5KLVJ

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
61
structure length
61
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 18
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 5klvJ00
4PD4I 1L0LJ 1P84I 3TGUJ 1SQPJ 3L72J 1NTKJ 5KLVJ 1SQQJ 3CXHI 1NTZJ 1SQVJ 1SQBJ 1BGYJ 3H1LJ 3L73J 3L70J 2IBZI 1NTMJ 1KB9I 1EZVI 3CX5I 1BE3J 1NU1J 2FYUJ 3H1HJ 1SQXJ 1BCCJ 3L74J 4D6TJ 3H1KJ 1PP9J 1KYOI 4U3FJ 3H1IJ 3L75J 1L0NJ 3H1JJ 3CWBJ 3L71J 2BCCJ 3BCCJ
chains in the Genus database with same CATH superfamily
3L72G 3WU2E 5KJ7D 3PLNA 1VQ6P 2WVRA 2I8DA 1BCCE 1G2CA 1KQLA 5AW6B 1SS1A 1YITP 1UIIA 1KZUB 2XZRA 3N4XA 2D2CD 3GMAA 3O6QB 1QVGO 1E79H 3TNUB 1FZBA 3T97A 3M06A 2M5AB 1BE3E 4ZKPA 1VQKP 1JO5A 4YXDC 4LC1A 2XNXA 1YJ9P 2K9YA 4JYBA 3L73D 2MKVA 2YMYA 2OYIA 2LR2A 4L76A 3L73G 1YIJP 1T6AA 2HYNA 2FXPA 3RK2C 4U3FE 3H1IJ 1W2EA 2R44A 4Z1MH 3L70D 1LWUB 1CZQA 3RK3B 2ZVNB 4PD4H 1L4AA 2O01J 2Q1KA 1U57A 1LTJA 3RL0D 4UB8E 3F89A 3S4RA 1QGKB 5EFWB 1FZCC 1URQB 5KJ7A 1L0NJ 2BCCJ 4WBAA 2KOGA 1U7JA 1ZP0C 3MGNA 2BEZF 4PD4D 2B89A 4C46A 2JWDA 3D71A 1NTKK 2N1TD 1BCCJ 5KLVD 3HTKB 1FAVA 2RKLA 2E74D 1VQ8P 1K8AQ 3KYQA 3PRJA 4H13C 1DD4A 2WPQA 1BE3J 3JC22 1KV4A 2WSEJ 1M1JB 1HGZA 1GW3A 1AFOA 2PFXA 4I6MC 3HD7C 1L0LE 3L72E 4JYCA 5GTHH 4JF7A 3CWBD 4OGQC 1ZW0A 2V4HA 4H44B 3NFQA 1BSHA 1TU3F 4U3FJ 2WT7A 1NAYA 1P84E 3B4SA 1LTSC 4M3LA 4NPFX 3L74D 5APYA 4U7JA 4MN4C 3K5BA 4HH2A 3N7NA 3IAOA 1SVFA 1NTME 3L74G 4R4LA 5KKZB 2FFDC 1SQBK 2FXMA 2AEMA 2ZYGA 1FZAA 3GG2A 1AVYA 2N1TA 1QL2A 3V2RA 1Q81Q 2ZVOB 3V6IA 2PP6A 2KS1B 1OW7A 1ZR4A 1KB9H 1S72P 2Y0CA 4UB6H 1AVOA 3RK3D 1IK7A 2C9NY 1NU1D 1SQXD 4WB4A 4YTPC 1GL2D 2P7JA 2MJZA 1VQMP 1NU1G 1SQXG 2E76C 3CC7P 1PIXA 2JDIH 2WSCJ 3MP7B 1T2KC 1FDOA 1LP1B 1EZVD 3P32A 3H6PA 1N7SB 1EXIA 4Y99B 2FYZA 1X8YA 3TGUG 4C7NB 1P84I 3ABVC 1PP9D 3L72J 2DW3A 1JEKA 1K04A 4ASVA 2Q3EA 1N73B 2NPSC 1PP9G 2R3CA 2ZT9B 3KPEA 3L75E 3TNUA 2ZXXA 1SQQD 1U7MA 2QG4A 2BEQD 1KYOD 1S9KD 3U59A 1SQQG 4GIFA 2QSIA 5TISE 1SQVG 1LTTC 3Q5PA 2NRGA 1FJPA 1LT9A 3H1HE 1NTMJ 4BRYB 5KLIB 5CJ0A 2HG5D 5CCGC 5AVRB 3SFEC 3B8EB 2KZIA 4DT0A 2G8YA 3VMXA 2XU6A 2K3RA 3SWFA 4PV1C 4N3YB 1EC5A 4L73A 5APQA 1L0NK 4Y28J 2VRSA 3B5NC 1RH5B 1RE4A 5APVA 1SFCB 3CD6P 3BCCG 2HLOA 1GL2A 3E7KA 3A0HE 4WWIA 3M0DC 1NTKE 2IYPA 3H1LE 3L4FA 1LT1A 1QEXA 4IL6X 2O01H 1RY3A 2L5GB 1PPJD 2A06E 2QIWA 3EQ2A 2A45G 3WUUA 1X22A 1XTGB 4D6TD 2IZ0A 2YIUC 3HTKA 1HJ0A 4YXWH 1S5LE 3V2QA 3MUDA 2WSFH 4YPCA 2Z4EA 3RGUA 1JCDA 1HJBA 3L75J 3V4QA 1AA0A 1OIPA 2WZ7A 1H89A 5L8RJ 4PJ0E 1M1JA 1HF9A 3H1HJ 3AEBC 1SQPD 1KILB 1HGVA 1N7SD 2HPCB 3ZDMA 1SQPG 2WSEH 1BCCD 2H7HA 3TGUE 2B88A 2K1AA 3RL0g 4OH8B 5DJUB 1Q90D 3IF4A 1IFNA 2ZT9D 3P8CE 1HBWA 2W8ZA 2WMMA 1JM0A 2BASA 4I7ZC 2YXRB 1N2DC 1NTKJ 1AJYA 1SQVE 1PL5A 1PZQA 2IBZE 3H1LJ 3CCVP 1IO4A 1J1DB 3H1KE 3Q1MA 5KAIE 1YHQP 1Q2NA 1H0TB 1ZMEC 4U3FD 3GHGA 2YKQA 1EQ7A 4N6JA 1DX7A 1T3JA 1EDIA 1ZOYC 4C7RA 1FZCB 1JTHB 3FXEA 5CJ4A 2G3AA 2E75D 1HUCA 1USEA 3PJSK 1KFMA 1PV3A 4JBZA 3D70A 1GU5A 1LP1A 4B86A 3KQGA 4W7YA 2QM7A 1N7SA 1UIXA 2FXOA 2FKWB 5AW5B 2WSCH 4IFDK 3AEEC 3MTUE 1N73A 1IFIA 4IL6H 1WT6A 3M9BA 3TGUJ 3BVHA 2J59M 3VP8A 3CX5E 3P8MC 4LGDE 1JY3P 2KXPB 2IBZI 5B5EE 1VF5B 2WPSA 2K88A 2AEFA 3V2PA 2OYIC 1VQ4P 1L0NE 5H2FE 5AVSB 4OGQB 4QMAA 4BRYA 4GDOA 2ZYAA 1P84H 1SQVJ 1L0LD 2B9BA 2HODA 3H1KJ 1FZGA 4DJGA 1MKMA 1KILD 1BSNA 2JO1A 4R4MA 5AW9B 2Z5IA 1LTJC 2FYUD 3CXHE 4ZKUA 1S5LX 4N78D 1JY3O 5TJHA 2QRXA 2FFDB 1FOSE 3Q2YA 2FYUG 2JP3A 5AVUB 5KJ7C 1YBKA 3VYIA 2YKOA 2OYHA 5AVTB 2QA4P 3H1JE 1BGYD 3PTZA 3G4SP 2QVAA 3BCCJ 4GOFA 2D2CC 2A45I 5APXA 1EXJA 5CCHD 3D6ZA 2XKMA 1KN7A 2K9JB 1H88A 3UIAA 3CX5I 1HTLC 3A7OA 1Y9BA 3M9HA 1FJKA 5K5GB 2E76B 3L70G 2Q5UA 2Q3IA 4EOTA 1NVOA 1N86A 3V5BA 2POHA 2H89C 1GU4A 2WPRA 1NTZE 1FU1A 2GA1A 3CXHI 4XFJA 1KILA 5TISH 1MFZA 1KQSO 3RL0C 3GLMA 3KZIE 3U1CA 1W2BO 1DIPA 4W80A 3FGAD 3O8ZA 3AE5C 2KNCB 5KLVG 2JEEA 1BDDA 3BASA 2WITA 3L75D 3E1RA 4IOIH 3HE5A 2KSEA 1VF5D 1K9MQ 1FZFA 5AW4B 3L71E 3H1JJ 5CCHA 1PGOA 3CLQA 2E74C 1RF1A 3B5NB 3EWKA 2IPPA 3A0HH 2AXCA 3HUSB 1H0TA 1CSBA 3CWBG 3AEGC 1ZRTD 1YTZI 4L75A 2YO3A 4IFFA 1FZCA 1JTHA 2H88C 2KI7B 3B71A 5E79H 2YMKA 2FYNB 1KQFB 3AE7C 1NTKD 2RMZA 4ZMDA 1S5LH 1SLQA 1RE3C 1RHZB 4GKGA 5AW2B 1HWTC 2Z5HA 4ZNCA 2YIUB 2HR3A 3BRTB 3HE4A 2QJKC 3G9RA 2QJPC 1NTZJ 3L73E 1ZN5A 3JSVC 3AE9C 3E1IA 1LGHB 2SPZA 2O3JA 4PJ0H 2ITAA 1SQVK 2B87B 4WY4C 4JPZB 3TSIA 3H25A 3A0BE 5AVWB 1LT9C 2E76D 2V7QH 3VMZA 2JKVA 2CK3H 4L74A 2R3SA 2E42A 2PRRA 2ZJSE 1AV1A 4RO0A 3G6EP 1URQD 2OTLP 1KB9D 1OVUA 3L71J 1JNMA 1RE4C 2PGDA 3U1AA 1EZVG 3RK3C 2W6AA 1D7MA 3AE4C 2IDBA 1GL2C 1S4XA 3O6QA 2P10A 3TK1A 4I7ZB 2W6BA 3I55P 2R5DA 1IFDA 1SQBD 2M5AA 2M3BA 3PH0A 1RQVA 1PGJA 1SQBG 1IFMA 5KAIH 1FOSF 3TF5A 1VQLP 2NZ2A 2Q6QA 3OAKA 1W5CE 1KFNA 1KTMA 1OW8A 3AE1C 3GW6A 1LTBC 4H0LB 2K9JA 5AW8B 3B5ND 3MUDC 3CL3D 3LW5J 3AECC 2LXCB 3L73J 4H44D 3IFMA 2M0BA 1LWUA 4JQ0D 4LLHA 2GUSA 2R32A 5GTIE 4KHXA 1LJ2A 5AW0B 1G2CB 1KQGB 3CCSP 1DEEG 1URQA 3L70J 1M8OB 4RESB 3OA7A 5AW1B 3L74E 3CX5H 4EDFA 1MV8A 4EYYQ 4AYCA 1PPJG 1VQOP 1WRGA 2KYVA 5H2FH 3H1ID 5C39A 1M57D 4TLFA 3SFDC 3WU2H 4RKUJ 2KP8A 1OVVA 5BVZA 3H1IG 4D6TG 2KNCA 3CX5D 3CCRP 2LXBA 3CCEP 1JMBA 1L0ND 3R2PA 4EI2A 3CXHH 2BCCD 1N7LA 1NU1E 1SQXE 2XV5A 2QM8A 1T8ZA 2WQYC 2BCCG 2Y0DA 1VQ5P 2KK7A 3GHGC 3B5NA 3V2NA 2KB7P 4K35A 1CW5A 1G1JA 2CPBA 1NAFA 1T3UA 3HUSA 1ZLLA 1N8RQ 1EZVE 1BCCG 1EDKA 3TYYA 3A2AA 1K05A 1AQ5A 1GTWA 1PP9E 1NTZK 2D2CB 2YO2A 1BE3D 2QEXP 1N7SC 4Y99C 1SQQE 3H1JD 2W83C 1NKNA 1JMMA 3RK2B 1IFJA 1LTAC 3F5HA 1KYOE 1S9KE 2OARA 3BATA 3L74J 1N73C 1VDFA 4UB8H 1VQPP 4H0LD 1LNQA 5APSA 2KS1A 3NTNA 3A5TA 1FDIA 2LKMA 2OTKE 4U3FG 3EFGA 1SFCD 2YXQB 1CI6B 3PHLA 2YNYA 1JOCA 5APTA 3RBZA 2HFED 3BCCE 1GW4A 4NPDA 3KZIH 1VQNP 5M1BA 5APUA 2WT7B 2QJYC 3RL0B 2L91A 3KHUA 3SWYA 1EZVI 1QVFO 1NU1J 1SQXJ 3ITKA 1VPCA 4K3AA 1QL1A 4C7NA 2WWWA 1M1KQ 3AE2C 1PPJE 1PGPA 2E75C 4H13B 1KC8Q 1J2JB 2OYHC 3CMEP 1FDMA 3JCUE 2O1KA 3AEFC 4HJGH 2J5UA 4KT0J 4D6TE 4DZOA 3SSUA 1PP9J 1KYOI 1JUNA 3SWKA 3HD7B 2E74B 3CC2P 3BRVB 2W90A 1ZR2A 1PGQA 5KAFE 1SQQJ 2ZFCA 3P7KA 3II6A 1PFIA 3CCMP 1Y8AA 3L72D 1S1CX 1S3JA 1NGMB 1L4AC 1Y47A 1L0LG 4OVNF 1R5LA 1MUUA 4TT3H 1SQPE 2I1JA 5B66E 1SFCA 1P84D 3L37A 1RF0A 1LTIC 3LW5H 2JR8A 2IFNA 1NYHA 2RN0A 1NTMD 2QJKB 3WMM0 1KILC 2QJPB 1JCCA 4AQRD 1L2PA 1JY2N 1BGYG 2O01N 1DEBA 3A0BH 1NTMG 3RK2D 1R8EA 2KIKA 1YQ3C 5CBOA 4WY4B 1Q86Q 5KLVK 1LTGC 2KLUA 2E43A 1LT9B 4DOJA 2PAJA 3AEDC 2KLVA 1X9VA 2P67A 3AE8C 1J1EC 4HKZH 1NH4A 4GOEA 5CCHC 4D6TJ 3M91A 1Z56A 1GK6A 1J1DC 1RF1C 4XA4A 2J58A 1GL2B 2NPSB 1OZHA 2W27A 1FC2C 1OFCX 5APWA 3HRNA 2HPCA 1A02J 5AW3B 2Y9ZA 1EDJA 4H13D 3L35A 1SQPJ 3IN6A 3Q3DA 2WSFJ 2FY8A 3AE6C 3CI9A 3L75G 2M3EA 3USSA 3S1KA 3HD7D 4PV1B 3MIWA 2N1TC 3H1HD 4OGQD 2YKPA 5GTIH 1OW6A 2AXTE 3H1HG 4CPGA 2I1KA 1ZV8A 3GF7A 1Q7YQ 2WTYA 4IL6E 1VF5C 5CMZA 3VTPC 1NU1K 1SQXK 2FBWC 1KILE 3M9QA 1CI6A 2KUBA 3MD0A 2FYUE 2IX7C 2KSJA 4N78E 1IC2A 2JWAA 2WSSH 3H1LD 3IR9A 3CCQP 2UWJE 3MZWB 5AVZB 3KXDA 1NTKG 2ZYDA 2A06D 3H1LG 4WVZA 3NMDA 1BGYE 3NXSA 4WY4D 2A06G 5AVXB 3Q5RA 3M0AA 2P58A 1SQQK 2N9YB 1K73Q 4BWNA 1YI2P 3AEAC 2OYOA 1BDCA 3H32B 2N9BA 3I5CA 4I2LC 3GF3A 2XDJA 2OGUA 1GK4A 1T2KD 3HD7A 3L70E 2P1JA 1FE6A 3GHGB 2H8PD 2ZXEB 1M90Q 3VP9A 1SP4A 3AE3C 3TDKA 3FX0A 1OWAA 3CMAP 1ZXGA 1LWUC 2NPSD 1JY2P 1DH3A 2QE7H 1A02F 1WMKA 3TGUD 3V4WA 3W68A 1KD1Q 3L36A 1KYOH 4PD4E 2FFDA 1NO4A 1HVVA 3FWLA 3VMAA 1URQC 1L0LJ 1GZLA 3P8CD 1RE3A 5KLVE 1IFPA 5CCGD 1E5WA 2OQQA 1EDLA 2FYUJ 1GMJA 2ZAEB 1QLED 1SQVD 2IBZD 4PV1D 1NWQA 1JY2O 4AUWA 4WY4A 2IBZG 3H1KD 1VQ7P 3CC4P 2H43A 4BXLA 4ASWA 1BGYJ 5AVQB 3H1KG 5BU5A 2Q7CA 2W6JH 5AW7B 2C0XA 3I56P 1KORA 3CWBE 2IZ1A 1RQUA 2QJYB 1H8AA 2HODB 3VN0A 1M1JC 2P2UA 1ZRTE 4GODA 2IYOA 1JY3N 2A45H 3QWOC 3BCCD 4W7ZA 3R4YA 1SQPK 2K37A 3JCUH 3T97B 1FZEA 3HUSC 4H44C 2E75B 2CPSA 1XTCC 2NPSA 5GTHE 5B5EH 2OYHB 4EIJA 1NJIQ 4PD4I 3OW2O 2GUVA 4IFMA 1IK9A 1VL2A 1JB0J 4A7PA 1IZNB 1IJDB 5KAFH 2FYNC 3CCUP 2OYIB 2IFMA 5KKZC 2C9LY 1GDTA 1YJWP 5CCGA 5E79E 5CHXA 1YQ4C 3FWNA 1KMIZ 2Q9IA 2M8RA 5KLVJ 3CCJP 3A3YB 2KZJA 3EFFK 1M56D 3RK3E 5B66H 1DD3A 1L4AB 2JJLA 4OWFA 1OMIA 1MFTA 1L0NG 2R5BA 1M7LA 1LTJB 3Q5SA 1NHLA 3S9OA 3C1LA 1AQTA 1KB9E 3WUVA 1OX3A 3WUTA 3LIDA 4UB6E 3G71P 3M0DA 3CXHD 1FS0E 2C0WA 2RH0A 5AVVB 3LIEA 1G1IA 2WPVB 4HYTB 2AEJA 3CWBJ 3G3ZA 2Y9YA 5AVYB 1USDA 1X79B 1SQBE 2Y0EA 5BU8B 1BE3G 2GM4A 3D6YA 3C9IA 4HB1A 3H1JG 4DCKA 4I1LA 3HE5B 2ZT9C 2O1JA 5KTBA 1J1EB 4GT1A 1Q82Q 1X0TA 2B87A 1RF1B 2E5TA 1S2EA 3QH9A 3VMYA 3H32A 3OJAB 1QX8A 3FXDA 5KLIC 4NPEA 2OTJP 1YTZT 4O9BA 4H0LC 4KJMA 4XE5B 1OVRA 1OXZA 1YYCA 1MZ9A 1YJNP 1R5SA 1L0LK 1KB9I 5DJTB 4RJTA 3RBXA 1NTZD 1SFCC 1FBMA 2FYUK 3CPWO 1RF0C 1NTZG 2XNDH 3PP5A 3C8VA 3W67A 2AXTH 5CBNA 3HE4B 1VQ9P 2N1TB 3H1IE 1NOHA 2E5YA 1NTMK 2V7QJ 3MHVA 1GD2E 3VOPA 3KDPB 1SQBJ 3L71D 1L4AD 3CCLP 1HH0A 3L71G 2BCCE 1NKZB
chains in the Genus database with same CATH topology
4PD4I 1L0LJ 1P84I 3TGUJ 1SQPJ 3L72J 1NTKJ 5KLVJ 1SQQJ 3CXHI 1NTZJ 1SQVJ 1SQBJ 1BGYJ 3H1LJ 3L73J 3L70J 2IBZI 1NTMJ 1KB9I 1EZVI 3CX5I 1BE3J 1NU1J 2FYUJ 3H1HJ 1SQXJ 1BCCJ 3L74J 4D6TJ 3H1KJ 1PP9J 1KYOI 4U3FJ 3H1IJ 3L75J 1L0NJ 3H1JJ 3CWBJ 3L71J 2BCCJ 3BCCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PD4 I;  1L0L J;  1P84 I;  3TGU J;  1SQP J;  3L72 J;  1NTK J;  5KLV J;  1SQQ J;  3CXH I;  1NTZ J;  1SQV J;  1SQB J;  1BGY J;  3H1L J;  3L73 J;  3L70 J;  2IBZ I;  1NTM J;  1KB9 I;  1EZV I;  3CX5 I;  1BE3 J;  1NU1 J;  2FYU J;  3H1H J;  1SQX J;  1BCC J;  3L74 J;  4D6T J;  3H1K J;  1PP9 J;  1KYO I;  4U3F J;  3H1I J;  3L75 J;  1L0N J;  3H1J J;  3CWB J;  3L71 J;  2BCC J;  3BCC J; 
#chains in the Genus database with same CATH topology
 3L72 G;  3WU2 E;  5KJ7 D;  3PLN A;  1VQ6 P;  2WVR A;  2I8D A;  1BCC E;  1G2C A;  1KQL A;  5AW6 B;  1SS1 A;  1YIT P;  1UII A;  1KZU B;  2XZR A;  3N4X A;  2D2C D;  3GMA A;  3O6Q B;  1QVG O;  1E79 H;  3TNU B;  1FZB A;  3T97 A;  3M06 A;  2M5A B;  1BE3 E;  4ZKP A;  1VQK P;  1JO5 A;  4YXD C;  4LC1 A;  2XNX A;  1YJ9 P;  2K9Y A;  4JYB A;  3L73 D;  2MKV A;  2YMY A;  2OYI A;  2LR2 A;  4L76 A;  3L73 G;  1YIJ P;  1T6A A;  2HYN A;  2FXP A;  3RK2 C;  4U3F E;  3H1I J;  1W2E A;  2R44 A;  4Z1M H;  3L70 D;  1LWU B;  1CZQ A;  3RK3 B;  2ZVN B;  4PD4 H;  1L4A A;  2O01 J;  2Q1K A;  1U57 A;  1LTJ A;  3RL0 D;  4UB8 E;  3F89 A;  3S4R A;  1QGK B;  5EFW B;  1FZC C;  1URQ B;  5KJ7 A;  1L0N J;  2BCC J;  4WBA A;  2KOG A;  1U7J A;  1ZP0 C;  3MGN A;  2BEZ F;  4PD4 D;  2B89 A;  4C46 A;  2JWD A;  3D71 A;  1NTK K;  2N1T D;  1BCC J;  5KLV D;  3HTK B;  1FAV A;  2RKL A;  2E74 D;  1VQ8 P;  1K8A Q;  3KYQ A;  3PRJ A;  4H13 C;  1DD4 A;  2WPQ A;  1BE3 J;  3JC2 2;  1KV4 A;  2WSE J;  1M1J B;  1HGZ A;  1GW3 A;  1AFO A;  2PFX A;  4I6M C;  3HD7 C;  1L0L E;  3L72 E;  4JYC A;  5GTH H;  4JF7 A;  3CWB D;  4OGQ C;  1ZW0 A;  2V4H A;  4H44 B;  3NFQ A;  1BSH A;  1TU3 F;  4U3F J;  2WT7 A;  1NAY A;  1P84 E;  3B4S A;  1LTS C;  4M3L A;  4NPF X;  3L74 D;  5APY A;  4U7J A;  4MN4 C;  3K5B A;  4HH2 A;  3N7N A;  3IAO A;  1SVF A;  1NTM E;  3L74 G;  4R4L A;  5KKZ B;  2FFD C;  1SQB K;  2FXM A;  2AEM A;  2ZYG A;  1FZA A;  3GG2 A;  1AVY A;  2N1T A;  1QL2 A;  3V2R A;  1Q81 Q;  2ZVO B;  3V6I A;  2PP6 A;  2KS1 B;  1OW7 A;  1ZR4 A;  1KB9 H;  1S72 P;  2Y0C A;  4UB6 H;  1AVO A;  3RK3 D;  1IK7 A;  2C9N Y;  1NU1 D;  1SQX D;  4WB4 A;  4YTP C;  1GL2 D;  2P7J A;  2MJZ A;  1VQM P;  1NU1 G;  1SQX G;  2E76 C;  3CC7 P;  1PIX A;  2JDI H;  2WSC J;  3MP7 B;  1T2K C;  1FDO A;  1LP1 B;  1EZV D;  3P32 A;  3H6P A;  1N7S B;  1EXI A;  4Y99 B;  2FYZ A;  1X8Y A;  3TGU G;  4C7N B;  1P84 I;  3ABV C;  1PP9 D;  3L72 J;  2DW3 A;  1JEK A;  1K04 A;  4ASV A;  2Q3E A;  1N73 B;  2NPS C;  1PP9 G;  2R3C A;  2ZT9 B;  3KPE A;  3L75 E;  3TNU A;  2ZXX A;  1SQQ D;  1U7M A;  2QG4 A;  2BEQ D;  1KYO D;  1S9K D;  3U59 A;  1SQQ G;  4GIF A;  2QSI A;  5TIS E;  1SQV G;  1LTT C;  3Q5P A;  2NRG A;  1FJP A;  1LT9 A;  3H1H E;  1NTM J;  4BRY B;  5KLI B;  5CJ0 A;  2HG5 D;  5CCG C;  5AVR B;  3SFE C;  3B8E B;  2KZI A;  4DT0 A;  2G8Y A;  3VMX A;  2XU6 A;  2K3R A;  3SWF A;  4PV1 C;  4N3Y B;  1EC5 A;  4L73 A;  5APQ A;  1L0N K;  4Y28 J;  2VRS A;  3B5N C;  1RH5 B;  1RE4 A;  5APV A;  1SFC B;  3CD6 P;  3BCC G;  2HLO A;  1GL2 A;  3E7K A;  3A0H E;  4WWI A;  3M0D C;  1NTK E;  2IYP A;  3H1L E;  3L4F A;  1LT1 A;  1QEX A;  4IL6 X;  2O01 H;  1RY3 A;  2L5G B;  1PPJ D;  2A06 E;  2QIW A;  3EQ2 A;  2A45 G;  3WUU A;  1X22 A;  1XTG B;  4D6T D;  2IZ0 A;  2YIU C;  3HTK A;  1HJ0 A;  4YXW H;  1S5L E;  3V2Q A;  3MUD A;  2WSF H;  4YPC A;  2Z4E A;  3RGU A;  1JCD A;  1HJB A;  3L75 J;  3V4Q A;  1AA0 A;  1OIP A;  2WZ7 A;  1H89 A;  5L8R J;  4PJ0 E;  1M1J A;  1HF9 A;  3H1H J;  3AEB C;  1SQP D;  1KIL B;  1HGV A;  1N7S D;  2HPC B;  3ZDM A;  1SQP G;  2WSE H;  1BCC D;  2H7H A;  3TGU E;  2B88 A;  2K1A A;  3RL0 g;  4OH8 B;  5DJU B;  1Q90 D;  3IF4 A;  1IFN A;  2ZT9 D;  3P8C E;  1HBW A;  2W8Z A;  2WMM A;  1JM0 A;  2BAS A;  4I7Z C;  2YXR B;  1N2D C;  1NTK J;  1AJY A;  1SQV E;  1PL5 A;  1PZQ A;  2IBZ E;  3H1L J;  3CCV P;  1IO4 A;  1J1D B;  3H1K E;  3Q1M A;  5KAI E;  1YHQ P;  1Q2N A;  1H0T B;  1ZME C;  4U3F D;  3GHG A;  2YKQ A;  1EQ7 A;  4N6J A;  1DX7 A;  1T3J A;  1EDI A;  1ZOY C;  4C7R A;  1FZC B;  1JTH B;  3FXE A;  5CJ4 A;  2G3A A;  2E75 D;  1HUC A;  1USE A;  3PJS K;  1KFM A;  1PV3 A;  4JBZ A;  3D70 A;  1GU5 A;  1LP1 A;  4B86 A;  3KQG A;  4W7Y A;  2QM7 A;  1N7S A;  1UIX A;  2FXO A;  2FKW B;  5AW5 B;  2WSC H;  4IFD K;  3AEE C;  3MTU E;  1N73 A;  1IFI A;  4IL6 H;  1WT6 A;  3M9B A;  3TGU J;  3BVH A;  2J59 M;  3VP8 A;  3CX5 E;  3P8M C;  4LGD E;  1JY3 P;  2KXP B;  2IBZ I;  5B5E E;  1VF5 B;  2WPS A;  2K88 A;  2AEF A;  3V2P A;  2OYI C;  1VQ4 P;  1L0N E;  5H2F E;  5AVS B;  4OGQ B;  4QMA A;  4BRY A;  4GDO A;  2ZYA A;  1P84 H;  1SQV J;  1L0L D;  2B9B A;  2HOD A;  3H1K J;  1FZG A;  4DJG A;  1MKM A;  1KIL D;  1BSN A;  2JO1 A;  4R4M A;  5AW9 B;  2Z5I A;  1LTJ C;  2FYU D;  3CXH E;  4ZKU A;  1S5L X;  4N78 D;  1JY3 O;  5TJH A;  2QRX A;  2FFD B;  1FOS E;  3Q2Y A;  2FYU G;  2JP3 A;  5AVU B;  5KJ7 C;  1YBK A;  3VYI A;  2YKO A;  2OYH A;  5AVT B;  2QA4 P;  3H1J E;  1BGY D;  3PTZ A;  3G4S P;  2QVA A;  3BCC J;  4GOF A;  2D2C C;  2A45 I;  5APX A;  1EXJ A;  5CCH D;  3D6Z A;  2XKM A;  1KN7 A;  2K9J B;  1H88 A;  3UIA A;  3CX5 I;  1HTL C;  3A7O A;  1Y9B A;  3M9H A;  1FJK A;  5K5G B;  2E76 B;  3L70 G;  2Q5U A;  2Q3I A;  4EOT A;  1NVO A;  1N86 A;  3V5B A;  2POH A;  2H89 C;  1GU4 A;  2WPR A;  1NTZ E;  1FU1 A;  2GA1 A;  3CXH I;  4XFJ A;  1KIL A;  5TIS H;  1MFZ A;  1KQS O;  3RL0 C;  3GLM A;  3KZI E;  3U1C A;  1W2B O;  1DIP A;  4W80 A;  3FGA D;  3O8Z A;  3AE5 C;  2KNC B;  5KLV G;  2JEE A;  1BDD A;  3BAS A;  2WIT A;  3L75 D;  3E1R A;  4IOI H;  3HE5 A;  2KSE A;  1VF5 D;  1K9M Q;  1FZF A;  5AW4 B;  3L71 E;  3H1J J;  5CCH A;  1PGO A;  3CLQ A;  2E74 C;  1RF1 A;  3B5N B;  3EWK A;  2IPP A;  3A0H H;  2AXC A;  3HUS B;  1H0T A;  1CSB A;  3CWB G;  3AEG C;  1ZRT D;  1YTZ I;  4L75 A;  2YO3 A;  4IFF A;  1FZC A;  1JTH A;  2H88 C;  2KI7 B;  3B71 A;  5E79 H;  2YMK A;  2FYN B;  1KQF B;  3AE7 C;  1NTK D;  2RMZ A;  4ZMD A;  1S5L H;  1SLQ A;  1RE3 C;  1RHZ B;  4GKG A;  5AW2 B;  1HWT C;  2Z5H A;  4ZNC A;  2YIU B;  2HR3 A;  3BRT B;  3HE4 A;  2QJK C;  3G9R A;  2QJP C;  1NTZ J;  3L73 E;  1ZN5 A;  3JSV C;  3AE9 C;  3E1I A;  1LGH B;  2SPZ A;  2O3J A;  4PJ0 H;  2ITA A;  1SQV K;  2B87 B;  4WY4 C;  4JPZ B;  3TSI A;  3H25 A;  3A0B E;  5AVW B;  1LT9 C;  2E76 D;  2V7Q H;  3VMZ A;  2JKV A;  2CK3 H;  4L74 A;  2R3S A;  2E42 A;  2PRR A;  2ZJS E;  1AV1 A;  4RO0 A;  3G6E P;  1URQ D;  2OTL P;  1KB9 D;  1OVU A;  3L71 J;  1JNM A;  1RE4 C;  2PGD A;  3U1A A;  1EZV G;  3RK3 C;  2W6A A;  1D7M A;  3AE4 C;  2IDB A;  1GL2 C;  1S4X A;  3O6Q A;  2P10 A;  3TK1 A;  4I7Z B;  2W6B A;  3I55 P;  2R5D A;  1IFD A;  1SQB D;  2M5A A;  2M3B A;  3PH0 A;  1RQV A;  1PGJ A;  1SQB G;  1IFM A;  5KAI H;  1FOS F;  3TF5 A;  1VQL P;  2NZ2 A;  2Q6Q A;  3OAK A;  1W5C E;  1KFN A;  1KTM A;  1OW8 A;  3AE1 C;  3GW6 A;  1LTB C;  4H0L B;  2K9J A;  5AW8 B;  3B5N D;  3MUD C;  3CL3 D;  3LW5 J;  3AEC C;  2LXC B;  3L73 J;  4H44 D;  3IFM A;  2M0B A;  1LWU A;  4JQ0 D;  4LLH A;  2GUS A;  2R32 A;  5GTI E;  4KHX A;  1LJ2 A;  5AW0 B;  1G2C B;  1KQG B;  3CCS P;  1DEE G;  1URQ A;  3L70 J;  1M8O B;  4RES B;  3OA7 A;  5AW1 B;  3L74 E;  3CX5 H;  4EDF A;  1MV8 A;  4EYY Q;  4AYC A;  1PPJ G;  1VQO P;  1WRG A;  2KYV A;  5H2F H;  3H1I D;  5C39 A;  1M57 D;  4TLF A;  3SFD C;  3WU2 H;  4RKU J;  2KP8 A;  1OVV A;  5BVZ A;  3H1I G;  4D6T G;  2KNC A;  3CX5 D;  3CCR P;  2LXB A;  3CCE P;  1JMB A;  1L0N D;  3R2P A;  4EI2 A;  3CXH H;  2BCC D;  1N7L A;  1NU1 E;  1SQX E;  2XV5 A;  2QM8 A;  1T8Z A;  2WQY C;  2BCC G;  2Y0D A;  1VQ5 P;  2KK7 A;  3GHG C;  3B5N A;  3V2N A;  2KB7 P;  4K35 A;  1CW5 A;  1G1J A;  2CPB A;  1NAF A;  1T3U A;  3HUS A;  1ZLL A;  1N8R Q;  1EZV E;  1BCC G;  1EDK A;  3TYY A;  3A2A A;  1K05 A;  1AQ5 A;  1GTW A;  1PP9 E;  1NTZ K;  2D2C B;  2YO2 A;  1BE3 D;  2QEX P;  1N7S C;  4Y99 C;  1SQQ E;  3H1J D;  2W83 C;  1NKN A;  1JMM A;  3RK2 B;  1IFJ A;  1LTA C;  3F5H A;  1KYO E;  1S9K E;  2OAR A;  3BAT A;  3L74 J;  1N73 C;  1VDF A;  4UB8 H;  1VQP P;  4H0L D;  1LNQ A;  5APS A;  2KS1 A;  3NTN A;  3A5T A;  1FDI A;  2LKM A;  2OTK E;  4U3F G;  3EFG A;  1SFC D;  2YXQ B;  1CI6 B;  3PHL A;  2YNY A;  1JOC A;  5APT A;  3RBZ A;  2HFE D;  3BCC E;  1GW4 A;  4NPD A;  3KZI H;  1VQN P;  5M1B A;  5APU A;  2WT7 B;  2QJY C;  3RL0 B;  2L91 A;  3KHU A;  3SWY A;  1EZV I;  1QVF O;  1NU1 J;  1SQX J;  3ITK A;  1VPC A;  4K3A A;  1QL1 A;  4C7N A;  2WWW A;  1M1K Q;  3AE2 C;  1PPJ E;  1PGP A;  2E75 C;  4H13 B;  1KC8 Q;  1J2J B;  2OYH C;  3CME P;  1FDM A;  3JCU E;  2O1K A;  3AEF C;  4HJG H;  2J5U A;  4KT0 J;  4D6T E;  4DZO A;  3SSU A;  1PP9 J;  1KYO I;  1JUN A;  3SWK A;  3HD7 B;  2E74 B;  3CC2 P;  3BRV B;  2W90 A;  1ZR2 A;  1PGQ A;  5KAF E;  1SQQ J;  2ZFC A;  3P7K A;  3II6 A;  1PFI A;  3CCM P;  1Y8A A;  3L72 D;  1S1C X;  1S3J A;  1NGM B;  1L4A C;  1Y47 A;  1L0L G;  4OVN F;  1R5L A;  1MUU A;  4TT3 H;  1SQP E;  2I1J A;  5B66 E;  1SFC A;  1P84 D;  3L37 A;  1RF0 A;  1LTI C;  3LW5 H;  2JR8 A;  2IFN A;  1NYH A;  2RN0 A;  1NTM D;  2QJK B;  3WMM 0;  1KIL C;  2QJP B;  1JCC A;  4AQR D;  1L2P A;  1JY2 N;  1BGY G;  2O01 N;  1DEB A;  3A0B H;  1NTM G;  3RK2 D;  1R8E A;  2KIK A;  1YQ3 C;  5CBO A;  4WY4 B;  1Q86 Q;  5KLV K;  1LTG C;  2KLU A;  2E43 A;  1LT9 B;  4DOJ A;  2PAJ A;  3AED C;  2KLV A;  1X9V A;  2P67 A;  3AE8 C;  1J1E C;  4HKZ H;  1NH4 A;  4GOE A;  5CCH C;  4D6T J;  3M91 A;  1Z56 A;  1GK6 A;  1J1D C;  1RF1 C;  4XA4 A;  2J58 A;  1GL2 B;  2NPS B;  1OZH A;  2W27 A;  1FC2 C;  1OFC X;  5APW A;  3HRN A;  2HPC A;  1A02 J;  5AW3 B;  2Y9Z A;  1EDJ A;  4H13 D;  3L35 A;  1SQP J;  3IN6 A;  3Q3D A;  2WSF J;  2FY8 A;  3AE6 C;  3CI9 A;  3L75 G;  2M3E A;  3USS A;  3S1K A;  3HD7 D;  4PV1 B;  3MIW A;  2N1T C;  3H1H D;  4OGQ D;  2YKP A;  5GTI H;  1OW6 A;  2AXT E;  3H1H G;  4CPG A;  2I1K A;  1ZV8 A;  3GF7 A;  1Q7Y Q;  2WTY A;  4IL6 E;  1VF5 C;  5CMZ A;  3VTP C;  1NU1 K;  1SQX K;  2FBW C;  1KIL E;  3M9Q A;  1CI6 A;  2KUB A;  3MD0 A;  2FYU E;  2IX7 C;  2KSJ A;  4N78 E;  1IC2 A;  2JWA A;  2WSS H;  3H1L D;  3IR9 A;  3CCQ P;  2UWJ E;  3MZW B;  5AVZ B;  3KXD A;  1NTK G;  2ZYD A;  2A06 D;  3H1L G;  4WVZ A;  3NMD A;  1BGY E;  3NXS A;  4WY4 D;  2A06 G;  5AVX B;  3Q5R A;  3M0A A;  2P58 A;  1SQQ K;  2N9Y B;  1K73 Q;  4BWN A;  1YI2 P;  3AEA C;  2OYO A;  1BDC A;  3H32 B;  2N9B A;  3I5C A;  4I2L C;  3GF3 A;  2XDJ A;  2OGU A;  1GK4 A;  1T2K D;  3HD7 A;  3L70 E;  2P1J A;  1FE6 A;  3GHG B;  2H8P D;  2ZXE B;  1M90 Q;  3VP9 A;  1SP4 A;  3AE3 C;  3TDK A;  3FX0 A;  1OWA A;  3CMA P;  1ZXG A;  1LWU C;  2NPS D;  1JY2 P;  1DH3 A;  2QE7 H;  1A02 F;  1WMK A;  3TGU D;  3V4W A;  3W68 A;  1KD1 Q;  3L36 A;  1KYO H;  4PD4 E;  2FFD A;  1NO4 A;  1HVV A;  3FWL A;  3VMA A;  1URQ C;  1L0L J;  1GZL A;  3P8C D;  1RE3 A;  5KLV E;  1IFP A;  5CCG D;  1E5W A;  2OQQ A;  1EDL A;  2FYU J;  1GMJ A;  2ZAE B;  1QLE D;  1SQV D;  2IBZ D;  4PV1 D;  1NWQ A;  1JY2 O;  4AUW A;  4WY4 A;  2IBZ G;  3H1K D;  1VQ7 P;  3CC4 P;  2H43 A;  4BXL A;  4ASW A;  1BGY J;  5AVQ B;  3H1K G;  5BU5 A;  2Q7C A;  2W6J H;  5AW7 B;  2C0X A;  3I56 P;  1KOR A;  3CWB E;  2IZ1 A;  1RQU A;  2QJY B;  1H8A A;  2HOD B;  3VN0 A;  1M1J C;  2P2U A;  1ZRT E;  4GOD A;  2IYO A;  1JY3 N;  2A45 H;  3QWO C;  3BCC D;  4W7Z A;  3R4Y A;  1SQP K;  2K37 A;  3JCU H;  3T97 B;  1FZE A;  3HUS C;  4H44 C;  2E75 B;  2CPS A;  1XTC C;  2NPS A;  5GTH E;  5B5E H;  2OYH B;  4EIJ A;  1NJI Q;  4PD4 I;  3OW2 O;  2GUV A;  4IFM A;  1IK9 A;  1VL2 A;  1JB0 J;  4A7P A;  1IZN B;  1IJD B;  5KAF H;  2FYN C;  3CCU P;  2OYI B;  2IFM A;  5KKZ C;  2C9L Y;  1GDT A;  1YJW P;  5CCG A;  5E79 E;  5CHX A;  1YQ4 C;  3FWN A;  1KMI Z;  2Q9I A;  2M8R A;  5KLV J;  3CCJ P;  3A3Y B;  2KZJ A;  3EFF K;  1M56 D;  3RK3 E;  5B66 H;  1DD3 A;  1L4A B;  2JJL A;  4OWF A;  1OMI A;  1MFT A;  1L0N G;  2R5B A;  1M7L A;  1LTJ B;  3Q5S A;  1NHL A;  3S9O A;  3C1L A;  1AQT A;  1KB9 E;  3WUV A;  1OX3 A;  3WUT A;  3LID A;  4UB6 E;  3G71 P;  3M0D A;  3CXH D;  1FS0 E;  2C0W A;  2RH0 A;  5AVV B;  3LIE A;  1G1I A;  2WPV B;  4HYT B;  2AEJ A;  3CWB J;  3G3Z A;  2Y9Y A;  5AVY B;  1USD A;  1X79 B;  1SQB E;  2Y0E A;  5BU8 B;  1BE3 G;  2GM4 A;  3D6Y A;  3C9I A;  4HB1 A;  3H1J G;  4DCK A;  4I1L A;  3HE5 B;  2ZT9 C;  2O1J A;  5KTB A;  1J1E B;  4GT1 A;  1Q82 Q;  1X0T A;  2B87 A;  1RF1 B;  2E5T A;  1S2E A;  3QH9 A;  3VMY A;  3H32 A;  3OJA B;  1QX8 A;  3FXD A;  5KLI C;  4NPE A;  2OTJ P;  1YTZ T;  4O9B A;  4H0L C;  4KJM A;  4XE5 B;  1OVR A;  1OXZ A;  1YYC A;  1MZ9 A;  1YJN P;  1R5S A;  1L0L K;  1KB9 I;  5DJT B;  4RJT A;  3RBX A;  1NTZ D;  1SFC C;  1FBM A;  2FYU K;  3CPW O;  1RF0 C;  1NTZ G;  2XND H;  3PP5 A;  3C8V A;  3W67 A;  2AXT H;  5CBN A;  3HE4 B;  1VQ9 P;  2N1T B;  3H1I E;  1NOH A;  2E5Y A;  1NTM K;  2V7Q J;  3MHV A;  1GD2 E;  3VOP A;  3KDP B;  1SQB J;  3L71 D;  1L4A D;  3CCL P;  1HH0 A;  3L71 G;  2BCC E;  1NKZ B; 
#chains in the Genus database with same CATH homology
 4PD4 I;  1L0L J;  1P84 I;  3TGU J;  1SQP J;  3L72 J;  1NTK J;  5KLV J;  1SQQ J;  3CXH I;  1NTZ J;  1SQV J;  1SQB J;  1BGY J;  3H1L J;  3L73 J;  3L70 J;  2IBZ I;  1NTM J;  1KB9 I;  1EZV I;  3CX5 I;  1BE3 J;  1NU1 J;  2FYU J;  3H1H J;  1SQX J;  1BCC J;  3L74 J;  4D6T J;  3H1K J;  1PP9 J;  1KYO I;  4U3F J;  3H1I J;  3L75 J;  1L0N J;  3H1J J;  3CWB J;  3L71 J;  2BCC J;  3BCC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...