5KLVJ

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
61
structure length
61
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 18
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 5klvJ00
3CX5I 1KYOI 1SQXJ 3L73J 1PP9J 3CXHI 1L0NJ 4U3FJ 3H1LJ 3L72J 1SQVJ 2BCCJ 2IBZI 1NTMJ 3L75J 1BCCJ 3TGUJ 3H1IJ 3BCCJ 4PD4I 3H1JJ 3L74J 3CWBJ 1BE3J 1P84I 3H1HJ 5KLVJ 1BGYJ 2FYUJ 1SQQJ 1SQPJ 1KB9I 3H1KJ 1NU1J 3L70J 4D6TJ 3L71J 1NTKJ 1NTZJ 1L0LJ 1EZVI 1SQBJ
chains in the Genus database with same CATH superfamily
2AXTH 1KQGB 1GMJA 1YBKA 1L0NG 3KZIH 2N1TA 2HFED 2BCCG 1D7MA 3BRTB 1Q81Q 3H1ID 2HODA 4UB8E 2H43A 1OMIA 1NWQA 2IYOA 1EDKA 2XU6A 3RL0B 1L0LD 3VMZA 2W27A 2NPSC 1LJ2A 3EFFK 3W67A 5C39A 5GTHE 4GT1A 1IZNB 1KFNA 3LW5J 1R5LA 3RBZA 1JY3O 4UB6E 2B88A 1E5WA 2ITAA 5KJ7C 2M8RA 4PD4I 1FJPA 1FDIA 5CCHC 3H1LE 1MFTA 5KLVK 1PGOA 1SQQK 4LLHA 2CPBA 2LKMA 1ZR4A 2OTKE 1LWUC 2OTJP 4K3AA 5B5EH 3HD7D 3MP7B 2YMKA 1M1JA 5E79E 3AEAC 1JY3N 1T2KC 4U3FE 3VP9A 1IK9A 4BWNA 2KZIA 2C0XA 3HE5B 4RO0A 3H25A 4AUWA 4H44D 4OGQD 2QJYC 5CJ4A 1QX8A 3BCCJ 1NTMK 4I6MC 3MZWB 1CZQA 1FZBA 3Q1MA 1WRGA 3AE8C 1H8AA 3M9QA 5APXA 5AW3B 5CCGA 2K9JB 4DJGA 2QJKC 1W2BO 1RF1C 2WSFJ 2K9YA 2C9LY 3HUSC 1RQVA 2OYIB 1YYCA 4N78D 3TK1A 2K88A 3SSUA 3I5CA 3D6ZA 1BDDA 1GL2A 2P10A 2IX7C 3JCUE 5APUA 2R44A 4Z1MH 1LNQA 1LT9B 1LTJB 1LTTC 2IBZG 4IFDK 3CD6P 2FFDA 5B66E 1SQPK 1NTKK 1S1CX 4UB6H 1KQFB 1NJIQ 5APYA 3RL0C 3A0BE 4EIJA 3H1JJ 1N73A 2FYUJ 2HR3A 3H1JG 1J2JB 3OW2O 3FX0A 1SFCA 2OARA 3OJAB 3I56P 3Q2YA 2IZ0A 1T6AA 5CJ0A 2O3JA 1JNMA 3LIDA 1OWAA 1ZLLA 5L8RJ 5KLVG 2E74D 1G1JA 1URQD 3L71J 2IFNA 4D6TG 1EC5A 1G2CA 2WSCH 3AEEC 2H88C 5EFWB 1RE3A 1FZCB 2KS1A 2ZAEB 1L0LE 5APQA 3H1JD 1KB9I 2ZYDA 3TGUE 4HH2A 3CXHH 2AXCA 3HE4A 3H1HE 3MUDA 3KPEA 2JWAA 1NTMG 1BCCG 1QL1A 1Q90D 2JDIH 1FOSE 3II6A 1L0NE 3V4WA 1S5LE 2R3CA 1ZV8A 2AEFA 2AEMA 2BCCE 4D6TD 1VQ6P 3L71D 2OGUA 1IFNA 4YXWH 1HF9A 2RKLA 1LP1B 1VQ9P 2LXCB 2RH0A 4PV1B 1VQ7P 1NTZE 2ZXXA 2E76B 2PP6A 3PLNA 2GUSA 4YXDC 4IL6E 4ZKPA 2NPSD 3H1KG 1HBWA 3MGNA 4RKUJ 1H0TB 3T97A 2LXBA 2OYIC 4AYCA 5AW1B 1DEEG 3PRJA 1T3UA 3S9OA 1ZRTE 1CI6A 1SQPG 5KJ7D 1J1DB 1LT9C 1NTKG 1HJBA 3L73J 3H1LJ 3L73G 5CCHD 3TF5A 2XKMA 4A7PA 2JP3A 1VPCA 2Y0EA 3CMAP 3FWLA 3HRNA 3HTKB 1LTAC 3MD0A 4EOTA 4NPDA 2R3SA 3KXDA 3Q5RA 1RF0A 5APTA 1T2KD 1NKNA 3WUUA 4C7NA 2RMZA 2A45H 5KAIE 3PHLA 2M0BA 3RBXA 1Q86Q 2JO1A 1LT1A 1SQPD 4I1LA 4JPZB 3A5TA 2W90A 4TT3H 5AW2B 1KQLA 3L73D 1YTZT 2W8ZA 1GK4A 3AEGC 1MZ9A 3N4XA 2BEZF 5AW7B 1FAVA 2AXTE 1L2PA 1QLED 1FZCC 2JWDA 3CCQP 3KZIE 3QH9A 3WUVA 1VQOP 4I2LC 2IFMA 2K1AA 1L4AB 3FWNA 2ZFCA 3CCEP 4L74A 1S9KE 2Z4EA 2FBWC 1NU1K 2QRXA 2IBZE 2JJLA 4H0LB 2G3AA 3G9RA 3CXHD 3U59A 4WY4D 5AW8B 4Y28J 2E43A 1LWUB 2YKPA 2WITA 3VMYA 1OZHA 1NKZB 2K37A 1URQA 4PV1C 3RL0D 4ASVA 4MN4C 2E76C 4WB4A 4IL6X 1JO5A 4YPCA 1SQXK 3H1JE 4HJGH 3M0DC 2GM4A 4HB1A 1R5SA 5AVQB 1YQ4C 1Q2NA 1DEBA 1OVVA 3H6PA 1KYOH 2QA4P 1IFDA 1AFOA 5AVUB 4BRYA 1K05A 5KLVE 1SQQE 2H7HA 4D6TE 1J1DC 4Y99B 1K9MQ 5K5GB 2A45G 5KAIH 3AE4C 3RL0g 1SQBJ 3V2NA 3D70A 4JYBA 3B4SA 3FGAD 1SQBG 1KN7A 2HPCB 4DT0A 3TGUJ 2J59M 3H1HJ 2D2CB 3L70J 1NTME 2NPSA 3IFMA 1BCCE 1MUUA 3L70G 4XA4A 5GTIH 4N6JA 1L0NJ 3H32B 3NMDA 2HYNA 2BCCJ 3PH0A 4W7ZA 3O8ZA 1WMKA 1P84I 3K5BA 1AV1A 4JBZA 1M7LA 1U7MA 1NTZJ 2Z5IA 1VQMP 1SQBD 1NTZG 1UIXA 1QGKB 5CCHA 3H1KE 1X9VA 3TGUD 1ZMEC 1M90Q 4WWIA 1VDFA 3SWKA 3H1HD 2O01H 3MTUE 1VQPP 2Q1KA 3CMEP 3L70D 1NU1G 1EZVI 1GL2B 1QVGO 1L4AC 4PJ0H 1L0ND 2KP8A 3IF4A 1NVOA 5KTBA 2WPSA 1SQPE 1N2DC 2BCCD 2FYZA 1IFPA 1NTKE 4H0LC 3L73E 1JEKA 2FFDB 2BASA 4EDFA 1DD3A 2YXRB 4BXLA 1NTZD 3RK3B 2ZYAA 1SQXG 4HKZH 1HGVA 1IO4A 4OVNF 4JYCA 3D6YA 5AVYB 2JKVA 2R5BA 1EDJA 2L91A 5H2FH 3KHUA 5TISH 1SFCB 2PFXA 4GOEA 3Q5SA 2M5AA 3HUSA 3CC7P 1ZRTD 1ZP0C 1KMIZ 1FS0E 3USSA 2C0WA 3CXHE 2W6JH 3V2PA 2WT7A 1G2CB 3CX5I 1DIPA 4Y99C 4GIFA 4EI2A 1M1KQ 1KYOD 2FYNB 4WY4A 4PD4H 3KYQA 3Q5PA 1J1EB 1BE3G 2IPPA 3BRVB 5AVZB 3EQ2A 2WPVB 1FU1A 3ITKA 3HE4B 3AE9C 1MV8A 2D2CC 3SFDC 3BASA 3VP8A 3CCRP 3M91A 2XNXA 3VYIA 1HJ0A 2HLOA 2I1JA 1SP4A 1CW5A 1Y47A 1JTHA 1GTWA 5CHXA 2WWWA 2O01J 2A06G 3GLMA 1YJWP 5CCGC 1NAFA 2B87A 3P8CD 4PV1D 1ZN5A 1KB9E 1FZAA 2E76D 2Y9ZA 1RQUA 1BSHA 5AW9B 3A3YB 2POHA 1S9KD 1GL2C 5M1BA 2IBZD 3CWBJ 5KLVJ 1SQQJ 1KQSO 3CC2P 3CWBG 4D6TJ 1X79B 5AVSB 1SQQG 1EDLA 4LGDE 2A06D 2KNCA 2QIWA 1DH3A 2QJPC 4H44B 3D71A 2FFDC 3HE5A 3SWYA 2QM8A 2NRGA 1GZLA 3L74J 2OYOA 3RK3C 1RY3A 1SQBE 4L75A 2WPQA 3U1CA 3L74G 1NGMB 1NO4A 1NTMJ 1SFCC 1BCCJ 2P7JA 2KOGA 3L70E 2CPSA 1RE4C 2E5YA 3CWBD 1JY2P 3NXSA 5KLVD 3V2QA 1SQQD 2OYIA 2XZRA 3AECC 1NH4A 3BVHA 3CC4P 4O9BA 3IN6A 3CCUP 1SQVK 3IR9A 1FDMA 1LTJA 3L74D 3H1KJ 3VOPA 3VN0A 2FYNC 3P8MC 3WU2H 1J1EC 1Q7YQ 2Q6QA 1USEA 1NU1E 1NTMD 1BCCD 1L4AD 3HD7A 2WSEH 1KB9H 1SQPJ 2I1KA 3F5HA 4PD4D 1EXIA 1NTKJ 4B86A 1IJDB 2P2UA 4H0LD 3I55P 1OVRA 3VTPC 2ZVOB 1YITP 1CSBA 1SQXE 2XV5A 3PJSK 2E74B 1KYOE 3H1KD 3GHGA 5DJTB 2Q7CA 1IK7A 4GKGA 1ZR2A 1HWTC 3QWOC 2OYHB 1HTLC 1NHLA 2WSCJ 1YJ9P 1JY2O 1HUCA 1JOCA 2W6AA 1FZCA 1X0TA 3GF7A 1PGPA 4KT0J 2KUBA 2Q9IA 4XE5B 1DX7A 3C8VA 3CL3D 1EDIA 2AEJA 1MFZA 2H8PD 3ABVC 4CPGA 1NTKD 4BRYB 4I7ZB 2Y0DA 1N7SB 1OIPA 4ZMDA 2E75B 2L5GB 1XTCC 4H44C 1KILB 5GTIE 1U7JA 1RH5B 3UIAA 1VQ4P 4QMAA 3P8CE 1JY2N 3WMM0 1GW3A 1BE3E 3ZDMA 1FOSF 3B5NB 3M0AA 1DD4A 1AA0A 1LP1A 1PZQA 1IFJA 1PIXA 1USDA 2DW3A 3B8EB 1PL5A 2D2CD 1EXJA 1JMBA 1VF5B 5AVTB 4K35A 1KZUB 4NPFX 2N1TB 1SQVG 2P67A 2KLUA 2HODB 2W6BA 2A06E 2P1JA 1UIIA 1OFCX 3NFQA 1HH0A 3CCVP 2KXPB 4JF7A 3O6QA 4PJ0E 1FZGA 1SS1A 4KHXA 4TLFA 3AE3C 3G3ZA 2WQYC 3Q3DA 2Q3IA 3LW5H 2YKOA 4WVZA 1NOHA 3HTKA 2E5TA 3CCLP 3P7KA 2Q3EA 2N9YB 2ZYGA 1A02J 3CWBE 1HGZA 3LIEA 3FXDA 5AVVB 1JCDA 2OQQA 2QG4A 3V2RA 5H2FE 5TISE 3V6IA 1NAYA 2Z5HA 5AVRB 2G8YA 5KKZC 3G6EP 3AEFC 1KB9D 2W83C 3RK3D 5APVA 1PP9G 3S1KA 3TDKA 5DJUB 3L74E 1KILE 2E74C 1URQC 1M1JB 2O1JA 1LTBC 3H1IG 4GDOA 1HVVA 1VQLP 4N3YB 2M5AB 1SFCD 2KB7P 3N7NA 2OYHC 3G4SP 2ZT9B 3TNUA 1KD1Q 1ZW0A 2PRRA 1GK6A 2BEQD 4YTPC 1LTSC 3L75J 4PD4E 4XFJA 2QSIA 3L75G 4H13B 4I7ZC 2YO2A 2PGDA 2WT7B 2VRSA 1N7SC 2V7QH 4IOIH 1VL2A 1K04A 2WSFH 2E75C 5KJ7A 1PP9D 4OH8B 5BU5A 1KILC 4ZKUA 4WY4B 3RK2B 1TU3F 1QL2A 2WVRA 1S4XA 1M8OB 3AE7C 5AW4B 2KK7A 3B5NC 1NU1J 1LWUA 5BU8B 3BATA 5TJHA 2OTLP 2KSEA 4M3LA 1BGYE 4U7JA 1VF5C 3L75D 4C7RA 3AE5C 1KFMA 4NPEA 3G71P 2QJPB 2N1TC 1JTHB 3CX5E 1PPJG 5CBNA 3L4FA 2FYUK 3A0HH 2GUVA 1SQXJ 3JSVC 4ASWA 1GU5A 1JB0J 2B87B 3KDPB 1N73B 2N9BA 2P58A 1XTGB 1P84H 2Y9YA 1RF1A 2JEEA 2WTYA 2KYVA 5BVZA 5CMZA 1NU1D 1FJKA 1VQ5P 1BDCA 5AW0B 2HPCA 2KI7B 1S2EA 1PPJD 5AW5B 2KNCB 2FKWB 1RHZB 2IZ1A 1OX3A 1VQNP 4LC1A 1SQXD 5KAFH 1LTGC 1W5CE 2KS1B 3H32A 3RGUA 1FZFA 3B71A 1JCCA 3M9HA 3AEDC 1BE3J 3BCCG 4RJTA 3E1RA 2Y0CA 2HG5D 2IDBA 1G1IA 4AQRD 1M1JC 1W2EA 2V7QJ 1S3JA 2R5DA 2XNDH 1EQ7A 2IYPA 4R4LA 2YO3A 2ZT9C 2NZ2A 3CCMP 3PP5A 1T3JA 1LGHB 1SQVE 4UB8H 3WU2E 1T8ZA 2O01N 4H13C 1ZOYC 5APWA 3EFGA 3L72J 1QEXA 1ZXGA 2KZJA 4OWFA 3L72G 3WUTA 3BCCD 1PFIA 3RK3E 1VQKP 3IAOA 1BE3D 4WY4C 3L37A 5GTHH 3RK2C 4DOJA 1FC2C 3CX5H 3AE6C 1QVFO 3CXHI 3T97B 3S4RA 3AEBC 3JC22 3HD7B 2YNYA 1Q82Q 2R32A 1AQ5A 1JUNA 1CI6B 2FYUG 2SPZA 3GMAA 1FBMA 3KQGA 1RE4A 4OGQB 1PGQA 3L72D 3NTNA 2J58A 3P32A 1Y9BA 1N8RQ 1OW6A 1LTIC 1PP9E 2RN0A 5E79H 3GHGB 1OXZA 2C9NY 2QM7A 2M3BA 1GDTA 1N73C 3L71G 3A2AA 3H1IE 2MJZA 2WMMA 3V5BA 1M57D 2K9JA 4C7NB 1EZVG 2KSJA 4L73A 4R4MA 1X22A 4DZOA 1E79H 3L36A 2FYUD 1VQ8P 3R2PA 1P84D 4EYYQ 3L75E 1H88A 1FE6A 1JM0A 1M56D 2YIUB 1N7SD 2E75D 1LT9A 1RE3C 2WPRA 1KILD 4HYTB 5APSA 3L35A 4WBAA 4W7YA 1X8YA 1YQ3C 3VMAA 3U1AA 1EZVD 2K3RA 3MHVA 3B5ND 2A45I 3JCUH 3EWKA 3MIWA 4W80A 1BGYJ 3MUDC 3M06A 2KLVA 1BGYG 3OAKA 1VF5D 1IFIA 1IFMA 4JQ0D 5B66H 1YJNP 5CBOA 2N1TD 1PPJE 5KKZB 1WT6A 2YXQB 2YKQA 3A0BH 3O6QB 4IFFA 1URQB 4DCKA 5KLIB 1LTJC 3FXEA 2KIKA 1NYHA 3GG2A 3H1LG 3CI9A 1A02F 2ZJSE 3V4QA 1OVUA 1N86A 2ZXEB 3VMXA 1KORA 3GF3A 1BGYD 1SVFA 3HD7C 3AE2C 1N7LA 4U3FJ 3R4YA 1SQBK 1L0LK 3CX5D 4U3FG 4N78E 4C46A 3AE1C 1U57A 2B89A 2GA1A 2Q5UA 3TSIA 1Z56A 4OGQC 5AVXB 1SLQA 1AQTA 2WZ7A 1YI2P 3SWFA 1OW7A 3BCCE 3GW6A 2PAJA 1OW8A 1PGJA 3H1LD 1L0NK 3GHGC 2E42A 2CK3H 3CPWO 2I8DA 3CCSP 1RF0C 1GU4A 1KC8Q 3TNUB 2NPSB 1JMMA 2ZT9D 2M3EA 1S5LH 2FXOA 1KYOI 1NTZK 3CLQA 3M0DA 4RESB 4U3FD 1SQVJ 1H0TA 5AW6B 2QVAA 1MKMA 1BSNA 3E1IA 3C1LA 4H13D 5AVWB 1R8EA 1AVOA 2O1KA 2WSEJ 2YIUC 3F89A 4IL6H 4ZNCA 5CCGD 3L72E 1GD2E 2LR2A 2UWJE 2B9BA 1IC2A 1S5LX 4KJMA 3RK2D 1K73Q 2J5UA 3TYYA 3W68A 3A0HE 3CCJP 1H89A 1GL2D 1YHQP 2QE7H 1K8AQ 2FYUE 1SQVD 4IFMA 1P84E 2OYHA 2QJYB 3OA7A 4GODA 1PP9J 3A7OA 2WSSH 1FZEA 5B5EE 1FDOA 2ZVNB 1Y8AA 1JY3P 3M9BA 2IBZI 3H1IJ 1KV4A 1N7SA 3L71E 5KLIC 2JR8A 2QJKB 1RF1B 1YIJP 1EZVE 1KILA 3HUSB 3PTZA 1L0LJ 2FXMA 2H89C 2XDJA 3E7KA 5KAFE 1AVYA 1YTZI 1L0LG 2V4HA 2FY8A 3SFEC 2FXPA 1S72P 2MKVA 1KTMA 3B5NA 3C9IA 2YMYA 3TGUG 1PV3A 1AJYA 1GW4A 2QEXP 4L76A 1L4AA 3H1HG 4GOFA
chains in the Genus database with same CATH topology
3CX5I 1KYOI 1SQXJ 3L73J 1PP9J 3CXHI 1L0NJ 4U3FJ 3H1LJ 3L72J 1SQVJ 2BCCJ 2IBZI 1NTMJ 3L75J 1BCCJ 3TGUJ 3H1IJ 3BCCJ 4PD4I 3H1JJ 3L74J 3CWBJ 1BE3J 1P84I 3H1HJ 5KLVJ 1BGYJ 2FYUJ 1SQQJ 1SQPJ 1KB9I 3H1KJ 1NU1J 3L70J 4D6TJ 3L71J 1NTKJ 1NTZJ 1L0LJ 1EZVI 1SQBJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CX5 I;  1KYO I;  1SQX J;  3L73 J;  1PP9 J;  3CXH I;  1L0N J;  4U3F J;  3H1L J;  3L72 J;  1SQV J;  2BCC J;  2IBZ I;  1NTM J;  3L75 J;  1BCC J;  3TGU J;  3H1I J;  3BCC J;  4PD4 I;  3H1J J;  3L74 J;  3CWB J;  1BE3 J;  1P84 I;  3H1H J;  5KLV J;  1BGY J;  2FYU J;  1SQQ J;  1SQP J;  1KB9 I;  3H1K J;  1NU1 J;  3L70 J;  4D6T J;  3L71 J;  1NTK J;  1NTZ J;  1L0L J;  1EZV I;  1SQB J; 
#chains in the Genus database with same CATH topology
 2AXT H;  1KQG B;  1GMJ A;  1YBK A;  1L0N G;  3KZI H;  2N1T A;  2HFE D;  2BCC G;  1D7M A;  3BRT B;  1Q81 Q;  3H1I D;  2HOD A;  4UB8 E;  2H43 A;  1OMI A;  1NWQ A;  2IYO A;  1EDK A;  2XU6 A;  3RL0 B;  1L0L D;  3VMZ A;  2W27 A;  2NPS C;  1LJ2 A;  3EFF K;  3W67 A;  5C39 A;  5GTH E;  4GT1 A;  1IZN B;  1KFN A;  3LW5 J;  1R5L A;  3RBZ A;  1JY3 O;  4UB6 E;  2B88 A;  1E5W A;  2ITA A;  5KJ7 C;  2M8R A;  4PD4 I;  1FJP A;  1FDI A;  5CCH C;  3H1L E;  1MFT A;  5KLV K;  1PGO A;  1SQQ K;  4LLH A;  2CPB A;  2LKM A;  1ZR4 A;  2OTK E;  1LWU C;  2OTJ P;  4K3A A;  5B5E H;  3HD7 D;  3MP7 B;  2YMK A;  1M1J A;  5E79 E;  3AEA C;  1JY3 N;  1T2K C;  4U3F E;  3VP9 A;  1IK9 A;  4BWN A;  2KZI A;  2C0X A;  3HE5 B;  4RO0 A;  3H25 A;  4AUW A;  4H44 D;  4OGQ D;  2QJY C;  5CJ4 A;  1QX8 A;  3BCC J;  1NTM K;  4I6M C;  3MZW B;  1CZQ A;  1FZB A;  3Q1M A;  1WRG A;  3AE8 C;  1H8A A;  3M9Q A;  5APX A;  5AW3 B;  5CCG A;  2K9J B;  4DJG A;  2QJK C;  1W2B O;  1RF1 C;  2WSF J;  2K9Y A;  2C9L Y;  3HUS C;  1RQV A;  2OYI B;  1YYC A;  4N78 D;  3TK1 A;  2K88 A;  3SSU A;  3I5C A;  3D6Z A;  1BDD A;  1GL2 A;  2P10 A;  2IX7 C;  3JCU E;  5APU A;  2R44 A;  4Z1M H;  1LNQ A;  1LT9 B;  1LTJ B;  1LTT C;  2IBZ G;  4IFD K;  3CD6 P;  2FFD A;  5B66 E;  1SQP K;  1NTK K;  1S1C X;  4UB6 H;  1KQF B;  1NJI Q;  5APY A;  3RL0 C;  3A0B E;  4EIJ A;  3H1J J;  1N73 A;  2FYU J;  2HR3 A;  3H1J G;  1J2J B;  3OW2 O;  3FX0 A;  1SFC A;  2OAR A;  3OJA B;  3I56 P;  3Q2Y A;  2IZ0 A;  1T6A A;  5CJ0 A;  2O3J A;  1JNM A;  3LID A;  1OWA A;  1ZLL A;  5L8R J;  5KLV G;  2E74 D;  1G1J A;  1URQ D;  3L71 J;  2IFN A;  4D6T G;  1EC5 A;  1G2C A;  2WSC H;  3AEE C;  2H88 C;  5EFW B;  1RE3 A;  1FZC B;  2KS1 A;  2ZAE B;  1L0L E;  5APQ A;  3H1J D;  1KB9 I;  2ZYD A;  3TGU E;  4HH2 A;  3CXH H;  2AXC A;  3HE4 A;  3H1H E;  3MUD A;  3KPE A;  2JWA A;  1NTM G;  1BCC G;  1QL1 A;  1Q90 D;  2JDI H;  1FOS E;  3II6 A;  1L0N E;  3V4W A;  1S5L E;  2R3C A;  1ZV8 A;  2AEF A;  2AEM A;  2BCC E;  4D6T D;  1VQ6 P;  3L71 D;  2OGU A;  1IFN A;  4YXW H;  1HF9 A;  2RKL A;  1LP1 B;  1VQ9 P;  2LXC B;  2RH0 A;  4PV1 B;  1VQ7 P;  1NTZ E;  2ZXX A;  2E76 B;  2PP6 A;  3PLN A;  2GUS A;  4YXD C;  4IL6 E;  4ZKP A;  2NPS D;  3H1K G;  1HBW A;  3MGN A;  4RKU J;  1H0T B;  3T97 A;  2LXB A;  2OYI C;  4AYC A;  5AW1 B;  1DEE G;  3PRJ A;  1T3U A;  3S9O A;  1ZRT E;  1CI6 A;  1SQP G;  5KJ7 D;  1J1D B;  1LT9 C;  1NTK G;  1HJB A;  3L73 J;  3H1L J;  3L73 G;  5CCH D;  3TF5 A;  2XKM A;  4A7P A;  2JP3 A;  1VPC A;  2Y0E A;  3CMA P;  3FWL A;  3HRN A;  3HTK B;  1LTA C;  3MD0 A;  4EOT A;  4NPD A;  2R3S A;  3KXD A;  3Q5R A;  1RF0 A;  5APT A;  1T2K D;  1NKN A;  3WUU A;  4C7N A;  2RMZ A;  2A45 H;  5KAI E;  3PHL A;  2M0B A;  3RBX A;  1Q86 Q;  2JO1 A;  1LT1 A;  1SQP D;  4I1L A;  4JPZ B;  3A5T A;  2W90 A;  4TT3 H;  5AW2 B;  1KQL A;  3L73 D;  1YTZ T;  2W8Z A;  1GK4 A;  3AEG C;  1MZ9 A;  3N4X A;  2BEZ F;  5AW7 B;  1FAV A;  2AXT E;  1L2P A;  1QLE D;  1FZC C;  2JWD A;  3CCQ P;  3KZI E;  3QH9 A;  3WUV A;  1VQO P;  4I2L C;  2IFM A;  2K1A A;  1L4A B;  3FWN A;  2ZFC A;  3CCE P;  4L74 A;  1S9K E;  2Z4E A;  2FBW C;  1NU1 K;  2QRX A;  2IBZ E;  2JJL A;  4H0L B;  2G3A A;  3G9R A;  3CXH D;  3U59 A;  4WY4 D;  5AW8 B;  4Y28 J;  2E43 A;  1LWU B;  2YKP A;  2WIT A;  3VMY A;  1OZH A;  1NKZ B;  2K37 A;  1URQ A;  4PV1 C;  3RL0 D;  4ASV A;  4MN4 C;  2E76 C;  4WB4 A;  4IL6 X;  1JO5 A;  4YPC A;  1SQX K;  3H1J E;  4HJG H;  3M0D C;  2GM4 A;  4HB1 A;  1R5S A;  5AVQ B;  1YQ4 C;  1Q2N A;  1DEB A;  1OVV A;  3H6P A;  1KYO H;  2QA4 P;  1IFD A;  1AFO A;  5AVU B;  4BRY A;  1K05 A;  5KLV E;  1SQQ E;  2H7H A;  4D6T E;  1J1D C;  4Y99 B;  1K9M Q;  5K5G B;  2A45 G;  5KAI H;  3AE4 C;  3RL0 g;  1SQB J;  3V2N A;  3D70 A;  4JYB A;  3B4S A;  3FGA D;  1SQB G;  1KN7 A;  2HPC B;  4DT0 A;  3TGU J;  2J59 M;  3H1H J;  2D2C B;  3L70 J;  1NTM E;  2NPS A;  3IFM A;  1BCC E;  1MUU A;  3L70 G;  4XA4 A;  5GTI H;  4N6J A;  1L0N J;  3H32 B;  3NMD A;  2HYN A;  2BCC J;  3PH0 A;  4W7Z A;  3O8Z A;  1WMK A;  1P84 I;  3K5B A;  1AV1 A;  4JBZ A;  1M7L A;  1U7M A;  1NTZ J;  2Z5I A;  1VQM P;  1SQB D;  1NTZ G;  1UIX A;  1QGK B;  5CCH A;  3H1K E;  1X9V A;  3TGU D;  1ZME C;  1M90 Q;  4WWI A;  1VDF A;  3SWK A;  3H1H D;  2O01 H;  3MTU E;  1VQP P;  2Q1K A;  3CME P;  3L70 D;  1NU1 G;  1EZV I;  1GL2 B;  1QVG O;  1L4A C;  4PJ0 H;  1L0N D;  2KP8 A;  3IF4 A;  1NVO A;  5KTB A;  2WPS A;  1SQP E;  1N2D C;  2BCC D;  2FYZ A;  1IFP A;  1NTK E;  4H0L C;  3L73 E;  1JEK A;  2FFD B;  2BAS A;  4EDF A;  1DD3 A;  2YXR B;  4BXL A;  1NTZ D;  3RK3 B;  2ZYA A;  1SQX G;  4HKZ H;  1HGV A;  1IO4 A;  4OVN F;  4JYC A;  3D6Y A;  5AVY B;  2JKV A;  2R5B A;  1EDJ A;  2L91 A;  5H2F H;  3KHU A;  5TIS H;  1SFC B;  2PFX A;  4GOE A;  3Q5S A;  2M5A A;  3HUS A;  3CC7 P;  1ZRT D;  1ZP0 C;  1KMI Z;  1FS0 E;  3USS A;  2C0W A;  3CXH E;  2W6J H;  3V2P A;  2WT7 A;  1G2C B;  3CX5 I;  1DIP A;  4Y99 C;  4GIF A;  4EI2 A;  1M1K Q;  1KYO D;  2FYN B;  4WY4 A;  4PD4 H;  3KYQ A;  3Q5P A;  1J1E B;  1BE3 G;  2IPP A;  3BRV B;  5AVZ B;  3EQ2 A;  2WPV B;  1FU1 A;  3ITK A;  3HE4 B;  3AE9 C;  1MV8 A;  2D2C C;  3SFD C;  3BAS A;  3VP8 A;  3CCR P;  3M91 A;  2XNX A;  3VYI A;  1HJ0 A;  2HLO A;  2I1J A;  1SP4 A;  1CW5 A;  1Y47 A;  1JTH A;  1GTW A;  5CHX A;  2WWW A;  2O01 J;  2A06 G;  3GLM A;  1YJW P;  5CCG C;  1NAF A;  2B87 A;  3P8C D;  4PV1 D;  1ZN5 A;  1KB9 E;  1FZA A;  2E76 D;  2Y9Z A;  1RQU A;  1BSH A;  5AW9 B;  3A3Y B;  2POH A;  1S9K D;  1GL2 C;  5M1B A;  2IBZ D;  3CWB J;  5KLV J;  1SQQ J;  1KQS O;  3CC2 P;  3CWB G;  4D6T J;  1X79 B;  5AVS B;  1SQQ G;  1EDL A;  4LGD E;  2A06 D;  2KNC A;  2QIW A;  1DH3 A;  2QJP C;  4H44 B;  3D71 A;  2FFD C;  3HE5 A;  3SWY A;  2QM8 A;  2NRG A;  1GZL A;  3L74 J;  2OYO A;  3RK3 C;  1RY3 A;  1SQB E;  4L75 A;  2WPQ A;  3U1C A;  3L74 G;  1NGM B;  1NO4 A;  1NTM J;  1SFC C;  1BCC J;  2P7J A;  2KOG A;  3L70 E;  2CPS A;  1RE4 C;  2E5Y A;  3CWB D;  1JY2 P;  3NXS A;  5KLV D;  3V2Q A;  1SQQ D;  2OYI A;  2XZR A;  3AEC C;  1NH4 A;  3BVH A;  3CC4 P;  4O9B A;  3IN6 A;  3CCU P;  1SQV K;  3IR9 A;  1FDM A;  1LTJ A;  3L74 D;  3H1K J;  3VOP A;  3VN0 A;  2FYN C;  3P8M C;  3WU2 H;  1J1E C;  1Q7Y Q;  2Q6Q A;  1USE A;  1NU1 E;  1NTM D;  1BCC D;  1L4A D;  3HD7 A;  2WSE H;  1KB9 H;  1SQP J;  2I1K A;  3F5H A;  4PD4 D;  1EXI A;  1NTK J;  4B86 A;  1IJD B;  2P2U A;  4H0L D;  3I55 P;  1OVR A;  3VTP C;  2ZVO B;  1YIT P;  1CSB A;  1SQX E;  2XV5 A;  3PJS K;  2E74 B;  1KYO E;  3H1K D;  3GHG A;  5DJT B;  2Q7C A;  1IK7 A;  4GKG A;  1ZR2 A;  1HWT C;  3QWO C;  2OYH B;  1HTL C;  1NHL A;  2WSC J;  1YJ9 P;  1JY2 O;  1HUC A;  1JOC A;  2W6A A;  1FZC A;  1X0T A;  3GF7 A;  1PGP A;  4KT0 J;  2KUB A;  2Q9I A;  4XE5 B;  1DX7 A;  3C8V A;  3CL3 D;  1EDI A;  2AEJ A;  1MFZ A;  2H8P D;  3ABV C;  4CPG A;  1NTK D;  4BRY B;  4I7Z B;  2Y0D A;  1N7S B;  1OIP A;  4ZMD A;  2E75 B;  2L5G B;  1XTC C;  4H44 C;  1KIL B;  5GTI E;  1U7J A;  1RH5 B;  3UIA A;  1VQ4 P;  4QMA A;  3P8C E;  1JY2 N;  3WMM 0;  1GW3 A;  1BE3 E;  3ZDM A;  1FOS F;  3B5N B;  3M0A A;  1DD4 A;  1AA0 A;  1LP1 A;  1PZQ A;  1IFJ A;  1PIX A;  1USD A;  2DW3 A;  3B8E B;  1PL5 A;  2D2C D;  1EXJ A;  1JMB A;  1VF5 B;  5AVT B;  4K35 A;  1KZU B;  4NPF X;  2N1T B;  1SQV G;  2P67 A;  2KLU A;  2HOD B;  2W6B A;  2A06 E;  2P1J A;  1UII A;  1OFC X;  3NFQ A;  1HH0 A;  3CCV P;  2KXP B;  4JF7 A;  3O6Q A;  4PJ0 E;  1FZG A;  1SS1 A;  4KHX A;  4TLF A;  3AE3 C;  3G3Z A;  2WQY C;  3Q3D A;  2Q3I A;  3LW5 H;  2YKO A;  4WVZ A;  1NOH A;  3HTK A;  2E5T A;  3CCL P;  3P7K A;  2Q3E A;  2N9Y B;  2ZYG A;  1A02 J;  3CWB E;  1HGZ A;  3LIE A;  3FXD A;  5AVV B;  1JCD A;  2OQQ A;  2QG4 A;  3V2R A;  5H2F E;  5TIS E;  3V6I A;  1NAY A;  2Z5H A;  5AVR B;  2G8Y A;  5KKZ C;  3G6E P;  3AEF C;  1KB9 D;  2W83 C;  3RK3 D;  5APV A;  1PP9 G;  3S1K A;  3TDK A;  5DJU B;  3L74 E;  1KIL E;  2E74 C;  1URQ C;  1M1J B;  2O1J A;  1LTB C;  3H1I G;  4GDO A;  1HVV A;  1VQL P;  4N3Y B;  2M5A B;  1SFC D;  2KB7 P;  3N7N A;  2OYH C;  3G4S P;  2ZT9 B;  3TNU A;  1KD1 Q;  1ZW0 A;  2PRR A;  1GK6 A;  2BEQ D;  4YTP C;  1LTS C;  3L75 J;  4PD4 E;  4XFJ A;  2QSI A;  3L75 G;  4H13 B;  4I7Z C;  2YO2 A;  2PGD A;  2WT7 B;  2VRS A;  1N7S C;  2V7Q H;  4IOI H;  1VL2 A;  1K04 A;  2WSF H;  2E75 C;  5KJ7 A;  1PP9 D;  4OH8 B;  5BU5 A;  1KIL C;  4ZKU A;  4WY4 B;  3RK2 B;  1TU3 F;  1QL2 A;  2WVR A;  1S4X A;  1M8O B;  3AE7 C;  5AW4 B;  2KK7 A;  3B5N C;  1NU1 J;  1LWU A;  5BU8 B;  3BAT A;  5TJH A;  2OTL P;  2KSE A;  4M3L A;  1BGY E;  4U7J A;  1VF5 C;  3L75 D;  4C7R A;  3AE5 C;  1KFM A;  4NPE A;  3G71 P;  2QJP B;  2N1T C;  1JTH B;  3CX5 E;  1PPJ G;  5CBN A;  3L4F A;  2FYU K;  3A0H H;  2GUV A;  1SQX J;  3JSV C;  4ASW A;  1GU5 A;  1JB0 J;  2B87 B;  3KDP B;  1N73 B;  2N9B A;  2P58 A;  1XTG B;  1P84 H;  2Y9Y A;  1RF1 A;  2JEE A;  2WTY A;  2KYV A;  5BVZ A;  5CMZ A;  1NU1 D;  1FJK A;  1VQ5 P;  1BDC A;  5AW0 B;  2HPC A;  2KI7 B;  1S2E A;  1PPJ D;  5AW5 B;  2KNC B;  2FKW B;  1RHZ B;  2IZ1 A;  1OX3 A;  1VQN P;  4LC1 A;  1SQX D;  5KAF H;  1LTG C;  1W5C E;  2KS1 B;  3H32 A;  3RGU A;  1FZF A;  3B71 A;  1JCC A;  3M9H A;  3AED C;  1BE3 J;  3BCC G;  4RJT A;  3E1R A;  2Y0C A;  2HG5 D;  2IDB A;  1G1I A;  4AQR D;  1M1J C;  1W2E A;  2V7Q J;  1S3J A;  2R5D A;  2XND H;  1EQ7 A;  2IYP A;  4R4L A;  2YO3 A;  2ZT9 C;  2NZ2 A;  3CCM P;  3PP5 A;  1T3J A;  1LGH B;  1SQV E;  4UB8 H;  3WU2 E;  1T8Z A;  2O01 N;  4H13 C;  1ZOY C;  5APW A;  3EFG A;  3L72 J;  1QEX A;  1ZXG A;  2KZJ A;  4OWF A;  3L72 G;  3WUT A;  3BCC D;  1PFI A;  3RK3 E;  1VQK P;  3IAO A;  1BE3 D;  4WY4 C;  3L37 A;  5GTH H;  3RK2 C;  4DOJ A;  1FC2 C;  3CX5 H;  3AE6 C;  1QVF O;  3CXH I;  3T97 B;  3S4R A;  3AEB C;  3JC2 2;  3HD7 B;  2YNY A;  1Q82 Q;  2R32 A;  1AQ5 A;  1JUN A;  1CI6 B;  2FYU G;  2SPZ A;  3GMA A;  1FBM A;  3KQG A;  1RE4 A;  4OGQ B;  1PGQ A;  3L72 D;  3NTN A;  2J58 A;  3P32 A;  1Y9B A;  1N8R Q;  1OW6 A;  1LTI C;  1PP9 E;  2RN0 A;  5E79 H;  3GHG B;  1OXZ A;  2C9N Y;  2QM7 A;  2M3B A;  1GDT A;  1N73 C;  3L71 G;  3A2A A;  3H1I E;  2MJZ A;  2WMM A;  3V5B A;  1M57 D;  2K9J A;  4C7N B;  1EZV G;  2KSJ A;  4L73 A;  4R4M A;  1X22 A;  4DZO A;  1E79 H;  3L36 A;  2FYU D;  1VQ8 P;  3R2P A;  1P84 D;  4EYY Q;  3L75 E;  1H88 A;  1FE6 A;  1JM0 A;  1M56 D;  2YIU B;  1N7S D;  2E75 D;  1LT9 A;  1RE3 C;  2WPR A;  1KIL D;  4HYT B;  5APS A;  3L35 A;  4WBA A;  4W7Y A;  1X8Y A;  1YQ3 C;  3VMA A;  3U1A A;  1EZV D;  2K3R A;  3MHV A;  3B5N D;  2A45 I;  3JCU H;  3EWK A;  3MIW A;  4W80 A;  1BGY J;  3MUD C;  3M06 A;  2KLV A;  1BGY G;  3OAK A;  1VF5 D;  1IFI A;  1IFM A;  4JQ0 D;  5B66 H;  1YJN P;  5CBO A;  2N1T D;  1PPJ E;  5KKZ B;  1WT6 A;  2YXQ B;  2YKQ A;  3A0B H;  3O6Q B;  4IFF A;  1URQ B;  4DCK A;  5KLI B;  1LTJ C;  3FXE A;  2KIK A;  1NYH A;  3GG2 A;  3H1L G;  3CI9 A;  1A02 F;  2ZJS E;  3V4Q A;  1OVU A;  1N86 A;  2ZXE B;  3VMX A;  1KOR A;  3GF3 A;  1BGY D;  1SVF A;  3HD7 C;  3AE2 C;  1N7L A;  4U3F J;  3R4Y A;  1SQB K;  1L0L K;  3CX5 D;  4U3F G;  4N78 E;  4C46 A;  3AE1 C;  1U57 A;  2B89 A;  2GA1 A;  2Q5U A;  3TSI A;  1Z56 A;  4OGQ C;  5AVX B;  1SLQ A;  1AQT A;  2WZ7 A;  1YI2 P;  3SWF A;  1OW7 A;  3BCC E;  3GW6 A;  2PAJ A;  1OW8 A;  1PGJ A;  3H1L D;  1L0N K;  3GHG C;  2E42 A;  2CK3 H;  3CPW O;  2I8D A;  3CCS P;  1RF0 C;  1GU4 A;  1KC8 Q;  3TNU B;  2NPS B;  1JMM A;  2ZT9 D;  2M3E A;  1S5L H;  2FXO A;  1KYO I;  1NTZ K;  3CLQ A;  3M0D A;  4RES B;  4U3F D;  1SQV J;  1H0T A;  5AW6 B;  2QVA A;  1MKM A;  1BSN A;  3E1I A;  3C1L A;  4H13 D;  5AVW B;  1R8E A;  1AVO A;  2O1K A;  2WSE J;  2YIU C;  3F89 A;  4IL6 H;  4ZNC A;  5CCG D;  3L72 E;  1GD2 E;  2LR2 A;  2UWJ E;  2B9B A;  1IC2 A;  1S5L X;  4KJM A;  3RK2 D;  1K73 Q;  2J5U A;  3TYY A;  3W68 A;  3A0H E;  3CCJ P;  1H89 A;  1GL2 D;  1YHQ P;  2QE7 H;  1K8A Q;  2FYU E;  1SQV D;  4IFM A;  1P84 E;  2OYH A;  2QJY B;  3OA7 A;  4GOD A;  1PP9 J;  3A7O A;  2WSS H;  1FZE A;  5B5E E;  1FDO A;  2ZVN B;  1Y8A A;  1JY3 P;  3M9B A;  2IBZ I;  3H1I J;  1KV4 A;  1N7S A;  3L71 E;  5KLI C;  2JR8 A;  2QJK B;  1RF1 B;  1YIJ P;  1EZV E;  1KIL A;  3HUS B;  3PTZ A;  1L0L J;  2FXM A;  2H89 C;  2XDJ A;  3E7K A;  5KAF E;  1AVY A;  1YTZ I;  1L0L G;  2V4H A;  2FY8 A;  3SFE C;  2FXP A;  1S72 P;  2MKV A;  1KTM A;  3B5N A;  3C9I A;  2YMY A;  3TGU G;  1PV3 A;  1AJY A;  1GW4 A;  2QEX P;  4L76 A;  1L4A A;  3H1H G;  4GOF A; 
#chains in the Genus database with same CATH homology
 3CX5 I;  1KYO I;  1SQX J;  3L73 J;  1PP9 J;  3CXH I;  1L0N J;  4U3F J;  3H1L J;  3L72 J;  1SQV J;  2BCC J;  2IBZ I;  1NTM J;  3L75 J;  1BCC J;  3TGU J;  3H1I J;  3BCC J;  4PD4 I;  3H1J J;  3L74 J;  3CWB J;  1BE3 J;  1P84 I;  3H1H J;  5KLV J;  1BGY J;  2FYU J;  1SQQ J;  1SQP J;  1KB9 I;  3H1K J;  1NU1 J;  3L70 J;  4D6T J;  3L71 J;  1NTK J;  1NTZ J;  1L0L J;  1EZV I;  1SQB J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...