI B;  5E79 H;  3H1K E;  2QJP C;  3TGU D;  3CC2 P;  3CI9 A;  1NKZ B;  3D71 A;  2G8Y A;  1YYC A;  4H44 D;  3SSU A;  3TSI A;  4HKZ H;  5M1B A;  2E5T A;  4XFJ A;  3QH9 A;  1KZU B;  4D6T D;  3A2A A;  2R5D A;  3HD7 B;  2FYN B;  2AEF A;  4W80 A;  4JYC A;  1EDK A;  1H88 A;  1LTA C;  3V4W A;  4PJ0 H;  2FY8 A;  4H0L B;  2ZYG A;  2W27 A;  2Z5H A;  3LIE A;  1J2J B;  3H1J J;  5BU8 B;  3H6P A;  4YXW H;  5K5G B;  2R3S A;  2OGU A;  4R4L A;  1JMM A;  5AVY B;  3FXE A;  1BE3 E;  3GF7 A;  1EZV E;  1P84 E;  3OA7 A;  1Q86 Q;  3HE4 B;  4I7Z B;  1IJD B;  5BVZ A;  2D2C C;  4U3F E;  3A0H E;  3M0A A;  1L0N J;  2BCC G;  1ZW0 A;  5APS A;  3MHV A;  1IK7 A;  3Q5P A;  2WTY A;  1N7S D; 
#chains in the Genus database with same CATH homology
 3L71 J;  1NTM J;  3BCC J;  5KLV J;  1SQV J;  2IBZ I;  3CWB J;  1NTZ J;  3H1H J;  4D6T J;  1SQP J;  2BCC J;  1BCC J;  1BGY J;  2FYU J;  1BE3 J;  3H1L J;  3L74 J;  1NTK J;  3L75 J;  1KYO I;  1SQB J;  3CX5 I;  1PP9 J;  1NU1 J;  1L0N J;  4PD4 I;  3H1J J;  1EZV I;  1P84 I;  3L72 J;  3TGU J;  3H1I J;  1KB9 I;  1SQX J;  4U3F J;  1L0L J;  3H1K J;  1SQQ J;  3L70 J;  3CXH I;  3L73 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...