2KSJA

Structure and dynamics of the membrane-bound form of pf1 coat protein: implications for structural rearrangement during virus assembly
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of the membrane-bound form of Pf1 coat protein: implications of structural rearrangement for virus assembly.
pubmed doi rcsb
source organism Pseudomonas phage pf1
molecule tags Viral protein
molecule keywords Capsid protein G8P
total genus 11
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2010-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ksjA00
2IFNA 4IFMA 1IFNA 2KSJA 1PFIA 1QL1A 3IFMA 2KLVA 2XKMA 1QL2A 1IFMA 1ZN5A 2IFMA
chains in the Genus database with same CATH superfamily
3BCCG 2NPSC 1EDLA 2KSJA 2KK7A 3QH9A 2Q1KA 4WY4A 2M3BA 3L74G 3RK3B 2FY8A 1SQBG 5M1BA 1AV1A 1DD4A 1RE3A 4EYYQ 1PPJD 3L73G 2WT7B 3V2QA 1L0LE 2P1JA 2WSFJ 5BU8B 3HE5B 3MTUE 5APVA 2AEMA 3H1LJ 2KZIA 5CCGD 1LTGC 4WWIA 3L72G 3GLMA 4GT1A 4HH2A 4DJGA 3B8EB 1U57A 2KB7P 3EWKA 4OWFA 2C9NY 3Q5SA 2OYHC 1JTHA 1NU1J 3CWBE 3R2PA 1IZNB 1RF1A 3M06A 1DX7A 3HE4B 1FAVA 2P67A 2XU6A 1J1EB 3H1HD 1KILE 3CWBD 4L74A 4L75A 5GTHH 2WMMA 5KAFE 3MGNA 5TJHA 3TYYA 1OW7A 1ZR4A 2B88A 1YJWP 3H32A 2KLUA 3RL0B 1L2PA 3HD7A 2M0BA 3CXHH 1Y9BA 1JY2N 2QJYC 2CPSA 3A2AA 2RKLA 1KILC 3M0DC 4O9BA 1SQQG 4PD4H 2W27A 3G71P 1T2KC 5KKZB 5GTIH 2FBWC 1S72P 1KC8Q 2FFDB 2M8RA 1L4AB 1E5WA 1N86A 1TU3F 1GW3A 1LTAC 1JY3N 2C0XA 2XNXA 1IFPA 5C39A 2ZT9C 4AQRD 1Q86Q 1KORA 2OTKE 5EFWB 4D6TJ 1BCCD 1MUUA 1NTMG 1WT6A 2KP8A 3EFFK 4PD4D 2E5YA 4HB1A 1YTZT 4Y99B 4ZKPA 4IFFA 5AW1B 2E76B 3B71A 2WPRA 1NH4A 2QJPB 4GODA 3L70J 5AW8B 2HODB 4XFJA 3V2RA 1DEEG 2O01J 4IL6H 1QL2A 1SQQE 2O3JA 3EFGA 1PGPA 1CZQA 2N1TC 2ZYDA 2E5TA 3M9BA 2GA1A 4NPEA 1JCDA 2FYNB 2K88A 3HD7D 4IFMA 1RF0A 2WQYC 4N78E 5AVUB 1LP1B 4EOTA 1NGMB 4RJTA 1OFCX 3FWNA 3N7NA 1K8AQ 3IF4A 2ZAEB 3CCEP 1KTMA 1S5LE 2H7HA 1AA0A 1MKMA 3Q3DA 5E79E 2Y9YA 4OGQC 1YTZI 3A3YB 1W2BO 1K73Q 1GD2E 3CC7P 3JCUH 1IC2A 1YHQP 2A06G 4K35A 1VQNP 1IFIA 1IFMA 3C9IA 4JYBA 5KTBA 2Q5UA 3TF5A 3IN6A 2ZXXA 1S5LH 1NTKG 1BE3G 2K9JB 1KYOH 2WPSA 3AE6C 1FZAA 4H44C 1EZVD 2KI7B 4GDOA 2BEQD 2RN0A 4UB6H 1LJ2A 1SQBK 4BRYA 2OYIB 2IZ0A 3L75G 2UWJE 3VOPA 1QL1A 2Y0CA 2D2CC 1NAFA 2HFED 1U7MA 2W6JH 1KILD 3PTZA 1QX8A 2MKVA 3AE8C 3B5ND 3CMEP 1EZVI 3P8MC 1S5LX 3RL0D 1RF1C 1LT9A 5AW4B 1OXZA 2FXOA 4UB8H 2G3AA 1AQTA 2L5GB 5KLIB 4RKUJ 3O6QA 1M90Q 2I8DA 1ZLLA 1X0TA 2KNCA 2QJKB 4LGDE 1HWTC 4KHXA 4ZMDA 4BRYB 2OYIA 3A0BE 2XKMA 3SSUA 2RMZA 2E74B 2YNYA 5AVXB 2IDBA 3MZWB 1T8ZA 2BCCJ 2AXTE 5AVZB 1PV3A 2JDIH 2E75B 2O1JA 5KLVE 3V2NA 3NXSA 2C9LY 4IL6X 1VQ7P 3HUSA 3MP7B 1SQPE 4WY4C 5AW0B 1PP9G 2IYPA 2ZT9B 1NU1E 1EDIA 3CWBJ 4PV1B 1SFCB 1VQKP 2KYVA 2M3EA 4D6TD 1IK9A 1N7SC 3H1KE 4B86A 3CCSP 2Z5IA 1GU4A 1SVFA 3ABVC 1FDMA 5BVZA 1NTZE 1URQB 1MFTA 2KOGA 2LR2A 3B5NA 3H32B 3KYQA 2QA4P 4PJ0H 3EQ2A 4I6MC 3AE4C 1RHZB 3OAKA 1NTMD 2P58A 1K9MQ 4H0LD 1KQSO 2QM7A 1P84D 1LT9B 4D6TG 3PP5A 4YPCA 3M9HA 3GW6A 3AEEC 3WMM0 4ASWA 2O01N 3PHLA 3L75D 1JY3O 1BCCE 4PD4E 3TGUG 1BSHA 1FOSF 4LLHA 3RK2C 1GU5A 1D7MA 5APXA 2B87A 3KPEA 5AW3B 3Q2YA 5AW6B 1EDKA 1VQ8P 1SFCC 2N9YB 4R4LA 3S9OA 1KQLA 1R5LA 4YXWH 1N7SB 2R32A 5CHXA 1NHLA 3WUVA 3V4WA 1VQ6P 1ZMEC 3CL3D 2KNCB 1VDFA 2YXQB 2K1AA 4U3FE 3SWFA 3U1CA 1FZFA 2AEJA 3H1KJ 3PJSK 1NVOA 1VQPP 1IFJA 2A45I 3FXDA 5TISH 1ZXGA 1IJDB 2QRXA 2OARA 4CPGA 1BSNA 1MV8A 1RE3C 3NTNA 5KAIE 2Q9IA 1UIXA 1OW8A 1M57D 2GUSA 2PRRA 2NRGA 2YKOA 1OVVA 3A0HE 3L75E 3F5HA 2IBZG 1USDA 2IFNA 4C7NB 1X9VA 4HYTB 3TGUJ 3VMAA 4EIJA 1RF1B 3H1JE 1PPJG 1PP9J 3SFEC 2OTJP 1KV4A 3M9QA 3TNUB 4DOJA 3BVHA 3LIEA 2NPSD 2ZJSE 4H13B 4JF7A 3L74D 2YXRB 3H25A 3HRNA 3CD6P 3H1JG 2KLVA 3AE1C 1L4AD 5AVQB 5AVSB 2QVAA 3U1AA 1VQ4P 2QG4A 4OVNF 2NPSB 1KYOI 4H13D 1IFDA 2WPQA 2E74C 2ZVNB 3KHUA 1LWUB 2XV5A 4ZNCA 5BU5A 1EXJA 2B87B 2V4HA 3V6IA 1T2KD 3GMAA 3VP9A 4C7RA 3FWLA 1SQQK 2E75C 1H88A 1SQBE 2K9YA 4NPDA 5H2FH 5KLVK 1HTLC 2H43A 4N6JA 4IOIH 3WU2E 3V2PA 1NTKJ 2V7QH 4UB8E 4PV1C 1URQD 1N2DC 4D6TE 1KB9D 3BCCE 3GF3A 1OVUA 1XTCC 3CX5H 1KYOD 3FX0A 3L70D 4L73A 1EC5A 4WVZA 1PGJA 4U3FG 2M5AA 2OGUA 1KQFB 2OYOA 1GDTA 1LTJA 2I1JA 1SQPD 4Z1MH 3CCMP 3WUUA 2FYUD 1JY3P 3H1HG 1SQPJ 5L8RJ 3H1IG 4XE5B 1FZCB 1SQBJ 3CLQA 1LTSC 2WSEH 3UIAA 4DT0A 1QVFO 2PP6A 1IO4A 1OIPA 1BCCG 2XNDH 3A7OA 1L4AA 2Q3IA 2KSEA 4RESB 2HPCB 2FFDA 2IZ1A 2BEZF 3VMXA 1Y8AA 5AW9B 3TNUA 3L73J 1Q7YQ 3CCJP 4NPFX 1MFZA 2FYUG 2J58A 1JUNA 2IBZI 5CMZA 1GW4A 2E42A 3HTKB 3GHGC 5APWA 1N73C 2OQQA 4U3FD 1N7LA 1W2EA 1LP1A 1FDOA 3AE9C 2BASA 2JEEA 1VF5B 1AJYA 1K04A 3CCVP 4AUWA 3M0DA 1M1KQ 1SFCA 3AE5C 1VQLP 1QLED 5TISE 1FE6A 1JM0A 1RE4A 4YTPC 3CWBG 4Y99C 3TGUD 1VQOP 3P7KA 2Q3EA 2PAJA 3RK3C 3IFMA 3LW5H 3Q5PA 1Q2NA 1RY3A 5KLVG 2WSCH 1JY2P 1ZOYC 3H1LD 3BATA 2W8ZA 4PD4I 1PZQA 3RL0g 1SQVE 3RBXA 2Z4EA 2LKMA 1BDDA 1JB0J 4R4MA 1A02F 4W7YA 1ZV8A 1USEA 3ITKA 1SQVG 5B5EH 3OW2O 1VQ5P 3L73E 2CK3H 2FYNC 1J2JB 1GMJA 1S1CX 3H1ID 1N73B 2YO2A 2VRSA 2YKQA 1PGOA 2WVRA 5K5GB 1G2CA 1VF5D 1W5CE 3CI9A 1VF5C 4N78D 4AYCA 3D6ZA 1ZRTD 2IBZD 1PP9D 4EDFA 2A06E 1VQMP 5DJUB 2KUBA 4W7ZA 1LWUC 3CPWO 3VMYA 1JMBA 1SS1A 2Z5HA 1SQPK 3H1LG 1S9KD 1FU1A 5KLVJ 1SFCD 3VMZA 1LWUA 5CCHC 2K3RA 1HH0A 2PFXA 4H44B 1RE4C 4L76A 3I55P 2QE7H 2R5DA 1KILB 1N73A 1SQXG 3L71E 5AW7B 3V5BA 2ZFCA 5KKZC 1NJIQ 1BE3E 3ZDMA 1NTMJ 1PGQA 1FJKA 3H1JD 3AEBC 2NZ2A 2I1KA 3T97B 3I56P 4H0LC 5APTA 2YMKA 1RH5B 3GG2A 4XA4A 1L0NJ 1M1JB 3BRTB 4LC1A 4C7NA 1YIJP 1GL2C 2JWDA 1M8OB 2OYIC 1OX3A 3S1KA 1OMIA 4GKGA 3M0AA 3D70A 1KB9H 3AE3C 3CC4P 3CCLP 1CW5A 1G1JA 2QIWA 4U3FJ 5AVVB 2GM4A 1BE3J 2M5AB 3L71J 1EZVG 4WY4D 3G4SP 5KJ7A 1ZW0A 3L4FA 4C46A 1BGYE 1SQVK 1EZVE 2HODA 2B9BA 2IFMA 2JR8A 4EI2A 5APYA 3V4QA 1VQ9P 4ZKUA 1P84E 1QVGO 2P10A 1FS0E 3MUDC 3P32A 1H89A 4IFDK 2J5UA 1NTME 4OGQB 1SQBD 2KZJA 3JSVC 3L70G 1NTZK 1PL5A 5GTHE 3RK3E 1M1JA 4PJ0E 2E76D 2J59M 1KYOE 1PP9E 3KXDA 3L70E 1J1EC 1JTHB 3CX5E 1KB9E 3BCCD 1L0LJ 3L74J 3LW5J 2Q7CA 2HPCA 1FOSE 1S4XA 1PIXA 3FXEA 1KMIZ 1T3UA 3L75J 3NFQA 3SWYA 3VP8A 5AVYB 1CSBA 1KILA 2IPPA 2D2CD 5E79H 1CI6A 1T6AA 3A0HH 3HD7B 1L0LG 1JCCA 3L36A 1ZRTE 2IBZE 4JBZA 5APQA 1ZP0C 3TDKA 2W6BA 3BRVB 1JO5A 1SQQJ 5KJ7D 2HG5D 1GK4A 4A7PA 2WSSH 4TLFA 4DZOA 2FFDC 4ASVA 2O01H 3L74E 1VL2A 1BGYD 1NTMK 5AVRB 3PH0A 3HUSB 3L35A 1N7SD 1WRGA 2QJKC 3CCUP 5CBOA 2E76C 3L72E 1KFNA 3D6YA 3C1LA 2QJPC 2A45H 2MJZA 3QWOC 2JKVA 4N3YB 2WPVB 3AEFC 1IK7A 2ZVOB 1NTKD 3TSIA 3CXHI 5H2FE 1H0TB 2BCCG 2SPZA 1FZBA 1NOHA 1RQUA 1YQ3C 2W90A 1HUCA 2YMYA 4WY4B 1NAYA 1SQXK 2FXPA 1U7JA 2R3SA 3C8VA 1ZN5A 3SWKA 2KIKA 1M1JC 2OYHB 2XDJA 4Y28J 1GL2B 1LT1A 2O1KA 2ZXEB 1R5SA 1BCCJ 3HUSC 4M3LA 4BXLA 1P84I 2WTYA 1URQC 1VPCA 2IX7C 3TK1A 3W67A 1OVRA 2FKWB 2L91A 3RL0C 1HBWA 1GL2D 2BCCE 3H1KG 3II6A 2AEFA 1L0NE 3IR9A 3JCUE 2QJYB 1N7SA 1NTZD 2POHA 4U7JA 5AVTB 1HVVA 4I7ZB 1L0LK 5KJ7C 2K9JA 1FDIA 1LT9C 1NU1G 2WITA 3HE4A 2QEXP 1DH3A 2E74D 3M91A 3AECC 1FBMA 1K05A 1S2EA 2HR3A 5AVWB 1YJ9P 3KQGA 1L4AC 1S3JA 1LTTC 3KZIE 3RK2B 4H44D 1KFMA 4KJMA 3RBZA 1FZCA 2A06D 1QGKB 3MD0A 3MHVA 1MZ9A 2IYOA 5APSA 1YBKA 1GZLA 3B4SA 3H1KD 3USSA 3H6PA 1A02J 2R44A 3FGAD 5KLIC 3VTPC 1H0TA 1RF0C 3KZIH 1SQQD 2QM8A 3WUTA 3O6QB 1H8AA 2H88C 2Q6QA 3H1JJ 1GTWA 1AVYA 2H89C 1KD1Q 4DCKA 3P8CE 3HTKA 3E1RA 2YKPA 4WB4A 4I7ZC 4BWNA 3HD7C 1NKNA 2YIUC 4JQ0D 1GL2A 1RQVA 2A45G 5CBNA 3E1IA 3A5TA 1NO4A 1WMKA 2BCCD 1L0NK 2LXBA 3D71A 1J1DB 4OH8B 5CJ4A 1XTGB 1YYCA 2LXCB 2NPSA 2HLOA 4I1LA 3SFDC 3CXHE 2RH0A 3CMAP 1FZGA 2R5BA 2R3CA 2CPBA 3KDPB 1E79H 1LTIC 1SLQA 1NTKE 2W83C 3H1HE 1AVOA 4GOEA 1HJBA 3B5NC 5AW2B 3GHGA 1NYHA 1NU1K 1BGYG 3W68A 1AFOA 1KQGB 2OTLP 2PGDA 5KAFH 3MIWA 1OZHA 1R8EA 1BE3D 3AE2C 2P7JA 1G2CB 1LNQA 1T3JA 2D2CB 2W6AA 2Y0DA 1L0LD 3OA7A 1EDJA 1J1DC 2V7QJ 3H1HJ 1NTZJ 2AXCA 1Q90D 4I2LC 1Y47A 2FXMA 1Q82Q 4YXDC 1S9KE 1FJPA 2KS1B 3S4RA 1OWAA 3T97A 5KAIH 1YITP 4OGQD 1X8YA 3G9RA 3L71G 2P2UA 2FYZA 1EXIA 2B89A 2WSFH 3PRJA 1PPJE 1BGYJ 1Q81Q 3CX5D 3AE7C 5CJ0A 3P8CD 1NTKK 2WSCJ 5B66E 4MN4C 2ZYGA 3L73D 4TT3H 3K5BA 3RGUA 3VN0A 3AEAC 1Z56A 1M7LA 1LTBC 1KZUB 1FC2C 1YJNP 1SQVD 4RO0A 1IFNA 2ZYAA 3NMDA 1PFIA 1UIIA 3E7KA 2OYHA 3GHGB 4GOFA 3R4YA 1JNMA 1NU1D 3RK3D 1L0ND 1DEBA 1NTZG 3U59A 4KT0J 1G1IA 3BCCJ 2G8YA 3WU2H 1JEKA 4H13C 2QSIA 2ZT9D 2N1TA 3AEDC 5B66H 1EQ7A 1P84H 4UB6E 3CCQP 3CCRP 1N8RQ 1JY2O 1SP4A 1YQ4C 2K37A 2YO3A 3L37A 5GTIE 1KB9I 3LIDA 2XZRA 1HJ0A 2Y9ZA 1BDCA 2YIUB 2Y0EA 3TGUE 1SQXJ 2WWWA 3PLNA 3GF7A 3OJAB 2WSEJ 3H1IJ 5DJTB 3G6EP 2KS1A 3CC2P 4GIFA 5CCHD 3HE5A 1LGHB 1HGZA 3F89A 3AEGC 3N4XA 3JC22 4W80A 1L0NG 1YI2P 2WT7A 1DIPA 3L72J 1LTJC 2AXTH 2JO1A 1URQA 3B5NB 3VYIA 1ZR2A 3L72D 1NWQA 3A0BH 1CI6B 1X79B 1HGVA 4IL6E 3CXHD 4JPZB 4JYCA 4WBAA 2FYUE 5AW5B 1FZCC 1M56D 1X22A 3I5CA 5CCGC 2N1TD 2ITAA 3Q5RA 1SQVJ 1DD3A 4K3AA 2GUVA 1SQPG 1QEXA 1FZEA 3MUDA 5B5EE 3O8ZA 5CCGA 4PV1D 5APUA 2H8PD 2HYNA 2JP3A 2FYUK 1OW6A 3RK2D 3BASA 1SQXE 3L71D 2KXPB 2N1TB 2E75D 3H1IE 3Q1MA 1JOCA 2JJLA 1KN7A 1NKZB 1HF9A 1GK6A 2JWAA 1SQXD 2C0WA 2DW3A 2N9BA 2FYUJ 3CX5I 3G3ZA 3IAOA 1LTJB 2WZ7A 4H0LB 4HJGH 5KLVD 3H1LE 5CCHA 1AQ5A 1JMMA 2E43A 4QMAA 4HKZH
chains in the Genus database with same CATH topology
2NPSC 2KSJA 4WY4A 2M3BA 3RK3B 2WT7B 1RE3A 3V2QA 2P1JA 3HE5B 3MTUE 5APVA 5CCGD 1LTGC 4GT1A 4HH2A 3B8EB 2KB7P 2C9NY 2OYHC 1JTHA 3R2PA 1RF1A 3M06A 1DX7A 3HE4B 1FAVA 2P67A 2XU6A 1J1EB 3TYYA 1ZR4A 3MGNA 3H32A 3RL0B 3HD7A 1JY2N 2CPSA 3A2AA 3M0DC 1KILC 4O9BA 2W27A 1T2KC 2FFDB 2M8RA 1L4AB 1E5WA 1N86A 2XNXA 1GW3A 1LTAC 1JY3N 2C0XA 4AQRD 1MUUA 1WT6A 2KP8A 5AVYB 4Y99B 4ZKPA 1YTZT 4IFFA 5AW1B 2WPRA 1NH4A 5AW8B 3V2RA 2HODB 1QL2A 3EFGA 2OYIC 3M9BA 1CZQA 2N1TC 1JCDA 4IFMA 3HD7D 4N78E 1RF0A 5AVUB 4EOTA 3N7NA 2H7HA 1GD2E 1YTZI 3A3YB 1IC2A 1IFIA 1IFMA 3C9IA 4JYBA 5KTBA 2Q5UA 2WPSA 1FZAA 1SQBK 2OYIB 3VOPA 1QL1A 1NAFA 2HFED 1KILD 3B5ND 3RL0D 3P8MC 1RF1C 1LT9A 5AW4B 1OXZA 2L5GB 1ZLLA 4LGDE 1HWTC 4KHXA 2OYIA 2XKMA 2YNYA 5AVXB 5AVZB 1T8ZA 2O1JA 2C9LY 3V2NA 3NXSA 3HUSA 4WY4C 5AW0B 1SFCB 2KYVA 1IK9A 1N7SC 2Z5IA 1GU4A 1SVFA 1FDMA 5BVZA 1URQB 3B5NA 2KOGA 3H32B 3KYQA 3EQ2A 4I6MC 3OAKA 2QM7A 1LT9B 3PP5A 3M9HA 3WMM0 1JY3O 1FOSF 4LLHA 3RK2C 1GU5A 5APXA 5AW3B 3KPEA 5AW6B 1SFCC 1KQLA 1N7SB 2R32A 5CHXA 1NHLA 3V4WA 3CL3D 1FZFA 1VDFA 3U1CA 3SWFA 1IFJA 2A45I 1IJDB 2OARA 2Q9IA 1MV8A 1RE3C 3NTNA 2GUSA 2YKOA 2IFNA 4C7NB 1X9VA 4HYTB 4EIJA 1RF1B 3M9QA 3TNUB 4DOJA 3BVHA 3LIEA 2NPSD 4JF7A 3HRNA 2KLVA 3U1AA 1L4AD 5AVQB 5AVSB 2NPSB 1IFDA 2WPQA 1LWUB 2XV5A 5BU5A 1T2KD 3VP9A 4C7RA 1H88A 1SQQK 5KLVK 2H43A 1HTLC 4N6JA 3V2PA 1URQD 1N2DC 1XTCC 1GDTA 1LTJA 2I1JA 1JY3P 4XE5B 1FZCB 3CLQA 1LTSC 2WSEH 3UIAA 2PP6A 1IO4A 3A7OA 1L4AA 2Q3IA 4RESB 2HPCB 2FFDA 3VMXA 5AW9B 3TNUA 1MFZA 1JUNA 2J58A 5CMZA 1GW4A 2E42A 3HTKB 3GHGC 5APWA 1N73C 1N7LA 1W2EA 2BASA 2JEEA 4AUWA 3M0DA 1SFCA 1RE4A 4Y99C 3P7KA 2PAJA 3RK3C 3IFMA 3LW5H 1RY3A 2WSCH 1JY2P 2Z4EA 3BATA 2LKMA 1A02F 4W7YA 1ZV8A 1J2JB 1N73B 2YO2A 2VRSA 2YKQA 1G2CA 3CI9A 4N78D 4AYCA 4W7ZA 1LWUC 3VMYA 2Z5HA 1SQPK 1S9KD 1FU1A 1SFCD 3VMZA 1LWUA 5CCHC 1HH0A 1RE4C 2R5DA 1KILB 1N73A 5AW7B 3V5BA 2ZFCA 1FJKA 2I1KA 5APTA 4XA4A 1M1JB 3BRTB 4LC1A 4C7NA 1GL2C 4GKGA 3M0AA 1CW5A 1G1JA 5AVVB 2GM4A 4WY4D 5KJ7A 4C46A 3L4FA 1SQVK 2HODA 2IFMA 5APYA 3V4QA 4ZKUA 4IFDK 3P32A 1H89A 1NTZK 1M1JA 2J59M 3SWYA 1J1EC 1JTHB 1FOSE 2Q7CA 2HPCA 1T3UA 3NFQA 3VP8A 1CSBA 1KILA 2IPPA 1CI6A 3L36A 3HD7B 5APQA 1JCCA 2W6BA 3BRVB 1JO5A 5KJ7D 2HG5D 1GK4A 2FFDC 4DZOA 2O01H 1NTMK 5AVRB 3HUSB 3L35A 1N7SD 1WRGA 1KFNA 2A45H 2MJZA 4N3YB 3TSIA 1FZBA 1NOHA 1HUCA 2YMYA 4WY4B 1SQXK 4B86A 1ZN5A 1M1JC 2OYHB 2XDJA 1GL2B 2O1KA 2ZXEB 3HUSC 4M3LA 2WTYA 1URQC 1VPCA 2IX7C 3TK1A 2FKWB 3RL0C 1HBWA 1GL2D 3II6A 3IR9A 5AVTB 1N7SA 2POHA 1HVVA 5KJ7C 1L0LK 1LT9C 3HE4A 1DH3A 2WITA 3M91A 1FBMA 5AVWB 3KQGA 1L4AC 3RK2B 1LTTC 1KFMA 1FZCA 3MD0A 1MZ9A 5APSA 1GZLA 3H6PA 1A02J 3VTPC 1RF0C 2QM8A 1H8AA 1GTWA 3P8CE 3HTKA 2YKPA 4WB4A 3HD7C 1NKNA 1GL2A 2A45G 3E1IA 3A5TA 1NO4A 1L0NK 1J1DB 4OH8B 5CJ4A 1XTGB 1YYCA 2NPSA 2HLOA 4I1LA 1FZGA 2R5BA 2R3CA 2CPBA 3KDPB 1LTIC 1SLQA 1HJBA 3B5NC 5AW2B 3GHGA 1NU1K 1AFOA 3MIWA 2P7JA 1G2CB 1T3JA 2W6AA 3OA7A 1J1DC 4I2LC 2FXMA 1S9KE 1FJPA 3T97A 1OWAA 1X8YA 2P2UA 2FYZA 2WSFH 5CJ0A 3P8CD 1NTKK 3VN0A 1Z56A 1M7LA 1LTBC 1KZUB 1IFNA 3NMDA 1PFIA 2OYHA 3GHGB 1JNMA 3RK3D 1DEBA 3U59A 1G1IA 2N1TA 1EQ7A 1JY2O 1SP4A 2YO3A 3L37A 3LIDA 2XZRA 2WWWA 3OJAB 4GIFA 5CCHD 3HE5A 1LGHB 1HGZA 3N4XA 4W80A 2WT7A 1LTJC 3VYIA 1URQA 3B5NB 1ZR2A 1NWQA 1CI6B 1X79B 1HGVA 4JYCA 4WBAA 5AW5B 1FZCC 3I5CA 5CCGC 2N1TD 2GUVA 3MUDA 1FZEA 3O8ZA 5CCGA 5APUA 2H8PD 2HYNA 2FYUK 3RK2D 3BASA 2N1TB 1JOCA 2JJLA 1NKZB 1GK6A 5BU8B 2C0WA 2N9BA 3G3ZA 5CCHA 1LTJB 2WZ7A 1AQ5A 1JMMA 2E43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IFN A;  4IFM A;  1IFN A;  2KSJ A;  1PFI A;  1QL1 A;  3IFM A;  2KLV A;  2XKM A;  1QL2 A;  1IFM A;  1ZN5 A;  2IFM A; 
#chains in the Genus database with same CATH topology
 3BCC G;  2NPS C;  1EDL A;  2KSJ A;  2KK7 A;  3QH9 A;  2Q1K A;  4WY4 A;  2M3B A;  3L74 G;  3RK3 B;  2FY8 A;  1SQB G;  5M1B A;  1AV1 A;  1DD4 A;  1RE3 A;  4EYY Q;  1PPJ D;  3L73 G;  2WT7 B;  3V2Q A;  1L0L E;  2P1J A;  2WSF J;  5BU8 B;  3HE5 B;  3MTU E;  5APV A;  2AEM A;  3H1L J;  2KZI A;  5CCG D;  1LTG C;  4WWI A;  3L72 G;  3GLM A;  4GT1 A;  4HH2 A;  4DJG A;  3B8E B;  1U57 A;  2KB7 P;  3EWK A;  4OWF A;  2C9N Y;  3Q5S A;  2OYH C;  1JTH A;  1NU1 J;  3CWB E;  3R2P A;  1IZN B;  1RF1 A;  3M06 A;  1DX7 A;  3HE4 B;  1FAV A;  2P67 A;  2XU6 A;  1J1E B;  3H1H D;  1KIL E;  3CWB D;  4L74 A;  4L75 A;  5GTH H;  2WMM A;  5KAF E;  3MGN A;  5TJH A;  3TYY A;  1OW7 A;  1ZR4 A;  2B88 A;  1YJW P;  3H32 A;  2KLU A;  3RL0 B;  1L2P A;  3HD7 A;  2M0B A;  3CXH H;  1Y9B A;  1JY2 N;  2QJY C;  2CPS A;  3A2A A;  2RKL A;  1KIL C;  3M0D C;  4O9B A;  1SQQ G;  4PD4 H;  2W27 A;  3G71 P;  1T2K C;  5KKZ B;  5GTI H;  2FBW C;  1S72 P;  1KC8 Q;  2FFD B;  2M8R A;  1L4A B;  1E5W A;  1N86 A;  1TU3 F;  1GW3 A;  1LTA C;  1JY3 N;  2C0X A;  2XNX A;  1IFP A;  5C39 A;  2ZT9 C;  4AQR D;  1Q86 Q;  1KOR A;  2OTK E;  5EFW B;  4D6T J;  1BCC D;  1MUU A;  1NTM G;  1WT6 A;  2KP8 A;  3EFF K;  4PD4 D;  2E5Y A;  4HB1 A;  1YTZ T;  4Y99 B;  4ZKP A;  4IFF A;  5AW1 B;  2E76 B;  3B71 A;  2WPR A;  1NH4 A;  2QJP B;  4GOD A;  3L70 J;  5AW8 B;  2HOD B;  4XFJ A;  3V2R A;  1DEE G;  2O01 J;  4IL6 H;  1QL2 A;  1SQQ E;  2O3J A;  3EFG A;  1PGP A;  1CZQ A;  2N1T C;  2ZYD A;  2E5T A;  3M9B A;  2GA1 A;  4NPE A;  1JCD A;  2FYN B;  2K88 A;  3HD7 D;  4IFM A;  1RF0 A;  2WQY C;  4N78 E;  5AVU B;  1LP1 B;  4EOT A;  1NGM B;  4RJT A;  1OFC X;  3FWN A;  3N7N A;  1K8A Q;  3IF4 A;  2ZAE B;  3CCE P;  1KTM A;  1S5L E;  2H7H A;  1AA0 A;  1MKM A;  3Q3D A;  5E79 E;  2Y9Y A;  4OGQ C;  1YTZ I;  3A3Y B;  1W2B O;  1K73 Q;  1GD2 E;  3CC7 P;  3JCU H;  1IC2 A;  1YHQ P;  2A06 G;  4K35 A;  1VQN P;  1IFI A;  1IFM A;  3C9I A;  4JYB A;  5KTB A;  2Q5U A;  3TF5 A;  3IN6 A;  2ZXX A;  1S5L H;  1NTK G;  1BE3 G;  2K9J B;  1KYO H;  2WPS A;  3AE6 C;  1FZA A;  4H44 C;  1EZV D;  2KI7 B;  4GDO A;  2BEQ D;  2RN0 A;  4UB6 H;  1LJ2 A;  1SQB K;  4BRY A;  2OYI B;  2IZ0 A;  3L75 G;  2UWJ E;  3VOP A;  1QL1 A;  2Y0C A;  2D2C C;  1NAF A;  2HFE D;  1U7M A;  2W6J H;  1KIL D;  3PTZ A;  1QX8 A;  2MKV A;  3AE8 C;  3B5N D;  3CME P;  1EZV I;  3P8M C;  1S5L X;  3RL0 D;  1RF1 C;  1LT9 A;  5AW4 B;  1OXZ A;  2FXO A;  4UB8 H;  2G3A A;  1AQT A;  2L5G B;  5KLI B;  4RKU J;  3O6Q A;  1M90 Q;  2I8D A;  1ZLL A;  1X0T A;  2KNC A;  2QJK B;  4LGD E;  1HWT C;  4KHX A;  4ZMD A;  4BRY B;  2OYI A;  3A0B E;  2XKM A;  3SSU A;  2RMZ A;  2E74 B;  2YNY A;  5AVX B;  2IDB A;  3MZW B;  1T8Z A;  2BCC J;  2AXT E;  5AVZ B;  1PV3 A;  2JDI H;  2E75 B;  2O1J A;  5KLV E;  3V2N A;  3NXS A;  2C9L Y;  4IL6 X;  1VQ7 P;  3HUS A;  3MP7 B;  1SQP E;  4WY4 C;  5AW0 B;  1PP9 G;  2IYP A;  2ZT9 B;  1NU1 E;  1EDI A;  3CWB J;  4PV1 B;  1SFC B;  1VQK P;  2KYV A;  2M3E A;  4D6T D;  1IK9 A;  1N7S C;  3H1K E;  4B86 A;  3CCS P;  2Z5I A;  1GU4 A;  1SVF A;  3ABV C;  1FDM A;  5BVZ A;  1NTZ E;  1URQ B;  1MFT A;  2KOG A;  2LR2 A;  3B5N A;  3H32 B;  3KYQ A;  2QA4 P;  4PJ0 H;  3EQ2 A;  4I6M C;  3AE4 C;  1RHZ B;  3OAK A;  1NTM D;  2P58 A;  1K9M Q;  4H0L D;  1KQS O;  2QM7 A;  1P84 D;  1LT9 B;  4D6T G;  3PP5 A;  4YPC A;  3M9H A;  3GW6 A;  3AEE C;  3WMM 0;  4ASW A;  2O01 N;  3PHL A;  3L75 D;  1JY3 O;  1BCC E;  4PD4 E;  3TGU G;  1BSH A;  1FOS F;  4LLH A;  3RK2 C;  1GU5 A;  1D7M A;  5APX A;  2B87 A;  3KPE A;  5AW3 B;  3Q2Y A;  5AW6 B;  1EDK A;  1VQ8 P;  1SFC C;  2N9Y B;  4R4L A;  3S9O A;  1KQL A;  1R5L A;  4YXW H;  1N7S B;  2R32 A;  5CHX A;  1NHL A;  3WUV A;  3V4W A;  1VQ6 P;  1ZME C;  3CL3 D;  2KNC B;  1VDF A;  2YXQ B;  2K1A A;  4U3F E;  3SWF A;  3U1C A;  1FZF A;  2AEJ A;  3H1K J;  3PJS K;  1NVO A;  1VQP P;  1IFJ A;  2A45 I;  3FXD A;  5TIS H;  1ZXG A;  1IJD B;  2QRX A;  2OAR A;  4CPG A;  1BSN A;  1MV8 A;  1RE3 C;  3NTN A;  5KAI E;  2Q9I A;  1UIX A;  1OW8 A;  1M57 D;  2GUS A;  2PRR A;  2NRG A;  2YKO A;  1OVV A;  3A0H E;  3L75 E;  3F5H A;  2IBZ G;  1USD A;  2IFN A;  4C7N B;  1X9V A;  4HYT B;  3TGU J;  3VMA A;  4EIJ A;  1RF1 B;  3H1J E;  1PPJ G;  1PP9 J;  3SFE C;  2OTJ P;  1KV4 A;  3M9Q A;  3TNU B;  4DOJ A;  3BVH A;  3LIE A;  2NPS D;  2ZJS E;  4H13 B;  4JF7 A;  3L74 D;  2YXR B;  3H25 A;  3HRN A;  3CD6 P;  3H1J G;  2KLV A;  3AE1 C;  1L4A D;  5AVQ B;  5AVS B;  2QVA A;  3U1A A;  1VQ4 P;  2QG4 A;  4OVN F;  2NPS B;  1KYO I;  4H13 D;  1IFD A;  2WPQ A;  2E74 C;  2ZVN B;  3KHU A;  1LWU B;  2XV5 A;  4ZNC A;  5BU5 A;  1EXJ A;  2B87 B;  2V4H A;  3V6I A;  1T2K D;  3GMA A;  3VP9 A;  4C7R A;  3FWL A;  1SQQ K;  2E75 C;  1H88 A;  1SQB E;  2K9Y A;  4NPD A;  5H2F H;  5KLV K;  1HTL C;  2H43 A;  4N6J A;  4IOI H;  3WU2 E;  3V2P A;  1NTK J;  2V7Q H;  4UB8 E;  4PV1 C;  1URQ D;  1N2D C;  4D6T E;  1KB9 D;  3BCC E;  3GF3 A;  1OVU A;  1XTC C;  3CX5 H;  1KYO D;  3FX0 A;  3L70 D;  4L73 A;  1EC5 A;  4WVZ A;  1PGJ A;  4U3F G;  2M5A A;  2OGU A;  1KQF B;  2OYO A;  1GDT A;  1LTJ A;  2I1J A;  1SQP D;  4Z1M H;  3CCM P;  3WUU A;  2FYU D;  1JY3 P;  3H1H G;  1SQP J;  5L8R J;  3H1I G;  4XE5 B;  1FZC B;  1SQB J;  3CLQ A;  1LTS C;  2WSE H;  3UIA A;  4DT0 A;  1QVF O;  2PP6 A;  1IO4 A;  1OIP A;  1BCC G;  2XND H;  3A7O A;  1L4A A;  2Q3I A;  2KSE A;  4RES B;  2HPC B;  2FFD A;  2IZ1 A;  2BEZ F;  3VMX A;  1Y8A A;  5AW9 B;  3TNU A;  3L73 J;  1Q7Y Q;  3CCJ P;  4NPF X;  1MFZ A;  2FYU G;  2J58 A;  1JUN A;  2IBZ I;  5CMZ A;  1GW4 A;  2E42 A;  3HTK B;  3GHG C;  5APW A;  1N73 C;  2OQQ A;  4U3F D;  1N7L A;  1W2E A;  1LP1 A;  1FDO A;  3AE9 C;  2BAS A;  2JEE A;  1VF5 B;  1AJY A;  1K04 A;  3CCV P;  4AUW A;  3M0D A;  1M1K Q;  1SFC A;  3AE5 C;  1VQL P;  1QLE D;  5TIS E;  1FE6 A;  1JM0 A;  1RE4 A;  4YTP C;  3CWB G;  4Y99 C;  3TGU D;  1VQO P;  3P7K A;  2Q3E A;  2PAJ A;  3RK3 C;  3IFM A;  3LW5 H;  3Q5P A;  1Q2N A;  1RY3 A;  5KLV G;  2WSC H;  1JY2 P;  1ZOY C;  3H1L D;  3BAT A;  2W8Z A;  4PD4 I;  1PZQ A;  3RL0 g;  1SQV E;  3RBX A;  2Z4E A;  2LKM A;  1BDD A;  1JB0 J;  4R4M A;  1A02 F;  4W7Y A;  1ZV8 A;  1USE A;  3ITK A;  1SQV G;  5B5E H;  3OW2 O;  1VQ5 P;  3L73 E;  2CK3 H;  2FYN C;  1J2J B;  1GMJ A;  1S1C X;  3H1I D;  1N73 B;  2YO2 A;  2VRS A;  2YKQ A;  1PGO A;  2WVR A;  5K5G B;  1G2C A;  1VF5 D;  1W5C E;  3CI9 A;  1VF5 C;  4N78 D;  4AYC A;  3D6Z A;  1ZRT D;  2IBZ D;  1PP9 D;  4EDF A;  2A06 E;  1VQM P;  5DJU B;  2KUB A;  4W7Z A;  1LWU C;  3CPW O;  3VMY A;  1JMB A;  1SS1 A;  2Z5H A;  1SQP K;  3H1L G;  1S9K D;  1FU1 A;  5KLV J;  1SFC D;  3VMZ A;  1LWU A;  5CCH C;  2K3R A;  1HH0 A;  2PFX A;  4H44 B;  1RE4 C;  4L76 A;  3I55 P;  2QE7 H;  2R5D A;  1KIL B;  1N73 A;  1SQX G;  3L71 E;  5AW7 B;  3V5B A;  2ZFC A;  5KKZ C;  1NJI Q;  1BE3 E;  3ZDM A;  1NTM J;  1PGQ A;  1FJK A;  3H1J D;  3AEB C;  2NZ2 A;  2I1K A;  3T97 B;  3I56 P;  4H0L C;  5APT A;  2YMK A;  1RH5 B;  3GG2 A;  4XA4 A;  1L0N J;  1M1J B;  3BRT B;  4LC1 A;  4C7N A;  1YIJ P;  1GL2 C;  2JWD A;  1M8O B;  2OYI C;  1OX3 A;  3S1K A;  1OMI A;  4GKG A;  3M0A A;  3D70 A;  1KB9 H;  3AE3 C;  3CC4 P;  3CCL P;  1CW5 A;  1G1J A;  2QIW A;  4U3F J;  5AVV B;  2GM4 A;  1BE3 J;  2M5A B;  3L71 J;  1EZV G;  4WY4 D;  3G4S P;  5KJ7 A;  1ZW0 A;  3L4F A;  4C46 A;  1BGY E;  1SQV K;  1EZV E;  2HOD A;  2B9B A;  2IFM A;  2JR8 A;  4EI2 A;  5APY A;  3V4Q A;  1VQ9 P;  4ZKU A;  1P84 E;  1QVG O;  2P10 A;  1FS0 E;  3MUD C;  3P32 A;  1H89 A;  4IFD K;  2J5U A;  1NTM E;  4OGQ B;  1SQB D;  2KZJ A;  3JSV C;  3L70 G;  1NTZ K;  1PL5 A;  5GTH E;  3RK3 E;  1M1J A;  4PJ0 E;  2E76 D;  2J59 M;  1KYO E;  1PP9 E;  3KXD A;  3L70 E;  1J1E C;  1JTH B;  3CX5 E;  1KB9 E;  3BCC D;  1L0L J;  3L74 J;  3LW5 J;  2Q7C A;  2HPC A;  1FOS E;  1S4X A;  1PIX A;  3FXE A;  1KMI Z;  1T3U A;  3L75 J;  3NFQ A;  3SWY A;  3VP8 A;  5AVY B;  1CSB A;  1KIL A;  2IPP A;  2D2C D;  5E79 H;  1CI6 A;  1T6A A;  3A0H H;  3HD7 B;  1L0L G;  1JCC A;  3L36 A;  1ZRT E;  2IBZ E;  4JBZ A;  5APQ A;  1ZP0 C;  3TDK A;  2W6B A;  3BRV B;  1JO5 A;  1SQQ J;  5KJ7 D;  2HG5 D;  1GK4 A;  4A7P A;  2WSS H;  4TLF A;  4DZO A;  2FFD C;  4ASV A;  2O01 H;  3L74 E;  1VL2 A;  1BGY D;  1NTM K;  5AVR B;  3PH0 A;  3HUS B;  3L35 A;  1N7S D;  1WRG A;  2QJK C;  3CCU P;  5CBO A;  2E76 C;  3L72 E;  1KFN A;  3D6Y A;  3C1L A;  2QJP C;  2A45 H;  2MJZ A;  3QWO C;  2JKV A;  4N3Y B;  2WPV B;  3AEF C;  1IK7 A;  2ZVO B;  1NTK D;  3TSI A;  3CXH I;  5H2F E;  1H0T B;  2BCC G;  2SPZ A;  1FZB A;  1NOH A;  1RQU A;  1YQ3 C;  2W90 A;  1HUC A;  2YMY A;  4WY4 B;  1NAY A;  1SQX K;  2FXP A;  1U7J A;  2R3S A;  3C8V A;  1ZN5 A;  3SWK A;  2KIK A;  1M1J C;  2OYH B;  2XDJ A;  4Y28 J;  1GL2 B;  1LT1 A;  2O1K A;  2ZXE B;  1R5S A;  1BCC J;  3HUS C;  4M3L A;  4BXL A;  1P84 I;  2WTY A;  1URQ C;  1VPC A;  2IX7 C;  3TK1 A;  3W67 A;  1OVR A;  2FKW B;  2L91 A;  3RL0 C;  1HBW A;  1GL2 D;  2BCC E;  3H1K G;  3II6 A;  2AEF A;  1L0N E;  3IR9 A;  3JCU E;  2QJY B;  1N7S A;  1NTZ D;  2POH A;  4U7J A;  5AVT B;  1HVV A;  4I7Z B;  1L0L K;  5KJ7 C;  2K9J A;  1FDI A;  1LT9 C;  1NU1 G;  2WIT A;  3HE4 A;  2QEX P;  1DH3 A;  2E74 D;  3M91 A;  3AEC C;  1FBM A;  1K05 A;  1S2E A;  2HR3 A;  5AVW B;  1YJ9 P;  3KQG A;  1L4A C;  1S3J A;  1LTT C;  3KZI E;  3RK2 B;  4H44 D;  1KFM A;  4KJM A;  3RBZ A;  1FZC A;  2A06 D;  1QGK B;  3MD0 A;  3MHV A;  1MZ9 A;  2IYO A;  5APS A;  1YBK A;  1GZL A;  3B4S A;  3H1K D;  3USS A;  3H6P A;  1A02 J;  2R44 A;  3FGA D;  5KLI C;  3VTP C;  1H0T A;  1RF0 C;  3KZI H;  1SQQ D;  2QM8 A;  3WUT A;  3O6Q B;  1H8A A;  2H88 C;  2Q6Q A;  3H1J J;  1GTW A;  1AVY A;  2H89 C;  1KD1 Q;  4DCK A;  3P8C E;  3HTK A;  3E1R A;  2YKP A;  4WB4 A;  4I7Z C;  4BWN A;  3HD7 C;  1NKN A;  2YIU C;  4JQ0 D;  1GL2 A;  1RQV A;  2A45 G;  5CBN A;  3E1I A;  3A5T A;  1NO4 A;  1WMK A;  2BCC D;  1L0N K;  2LXB A;  3D71 A;  1J1D B;  4OH8 B;  5CJ4 A;  1XTG B;  1YYC A;  2LXC B;  2NPS A;  2HLO A;  4I1L A;  3SFD C;  3CXH E;  2RH0 A;  3CMA P;  1FZG A;  2R5B A;  2R3C A;  2CPB A;  3KDP B;  1E79 H;  1LTI C;  1SLQ A;  1NTK E;  2W83 C;  3H1H E;  1AVO A;  4GOE A;  1HJB A;  3B5N C;  5AW2 B;  3GHG A;  1NYH A;  1NU1 K;  1BGY G;  3W68 A;  1AFO A;  1KQG B;  2OTL P;  2PGD A;  5KAF H;  3MIW A;  1OZH A;  1R8E A;  1BE3 D;  3AE2 C;  2P7J A;  1G2C B;  1LNQ A;  1T3J A;  2D2C B;  2W6A A;  2Y0D A;  1L0L D;  3OA7 A;  1EDJ A;  1J1D C;  2V7Q J;  3H1H J;  1NTZ J;  2AXC A;  1Q90 D;  4I2L C;  1Y47 A;  2FXM A;  1Q82 Q;  4YXD C;  1S9K E;  1FJP A;  2KS1 B;  3S4R A;  1OWA A;  3T97 A;  5KAI H;  1YIT P;  4OGQ D;  1X8Y A;  3G9R A;  3L71 G;  2P2U A;  2FYZ A;  1EXI A;  2B89 A;  2WSF H;  3PRJ A;  1PPJ E;  1BGY J;  1Q81 Q;  3CX5 D;  3AE7 C;  5CJ0 A;  3P8C D;  1NTK K;  2WSC J;  5B66 E;  4MN4 C;  2ZYG A;  3L73 D;  4TT3 H;  3K5B A;  3RGU A;  3VN0 A;  3AEA C;  1Z56 A;  1M7L A;  1LTB C;  1KZU B;  1FC2 C;  1YJN P;  1SQV D;  4RO0 A;  1IFN A;  2ZYA A;  3NMD A;  1PFI A;  1UII A;  3E7K A;  2OYH A;  3GHG B;  4GOF A;  3R4Y A;  1JNM A;  1NU1 D;  3RK3 D;  1L0N D;  1DEB A;  1NTZ G;  3U59 A;  4KT0 J;  1G1I A;  3BCC J;  2G8Y A;  3WU2 H;  1JEK A;  4H13 C;  2QSI A;  2ZT9 D;  2N1T A;  3AED C;  5B66 H;  1EQ7 A;  1P84 H;  4UB6 E;  3CCQ P;  3CCR P;  1N8R Q;  1JY2 O;  1SP4 A;  1YQ4 C;  2K37 A;  2YO3 A;  3L37 A;  5GTI E;  1KB9 I;  3LID A;  2XZR A;  1HJ0 A;  2Y9Z A;  1BDC A;  2YIU B;  2Y0E A;  3TGU E;  1SQX J;  2WWW A;  3PLN A;  3GF7 A;  3OJA B;  2WSE J;  3H1I J;  5DJT B;  3G6E P;  2KS1 A;  3CC2 P;  4GIF A;  5CCH D;  3HE5 A;  1LGH B;  1HGZ A;  3F89 A;  3AEG C;  3N4X A;  3JC2 2;  4W80 A;  1L0N G;  1YI2 P;  2WT7 A;  1DIP A;  3L72 J;  1LTJ C;  2AXT H;  2JO1 A;  1URQ A;  3B5N B;  3VYI A;  1ZR2 A;  3L72 D;  1NWQ A;  3A0B H;  1CI6 B;  1X79 B;  1HGV A;  4IL6 E;  3CXH D;  4JPZ B;  4JYC A;  4WBA A;  2FYU E;  5AW5 B;  1FZC C;  1M56 D;  1X22 A;  3I5C A;  5CCG C;  2N1T D;  2ITA A;  3Q5R A;  1SQV J;  1DD3 A;  4K3A A;  2GUV A;  1SQP G;  1QEX A;  1FZE A;  3MUD A;  5B5E E;  3O8Z A;  5CCG A;  4PV1 D;  5APU A;  2H8P D;  2HYN A;  2JP3 A;  2FYU K;  1OW6 A;  3RK2 D;  3BAS A;  1SQX E;  3L71 D;  2KXP B;  2N1T B;  2E75 D;  3H1I E;  3Q1M A;  1JOC A;  2JJL A;  1KN7 A;  1NKZ B;  1HF9 A;  1GK6 A;  2JWA A;  1SQX D;  2C0W A;  2DW3 A;  2N9B A;  2FYU J;  3CX5 I;  3G3Z A;  3IAO A;  1LTJ B;  2WZ7 A;  4H0L B;  4HJG H;  5KLV D;  3H1L E;  5CCH A;  1AQ5 A;  1JMM A;  2E43 A;  4QMA A;  4HKZ H; 
#chains in the Genus database with same CATH homology
 2NPS C;  2KSJ A;  4WY4 A;  2M3B A;  3RK3 B;  2WT7 B;  1RE3 A;  3V2Q A;  2P1J A;  3HE5 B;  3MTU E;  5APV A;  5CCG D;  1LTG C;  4GT1 A;  4HH2 A;  3B8E B;  2KB7 P;  2C9N Y;  2OYH C;  1JTH A;  3R2P A;  1RF1 A;  3M06 A;  1DX7 A;  3HE4 B;  1FAV A;  2P67 A;  2XU6 A;  1J1E B;  3TYY A;  1ZR4 A;  3MGN A;  3H32 A;  3RL0 B;  3HD7 A;  1JY2 N;  2CPS A;  3A2A A;  3M0D C;  1KIL C;  4O9B A;  2W27 A;  1T2K C;  2FFD B;  2M8R A;  1L4A B;  1E5W A;  1N86 A;  2XNX A;  1GW3 A;  1LTA C;  1JY3 N;  2C0X A;  4AQR D;  1MUU A;  1WT6 A;  2KP8 A;  5AVY B;  4Y99 B;  4ZKP A;  1YTZ T;  4IFF A;  5AW1 B;  2WPR A;  1NH4 A;  5AW8 B;  3V2R A;  2HOD B;  1QL2 A;  3EFG A;  2OYI C;  3M9B A;  1CZQ A;  2N1T C;  1JCD A;  4IFM A;  3HD7 D;  4N78 E;  1RF0 A;  5AVU B;  4EOT A;  3N7N A;  2H7H A;  1GD2 E;  1YTZ I;  3A3Y B;  1IC2 A;  1IFI A;  1IFM A;  3C9I A;  4JYB A;  5KTB A;  2Q5U A;  2WPS A;  1FZA A;  1SQB K;  2OYI B;  3VOP A;  1QL1 A;  1NAF A;  2HFE D;  1KIL D;  3B5N D;  3RL0 D;  3P8M C;  1RF1 C;  1LT9 A;  5AW4 B;  1OXZ A;  2L5G B;  1ZLL A;  4LGD E;  1HWT C;  4KHX A;  2OYI A;  2XKM A;  2YNY A;  5AVX B;  5AVZ B;  1T8Z A;  2O1J A;  2C9L Y;  3V2N A;  3NXS A;  3HUS A;  4WY4 C;  5AW0 B;  1SFC B;  2KYV A;  1IK9 A;  1N7S C;  2Z5I A;  1GU4 A;  1SVF A;  1FDM A;  5BVZ A;  1URQ B;  3B5N A;  2KOG A;  3H32 B;  3KYQ A;  3EQ2 A;  4I6M C;  3OAK A;  2QM7 A;  1LT9 B;  3PP5 A;  3M9H A;  3WMM 0;  1JY3 O;  1FOS F;  4LLH A;  3RK2 C;  1GU5 A;  5APX A;  5AW3 B;  3KPE A;  5AW6 B;  1SFC C;  1KQL A;  1N7S B;  2R32 A;  5CHX A;  1NHL A;  3V4W A;  3CL3 D;  1FZF A;  1VDF A;  3U1C A;  3SWF A;  1IFJ A;  2A45 I;  1IJD B;  2OAR A;  2Q9I A;  1MV8 A;  1RE3 C;  3NTN A;  2GUS A;  2YKO A;  2IFN A;  4C7N B;  1X9V A;  4HYT B;  4EIJ A;  1RF1 B;  3M9Q A;  3TNU B;  4DOJ A;  3BVH A;  3LIE A;  2NPS D;  4JF7 A;  3HRN A;  2KLV A;  3U1A A;  1L4A D;  5AVQ B;  5AVS B;  2NPS B;  1IFD A;  2WPQ A;  1LWU B;  2XV5 A;  5BU5 A;  1T2K D;  3VP9 A;  4C7R A;  1H88 A;  1SQQ K;  5KLV K;  2H43 A;  1HTL C;  4N6J A;  3V2P A;  1URQ D;  1N2D C;  1XTC C;  1GDT A;  1LTJ A;  2I1J A;  1JY3 P;  4XE5 B;  1FZC B;  3CLQ A;  1LTS C;  2WSE H;  3UIA A;  2PP6 A;  1IO4 A;  3A7O A;  1L4A A;  2Q3I A;  4RES B;  2HPC B;  2FFD A;  3VMX A;  5AW9 B;  3TNU A;  1MFZ A;  1JUN A;  2J58 A;  5CMZ A;  1GW4 A;  2E42 A;  3HTK B;  3GHG C;  5APW A;  1N73 C;  1N7L A;  1W2E A;  2BAS A;  2JEE A;  4AUW A;  3M0D A;  1SFC A;  1RE4 A;  4Y99 C;  3P7K A;  2PAJ A;  3RK3 C;  3IFM A;  3LW5 H;  1RY3 A;  2WSC H;  1JY2 P;  2Z4E A;  3BAT A;  2LKM A;  1A02 F;  4W7Y A;  1ZV8 A;  1J2J B;  1N73 B;  2YO2 A;  2VRS A;  2YKQ A;  1G2C A;  3CI9 A;  4N78 D;  4AYC A;  4W7Z A;  1LWU C;  3VMY A;  2Z5H A;  1SQP K;  1S9K D;  1FU1 A;  1SFC D;  3VMZ A;  1LWU A;  5CCH C;  1HH0 A;  1RE4 C;  2R5D A;  1KIL B;  1N73 A;  5AW7 B;  3V5B A;  2ZFC A;  1FJK A;  2I1K A;  5APT A;  4XA4 A;  1M1J B;  3BRT B;  4LC1 A;  4C7N A;  1GL2 C;  4GKG A;  3M0A A;  1CW5 A;  1G1J A;  5AVV B;  2GM4 A;  4WY4 D;  5KJ7 A;  4C46 A;  3L4F A;  1SQV K;  2HOD A;  2IFM A;  5APY A;  3V4Q A;  4ZKU A;  4IFD K;  3P32 A;  1H89 A;  1NTZ K;  1M1J A;  2J59 M;  3SWY A;  1J1E C;  1JTH B;  1FOS E;  2Q7C A;  2HPC A;  1T3U A;  3NFQ A;  3VP8 A;  1CSB A;  1KIL A;  2IPP A;  1CI6 A;  3L36 A;  3HD7 B;  5APQ A;  1JCC A;  2W6B A;  3BRV B;  1JO5 A;  5KJ7 D;  2HG5 D;  1GK4 A;  2FFD C;  4DZO A;  2O01 H;  1NTM K;  5AVR B;  3HUS B;  3L35 A;  1N7S D;  1WRG A;  1KFN A;  2A45 H;  2MJZ A;  4N3Y B;  3TSI A;  1FZB A;  1NOH A;  1HUC A;  2YMY A;  4WY4 B;  1SQX K;  4B86 A;  1ZN5 A;  1M1J C;  2OYH B;  2XDJ A;  1GL2 B;  2O1K A;  2ZXE B;  3HUS C;  4M3L A;  2WTY A;  1URQ C;  1VPC A;  2IX7 C;  3TK1 A;  2FKW B;  3RL0 C;  1HBW A;  1GL2 D;  3II6 A;  3IR9 A;  5AVT B;  1N7S A;  2POH A;  1HVV A;  5KJ7 C;  1L0L K;  1LT9 C;  3HE4 A;  1DH3 A;  2WIT A;  3M91 A;  1FBM A;  5AVW B;  3KQG A;  1L4A C;  3RK2 B;  1LTT C;  1KFM A;  1FZC A;  3MD0 A;  1MZ9 A;  5APS A;  1GZL A;  3H6P A;  1A02 J;  3VTP C;  1RF0 C;  2QM8 A;  1H8A A;  1GTW A;  3P8C E;  3HTK A;  2YKP A;  4WB4 A;  3HD7 C;  1NKN A;  1GL2 A;  2A45 G;  3E1I A;  3A5T A;  1NO4 A;  1L0N K;  1J1D B;  4OH8 B;  5CJ4 A;  1XTG B;  1YYC A;  2NPS A;  2HLO A;  4I1L A;  1FZG A;  2R5B A;  2R3C A;  2CPB A;  3KDP B;  1LTI C;  1SLQ A;  1HJB A;  3B5N C;  5AW2 B;  3GHG A;  1NU1 K;  1AFO A;  3MIW A;  2P7J A;  1G2C B;  1T3J A;  2W6A A;  3OA7 A;  1J1D C;  4I2L C;  2FXM A;  1S9K E;  1FJP A;  3T97 A;  1OWA A;  1X8Y A;  2P2U A;  2FYZ A;  2WSF H;  5CJ0 A;  3P8C D;  1NTK K;  3VN0 A;  1Z56 A;  1M7L A;  1LTB C;  1KZU B;  1IFN A;  3NMD A;  1PFI A;  2OYH A;  3GHG B;  1JNM A;  3RK3 D;  1DEB A;  3U59 A;  1G1I A;  2N1T A;  1EQ7 A;  1JY2 O;  1SP4 A;  2YO3 A;  3L37 A;  3LID A;  2XZR A;  2WWW A;  3OJA B;  4GIF A;  5CCH D;  3HE5 A;  1LGH B;  1HGZ A;  3N4X A;  4W80 A;  2WT7 A;  1LTJ C;  3VYI A;  1URQ A;  3B5N B;  1ZR2 A;  1NWQ A;  1CI6 B;  1X79 B;  1HGV A;  4JYC A;  4WBA A;  5AW5 B;  1FZC C;  3I5C A;  5CCG C;  2N1T D;  2GUV A;  3MUD A;  1FZE A;  3O8Z A;  5CCG A;  5APU A;  2H8P D;  2HYN A;  2FYU K;  3RK2 D;  3BAS A;  2N1T B;  1JOC A;  2JJL A;  1NKZ B;  1GK6 A;  5BU8 B;  2C0W A;  2N9B A;  3G3Z A;  5CCH A;  1LTJ B;  2WZ7 A;  1AQ5 A;  1JMM A;  2E43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...