2KSJA

Structure and dynamics of the membrane-bound form of pf1 coat protein: implications for structural rearrangement during virus assembly
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein G8P
publication title Structure and dynamics of the membrane-bound form of Pf1 coat protein: implications of structural rearrangement for virus assembly.
pubmed doi rcsb
source organism Pseudomonas phage pf1
total genus 11
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2010-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ksjA00
3IFMA 1ZN5A 2IFMA 2KLVA 1QL2A 2IFNA 2XKMA 4IFMA 1IFNA 1QL1A 2KSJA 1PFIA 1IFMA
chains in the Genus database with same CATH superfamily
2R44A 5H2FH 1CW5A 1NGMB 3HTKB 3TF5A 3L71J 1CSBA 2KI7B 1GL2C 3OJAB 3SWYA 2P2UA 3U59A 2KP8A 1N7SB 3BCCD 2YKQA 1S9KD 2RH0A 1OW6A 2N1TB 4AYCA 4KHXA 1D7MA 1EDKA 1T2KC 2E76D 3KXDA 2NPSC 3RBXA 2BASA 1Y47A 2A45G 1IFNA 3B5NC 3PTZA 3FGAD 3AE8C 1LTTC 4UB6H 1LT9A 1FJKA 1X0TA 1IFMA 2FFDB 1Y9BA 3SFDC 3G3ZA 5B66H 4LLHA 2JJLA 4U3FJ 3E1RA 3N4XA 3ABVC 2FKWB 2J5UA 4RKUJ 1JEKA 1SQPJ 3EFGA 3EQ2A 4R4LA 3T97A 1PP9D 3GW6A 1QX8A 1VQ4P 5AVTB 3P8CD 3L4FA 5CJ4A 1GK4A 5KLVJ 4HKZH 2AXTE 1ZOYC 1L0LJ 3HUSA 1SQXJ 1IO4A 3D6YA 4WBAA 5AVRB 4N3YB 3ITKA 1HVVA 1L4AB 2QVAA 4JYBA 2IYPA 3PH0A 3CPWO 3H25A 4I2LC 1NVOA 3MUDC 3H1LJ 4L75A 2KXPB 2AEFA 2QM8A 1MFTA 3RK2D 1KB9I 2SPZA 4ASWA 1J2JB 4UB8E 4D6TD 3CMEP 5GTIE 2OGUA 2WSEH 5AW1B 2H88C 1OVRA 1HH0A 1NU1K 3S9OA 1MFZA 3H1JE 2FYZA 3VMXA 1NOHA 2QIWA 2QSIA 2ZYAA 2E74D 2O01N 1YJNP 1N86A 2XKMA 1NU1E 1A02F 1N7SC 5AVXB 4ZMDA 3CCRP 2A06G 2N1TC 1OMIA 2I1KA 2BEZF 4M3LA 5AW6B 1BDCA 1P84E 1DD3A 1RF0A 2QJKB 1FDOA 3GHGB 1YI2P 1SQBJ 4NPEA 4WVZA 3V4QA 5H2FE 1S2EA 2M5AA 5CCHA 5AVSB 3HE5A 1G1IA 3GMAA 1KB9H 1JTHA 2NZ2A 1Q81Q 2OARA 2W6BA 4HH2A 1U7MA 1NTMJ 1PFIA 5BU8B 2E76B 3L71D 2Q6QA 1USDA 3CI9A 3CXHD 5DJTB 2K9JA 1BCCE 3G6EP 3L74G 2K9YA 4PD4D 3O6QA 2IPPA 1AVYA 2IYOA 4I1LA 1WMKA 1L4AC 3HE4A 2ZXXA 5B66E 3VP8A 4C46A 3II6A 2QJYB 5KJ7D 3A2AA 2B9BA 2Y0CA 3W67A 2YMYA 2BCCJ 1URQD 2K37A 1VQNP 5AVQB 3L71G 4EI2A 4W7ZA 3CCQP 3L70E 1EDLA 1NTKE 1VL2A 1EZVI 1SFCA 5AW9B 2Q9IA 1JY2P 1YIJP 1SP4A 1LTGC 1AA0A 1BE3J 5KTBA 1FOSF 3CC7P 4PV1D 2IDBA 1SQXD 1ZR4A 3CCLP 3H1KJ 3GHGC 3A0HH 2ITAA 1VF5D 3L72D 3C9IA 1T6AA 2WSCH 1P84D 1NKZB 3O8ZA 1VQPP 2P7JA 5CCGD 1Q2NA 3H1LD 4U3FG 1M1JA 1VQ6P 1SQVK 1H0TA 2K88A 3IF4A 2IBZI 3VOPA 1FS0E 1X8YA 2YIUC 3L73G 1BGYD 3L36A 1SQPG 2E76C 5AVVB 1JMMA 5KLIB 1BDDA 3WUUA 1N73C 3V2NA 2WQYC 2HG5D 3NTNA 1FZFA 4IFDK 5KLVG 3WU2H 1L0LG 3M0DA 2P1JA 4HJGH 1SQXG 1NKNA 1NTZD 4JYCA 1RQVA 4YXDC 1G1JA 2R5DA 3L75E 2Z5HA 1FZAA 1JY3N 2LKMA 3BCCJ 1KB9E 1IZNB 2MJZA 1SQBD 2QJYC 1GK6A 1ZV8A 3VP9A 3MP7B 1KILD 5TISE 3M91A 3PHLA 5APUA 1VDFA 2B87B 4K35A 4DOJA 1E79H 2WT7A 2FXMA 2JO1A 5EFWB 4JF7A 3G4SP 4EOTA 3H1HE 5AVWB 4H0LD 3CLQA 2WVRA 2KS1B 1PP9J 1NTKD 2O1KA 1S5LE 2FY8A 2D2CD 3M9QA 1QEXA 3OA7A 3D6ZA 2OYIB 1SQBG 2NRGA 1URQB 1AFOA 4IL6H 1TU3F 1G2CA 2OTLP 5CHXA 5KAIH 2UWJE 4JBZA 2KSEA 1LNQA 2HPCA 3OW2O 3FXEA 2OQQA 2AXTH 1CI6A 2GA1A 1LGHB 1RQUA 1FZCB 1NTMG 5KLIC 4D6TJ 4PV1B 3P32A 3CC2P 1MKMA 3NFQA 1FU1A 1S4XA 3FWLA 1M1KQ 2HODB 3Q1MA 4XE5B 1IFJA 3TNUA 5GTIH 1KYOH 2FYUE 3BASA 3H1KD 3HD7D 1JOCA 3FX0A 1NO4A 1WT6A 2KOGA 1LTIC 3L75D 2WPRA 3RGUA 1EXJA 1RF1B 5M1BA 3A5TA 3RK3D 1KQFB 1EZVE 2BCCG 4WY4D 2Z4EA 3V2PA 2YXQB 2ZXEB 1AQTA 2OYHB 1SQQE 3AEAC 3NMDA 1K8AQ 3AEEC 2KZJA 3MIWA 2JEEA 3MGNA 2Y0DA 3N7NA 4BRYA 1BE3G 3C1LA 3A0BE 5KJ7C 3KQGA 2XZRA 4CPGA 3E7KA 3BRVB 5APTA 1RHZB 1KQGB 1LTBC 1KILB 2OYIC 3H1HD 3H1KG 1URQC 1KV4A 2E75D 4ZKUA 1RE3C 1DEEG 3ZDMA 2ZT9D 2IBZE 2Q1KA 4JPZB 3FXDA 1PGQA 3Q3DA 1OFCX 4GDOA 3L74E 1LTJA 1JY3O 4H0LB 1J1DB 2K1AA 1FZCC 1GTWA 2CPSA 2D2CB 4PV1C 3TYYA 1R5LA 1H8AA 4IL6E 1LT1A 1PIXA 3JCUH 1VQKP 5KAIE 5CCGC 4L73A 2G8YA 3CX5D 2I1JA 3D70A 3BCCG 1M56D 3CWBE 1QVGO 2KNCB 3I5CA 1NWQA 3OAKA 2WWWA 1L0ND 1RF1C 4GOEA 3L72J 2FYUD 5AVZB 4ASVA 1K04A 1Y8AA 3PLNA 1PGJA 5L8RJ 2OYHC 3KPEA 2E5TA 3H32A 1SQPK 2H7HA 2HLOA 1M8OB 1BGYJ 1KYOE 4EYYQ 1IFDA 4U3FE 3HD7B 2WPSA 3MTUE 2YMKA 1SQQD 5KLVK 1PP9G 3L73E 1KFNA 1L0LK 2XV5A 3RBZA 1KILC 1SQPE 1EDJA 2HFED 1HUCA 1SQXK 3RK3B 2A45I 2WSFH 2M3BA 4WY4B 2QRXA 1NTZJ 3TGUE 2LXCB 1MV8A 3LW5H 3I56P 5APYA 2W6AA 2OTJP 1LWUB 1FZGA 2ZYGA 2ZFCA 1GL2A 3CCJP 4H0LC 1J1DC 3BVHA 4ZKPA 2HPCB 1JNMA 3GLMA 2FFDC 2D2CC 1OWAA 4D6TG 2GM4A 4WWIA 2YO3A 2NPSA 1KC8Q 1A02J 1DD4A 1T8ZA 1IK7A 2E75B 3B5NA 2Z5IA 4LGDE 2JR8A 3GF3A 5TISH 4MN4C 5AW7B 2JWAA 4IL6X 2A45H 3AECC 2AXCA 4EDFA 1NTKJ 2Q3EA 3BRTB 2FXOA 1KQLA 1HTLC 3Q5PA 1LP1B 3H1IE 1H89A 1SQBK 1PZQA 2JWDA 1HJ0A 2V7QH 2P58A 1GDTA 1CZQA 1BSHA 1PGPA 2IFNA 1EQ7A 2XNDH 3CWBD 1S5LH 1SS1A 2C0XA 1PPJE 3G71P 3KHUA 1NTMK 3JCUE 4C7NA 2WSEJ 1EDIA 1QL1A 1U57A 3L37A 1VQ5P 3IAOA 1VQ7P 2O01H 3HD7C 3R4YA 1HWTC 1M90Q 2YNYA 1NTME 3PRJA 3MUDA 1LTSC 3RK3C 3G9RA 3AEDC 2KSJA 1KYOD 1U7JA 4WY4C 3H1JD 1VPCA 5CCHD 5CBNA 3HTKA 2KYVA 2AEJA 2YKOA 1LWUC 2QJKC 3M0AA 3RK2B 1JUNA 3SSUA 3TSIA 1NU1D 1FBMA 3TGUD 1OZHA 3LIDA 3S4RA 3L75J 1N7SA 3A7OA 1OXZA 2KZIA 2N1TA 2E74B 1IFIA 1JM0A 1USEA 3JSVC 2E75C 2IFMA 1LT9B 4R4MA 2BCCE 1M7LA 5AVUB 2QE7H 2M8RA 1T3JA 4N78E 1SQVE 1JCDA 3M06A 2POHA 4AUWA 3T97B 3H1HJ 1Z56A 3CMAP 2IZ1A 4LC1A 3L35A 3L72G 1NAYA 3A0BH 1RE4C 1OVUA 1BCCD 3PJSK 3HUSB 3H1ID 1LTAC 1SFCD 1JY3P 1OIPA 1KD1Q 3H1LG 3AEBC 1QVFO 3CXHI 2XDJA 5DJUB 2YXRB 1K73Q 1BGYG 4H44D 1L4AA 2RN0A 2Q7CA 2WMMA 2E43A 1PPJD 2FBWC 4PD4I 4WB4A 1JCCA 3TK1A 4AQRD 1ZMEC 3A3YB 2WPVB 1K05A 1N7SD 1NTZG 1JMBA 3L70D 2QEXP 3RK2C 2H89C 1DX7A 3KDPB 2HYNA 1E5WA 1YITP 3SWKA 2WSCJ 1VQMP 1S9KE 1L0NJ 2E74C 2PFXA 1WRGA 2FYUJ 5C39A 4I7ZB 2ZVNB 5AW4B 1S72P 3Q5SA 2E42A 1L2PA 4JQ0D 3GHGA 2M5AB 1LT9C 4U7JA 3HE5B 1VQ9P 3MZWB 2C9NY 3IN6A 3VYIA 1JTHB 3AE6C 5AW0B 1SQQJ 3AEFC 1VF5B 3P7KA 1YQ4C 1YTZI 1NTKG 2GUVA 5CJ0A 4YXWH 2W27A 1FZEA 3M9BA 2J58A 2DW3A 1QGKB 1XTCC 4N78D 2N9YB 4C7RA 5TJHA 1N73A 3P8CE 2K9JB 3AE9C 1QLED 3VTPC 3HUSC 1R8EA 3CC4P 3PP5A 1S3JA 4DZOA 3O6QB 2A06E 1ZP0C 4GT1A 4Y28J 3HE4B 5CBOA 1KB9D 1Q90D 1GW4A 3JC22 3B8EB 1AV1A 1ZN5A 4OGQD 4I6MC 4DJGA 2JKVA 2RMZA 2H8PD 1JO5A 2JP3A 4H13D 3E1IA 2WPQA 2R32A 5AW8B 4N6JA 1K9MQ 1EXIA 1AVOA 1X9VA 1YTZT 1SFCB 1Q86Q 4ZNCA 1S5LX 4H44B 1J1EB 1OW8A 4IFFA 3L75G 1RY3A 1RF0C 3KZIE 3U1AA 5AW3B 4I7ZC 1AJYA 3CWBJ 3F5HA 4EIJA 1VQ8P 4PJ0E 5CCHC 3W68A 3IFMA 1NYHA 1VQLP 1M1JB 2E5YA 1H0TB 2QG4A 3I55P 1VF5C 1OX3A 2BEQD 3H1HG 3L71E 4Y99B 2P67A 1YYCA 3H1JJ 3RL0D 3CXHE 5E79H 3L73J 3BATA 5KAFE 1PV3A 1DH3A 3EWKA 4O9BA 2C0WA 1W2EA 1NU1J 4PD4E 3TGUJ 3AE1C 2WSSH 1HBWA 3UIAA 4GODA 3CCMP 4YPCA 4TLFA 2PRRA 4IOIH 2A06D 2Q5UA 1N7LA 2VRSA 5KKZB 1EZVD 1YJ9P 1YBKA 2QJPB 5APWA 4TT3H 2CK3H 1JB0J 2WT7B 2B87A 1SFCC 2Y0EA 1KZUB 1IC2A 2Q3IA 4NPFX 4H44C 1RH5B 1J1EC 2YO2A 4OGQB 1BSNA 2M3EA 2O3JA 5KLVE 1L0NG 1HGVA 2KS1A 5KJ7A 1L0LE 3AE4C 1W5CE 2QA4P 2FYUG 4RJTA 3EFFK 1BCCJ 1SQXE 3H1IJ 4H13B 1FC2C 1G2CB 2OYIA 2IX7C 1URQA 2IBZD 3L72E 1RE3A 3WMM0 1EZVG 1CI6B 1M1JC 1HJBA 2N9BA 3L74D 1PGOA 4L76A 3H1LE 2PP6A 1SQQG 4XFJA 2I8DA 1FZBA 2ZT9B 5CMZA 1BGYE 1FZCA 4HB1A 1FAVA 1DIPA 2KK7A 1NTZK 4Y99C 4OVNF 1X79B 4OH8B 3M0DC 1Q82Q 3L70J 2L91A 4BXLA 3SWFA 2YIUB 3CCVP 2FXPA 4GIFA 4K3AA 2C9LY 3TNUB 2HODA 1YJWP 1NTZE 2PGDA 1N73B 3V2RA 1GU4A 1ZW0A 5CCGA 4IFMA 2IBZG 2P10A 4GOFA 1GZLA 1SQBE 1OVVA 3GF7A 2XU6A 4UB6E 2M0BA 2RKLA 2KB7P 3CX5I 5APXA 5KKZC 1KILE 1EC5A 3VMAA 1XTGB 3M9HA 3RL0B 1RF1A 4DCKA 3HRNA 2QJPC 1YQ3C 2XNXA 2L5GB 5E79E 1ZRTE 3USSA 1ZXGA 2OYHA 1NTKK 2KLUA 4GKGA 2FYNB 3AE3C 5B5EH 1GL2D 5AVYB 2WSFJ 4BRYB 3GG2A 1SVFA 2LXBA 4U3FD 1H88A 1JY2N 3LW5J 4OGQC 5BVZA 2WTYA 2ZAEB 3L73D 1T2KD 1SQVJ 2V4HA 2NPSD 1SQPD 3V2QA 1DEBA 4H13C 3CWBG 1QL2A 2OTKE 1KILA 3B5ND 1LJ2A 3P8MC 2GUSA 2B88A 1IJDB 3S1KA 1KQSO 2WZ7A 2IZ0A 5KLVD 2O1JA 1YHQP 3U1CA 3CCUP 1L0LD 1AQ5A 2K3RA 1HF9A 1S1CX 3CX5H 1LTJB 1NJIQ 1KORA 1ZR2A 2YKPA 4YTPC 4RO0A 2ZT9C 4XA4A 3Q5RA 2B89A 4DT0A 2FFDA 3H1JG 2KIKA 2W8ZA 1NH4A 2MKVA 1FDIA 2G3AA 3F89A 1BE3E 5GTHH 3VN0A 2V7QJ 1X22A 1NU1G 3AE7C 1FJPA 3TGUG 4KT0J 1GMJA 3H1KE 5K5GB 1ZLLA 3V5BA 1N8RQ 2KNCA 3WUVA 3AEGC 2R5BA 1R5SA 3K5BA 5APVA 1M57D 1SLQA 1GU5A 3RL0C 1MUUA 3RK3E 4W7YA 2O01J 3IR9A 2W6JH 2WITA 3KZIH 1KMIZ 3R2PA 3CCEP 1FOSE 2OYOA 1Q7YQ 2Y9YA 2FYNC 3H32B 3TDKA 2KUBA 1GW3A 4B86A 4PJ0H 4Z1MH 3CD6P 3B71A 1FDMA 4HYTB 3CL3D 2AEMA 1VQOP 2J59M 1ZRTD 2N1TD 3HD7A 4L74A 3V6IA 1NTMD 2Y9ZA 1BCCG 3H1IG 3VMYA 1NHLA 2HR3A 3FWNA 4OWFA 4WY4A 4W80A 2H43A 3BCCE 3LIEA 1UIXA 3WUTA 1NAFA 2R3CA 2JDIH 1LTJC 1KYOI 3CXHH 1GL2B 1LWUA 3SFEC 1PL5A 1UIIA 2ZJSE 5B5EE 5KAFH 1FE6A 4KJMA 1PPJG 3H6PA 1KFMA 3VMZA 2PAJA 4A7PA 4PD4H 1KN7A 1T3UA 1N2DC 2NPSB 3C8VA 2ZYDA 3RL0g 4NPDA 3B5NB 3QWOC 3Q2YA 1KTMA 2BCCD 3L70G 1P84I 3KYQA 2KLVA 2W90A 3D71A 1PP9E 1L0NK 3MD0A 1SQVD 2W83C 3AE5C 1OW7A 3CX5E 2CPBA 1L4AD 2FYUK 1HGZA 3A0HE 3V4WA 1JY2O 5APSA 1BE3D 1LP1A 4BWNA 2LR2A 3B4SA 4UB8H 1L0NE 3NXSA 4RESB 2QM7A 1W2BO 3AE2C 4QMAA 1RE4A 1IFPA 1SQQK 3L74J 4C7NB 3MHVA 5BU5A 5GTHE 1MZ9A 4D6TE 3CCSP 1P84H 5AW5B 3WU2E 2ZVOB 5AW2B 5APQA 1GD2E 1SQVG 1IK9A 2R3SA 3QH9A
chains in the Genus database with same CATH topology
4EOTA 1CW5A 5AVWB 4WY4C 3HTKB 1VPCA 5CCHD 3CLQA 3HTKA 1J1EC 2KYVA 2YO2A 2YKOA 1CSBA 2O1KA 1HGVA 5KJ7A 1LWUC 3M9QA 3M0AA 1GL2C 3RK2B 3OA7A 1JUNA 3OJAB 3SWYA 2P2UA 2OYIB 3TSIA 3U59A 1URQB 1G2CB 2OYIA 1AFOA 1FBMA 2IX7C 2KP8A 1URQA 1G2CA 1N7SB 3LIDA 2YKQA 1S9KD 5CHXA 2N1TB 4AYCA 1N7SA 1RE3A 4KHXA 3A7OA 1OXZA 3WMM0 1T2KC 2HPCA 2N1TA 1CI6B 2NPSC 1IFIA 1M1JC 1HJBA 2N9BA 2BASA 1CI6A 2A45G 1LGHB 1IFNA 3B5NC 2PP6A 2IFMA 1LT9B 1FZCB 1FZBA 1LTTC 5CMZA 1M7LA 1LT9A 1FZCA 5AVUB 1FJKA 1FAVA 1IFMA 2M8RA 2FFDB 1NTZK 4Y99C 3G3ZA 3P32A 1T3JA 4LLHA 2JJLA 4N78E 3NFQA 1FU1A 3N4XA 1X79B 4OH8B 1JCDA 3M0DC 3M06A 2FKWB 3SWFA 2HODB 4GIFA 2POHA 2C9LY 4XE5B 3TNUB 2HODA 4AUWA 1IFJA 3EFGA 3TNUA 3EQ2A 1Z56A 3T97A 1N73B 4LC1A 3V2RA 1GU4A 5AVTB 3P8CD 3L35A 3L4FA 5CJ4A 5CCGA 1GK4A 4IFMA 3BASA 1RE4C 3HUSB 1GZLA 3HD7D 3HUSA 1JOCA 1NO4A 1WT6A 2KOGA 1LTAC 1SFCD 1JY3P 1IO4A 1LTIC 2XU6A 2WPRA 2KB7P 4WBAA 5AVRB 4N3YB 5APXA 1RF1B 1HVVA 3A5TA 3RK3D 2XDJA 1XTGB 3M9HA 3RL0B 1RF1A 3HRNA 1L4AB 4WY4D 2Z4EA 4JYBA 3V2PA 1L4AA 2Q7CA 2XNXA 2ZXEB 2OYHB 2E43A 2L5GB 3NMDA 4I2LC 2OYHA 4WB4A 1NTKK 1JCCA 2QM8A 4GKGA 3TK1A 4AQRD 3RK2D 1GL2D 3MIWA 2JEEA 5AVYB 2KSJA 3A3YB 1J2JB 1SVFA 3MGNA 2WSEH 5AW1B 3N7NA 1HH0A 1NU1K 1H88A 1JY2N 1MFZA 1N7SD 5BVZA 2FYZA 5KJ7C 3KQGA 3VMXA 2WTYA 2XZRA 1NOHA 1T2KD 3BRVB 5APTA 3RK2C 2NPSD 1LTBC 1KILB 3V2QA 1DEBA 2OYIC 1DX7A 1QL2A 1URQC 1KILA 3KDPB 3B5ND 1N86A 2HYNA 2XKMA 1E5WA 3P8MC 4ZKUA 2GUSA 1A02F 1N7SC 1RE3C 1IJDB 2WZ7A 5AVXB 2O1JA 2N1TC 1S9KE 2I1KA 4M3LA 3U1CA 5AW6B 1AQ5A 1WRGA 1RF0A 1LTJB 5AW4B 1ZR2A 2YKPA 2E42A 3GHGB 1LTJA 1JY3O 3GHGA 1J1DB 1LT9C 1FZCC 3V4QA 1GTWA 3HE5B 4XA4A 5CCHA 5AVSB 3HE5A 2C9NY 1G1IA 3VYIA 1JTHB 2CPSA 5AW0B 3TYYA 1JTHA 2FFDA 1H8AA 2OARA 2W6BA 4HH2A 1NH4A 3P7KA 1YTZI 5CJ0A 2GUVA 2W27A 1FZEA 3M9BA 1PFIA 5BU8B 2J58A 3VN0A 1XTCC 5CCGC 4N78D 3CI9A 1FJPA 4C7RA 1N73A 3P8CE 2I1JA 3VTPC 3HUSC 3PP5A 1ZLLA 3I5CA 4DZOA 3V5BA 1NWQA 2R5BA 3OAKA 5APVA 2WWWA 1SLQA 1RF1C 2IPPA 4GT1A 3HE4B 1GU5A 4I1LA 3RL0C 1MUUA 1GW4A 1L4AC 3HE4A 4W7YA 5AVZB 3B8EB 3VP8A 4C46A 3IR9A 3II6A 2WITA 1ZN5A 4I6MC 2OYHC 5KJ7D 3A2AA 3R2PA 3KPEA 1FOSE 3H32B 2H8PD 1GW3A 3H32A 4B86A 1JO5A 1SQPK 2H7HA 3E1IA 2YMYA 2WPQA 2R32A 2HLOA 1URQD 1FDMA 4HYTB 5AW8B 3CL3D 4N6JA 5AVQB 1IFDA 3HD7B 2J59M 2WPSA 3MTUE 2N1TD 5KLVK 1X9VA 1YTZT 3HD7A 1SFCB 4W7ZA 1KFNA 1L0LK 2XV5A 1SFCA 5AW9B 1KILC 2Q9IA 1JY2P 2HFED 1HUCA 1SP4A 1SQXK 3RK3B 3VMYA 1NHLA 2A45I 2WSFH 1LTGC 2M3BA 4WY4B 5KTBA 4WY4A 4W80A 2H43A 1FOSF 1J1EB 1MV8A 3LW5H 4IFFA 1RY3A 3LIEA 5APYA 1RF0C 1NAFA 2W6AA 2R3CA 3U1AA 1LWUB 5AW3B 1LTJC 1GL2B 1LWUA 1ZR4A 1FZGA 3GHGC 2ZFCA 4EIJA 1GL2A 1J1DC 3BVHA 5CCHC 3H6PA 1KFMA 4ZKPA 3C9IA 3VMZA 2WSCH 2HPCB 2PAJA 1JNMA 1NKZB 3IFMA 2FFDC 3O8ZA 1T3UA 1N2DC 1OWAA 2P7JA 2NPSB 1M1JB 5CCGD 2GM4A 2YO3A 2NPSA 1M1JA 1A02J 1SQVK 3B5NB 1T8ZA 3VOPA 1X8YA 2Z5IA 3B5NA 3L36A 4LGDE 3KYQA 5AVVB 1JMMA 2KLVA 5AW7B 1N73C 4Y99B 2P67A 3V2NA 1YYCA 1L0NK 3MD0A 2HG5D 3RL0D 2A45H 3NTNA 1FZFA 4IFDK 2CPBA 1L4AD 2FYUK 1HGZA 3BRTB 3V4WA 3BATA 1KQLA 1HTLC 3M0DA 2P1JA 1H89A 1SQBK 1JY2O 5APSA 1DH3A 4O9BA 1NKNA 2C0WA 4JYCA 1G1JA 1W2EA 2R5DA 2Z5HA 3NXSA 4RESB 1GDTA 1CZQA 1FZAA 1JY3N 2LKMA 2QM7A 1HBWA 2IFNA 3UIAA 2MJZA 1EQ7A 1GK6A 1RE4A 2C0XA 1SQQK 1ZV8A 3VP9A 4C7NB 5BU5A 2Q5UA 1N7LA 1KILD 1NTMK 2VRSA 4C7NA 1MZ9A 3M91A 5APUA 1VDFA 1QL1A 3L37A 5APWA 2O01H 3HD7C 2WT7B 1HWTC 5AW5B 4DOJA 1SFCC 2WT7A 5AW2B 2FXMA 2YNYA 5APQA 1GD2E 1IK9A 4JF7A 1KZUB 1IC2A 3MUDA 1LTSC 3RK3C 2Q3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFM A;  1ZN5 A;  2IFM A;  2KLV A;  1QL2 A;  2IFN A;  2XKM A;  4IFM A;  1IFN A;  1QL1 A;  2KSJ A;  1PFI A;  1IFM A; 
#chains in the Genus database with same CATH topology
 2R44 A;  5H2F H;  1CW5 A;  1NGM B;  3HTK B;  3TF5 A;  3L71 J;  1CSB A;  2KI7 B;  1GL2 C;  3OJA B;  3SWY A;  2P2U A;  3U59 A;  2KP8 A;  1N7S B;  3BCC D;  2YKQ A;  1S9K D;  2RH0 A;  1OW6 A;  2N1T B;  4AYC A;  4KHX A;  1D7M A;  1EDK A;  1T2K C;  2E76 D;  3KXD A;  2NPS C;  3RBX A;  2BAS A;  1Y47 A;  2A45 G;  1IFN A;  3B5N C;  3PTZ A;  3FGA D;  3AE8 C;  1LTT C;  4UB6 H;  1LT9 A;  1FJK A;  1X0T A;  1IFM A;  2FFD B;  1Y9B A;  3SFD C;  3G3Z A;  5B66 H;  4LLH A;  2JJL A;  4U3F J;  3E1R A;  3N4X A;  3ABV C;  2FKW B;  2J5U A;  4RKU J;  1JEK A;  1SQP J;  3EFG A;  3EQ2 A;  4R4L A;  3T97 A;  1PP9 D;  3GW6 A;  1QX8 A;  1VQ4 P;  5AVT B;  3P8C D;  3L4F A;  5CJ4 A;  1GK4 A;  5KLV J;  4HKZ H;  2AXT E;  1ZOY C;  1L0L J;  3HUS A;  1SQX J;  1IO4 A;  3D6Y A;  4WBA A;  5AVR B;  4N3Y B;  3ITK A;  1HVV A;  1L4A B;  2QVA A;  4JYB A;  2IYP A;  3PH0 A;  3CPW O;  3H25 A;  4I2L C;  1NVO A;  3MUD C;  3H1L J;  4L75 A;  2KXP B;  2AEF A;  2QM8 A;  1MFT A;  3RK2 D;  1KB9 I;  2SPZ A;  4ASW A;  1J2J B;  4UB8 E;  4D6T D;  3CME P;  5GTI E;  2OGU A;  2WSE H;  5AW1 B;  2H88 C;  1OVR A;  1HH0 A;  1NU1 K;  3S9O A;  1MFZ A;  3H1J E;  2FYZ A;  3VMX A;  1NOH A;  2QIW A;  2QSI A;  2ZYA A;  2E74 D;  2O01 N;  1YJN P;  1N86 A;  2XKM A;  1NU1 E;  1A02 F;  1N7S C;  5AVX B;  4ZMD A;  3CCR P;  2A06 G;  2N1T C;  1OMI A;  2I1K A;  2BEZ F;  4M3L A;  5AW6 B;  1BDC A;  1P84 E;  1DD3 A;  1RF0 A;  2QJK B;  1FDO A;  3GHG B;  1YI2 P;  1SQB J;  4NPE A;  4WVZ A;  3V4Q A;  5H2F E;  1S2E A;  2M5A A;  5CCH A;  5AVS B;  3HE5 A;  1G1I A;  3GMA A;  1KB9 H;  1JTH A;  2NZ2 A;  1Q81 Q;  2OAR A;  2W6B A;  4HH2 A;  1U7M A;  1NTM J;  1PFI A;  5BU8 B;  2E76 B;  3L71 D;  2Q6Q A;  1USD A;  3CI9 A;  3CXH D;  5DJT B;  2K9J A;  1BCC E;  3G6E P;  3L74 G;  2K9Y A;  4PD4 D;  3O6Q A;  2IPP A;  1AVY A;  2IYO A;  4I1L A;  1WMK A;  1L4A C;  3HE4 A;  2ZXX A;  5B66 E;  3VP8 A;  4C46 A;  3II6 A;  2QJY B;  5KJ7 D;  3A2A A;  2B9B A;  2Y0C A;  3W67 A;  2YMY A;  2BCC J;  1URQ D;  2K37 A;  1VQN P;  5AVQ B;  3L71 G;  4EI2 A;  4W7Z A;  3CCQ P;  3L70 E;  1EDL A;  1NTK E;  1VL2 A;  1EZV I;  1SFC A;  5AW9 B;  2Q9I A;  1JY2 P;  1YIJ P;  1SP4 A;  1LTG C;  1AA0 A;  1BE3 J;  5KTB A;  1FOS F;  3CC7 P;  4PV1 D;  2IDB A;  1SQX D;  1ZR4 A;  3CCL P;  3H1K J;  3GHG C;  3A0H H;  2ITA A;  1VF5 D;  3L72 D;  3C9I A;  1T6A A;  2WSC H;  1P84 D;  1NKZ B;  3O8Z A;  1VQP P;  2P7J A;  5CCG D;  1Q2N A;  3H1L D;  4U3F G;  1M1J A;  1VQ6 P;  1SQV K;  1H0T A;  2K88 A;  3IF4 A;  2IBZ I;  3VOP A;  1FS0 E;  1X8Y A;  2YIU C;  3L73 G;  1BGY D;  3L36 A;  1SQP G;  2E76 C;  5AVV B;  1JMM A;  5KLI B;  1BDD A;  3WUU A;  1N73 C;  3V2N A;  2WQY C;  2HG5 D;  3NTN A;  1FZF A;  4IFD K;  5KLV G;  3WU2 H;  1L0L G;  3M0D A;  2P1J A;  4HJG H;  1SQX G;  1NKN A;  1NTZ D;  4JYC A;  1RQV A;  4YXD C;  1G1J A;  2R5D A;  3L75 E;  2Z5H A;  1FZA A;  1JY3 N;  2LKM A;  3BCC J;  1KB9 E;  1IZN B;  2MJZ A;  1SQB D;  2QJY C;  1GK6 A;  1ZV8 A;  3VP9 A;  3MP7 B;  1KIL D;  5TIS E;  3M91 A;  3PHL A;  5APU A;  1VDF A;  2B87 B;  4K35 A;  4DOJ A;  1E79 H;  2WT7 A;  2FXM A;  2JO1 A;  5EFW B;  4JF7 A;  3G4S P;  4EOT A;  3H1H E;  5AVW B;  4H0L D;  3CLQ A;  2WVR A;  2KS1 B;  1PP9 J;  1NTK D;  2O1K A;  1S5L E;  2FY8 A;  2D2C D;  3M9Q A;  1QEX A;  3OA7 A;  3D6Z A;  2OYI B;  1SQB G;  2NRG A;  1URQ B;  1AFO A;  4IL6 H;  1TU3 F;  1G2C A;  2OTL P;  5CHX A;  5KAI H;  2UWJ E;  4JBZ A;  2KSE A;  1LNQ A;  2HPC A;  3OW2 O;  3FXE A;  2OQQ A;  2AXT H;  1CI6 A;  2GA1 A;  1LGH B;  1RQU A;  1FZC B;  1NTM G;  5KLI C;  4D6T J;  4PV1 B;  3P32 A;  3CC2 P;  1MKM A;  3NFQ A;  1FU1 A;  1S4X A;  3FWL A;  1M1K Q;  2HOD B;  3Q1M A;  4XE5 B;  1IFJ A;  3TNU A;  5GTI H;  1KYO H;  2FYU E;  3BAS A;  3H1K D;  3HD7 D;  1JOC A;  3FX0 A;  1NO4 A;  1WT6 A;  2KOG A;  1LTI C;  3L75 D;  2WPR A;  3RGU A;  1EXJ A;  1RF1 B;  5M1B A;  3A5T A;  3RK3 D;  1KQF B;  1EZV E;  2BCC G;  4WY4 D;  2Z4E A;  3V2P A;  2YXQ B;  2ZXE B;  1AQT A;  2OYH B;  1SQQ E;  3AEA C;  3NMD A;  1K8A Q;  3AEE C;  2KZJ A;  3MIW A;  2JEE A;  3MGN A;  2Y0D A;  3N7N A;  4BRY A;  1BE3 G;  3C1L A;  3A0B E;  5KJ7 C;  3KQG A;  2XZR A;  4CPG A;  3E7K A;  3BRV B;  5APT A;  1RHZ B;  1KQG B;  1LTB C;  1KIL B;  2OYI C;  3H1H D;  3H1K G;  1URQ C;  1KV4 A;  2E75 D;  4ZKU A;  1RE3 C;  1DEE G;  3ZDM A;  2ZT9 D;  2IBZ E;  2Q1K A;  4JPZ B;  3FXD A;  1PGQ A;  3Q3D A;  1OFC X;  4GDO A;  3L74 E;  1LTJ A;  1JY3 O;  4H0L B;  1J1D B;  2K1A A;  1FZC C;  1GTW A;  2CPS A;  2D2C B;  4PV1 C;  3TYY A;  1R5L A;  1H8A A;  4IL6 E;  1LT1 A;  1PIX A;  3JCU H;  1VQK P;  5KAI E;  5CCG C;  4L73 A;  2G8Y A;  3CX5 D;  2I1J A;  3D70 A;  3BCC G;  1M56 D;  3CWB E;  1QVG O;  2KNC B;  3I5C A;  1NWQ A;  3OAK A;  2WWW A;  1L0N D;  1RF1 C;  4GOE A;  3L72 J;  2FYU D;  5AVZ B;  4ASV A;  1K04 A;  1Y8A A;  3PLN A;  1PGJ A;  5L8R J;  2OYH C;  3KPE A;  2E5T A;  3H32 A;  1SQP K;  2H7H A;  2HLO A;  1M8O B;  1BGY J;  1KYO E;  4EYY Q;  1IFD A;  4U3F E;  3HD7 B;  2WPS A;  3MTU E;  2YMK A;  1SQQ D;  5KLV K;  1PP9 G;  3L73 E;  1KFN A;  1L0L K;  2XV5 A;  3RBZ A;  1KIL C;  1SQP E;  1EDJ A;  2HFE D;  1HUC A;  1SQX K;  3RK3 B;  2A45 I;  2WSF H;  2M3B A;  4WY4 B;  2QRX A;  1NTZ J;  3TGU E;  2LXC B;  1MV8 A;  3LW5 H;  3I56 P;  5APY A;  2W6A A;  2OTJ P;  1LWU B;  1FZG A;  2ZYG A;  2ZFC A;  1GL2 A;  3CCJ P;  4H0L C;  1J1D C;  3BVH A;  4ZKP A;  2HPC B;  1JNM A;  3GLM A;  2FFD C;  2D2C C;  1OWA A;  4D6T G;  2GM4 A;  4WWI A;  2YO3 A;  2NPS A;  1KC8 Q;  1A02 J;  1DD4 A;  1T8Z A;  1IK7 A;  2E75 B;  3B5N A;  2Z5I A;  4LGD E;  2JR8 A;  3GF3 A;  5TIS H;  4MN4 C;  5AW7 B;  2JWA A;  4IL6 X;  2A45 H;  3AEC C;  2AXC A;  4EDF A;  1NTK J;  2Q3E A;  3BRT B;  2FXO A;  1KQL A;  1HTL C;  3Q5P A;  1LP1 B;  3H1I E;  1H89 A;  1SQB K;  1PZQ A;  2JWD A;  1HJ0 A;  2V7Q H;  2P58 A;  1GDT A;  1CZQ A;  1BSH A;  1PGP A;  2IFN A;  1EQ7 A;  2XND H;  3CWB D;  1S5L H;  1SS1 A;  2C0X A;  1PPJ E;  3G71 P;  3KHU A;  1NTM K;  3JCU E;  4C7N A;  2WSE J;  1EDI A;  1QL1 A;  1U57 A;  3L37 A;  1VQ5 P;  3IAO A;  1VQ7 P;  2O01 H;  3HD7 C;  3R4Y A;  1HWT C;  1M90 Q;  2YNY A;  1NTM E;  3PRJ A;  3MUD A;  1LTS C;  3RK3 C;  3G9R A;  3AED C;  2KSJ A;  1KYO D;  1U7J A;  4WY4 C;  3H1J D;  1VPC A;  5CCH D;  5CBN A;  3HTK A;  2KYV A;  2AEJ A;  2YKO A;  1LWU C;  2QJK C;  3M0A A;  3RK2 B;  1JUN A;  3SSU A;  3TSI A;  1NU1 D;  1FBM A;  3TGU D;  1OZH A;  3LID A;  3S4R A;  3L75 J;  1N7S A;  3A7O A;  1OXZ A;  2KZI A;  2N1T A;  2E74 B;  1IFI A;  1JM0 A;  1USE A;  3JSV C;  2E75 C;  2IFM A;  1LT9 B;  4R4M A;  2BCC E;  1M7L A;  5AVU B;  2QE7 H;  2M8R A;  1T3J A;  4N78 E;  1SQV E;  1JCD A;  3M06 A;  2POH A;  4AUW A;  3T97 B;  3H1H J;  1Z56 A;  3CMA P;  2IZ1 A;  4LC1 A;  3L35 A;  3L72 G;  1NAY A;  3A0B H;  1RE4 C;  1OVU A;  1BCC D;  3PJS K;  3HUS B;  3H1I D;  1LTA C;  1SFC D;  1JY3 P;  1OIP A;  1KD1 Q;  3H1L G;  3AEB C;  1QVF O;  3CXH I;  2XDJ A;  5DJU B;  2YXR B;  1K73 Q;  1BGY G;  4H44 D;  1L4A A;  2RN0 A;  2Q7C A;  2WMM A;  2E43 A;  1PPJ D;  2FBW C;  4PD4 I;  4WB4 A;  1JCC A;  3TK1 A;  4AQR D;  1ZME C;  3A3Y B;  2WPV B;  1K05 A;  1N7S D;  1NTZ G;  1JMB A;  3L70 D;  2QEX P;  3RK2 C;  2H89 C;  1DX7 A;  3KDP B;  2HYN A;  1E5W A;  1YIT P;  3SWK A;  2WSC J;  1VQM P;  1S9K E;  1L0N J;  2E74 C;  2PFX A;  1WRG A;  2FYU J;  5C39 A;  4I7Z B;  2ZVN B;  5AW4 B;  1S72 P;  3Q5S A;  2E42 A;  1L2P A;  4JQ0 D;  3GHG A;  2M5A B;  1LT9 C;  4U7J A;  3HE5 B;  1VQ9 P;  3MZW B;  2C9N Y;  3IN6 A;  3VYI A;  1JTH B;  3AE6 C;  5AW0 B;  1SQQ J;  3AEF C;  1VF5 B;  3P7K A;  1YQ4 C;  1YTZ I;  1NTK G;  2GUV A;  5CJ0 A;  4YXW H;  2W27 A;  1FZE A;  3M9B A;  2J58 A;  2DW3 A;  1QGK B;  1XTC C;  4N78 D;  2N9Y B;  4C7R A;  5TJH A;  1N73 A;  3P8C E;  2K9J B;  3AE9 C;  1QLE D;  3VTP C;  3HUS C;  1R8E A;  3CC4 P;  3PP5 A;  1S3J A;  4DZO A;  3O6Q B;  2A06 E;  1ZP0 C;  4GT1 A;  4Y28 J;  3HE4 B;  5CBO A;  1KB9 D;  1Q90 D;  1GW4 A;  3JC2 2;  3B8E B;  1AV1 A;  1ZN5 A;  4OGQ D;  4I6M C;  4DJG A;  2JKV A;  2RMZ A;  2H8P D;  1JO5 A;  2JP3 A;  4H13 D;  3E1I A;  2WPQ A;  2R32 A;  5AW8 B;  4N6J A;  1K9M Q;  1EXI A;  1AVO A;  1X9V A;  1YTZ T;  1SFC B;  1Q86 Q;  4ZNC A;  1S5L X;  4H44 B;  1J1E B;  1OW8 A;  4IFF A;  3L75 G;  1RY3 A;  1RF0 C;  3KZI E;  3U1A A;  5AW3 B;  4I7Z C;  1AJY A;  3CWB J;  3F5H A;  4EIJ A;  1VQ8 P;  4PJ0 E;  5CCH C;  3W68 A;  3IFM A;  1NYH A;  1VQL P;  1M1J B;  2E5Y A;  1H0T B;  2QG4 A;  3I55 P;  1VF5 C;  1OX3 A;  2BEQ D;  3H1H G;  3L71 E;  4Y99 B;  2P67 A;  1YYC A;  3H1J J;  3RL0 D;  3CXH E;  5E79 H;  3L73 J;  3BAT A;  5KAF E;  1PV3 A;  1DH3 A;  3EWK A;  4O9B A;  2C0W A;  1W2E A;  1NU1 J;  4PD4 E;  3TGU J;  3AE1 C;  2WSS H;  1HBW A;  3UIA A;  4GOD A;  3CCM P;  4YPC A;  4TLF A;  2PRR A;  4IOI H;  2A06 D;  2Q5U A;  1N7L A;  2VRS A;  5KKZ B;  1EZV D;  1YJ9 P;  1YBK A;  2QJP B;  5APW A;  4TT3 H;  2CK3 H;  1JB0 J;  2WT7 B;  2B87 A;  1SFC C;  2Y0E A;  1KZU B;  1IC2 A;  2Q3I A;  4NPF X;  4H44 C;  1RH5 B;  1J1E C;  2YO2 A;  4OGQ B;  1BSN A;  2M3E A;  2O3J A;  5KLV E;  1L0N G;  1HGV A;  2KS1 A;  5KJ7 A;  1L0L E;  3AE4 C;  1W5C E;  2QA4 P;  2FYU G;  4RJT A;  3EFF K;  1BCC J;  1SQX E;  3H1I J;  4H13 B;  1FC2 C;  1G2C B;  2OYI A;  2IX7 C;  1URQ A;  2IBZ D;  3L72 E;  1RE3 A;  3WMM 0;  1EZV G;  1CI6 B;  1M1J C;  1HJB A;  2N9B A;  3L74 D;  1PGO A;  4L76 A;  3H1L E;  2PP6 A;  1SQQ G;  4XFJ A;  2I8D A;  1FZB A;  2ZT9 B;  5CMZ A;  1BGY E;  1FZC A;  4HB1 A;  1FAV A;  1DIP A;  2KK7 A;  1NTZ K;  4Y99 C;  4OVN F;  1X79 B;  4OH8 B;  3M0D C;  1Q82 Q;  3L70 J;  2L91 A;  4BXL A;  3SWF A;  2YIU B;  3CCV P;  2FXP A;  4GIF A;  4K3A A;  2C9L Y;  3TNU B;  2HOD A;  1YJW P;  1NTZ E;  2PGD A;  1N73 B;  3V2R A;  1GU4 A;  1ZW0 A;  5CCG A;  4IFM A;  2IBZ G;  2P10 A;  4GOF A;  1GZL A;  1SQB E;  1OVV A;  3GF7 A;  2XU6 A;  4UB6 E;  2M0B A;  2RKL A;  2KB7 P;  3CX5 I;  5APX A;  5KKZ C;  1KIL E;  1EC5 A;  3VMA A;  1XTG B;  3M9H A;  3RL0 B;  1RF1 A;  4DCK A;  3HRN A;  2QJP C;  1YQ3 C;  2XNX A;  2L5G B;  5E79 E;  1ZRT E;  3USS A;  1ZXG A;  2OYH A;  1NTK K;  2KLU A;  4GKG A;  2FYN B;  3AE3 C;  5B5E H;  1GL2 D;  5AVY B;  2WSF J;  4BRY B;  3GG2 A;  1SVF A;  2LXB A;  4U3F D;  1H88 A;  1JY2 N;  3LW5 J;  4OGQ C;  5BVZ A;  2WTY A;  2ZAE B;  3L73 D;  1T2K D;  1SQV J;  2V4H A;  2NPS D;  1SQP D;  3V2Q A;  1DEB A;  4H13 C;  3CWB G;  1QL2 A;  2OTK E;  1KIL A;  3B5N D;  1LJ2 A;  3P8M C;  2GUS A;  2B88 A;  1IJD B;  3S1K A;  1KQS O;  2WZ7 A;  2IZ0 A;  5KLV D;  2O1J A;  1YHQ P;  3U1C A;  3CCU P;  1L0L D;  1AQ5 A;  2K3R A;  1HF9 A;  1S1C X;  3CX5 H;  1LTJ B;  1NJI Q;  1KOR A;  1ZR2 A;  2YKP A;  4YTP C;  4RO0 A;  2ZT9 C;  4XA4 A;  3Q5R A;  2B89 A;  4DT0 A;  2FFD A;  3H1J G;  2KIK A;  2W8Z A;  1NH4 A;  2MKV A;  1FDI A;  2G3A A;  3F89 A;  1BE3 E;  5GTH H;  3VN0 A;  2V7Q J;  1X22 A;  1NU1 G;  3AE7 C;  1FJP A;  3TGU G;  4KT0 J;  1GMJ A;  3H1K E;  5K5G B;  1ZLL A;  3V5B A;  1N8R Q;  2KNC A;  3WUV A;  3AEG C;  2R5B A;  1R5S A;  3K5B A;  5APV A;  1M57 D;  1SLQ A;  1GU5 A;  3RL0 C;  1MUU A;  3RK3 E;  4W7Y A;  2O01 J;  3IR9 A;  2W6J H;  2WIT A;  3KZI H;  1KMI Z;  3R2P A;  3CCE P;  1FOS E;  2OYO A;  1Q7Y Q;  2Y9Y A;  2FYN C;  3H32 B;  3TDK A;  2KUB A;  1GW3 A;  4B86 A;  4PJ0 H;  4Z1M H;  3CD6 P;  3B71 A;  1FDM A;  4HYT B;  3CL3 D;  2AEM A;  1VQO P;  2J59 M;  1ZRT D;  2N1T D;  3HD7 A;  4L74 A;  3V6I A;  1NTM D;  2Y9Z A;  1BCC G;  3H1I G;  3VMY A;  1NHL A;  2HR3 A;  3FWN A;  4OWF A;  4WY4 A;  4W80 A;  2H43 A;  3BCC E;  3LIE A;  1UIX A;  3WUT A;  1NAF A;  2R3C A;  2JDI H;  1LTJ C;  1KYO I;  3CXH H;  1GL2 B;  1LWU A;  3SFE C;  1PL5 A;  1UII A;  2ZJS E;  5B5E E;  5KAF H;  1FE6 A;  4KJM A;  1PPJ G;  3H6P A;  1KFM A;  3VMZ A;  2PAJ A;  4A7P A;  4PD4 H;  1KN7 A;  1T3U A;  1N2D C;  2NPS B;  3C8V A;  2ZYD A;  3RL0 g;  4NPD A;  3B5N B;  3QWO C;  3Q2Y A;  1KTM A;  2BCC D;  3L70 G;  1P84 I;  3KYQ A;  2KLV A;  2W90 A;  3D71 A;  1PP9 E;  1L0N K;  3MD0 A;  1SQV D;  2W83 C;  3AE5 C;  1OW7 A;  3CX5 E;  2CPB A;  1L4A D;  2FYU K;  1HGZ A;  3A0H E;  3V4W A;  1JY2 O;  5APS A;  1BE3 D;  1LP1 A;  4BWN A;  2LR2 A;  3B4S A;  4UB8 H;  1L0N E;  3NXS A;  4RES B;  2QM7 A;  1W2B O;  3AE2 C;  4QMA A;  1RE4 A;  1IFP A;  1SQQ K;  3L74 J;  4C7N B;  3MHV A;  5BU5 A;  5GTH E;  1MZ9 A;  4D6T E;  3CCS P;  1P84 H;  5AW5 B;  3WU2 E;  2ZVO B;  5AW2 B;  5APQ A;  1GD2 E;  1SQV G;  1IK9 A;  2R3S A;  3QH9 A; 
#chains in the Genus database with same CATH homology
 4EOT A;  1CW5 A;  5AVW B;  4WY4 C;  3HTK B;  1VPC A;  5CCH D;  3CLQ A;  3HTK A;  1J1E C;  2KYV A;  2YO2 A;  2YKO A;  1CSB A;  2O1K A;  1HGV A;  5KJ7 A;  1LWU C;  3M9Q A;  3M0A A;  1GL2 C;  3RK2 B;  3OA7 A;  1JUN A;  3OJA B;  3SWY A;  2P2U A;  2OYI B;  3TSI A;  3U59 A;  1URQ B;  1G2C B;  2OYI A;  1AFO A;  1FBM A;  2IX7 C;  2KP8 A;  1URQ A;  1G2C A;  1N7S B;  3LID A;  2YKQ A;  1S9K D;  5CHX A;  2N1T B;  4AYC A;  1N7S A;  1RE3 A;  4KHX A;  3A7O A;  1OXZ A;  3WMM 0;  1T2K C;  2HPC A;  2N1T A;  1CI6 B;  2NPS C;  1IFI A;  1M1J C;  1HJB A;  2N9B A;  2BAS A;  1CI6 A;  2A45 G;  1LGH B;  1IFN A;  3B5N C;  2PP6 A;  2IFM A;  1LT9 B;  1FZC B;  1FZB A;  1LTT C;  5CMZ A;  1M7L A;  1LT9 A;  1FZC A;  5AVU B;  1FJK A;  1FAV A;  1IFM A;  2M8R A;  2FFD B;  1NTZ K;  4Y99 C;  3G3Z A;  3P32 A;  1T3J A;  4LLH A;  2JJL A;  4N78 E;  3NFQ A;  1FU1 A;  3N4X A;  1X79 B;  4OH8 B;  1JCD A;  3M0D C;  3M06 A;  2FKW B;  3SWF A;  2HOD B;  4GIF A;  2POH A;  2C9L Y;  4XE5 B;  3TNU B;  2HOD A;  4AUW A;  1IFJ A;  3EFG A;  3TNU A;  3EQ2 A;  1Z56 A;  3T97 A;  1N73 B;  4LC1 A;  3V2R A;  1GU4 A;  5AVT B;  3P8C D;  3L35 A;  3L4F A;  5CJ4 A;  5CCG A;  1GK4 A;  4IFM A;  3BAS A;  1RE4 C;  3HUS B;  1GZL A;  3HD7 D;  3HUS A;  1JOC A;  1NO4 A;  1WT6 A;  2KOG A;  1LTA C;  1SFC D;  1JY3 P;  1IO4 A;  1LTI C;  2XU6 A;  2WPR A;  2KB7 P;  4WBA A;  5AVR B;  4N3Y B;  5APX A;  1RF1 B;  1HVV A;  3A5T A;  3RK3 D;  2XDJ A;  1XTG B;  3M9H A;  3RL0 B;  1RF1 A;  3HRN A;  1L4A B;  4WY4 D;  2Z4E A;  4JYB A;  3V2P A;  1L4A A;  2Q7C A;  2XNX A;  2ZXE B;  2OYH B;  2E43 A;  2L5G B;  3NMD A;  4I2L C;  2OYH A;  4WB4 A;  1NTK K;  1JCC A;  2QM8 A;  4GKG A;  3TK1 A;  4AQR D;  3RK2 D;  1GL2 D;  3MIW A;  2JEE A;  5AVY B;  2KSJ A;  3A3Y B;  1J2J B;  1SVF A;  3MGN A;  2WSE H;  5AW1 B;  3N7N A;  1HH0 A;  1NU1 K;  1H88 A;  1JY2 N;  1MFZ A;  1N7S D;  5BVZ A;  2FYZ A;  5KJ7 C;  3KQG A;  3VMX A;  2WTY A;  2XZR A;  1NOH A;  1T2K D;  3BRV B;  5APT A;  3RK2 C;  2NPS D;  1LTB C;  1KIL B;  3V2Q A;  1DEB A;  2OYI C;  1DX7 A;  1QL2 A;  1URQ C;  1KIL A;  3KDP B;  3B5N D;  1N86 A;  2HYN A;  2XKM A;  1E5W A;  3P8M C;  4ZKU A;  2GUS A;  1A02 F;  1N7S C;  1RE3 C;  1IJD B;  2WZ7 A;  5AVX B;  2O1J A;  2N1T C;  1S9K E;  2I1K A;  4M3L A;  3U1C A;  5AW6 B;  1AQ5 A;  1WRG A;  1RF0 A;  1LTJ B;  5AW4 B;  1ZR2 A;  2YKP A;  2E42 A;  3GHG B;  1LTJ A;  1JY3 O;  3GHG A;  1J1D B;  1LT9 C;  1FZC C;  3V4Q A;  1GTW A;  3HE5 B;  4XA4 A;  5CCH A;  5AVS B;  3HE5 A;  2C9N Y;  1G1I A;  3VYI A;  1JTH B;  2CPS A;  5AW0 B;  3TYY A;  1JTH A;  2FFD A;  1H8A A;  2OAR A;  2W6B A;  4HH2 A;  1NH4 A;  3P7K A;  1YTZ I;  5CJ0 A;  2GUV A;  2W27 A;  1FZE A;  3M9B A;  1PFI A;  5BU8 B;  2J58 A;  3VN0 A;  1XTC C;  5CCG C;  4N78 D;  3CI9 A;  1FJP A;  4C7R A;  1N73 A;  3P8C E;  2I1J A;  3VTP C;  3HUS C;  3PP5 A;  1ZLL A;  3I5C A;  4DZO A;  3V5B A;  1NWQ A;  2R5B A;  3OAK A;  5APV A;  2WWW A;  1SLQ A;  1RF1 C;  2IPP A;  4GT1 A;  3HE4 B;  1GU5 A;  4I1L A;  3RL0 C;  1MUU A;  1GW4 A;  1L4A C;  3HE4 A;  4W7Y A;  5AVZ B;  3B8E B;  3VP8 A;  4C46 A;  3IR9 A;  3II6 A;  2WIT A;  1ZN5 A;  4I6M C;  2OYH C;  5KJ7 D;  3A2A A;  3R2P A;  3KPE A;  1FOS E;  3H32 B;  2H8P D;  1GW3 A;  3H32 A;  4B86 A;  1JO5 A;  1SQP K;  2H7H A;  3E1I A;  2YMY A;  2WPQ A;  2R32 A;  2HLO A;  1URQ D;  1FDM A;  4HYT B;  5AW8 B;  3CL3 D;  4N6J A;  5AVQ B;  1IFD A;  3HD7 B;  2J59 M;  2WPS A;  3MTU E;  2N1T D;  5KLV K;  1X9V A;  1YTZ T;  3HD7 A;  1SFC B;  4W7Z A;  1KFN A;  1L0L K;  2XV5 A;  1SFC A;  5AW9 B;  1KIL C;  2Q9I A;  1JY2 P;  2HFE D;  1HUC A;  1SP4 A;  1SQX K;  3RK3 B;  3VMY A;  1NHL A;  2A45 I;  2WSF H;  1LTG C;  2M3B A;  4WY4 B;  5KTB A;  4WY4 A;  4W80 A;  2H43 A;  1FOS F;  1J1E B;  1MV8 A;  3LW5 H;  4IFF A;  1RY3 A;  3LIE A;  5APY A;  1RF0 C;  1NAF A;  2W6A A;  2R3C A;  3U1A A;  1LWU B;  5AW3 B;  1LTJ C;  1GL2 B;  1LWU A;  1ZR4 A;  1FZG A;  3GHG C;  2ZFC A;  4EIJ A;  1GL2 A;  1J1D C;  3BVH A;  5CCH C;  3H6P A;  1KFM A;  4ZKP A;  3C9I A;  3VMZ A;  2WSC H;  2HPC B;  2PAJ A;  1JNM A;  1NKZ B;  3IFM A;  2FFD C;  3O8Z A;  1T3U A;  1N2D C;  1OWA A;  2P7J A;  2NPS B;  1M1J B;  5CCG D;  2GM4 A;  2YO3 A;  2NPS A;  1M1J A;  1A02 J;  1SQV K;  3B5N B;  1T8Z A;  3VOP A;  1X8Y A;  2Z5I A;  3B5N A;  3L36 A;  4LGD E;  3KYQ A;  5AVV B;  1JMM A;  2KLV A;  5AW7 B;  1N73 C;  4Y99 B;  2P67 A;  3V2N A;  1YYC A;  1L0N K;  3MD0 A;  2HG5 D;  3RL0 D;  2A45 H;  3NTN A;  1FZF A;  4IFD K;  2CPB A;  1L4A D;  2FYU K;  1HGZ A;  3BRT B;  3V4W A;  3BAT A;  1KQL A;  1HTL C;  3M0D A;  2P1J A;  1H89 A;  1SQB K;  1JY2 O;  5APS A;  1DH3 A;  4O9B A;  1NKN A;  2C0W A;  4JYC A;  1G1J A;  1W2E A;  2R5D A;  2Z5H A;  3NXS A;  4RES B;  1GDT A;  1CZQ A;  1FZA A;  1JY3 N;  2LKM A;  2QM7 A;  1HBW A;  2IFN A;  3UIA A;  2MJZ A;  1EQ7 A;  1GK6 A;  1RE4 A;  2C0X A;  1SQQ K;  1ZV8 A;  3VP9 A;  4C7N B;  5BU5 A;  2Q5U A;  1N7L A;  1KIL D;  1NTM K;  2VRS A;  4C7N A;  1MZ9 A;  3M91 A;  5APU A;  1VDF A;  1QL1 A;  3L37 A;  5APW A;  2O01 H;  3HD7 C;  2WT7 B;  1HWT C;  5AW5 B;  4DOJ A;  1SFC C;  2WT7 A;  5AW2 B;  2FXM A;  2YNY A;  5APQ A;  1GD2 E;  1IK9 A;  4JF7 A;  1KZU B;  1IC2 A;  3MUD A;  1LTS C;  3RK3 C;  2Q3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...