2KSJA

Structure and dynamics of the membrane-bound form of pf1 coat protein: implications for structural rearrangement during virus assembly
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of the membrane-bound form of Pf1 coat protein: implications of structural rearrangement for virus assembly.
pubmed doi rcsb
source organism Pseudomonas phage pf1
molecule tags Viral protein
molecule keywords Capsid protein G8P
total genus 11
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2010-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ksjA00
2XKMA 1PFIA 2KLVA 2IFNA 1ZN5A 1IFNA 3IFMA 4IFMA 1QL1A 1IFMA 1QL2A 2IFMA 2KSJA
chains in the Genus database with same CATH superfamily
1NTKK 4U7JA 3CCMP 4WB4A 3GHGB 4LLHA 1IFNA 1SQVG 3Q1MA 3H1HJ 3AEEC 4A7PA 1NOHA 1JY2N 1MFZA 1NAYA 1UIXA 2FYUE 2W27A 3AE2C 3BCCG 1N7SC 4I1LA 1S72P 4Z1MH 1GU4A 1RQUA 1USEA 5KAFE 1VQOP 2ZT9C 5CCGD 1X8YA 2W6AA 3NXSA 4LGDE 2W83C 4W80A 5AW3B 3V5BA 3VMAA 2PFXA 3HD7B 3VP9A 3MGNA 1EDIA 3JC22 2XDJA 1NTZJ 3H1JJ 2ZJSE 1KMIZ 3SWKA 5AVWB 5KJ7A 3AE5C 1IZNB 2YKPA 4UB8E 1SFCB 4HJGH 2QJPC 1T8ZA 3C1LA 1AFOA 1KV4A 4D6TD 3AE8C 4DOJA 2JO1A 5APQA 2FXPA 1PP9D 4PV1C 1NTMK 2QIWA 1Y8AA 4N3YB 1VQ7P 1SQPK 2Q6QA 1RHZB 4XA4A 1PGJA 1GD2E 1QEXA 2P1JA 3KYQA 4U3FE 1Q86Q 4GT1A 1X79B 1EDKA 2W6BA 3B5NA 1RE3C 2WSCJ 1IO4A 1MZ9A 2Y0CA 3L71E 2KSEA 1L0NG 3TF5A 1JCCA 2R5DA 1RE4C 1SS1A 1KFNA 2WQYC 4EIJA 2FY8A 1RF1C 1JY2P 2D2CC 3TK1A 4ZKPA 2GUSA 2ZVNB 1VQMP 1SLQA 2IDBA 1KYOE 1XTGB 1LTJA 3OW2O 3ABVC 2RMZA 2Z5HA 3VMYA 4ASWA 3PLNA 2NZ2A 3KZIE 1KILD 1IJDB 2V4HA 3RGUA 2O01H 1P84E 2HLOA 4ZMDA 1OVUA 2QEXP 3P8CE 4PD4E 3KHUA 3H32B 1LJ2A 3L73J 1X9VA 3GG2A 4PV1D 3L75D 1BCCE 1SQBE 2JWDA 1S5LE 3KXDA 4JF7A 2K1AA 5AW0B 1BE3E 2M3EA 3WUVA 5KLVJ 4C7NB 1LNQA 2WT7A 2KS1B 4KT0J 5APWA 1VQLP 1DEBA 4BXLA 2QSIA 2HG5D 1M1JB 1S4XA 1U7JA 2FBWC 3L74J 1OX3A 2KP8A 4I7ZC 1NTMJ 5E79H 3WU2E 1KILE 2WITA 3P7KA 2YXRB 3HRNA 3L72J 1Z56A 1VQNP 2D2CD 4PD4D 4OH8B 3L70E 3TGUD 1ZR4A 1FZAA 3CLQA 4GODA 3SWFA 1DD3A 1IFIA 1FZBA 3HUSC 4C7NA 1LP1B 3VYIA 5GTHH 3B5ND 1VL2A 1LTIC 4RJTA 1SQBD 1BCCD 3L35A 1KILC 1SQXD 1AA0A 1LGHB 2E75D 2V7QH 4R4LA 4W7YA 2OARA 3VOPA 5KLVG 2C9NY 4I2LC 1M1KQ 2AXTE 3M9QA 3QH9A 2JKVA 3CWBG 4JBZA 1NVOA 3RL0D 4RKUJ 5TISH 3CC2P 1NTZD 3H1JD 1J1DB 1JY2O 1KYOI 2JR8A 2KIKA 5BU5A 2OYIA 4AQRD 1JOCA 3HTKA 2OGUA 1SQQK 1QL2A 1L0LJ 3L74D 4JPZB 2FFDB 1PZQA 1SQPD 3GF3A 1IC2A 5KAIH 3CCQP 3M0AA 1YJ9P 2HPCB 1ZMEC 3CCJP 5AVQB 3PTZA 1CSBA 5AW4B 4L74A 1BSNA 3TYYA 5AVRB 2PRRA 3A0HE 2IYOA 2KOGA 2WWWA 2ZT9B 3BCCE 5KLVK 1NJIQ 1FE6A 1W2EA 2OQQA 1JMBA 4PJ0H 4C7RA 3K5BA 3V2QA 1SVFA 1S5LH 3CL3D 3G4SP 5KAIE 1FZCC 1K04A 2WPRA 1ZV8A 3M06A 4H13B 5APYA 1OW8A 2Q7CA 2PGDA 4N78E 2QJPB 1DD4A 3B5NC 1GMJA 3G6EP 2Z4EA 1M7LA 2H89C 2IFMA 2M3BA 3CI9A 5M1BA 1KQSO 1JY3O 2MJZA 3CXHD 3H1KD 2H88C 1SQQD 1EZVD 2OTKE 3LIEA 5AVZB 1QX8A 5CCGC 1ZP0C 4I7ZB 4D6TG 1Y9BA 1DX7A 1L4AA 1HGVA 5KKZB 4NPFX 1L0ND 3CCEP 1URQB 3CMEP 1KYOH 2YO3A 5GTHE 2XNXA 2Y9YA 1RF1A 1IK9A 1LTSC 2RN0A 1VDFA 1KC8Q 4DCKA 1VQ5P 4N6JA 3A2AA 4WWIA 4D6TE 1X22A 1PIXA 3N4XA 3Q3DA 1JUNA 1GW4A 2KI7B 1OMIA 2OYOA 1SQQG 1L0LK 3GHGA 1GL2C 1IFPA 1JTHA 2G3AA 2HODA 2P7JA 4L76A 1VPCA 1PL5A 4Y28J 3CXHE 2FFDA 3LIDA 3BVHA 3RK3E 1XTCC 1FBMA 2KZIA 2M0BA 3USSA 3W67A 1YI2P 2KK7A 1OIPA 2IYPA 2Y0DA 1NHLA 4L75A 4NPDA 1WRGA 5AW2B 1GTWA 1KB9I 1WT6A 1H8AA 4UB8H 3LW5H 3ZDMA 1JY3P 1EZVI 1ZOYC 2A06G 3SFDC 3EFFK 1KQFB 1VF5B 3CCUP 2IFNA 1EXJA 1SQXJ 1T3UA 3VP8A 3IR9A 2A06E 2NPSA 5CBNA 2H7HA 3A0BE 3RL0C 3V2NA 2NRGA 3KZIH 5AW6B 1G2CA 1FDIA 1N86A 1UIIA 3Q2YA 3M0DC 1LT9B 4RESB 4EI2A 1HJ0A 3WMM0 1W5CE 4DT0A 5AVXB 5APUA 2R32A 1BDDA 1NTMD 3G9RA 1SQQJ 2K3RA 2WTYA 3PRJA 1L4AD 1SQQE 2FKWB 3JCUE 1PGOA 1FS0E 1SQXG 3CXHH 4HYTB 5CJ0A 3S1KA 5KJ7C 5KTBA 1K9MQ 3MD0A 2Z5IA 4Y99C 5CBOA 3RK3B 1A02F 1K73Q 1LT9A 2A06D 2H8PD 2WMMA 3U1AA 4PV1B 2NPSD 3L73D 3AEFC 3MTUE 2FFDC 3L72E 2BEZF 3A3YB 1HF9A 3H1LG 2AEFA 3CX5E 4W7ZA 3NTNA 3V6IA 1M90Q 1H88A 2UWJE 5L8RJ 1LTBC 2E74D 2FYUD 3M0DA 1JCDA 1L2PA 4IL6H 1QGKB 2OTJP 2E75C 2OYHB 1LTJC 3RK3D 1CI6A 4YXDC 2IPPA 3LW5J 1VQ8P 1HJBA 2N9BA 3L74G 1GZLA 1RH5B 1SQXK 1SQPG 1L4AB 2ZFCA 2HR3A 2H43A 1YITP 1AVOA 2KLVA 3V4WA 5CCGA 1YIJP 1Q90D 1N73A 1PV3A 5C39A 2VRSA 2I1JA 3L74E 5AW5B 1NTME 2YMKA 2V7QJ 1OFCX 5KJ7D 1QVFO 2XV5A 1SP4A 2IX7C 2QJYB 1N73C 1PP9E 3IN6A 4KJMA 1EXIA 3RL0B 1OVVA 2WSFH 3F5HA 3MIWA 5H2FE 2W90A 4IFMA 1FAVA 2M8RA 1LP1A 2QM7A 2K9JB 2L91A 1WMKA 4JYCA 2K9JA 1S9KD 2FYNC 3II6A 4GKGA 3RBXA 3L70J 4EOTA 3Q5SA 2K37A 2XNDH 1OVRA 3L71D 3D70A 2C0WA 2J58A 3CXHI 1FJKA 1EZVG 3H6PA 1N7SD 1SFCD 3H1KJ 3SFEC 5KLVE 1R5LA 2BCCD 2KXPB 1NU1K 3D6YA 1KB9E 1GDTA 1NTKG 2QRXA 2B87B 3HUSA 5TISE 1CW5A 3SSUA 2AXTH 1JB0J 2E74B 2N1TB 4TT3H 4H44D 3CCVP 2I1KA 4OWFA 5CJ4A 5B5EH 2R5BA 1USDA 3CX5I 1G2CB 2GA1A 2Y9ZA 2SPZA 1ZXGA 3KQGA 1SQBK 1PPJG 3W68A 5BU8B 3G71P 3JSVC 4H13C 4H44B 3O6QB 1L4AC 1BDCA 1FZCA 3AE1C 3T97A 1FOSE 1SQPJ 1Q7YQ 2ZYDA 1EZVE 1BE3G 3WU2H 1S2EA 1JM0A 1GL2D 2WPSA 4MN4C 4L73A 4IL6X 1LTJB 2OTLP 1PPJE 1KB9D 1N8RQ 1PFIA 1M56D 1J1EC 5H2FH 1YTZT 2AXCA 2ZYAA 2NPSC 3HE5A 1JEKA 5EFWB 5APTA 4UB6H 1GW3A 2I8DA 1E5WA 1JMMA 1KZUB 3CWBE 1SFCC 3H1HG 4ASVA 2RH0A 2HFED 2E76D 2RKLA 2WPQA 4I6MC 5DJUB 3T97B 2B87A 1FZCB 1AQ5A 2OYIC 1LT9C 4K35A 3C8VA 2YXQB 3H1HE 4YTPC 3H1KG 4B86A 2KNCB 3RK3C 1FZFA 2Q9IA 1AVYA 1KTMA 1SQVD 3L75G 4YPCA 4O9BA 4DJGA 2YMYA 2ZAEB 1DH3A 1GK4A 3F89A 1SFCA 3L70G 3M9HA 3CCSP 1GU5A 3L73G 5AVSB 3HUSB 2R3SA 1ZLLA 3H1JG 5KLIB 3BRVB 1S9KE 1T2KC 3AE3C 1L0LG 1M57D 3B4SA 3ITKA 2J59M 3P8MC 3V2RA 3B8EB 4EDFA 2WZ7A 2FYUG 1Q82Q 2WSSH 1FJPA 3HD7D 3CWBJ 4LC1A 4WY4A 1YJWP 1G1IA 1AV1A 1FDMA 3P32A 1LTAC 3UIAA 3H1HD 5AW8B 3PJSK 1E79H 4C46A 1ZR2A 1M8OB 2ZVOB 3H1IG 3TDKA 3BATA 2YO2A 3KPEA 1BGYE 1VF5C 5AVVB 1AQTA 1NAFA 1BGYJ 1NTKE 4H0LC 3TNUA 2E43A 3PHLA 4IFDK 1LTGC 3AEAC 1P84I 1T3JA 3FGAD 2P67A 3CWBD 1SQXE 5B66E 3OAKA 4WY4B 2FYNB 1A02J 2BCCJ 1KYOD 2BEQD 2FXOA 2JWAA 1T6AA 3MP7B 2QJKB 2Q5UA 2WVRA 1NU1J 3WUUA 5KAFH 4YXWH 1EDLA 2P10A 3PH0A 4HH2A 3GLMA 1KB9H 3A0BH 3H1ID 4NPEA 4U3FD 4XFJA 3Q5PA 4OGQB 3M9BA 4XE5B 2IBZG 1HH0A 3HD7A 4WY4D 4ZNCA 3L73E 1FU1A 3P8CD 2LXBA 4RO0A 2C9LY 1L0NE 2KB7P 2O1KA 3RK2D 1S3JA 4H0LB 2OYHA 2WSFJ 1U7MA 3O8ZA 1K05A 1RF1B 2D2CB 1KQGB 1BCCJ 1SQBJ 2E5YA 2QG4A 2QVAA 1KORA 2BCCG 1VQ6P 3H1KE 5CMZA 1HTLC 1HVVA 1OW6A 2N1TD 1KN7A 5DJTB 2W8ZA 1IK7A 2WPVB 4D6TJ 3TGUJ 1BSHA 5CCHC 2G8YA 1BGYG 1ZRTE 1VF5D 2IBZD 2C0XA 3A7OA 5AW9B 3H1IE 3S4RA 1EDJA 2LKMA 2K88A 3H1IJ 1R8EA 3RK2B 2XU6A 3CD6P 1MV8A 2JDIH 1KILA 1MKMA 1NTKD 5KLIC 1LWUC 3D71A 2HPCA 1M1JA 2E76C 3Q5RA 3CC4P 3E1IA 1NO4A 1RE3A 2FYUJ 2YNYA 5KLVD 4AYCA 3FXEA 3M91A 5B5EE 4PD4I 2FYZA 1S5LX 4Y99B 1OW7A 1NGMB 1VQKP 2A45H 3VMZA 1BGYD 4IL6E 1ZN5A 1R5SA 3SWYA 1HGZA 5B66H 2ITAA 2J5UA 4H44C 1KQLA 4HB1A 3TSIA 3FXDA 2E76B 3L75E 2R44A 1N7SB 1NTZE 2B9BA 3H1JE 3R4YA 5APVA 1BE3D 2A45I 3GHGC 1NU1E 2ZYGA 1PP9G 3IFMA 2XZRA 4KHXA 1X0TA 1QL1A 2Q3IA 3U1CA 2CPSA 3CCLP 1PGPA 1J1EB 1G1JA 3MUDC 2IBZI 1RF0C 2ZXEB 2B88A 2K9YA 3HD7C 1J2JB 1FDOA 2KUBA 3B71A 5APSA 5GTIH 1HWTC 2Q3EA 1YYCA 3VN0A 5E79E 4BRYA 1VQ9P 3L70D 2XKMA 1K8AQ 1YTZI 4GOFA 5K5GB 2CK3H 3H32A 2JJLA 1FZGA 2O1JA 3L71G 2E5TA 1YQ4C 1SQVK 3L4FA 2N1TA 4EYYQ 3MHVA 1H0TA 1YBKA 1LT1A 3E1RA 1D7MA 2M5AB 3PP5A 1NWQA 3WUTA 4GIFA 3U59A 4K3AA 3I55P 3L72G 1TU3F 2B89A 2WSCH 3G3ZA 3FWNA 1NYHA 1ZRTD 4PD4H 1LWUA 1PPJD 1EC5A 5AVTB 1NTMG 2LR2A 3BCCD 2PAJA 1L0LD 2FYUK 2QJKC 3AEGC 3C9IA 2QE7H 1URQA 1N73B 3NFQA 4WY4C 2O01N 5BVZA 3TNUB 3OJAB 1IFJA 4IFFA 2CPBA 3OA7A 1SQPE 2AEJA 3B5NB 1T2KD 3GMAA 4ZKUA 1CI6B 3AE6C 2LXCB 1MUUA 2Q1KA 3V4QA 3CC7P 1N2DC 4GDOA 1FZEA 1RQVA 1RY3A 1GK6A 1PGQA 2AEMA 4JYBA 2O3JA 1DEEG 2PP6A 3E7KA 3GW6A 4OGQD 2JP3A 2E75B 2OYHC 3IAOA 3KDPB 2MKVA 1IFMA 1NKNA 3H1LD 3R2PA 1QVGO 3AE7C 1H0TB 3MUDA 4OVNF 3I5CA 3H25A 1ZW0A 4N78D 2WSEJ 3L72D 1H89A 3BRTB 3CMAP 2O01J 3AECC 3RL0g 4H0LD 2KLUA 5AVYB 4U3FJ 4QMAA 1OXZA 2YIUB 1MFTA 3EFGA 1AJYA 1L0NK 3CPWO 1DIPA 3BASA 3TGUG 2M5AA 3L71J 1BE3J 1JNMA 2WSEH 1YHQP 1P84H 2OYIB 2YKOA 1IFDA 2W6JH 4DZOA 1LWUB 1NKZB 1LTTC 1OZHA 2YIUC 2A45G 2KYVA 4UB6E 3RK2C 3CCRP 2BASA 3NMDA 2NPSB 5AW1B 1Q81Q 1J1DC 1URQD 3I56P 3FX0A 4PJ0E 2GM4A 2YKQA 4OGQC 5GTIE 1L0LE 2N1TC 3VMXA 2DW3A 1HUCA 1NTKJ 3HTKB 1NU1G 2ZXXA 3S9OA 2HYNA 1KILB 3AEDC 3HE5B 5CCHD 1W2BO 1VQPP 4BRYB 1N7SA 1OWAA 1YQ3C 4HKZH 3HE4B 2N9YB 4AUWA 1GL2A 3EQ2A 2IZ1A 3TGUE 3BCCJ 2QM8A 4U3FG 1FC2C 1KD1Q 1EQ7A 4IOIH 3VTPC 2KNCA 1SQVJ 2BCCE 2L5GB 1JY3N 2P2UA 5TJHA 1N7LA 3L36A 2FXMA 4GOEA 2WT7B 3IF4A 2E74C 1NTZK 3AEBC 3MZWB 1S1CX 1PP9J 3H1LE 4TLFA 2ZT9D 1M1JC 5APXA 1RE4A 3RBZA 2Y0EA 3AE4C 2R3CA 2IBZE 3AE9C 3N7NA 1Q2NA 4JQ0D 2E42A 2POHA 1GL2B 3CX5H 3QWOC 3L37A 3V2PA 1L0NJ 2P58A 2QJYC 3D6ZA 1KFMA 3EWKA 4WVZA 2IZ0A 1YJNP 1VQ4P 1Y47A 2KSJA 4CPGA 2GUVA 1NH4A 4WBAA 5CCHA 1NU1D 2JEEA 2QA4P 1JO5A 4H13D 5AVUB 2KS1A 1URQC 1JTHB 2HODB 2KZJA 3CX5D 1BCCG 1SQBG 3O6QA 5AW7B 4BWNA 3FWLA 4M3LA 4R4MA 3GF7A 1SQVE 5KKZC 3HE4A 3A5TA 3L75J 1U57A 1CZQA 3A0HH 5CHXA 3JCUH 1HBWA 1P84D 1QLED 1RF0A 1FOSF 1NTZG 3H1LJ
chains in the Genus database with same CATH topology
1NTKK 4WB4A 3GHGB 4LLHA 1IFNA 1NOHA 1JY2N 1MFZA 2W27A 4I1LA 1N7SC 1GU4A 5CCGD 1X8YA 2W6AA 3NXSA 4LGDE 4W80A 3V5BA 5AW3B 3HD7B 3VP9A 3MGNA 2XDJA 5KJ7A 5AVWB 2YKPA 1AFOA 1SFCB 1T8ZA 4DOJA 5APQA 1NTMK 4N3YB 1SQPK 4XA4A 1GD2E 2P1JA 3KYQA 4GT1A 1X79B 2W6BA 3B5NA 1RE3C 1IO4A 1MZ9A 1JCCA 2R5DA 1RE4C 4EIJA 1KFNA 1RF1C 1JY2P 3TK1A 4ZKPA 2GUSA 1SLQA 1XTGB 1LTJA 2Z5HA 3VMYA 1KILD 1IJDB 2O01H 2HLOA 3P8CE 3H32B 1X9VA 5AW0B 4JF7A 1S9KD 2WT7A 4C7NB 5APWA 1DEBA 2HG5D 1M1JB 2KP8A 2WITA 3P7KA 3HRNA 1Z56A 4OH8B 1ZR4A 1FZAA 3CLQA 3SWFA 1IFIA 1FZBA 3HUSC 4C7NA 3VYIA 3B5ND 1LTIC 3L35A 1KILC 1LGHB 4W7YA 3VOPA 2OARA 2C9NY 4I2LC 3M9QA 3RL0D 1J1DB 1JY2O 5BU5A 2OYIA 4AQRD 1JOCA 3HTKA 1SQQK 1QL2A 2FFDB 1IC2A 2HPCB 3M0AA 5AVQB 1CSBA 5AW4B 3TYYA 5AVRB 2WWWA 2KOGA 5KLVK 1W2EA 4C7RA 3V2QA 1SVFA 3CL3D 1FZCC 2WPRA 1ZV8A 3M06A 5APYA 2Q7CA 4N78E 3B5NC 2Z4EA 1M7LA 2IFMA 2M3BA 3CI9A 1JY3O 2MJZA 3LIEA 5AVZB 5CCGC 1DX7A 1L4AA 1HGVA 1URQB 2YO3A 2XNXA 1IK9A 1LTSC 1VDFA 4N6JA 3A2AA 3N4XA 1JUNA 1GW4A 1L0LK 3GHGA 1GL2C 1JTHA 2HODA 2P7JA 2FFDA 1VPCA 3LIDA 3BVHA 1XTCC 1FBMA 1GTWA 1NHLA 5AW2B 1WRGA 1WT6A 1H8AA 3LW5H 1JY3P 2IFNA 1T3UA 3VP8A 3IR9A 2NPSA 2H7HA 3RL0C 3V2NA 5AW6B 1G2CA 1N86A 3M0DC 1LT9B 4RESB 3WMM0 5AVXB 5APUA 2R32A 2WTYA 1L4AD 2FKWB 5KJ7C 5CJ0A 4HYTB 5KTBA 3MD0A 2Z5IA 4Y99C 3RK3B 1A02F 1LT9A 2H8PD 3U1AA 2NPSD 3MTUE 2FFDC 3A3YB 1H88A 4W7ZA 3NTNA 1LTBC 3M0DA 1JCDA 2OYHB 1LTJC 3RK3D 1CI6A 2IPPA 1HJBA 2N9BA 1GZLA 1SQXK 2ZFCA 1L4AB 2H43A 2KLVA 3V4WA 5CCGA 1N73A 2VRSA 2I1JA 5AW5B 5KJ7D 2XV5A 1SP4A 2IX7C 1N73C 3RL0B 2WSFH 3MIWA 4IFMA 1FAVA 2M8RA 2QM7A 4JYCA 3II6A 4GKGA 4EOTA 2C0WA 2J58A 1FJKA 3H6PA 1N7SD 1SFCD 1NU1K 1GDTA 3HUSA 1CW5A 2N1TB 2I1KA 5CJ4A 2R5BA 1G2CB 3KQGA 1SQBK 5BU8B 1L4AC 1FZCA 1FOSE 3T97A 1GL2D 2WPSA 1LTJB 1PFIA 1J1EC 1YTZT 3HE5A 5APTA 2NPSC 1GW3A 1E5WA 1JMMA 1KZUB 1SFCC 2HFED 2WPQA 4I6MC 1AQ5A 1FZCB 2OYIC 1LT9C 4B86A 1FZFA 3RK3C 2Q9IA 4O9BA 2YMYA 1DH3A 1GK4A 1SFCA 3M9HA 1GU5A 5AVSB 3HUSB 1ZLLA 1T2KC 3BRVB 1S9KE 3P8MC 2J59M 3V2RA 3B8EB 2WZ7A 1FJPA 3HD7D 4LC1A 4WY4A 1FDMA 1G1IA 3P32A 1LTAC 3UIAA 5AW8B 1ZR2A 4C46A 3BATA 2YO2A 3KPEA 5AVVB 1NAFA 3TNUA 2E43A 4IFDK 1LTGC 1T3JA 2P67A 3OAKA 4WY4B 1A02J 2Q5UA 4HH2A 3M9BA 4XE5B 3HD7A 1HH0A 4WY4D 1FU1A 3P8CD 2C9LY 2KB7P 2O1KA 3RK2D 2OYHA 3O8ZA 1RF1B 5CMZA 1HTLC 1HVVA 2N1TD 5CCHC 2C0XA 3A7OA 5AW9B 2LKMA 3RK2B 2XU6A 1MV8A 1KILA 1LWUC 2HPCA 1M1JA 3E1IA 1NO4A 1RE3A 2YNYA 4AYCA 3M91A 2FYZA 4Y99B 2A45H 3VMZA 3SWYA 1ZN5A 1HGZA 3TSIA 1KQLA 5APVA 1N7SB 3GHGC 2A45I 3IFMA 2XZRA 4KHXA 1QL1A 2Q3IA 3U1CA 2CPSA 1J1EB 1G1JA 2ZXEB 1RF0C 3HD7C 1J2JB 1HWTC 5APSA 1YYCA 3VN0A 2XKMA 1YTZI 3H32A 2JJLA 1FZGA 2O1JA 3L4FA 1SQVK 2N1TA 3PP5A 1NWQA 4GIFA 3U59A 2WSCH 3G3ZA 5AVTB 5AW7B 1RF1A 1LWUA 2PAJA 2FYUK 1N73B 3C9IA 1URQA 3NFQA 4WY4C 5BVZA 3TNUB 3OJAB 1IFJA 4IFFA 2CPBA 3OA7A 3B5NB 1T2KD 4ZKUA 1CI6B 1MUUA 3V4QA 1N2DC 1FZEA 1RY3A 1GK6A 4JYBA 2PP6A 2OYHC 3KDPB 3R2PA 1IFMA 1NKNA 3MUDA 3I5CA 4N78D 1H89A 3BRTB 5AVYB 1OXZA 3EFGA 1L0NK 3BASA 1JNMA 2WSEH 2OYIB 2YKOA 1IFDA 4DZOA 1LWUB 1NKZB 1LTTC 2A45G 2KYVA 3RK2C 2BASA 3NMDA 2NPSB 5AW1B 1J1DC 1URQD 2GM4A 2YKQA 2N1TC 3VMXA 1HUCA 3HTKB 2HYNA 1KILB 5CCHD 3HE5B 1N7SA 1OWAA 4AUWA 3HE4B 1GL2A 3EQ2A 2QM8A 1EQ7A 3VTPC 2L5GB 2P2UA 1JY3N 1N7LA 3L36A 2FXMA 2WT7B 1NTZK 5APXA 1M1JC 1RE4A 2R3CA 2E42A 3N7NA 1HBWA 2POHA 1GL2B 3V2PA 3L37A 1KFMA 2KSJA 2GUVA 1NH4A 4WBAA 5CCHA 2JEEA 1JO5A 5AVUB 1URQC 1JTHB 2HODB 4M3LA 3HE4A 3A5TA 1CZQA 5CHXA 1RF0A 1FOSF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XKM A;  1PFI A;  2KLV A;  2IFN A;  1ZN5 A;  1IFN A;  3IFM A;  4IFM A;  1QL1 A;  1IFM A;  1QL2 A;  2IFM A;  2KSJ A; 
#chains in the Genus database with same CATH topology
 1NTK K;  4U7J A;  3CCM P;  4WB4 A;  3GHG B;  4LLH A;  1IFN A;  1SQV G;  3Q1M A;  3H1H J;  3AEE C;  4A7P A;  1NOH A;  1JY2 N;  1MFZ A;  1NAY A;  1UIX A;  2FYU E;  2W27 A;  3AE2 C;  3BCC G;  1N7S C;  4I1L A;  1S72 P;  4Z1M H;  1GU4 A;  1RQU A;  1USE A;  5KAF E;  1VQO P;  2ZT9 C;  5CCG D;  1X8Y A;  2W6A A;  3NXS A;  4LGD E;  2W83 C;  4W80 A;  5AW3 B;  3V5B A;  3VMA A;  2PFX A;  3HD7 B;  3VP9 A;  3MGN A;  1EDI A;  3JC2 2;  2XDJ A;  1NTZ J;  3H1J J;  2ZJS E;  1KMI Z;  3SWK A;  5AVW B;  5KJ7 A;  3AE5 C;  1IZN B;  2YKP A;  4UB8 E;  1SFC B;  4HJG H;  2QJP C;  1T8Z A;  3C1L A;  1AFO A;  1KV4 A;  4D6T D;  3AE8 C;  4DOJ A;  2JO1 A;  5APQ A;  2FXP A;  1PP9 D;  4PV1 C;  1NTM K;  2QIW A;  1Y8A A;  4N3Y B;  1VQ7 P;  1SQP K;  2Q6Q A;  1RHZ B;  4XA4 A;  1PGJ A;  1GD2 E;  1QEX A;  2P1J A;  3KYQ A;  4U3F E;  1Q86 Q;  4GT1 A;  1X79 B;  1EDK A;  2W6B A;  3B5N A;  1RE3 C;  2WSC J;  1IO4 A;  1MZ9 A;  2Y0C A;  3L71 E;  2KSE A;  1L0N G;  3TF5 A;  1JCC A;  2R5D A;  1RE4 C;  1SS1 A;  1KFN A;  2WQY C;  4EIJ A;  2FY8 A;  1RF1 C;  1JY2 P;  2D2C C;  3TK1 A;  4ZKP A;  2GUS A;  2ZVN B;  1VQM P;  1SLQ A;  2IDB A;  1KYO E;  1XTG B;  1LTJ A;  3OW2 O;  3ABV C;  2RMZ A;  2Z5H A;  3VMY A;  4ASW A;  3PLN A;  2NZ2 A;  3KZI E;  1KIL D;  1IJD B;  2V4H A;  3RGU A;  2O01 H;  1P84 E;  2HLO A;  4ZMD A;  1OVU A;  2QEX P;  3P8C E;  4PD4 E;  3KHU A;  3H32 B;  1LJ2 A;  3L73 J;  1X9V A;  3GG2 A;  4PV1 D;  3L75 D;  1BCC E;  1SQB E;  2JWD A;  1S5L E;  3KXD A;  4JF7 A;  2K1A A;  5AW0 B;  1BE3 E;  2M3E A;  3WUV A;  5KLV J;  4C7N B;  1LNQ A;  2WT7 A;  2KS1 B;  4KT0 J;  5APW A;  1VQL P;  1DEB A;  4BXL A;  2QSI A;  2HG5 D;  1M1J B;  1S4X A;  1U7J A;  2FBW C;  3L74 J;  1OX3 A;  2KP8 A;  4I7Z C;  1NTM J;  5E79 H;  3WU2 E;  1KIL E;  2WIT A;  3P7K A;  2YXR B;  3HRN A;  3L72 J;  1Z56 A;  1VQN P;  2D2C D;  4PD4 D;  4OH8 B;  3L70 E;  3TGU D;  1ZR4 A;  1FZA A;  3CLQ A;  4GOD A;  3SWF A;  1DD3 A;  1IFI A;  1FZB A;  3HUS C;  4C7N A;  1LP1 B;  3VYI A;  5GTH H;  3B5N D;  1VL2 A;  1LTI C;  4RJT A;  1SQB D;  1BCC D;  3L35 A;  1KIL C;  1SQX D;  1AA0 A;  1LGH B;  2E75 D;  2V7Q H;  4R4L A;  4W7Y A;  2OAR A;  3VOP A;  5KLV G;  2C9N Y;  4I2L C;  1M1K Q;  2AXT E;  3M9Q A;  3QH9 A;  2JKV A;  3CWB G;  4JBZ A;  1NVO A;  3RL0 D;  4RKU J;  5TIS H;  3CC2 P;  1NTZ D;  3H1J D;  1J1D B;  1JY2 O;  1KYO I;  2JR8 A;  2KIK A;  5BU5 A;  2OYI A;  4AQR D;  1JOC A;  3HTK A;  2OGU A;  1SQQ K;  1QL2 A;  1L0L J;  3L74 D;  4JPZ B;  2FFD B;  1PZQ A;  1SQP D;  3GF3 A;  1IC2 A;  5KAI H;  3CCQ P;  3M0A A;  1YJ9 P;  2HPC B;  1ZME C;  3CCJ P;  5AVQ B;  3PTZ A;  1CSB A;  5AW4 B;  4L74 A;  1BSN A;  3TYY A;  5AVR B;  2PRR A;  3A0H E;  2IYO A;  2KOG A;  2WWW A;  2ZT9 B;  3BCC E;  5KLV K;  1NJI Q;  1FE6 A;  1W2E A;  2OQQ A;  1JMB A;  4PJ0 H;  4C7R A;  3K5B A;  3V2Q A;  1SVF A;  1S5L H;  3CL3 D;  3G4S P;  5KAI E;  1FZC C;  1K04 A;  2WPR A;  1ZV8 A;  3M06 A;  4H13 B;  5APY A;  1OW8 A;  2Q7C A;  2PGD A;  4N78 E;  2QJP B;  1DD4 A;  3B5N C;  1GMJ A;  3G6E P;  2Z4E A;  1M7L A;  2H89 C;  2IFM A;  2M3B A;  3CI9 A;  5M1B A;  1KQS O;  1JY3 O;  2MJZ A;  3CXH D;  3H1K D;  2H88 C;  1SQQ D;  1EZV D;  2OTK E;  3LIE A;  5AVZ B;  1QX8 A;  5CCG C;  1ZP0 C;  4I7Z B;  4D6T G;  1Y9B A;  1DX7 A;  1L4A A;  1HGV A;  5KKZ B;  4NPF X;  1L0N D;  3CCE P;  1URQ B;  3CME P;  1KYO H;  2YO3 A;  5GTH E;  2XNX A;  2Y9Y A;  1RF1 A;  1IK9 A;  1LTS C;  2RN0 A;  1VDF A;  1KC8 Q;  4DCK A;  1VQ5 P;  4N6J A;  3A2A A;  4WWI A;  4D6T E;  1X22 A;  1PIX A;  3N4X A;  3Q3D A;  1JUN A;  1GW4 A;  2KI7 B;  1OMI A;  2OYO A;  1SQQ G;  1L0L K;  3GHG A;  1GL2 C;  1IFP A;  1JTH A;  2G3A A;  2HOD A;  2P7J A;  4L76 A;  1VPC A;  1PL5 A;  4Y28 J;  3CXH E;  2FFD A;  3LID A;  3BVH A;  3RK3 E;  1XTC C;  1FBM A;  2KZI A;  2M0B A;  3USS A;  3W67 A;  1YI2 P;  2KK7 A;  1OIP A;  2IYP A;  2Y0D A;  1NHL A;  4L75 A;  4NPD A;  1WRG A;  5AW2 B;  1GTW A;  1KB9 I;  1WT6 A;  1H8A A;  4UB8 H;  3LW5 H;  3ZDM A;  1JY3 P;  1EZV I;  1ZOY C;  2A06 G;  3SFD C;  3EFF K;  1KQF B;  1VF5 B;  3CCU P;  2IFN A;  1EXJ A;  1SQX J;  1T3U A;  3VP8 A;  3IR9 A;  2A06 E;  2NPS A;  5CBN A;  2H7H A;  3A0B E;  3RL0 C;  3V2N A;  2NRG A;  3KZI H;  5AW6 B;  1G2C A;  1FDI A;  1N86 A;  1UII A;  3Q2Y A;  3M0D C;  1LT9 B;  4RES B;  4EI2 A;  1HJ0 A;  3WMM 0;  1W5C E;  4DT0 A;  5AVX B;  5APU A;  2R32 A;  1BDD A;  1NTM D;  3G9R A;  1SQQ J;  2K3R A;  2WTY A;  3PRJ A;  1L4A D;  1SQQ E;  2FKW B;  3JCU E;  1PGO A;  1FS0 E;  1SQX G;  3CXH H;  4HYT B;  5CJ0 A;  3S1K A;  5KJ7 C;  5KTB A;  1K9M Q;  3MD0 A;  2Z5I A;  4Y99 C;  5CBO A;  3RK3 B;  1A02 F;  1K73 Q;  1LT9 A;  2A06 D;  2H8P D;  2WMM A;  3U1A A;  4PV1 B;  2NPS D;  3L73 D;  3AEF C;  3MTU E;  2FFD C;  3L72 E;  2BEZ F;  3A3Y B;  1HF9 A;  3H1L G;  2AEF A;  3CX5 E;  4W7Z A;  3NTN A;  3V6I A;  1M90 Q;  1H88 A;  2UWJ E;  5L8R J;  1LTB C;  2E74 D;  2FYU D;  3M0D A;  1JCD A;  1L2P A;  4IL6 H;  1QGK B;  2OTJ P;  2E75 C;  2OYH B;  1LTJ C;  3RK3 D;  1CI6 A;  4YXD C;  2IPP A;  3LW5 J;  1VQ8 P;  1HJB A;  2N9B A;  3L74 G;  1GZL A;  1RH5 B;  1SQX K;  1SQP G;  1L4A B;  2ZFC A;  2HR3 A;  2H43 A;  1YIT P;  1AVO A;  2KLV A;  3V4W A;  5CCG A;  1YIJ P;  1Q90 D;  1N73 A;  1PV3 A;  5C39 A;  2VRS A;  2I1J A;  3L74 E;  5AW5 B;  1NTM E;  2YMK A;  2V7Q J;  1OFC X;  5KJ7 D;  1QVF O;  2XV5 A;  1SP4 A;  2IX7 C;  2QJY B;  1N73 C;  1PP9 E;  3IN6 A;  4KJM A;  1EXI A;  3RL0 B;  1OVV A;  2WSF H;  3F5H A;  3MIW A;  5H2F E;  2W90 A;  4IFM A;  1FAV A;  2M8R A;  1LP1 A;  2QM7 A;  2K9J B;  2L91 A;  1WMK A;  4JYC A;  2K9J A;  1S9K D;  2FYN C;  3II6 A;  4GKG A;  3RBX A;  3L70 J;  4EOT A;  3Q5S A;  2K37 A;  2XND H;  1OVR A;  3L71 D;  3D70 A;  2C0W A;  2J58 A;  3CXH I;  1FJK A;  1EZV G;  3H6P A;  1N7S D;  1SFC D;  3H1K J;  3SFE C;  5KLV E;  1R5L A;  2BCC D;  2KXP B;  1NU1 K;  3D6Y A;  1KB9 E;  1GDT A;  1NTK G;  2QRX A;  2B87 B;  3HUS A;  5TIS E;  1CW5 A;  3SSU A;  2AXT H;  1JB0 J;  2E74 B;  2N1T B;  4TT3 H;  4H44 D;  3CCV P;  2I1K A;  4OWF A;  5CJ4 A;  5B5E H;  2R5B A;  1USD A;  3CX5 I;  1G2C B;  2GA1 A;  2Y9Z A;  2SPZ A;  1ZXG A;  3KQG A;  1SQB K;  1PPJ G;  3W68 A;  5BU8 B;  3G71 P;  3JSV C;  4H13 C;  4H44 B;  3O6Q B;  1L4A C;  1BDC A;  1FZC A;  3AE1 C;  3T97 A;  1FOS E;  1SQP J;  1Q7Y Q;  2ZYD A;  1EZV E;  1BE3 G;  3WU2 H;  1S2E A;  1JM0 A;  1GL2 D;  2WPS A;  4MN4 C;  4L73 A;  4IL6 X;  1LTJ B;  2OTL P;  1PPJ E;  1KB9 D;  1N8R Q;  1PFI A;  1M56 D;  1J1E C;  5H2F H;  1YTZ T;  2AXC A;  2ZYA A;  2NPS C;  3HE5 A;  1JEK A;  5EFW B;  5APT A;  4UB6 H;  1GW3 A;  2I8D A;  1E5W A;  1JMM A;  1KZU B;  3CWB E;  1SFC C;  3H1H G;  4ASV A;  2RH0 A;  2HFE D;  2E76 D;  2RKL A;  2WPQ A;  4I6M C;  5DJU B;  3T97 B;  2B87 A;  1FZC B;  1AQ5 A;  2OYI C;  1LT9 C;  4K35 A;  3C8V A;  2YXQ B;  3H1H E;  4YTP C;  3H1K G;  4B86 A;  2KNC B;  3RK3 C;  1FZF A;  2Q9I A;  1AVY A;  1KTM A;  1SQV D;  3L75 G;  4YPC A;  4O9B A;  4DJG A;  2YMY A;  2ZAE B;  1DH3 A;  1GK4 A;  3F89 A;  1SFC A;  3L70 G;  3M9H A;  3CCS P;  1GU5 A;  3L73 G;  5AVS B;  3HUS B;  2R3S A;  1ZLL A;  3H1J G;  5KLI B;  3BRV B;  1S9K E;  1T2K C;  3AE3 C;  1L0L G;  1M57 D;  3B4S A;  3ITK A;  2J59 M;  3P8M C;  3V2R A;  3B8E B;  4EDF A;  2WZ7 A;  2FYU G;  1Q82 Q;  2WSS H;  1FJP A;  3HD7 D;  3CWB J;  4LC1 A;  4WY4 A;  1YJW P;  1G1I A;  1AV1 A;  1FDM A;  3P32 A;  1LTA C;  3UIA A;  3H1H D;  5AW8 B;  3PJS K;  1E79 H;  4C46 A;  1ZR2 A;  1M8O B;  2ZVO B;  3H1I G;  3TDK A;  3BAT A;  2YO2 A;  3KPE A;  1BGY E;  1VF5 C;  5AVV B;  1AQT A;  1NAF A;  1BGY J;  1NTK E;  4H0L C;  3TNU A;  2E43 A;  3PHL A;  4IFD K;  1LTG C;  3AEA C;  1P84 I;  1T3J A;  3FGA D;  2P67 A;  3CWB D;  1SQX E;  5B66 E;  3OAK A;  4WY4 B;  2FYN B;  1A02 J;  2BCC J;  1KYO D;  2BEQ D;  2FXO A;  2JWA A;  1T6A A;  3MP7 B;  2QJK B;  2Q5U A;  2WVR A;  1NU1 J;  3WUU A;  5KAF H;  4YXW H;  1EDL A;  2P10 A;  3PH0 A;  4HH2 A;  3GLM A;  1KB9 H;  3A0B H;  3H1I D;  4NPE A;  4U3F D;  4XFJ A;  3Q5P A;  4OGQ B;  3M9B A;  4XE5 B;  2IBZ G;  1HH0 A;  3HD7 A;  4WY4 D;  4ZNC A;  3L73 E;  1FU1 A;  3P8C D;  2LXB A;  4RO0 A;  2C9L Y;  1L0N E;  2KB7 P;  2O1K A;  3RK2 D;  1S3J A;  4H0L B;  2OYH A;  2WSF J;  1U7M A;  3O8Z A;  1K05 A;  1RF1 B;  2D2C B;  1KQG B;  1BCC J;  1SQB J;  2E5Y A;  2QG4 A;  2QVA A;  1KOR A;  2BCC G;  1VQ6 P;  3H1K E;  5CMZ A;  1HTL C;  1HVV A;  1OW6 A;  2N1T D;  1KN7 A;  5DJT B;  2W8Z A;  1IK7 A;  2WPV B;  4D6T J;  3TGU J;  1BSH A;  5CCH C;  2G8Y A;  1BGY G;  1ZRT E;  1VF5 D;  2IBZ D;  2C0X A;  3A7O A;  5AW9 B;  3H1I E;  3S4R A;  1EDJ A;  2LKM A;  2K88 A;  3H1I J;  1R8E A;  3RK2 B;  2XU6 A;  3CD6 P;  1MV8 A;  2JDI H;  1KIL A;  1MKM A;  1NTK D;  5KLI C;  1LWU C;  3D71 A;  2HPC A;  1M1J A;  2E76 C;  3Q5R A;  3CC4 P;  3E1I A;  1NO4 A;  1RE3 A;  2FYU J;  2YNY A;  5KLV D;  4AYC A;  3FXE A;  3M91 A;  5B5E E;  4PD4 I;  2FYZ A;  1S5L X;  4Y99 B;  1OW7 A;  1NGM B;  1VQK P;  2A45 H;  3VMZ A;  1BGY D;  4IL6 E;  1ZN5 A;  1R5S A;  3SWY A;  1HGZ A;  5B66 H;  2ITA A;  2J5U A;  4H44 C;  1KQL A;  4HB1 A;  3TSI A;  3FXD A;  2E76 B;  3L75 E;  2R44 A;  1N7S B;  1NTZ E;  2B9B A;  3H1J E;  3R4Y A;  5APV A;  1BE3 D;  2A45 I;  3GHG C;  1NU1 E;  2ZYG A;  1PP9 G;  3IFM A;  2XZR A;  4KHX A;  1X0T A;  1QL1 A;  2Q3I A;  3U1C A;  2CPS A;  3CCL P;  1PGP A;  1J1E B;  1G1J A;  3MUD C;  2IBZ I;  1RF0 C;  2ZXE B;  2B88 A;  2K9Y A;  3HD7 C;  1J2J B;  1FDO A;  2KUB A;  3B71 A;  5APS A;  5GTI H;  1HWT C;  2Q3E A;  1YYC A;  3VN0 A;  5E79 E;  4BRY A;  1VQ9 P;  3L70 D;  2XKM A;  1K8A Q;  1YTZ I;  4GOF A;  5K5G B;  2CK3 H;  3H32 A;  2JJL A;  1FZG A;  2O1J A;  3L71 G;  2E5T A;  1YQ4 C;  1SQV K;  3L4F A;  2N1T A;  4EYY Q;  3MHV A;  1H0T A;  1YBK A;  1LT1 A;  3E1R A;  1D7M A;  2M5A B;  3PP5 A;  1NWQ A;  3WUT A;  4GIF A;  3U59 A;  4K3A A;  3I55 P;  3L72 G;  1TU3 F;  2B89 A;  2WSC H;  3G3Z A;  3FWN A;  1NYH A;  1ZRT D;  4PD4 H;  1LWU A;  1PPJ D;  1EC5 A;  5AVT B;  1NTM G;  2LR2 A;  3BCC D;  2PAJ A;  1L0L D;  2FYU K;  2QJK C;  3AEG C;  3C9I A;  2QE7 H;  1URQ A;  1N73 B;  3NFQ A;  4WY4 C;  2O01 N;  5BVZ A;  3TNU B;  3OJA B;  1IFJ A;  4IFF A;  2CPB A;  3OA7 A;  1SQP E;  2AEJ A;  3B5N B;  1T2K D;  3GMA A;  4ZKU A;  1CI6 B;  3AE6 C;  2LXC B;  1MUU A;  2Q1K A;  3V4Q A;  3CC7 P;  1N2D C;  4GDO A;  1FZE A;  1RQV A;  1RY3 A;  1GK6 A;  1PGQ A;  2AEM A;  4JYB A;  2O3J A;  1DEE G;  2PP6 A;  3E7K A;  3GW6 A;  4OGQ D;  2JP3 A;  2E75 B;  2OYH C;  3IAO A;  3KDP B;  2MKV A;  1IFM A;  1NKN A;  3H1L D;  3R2P A;  1QVG O;  3AE7 C;  1H0T B;  3MUD A;  4OVN F;  3I5C A;  3H25 A;  1ZW0 A;  4N78 D;  2WSE J;  3L72 D;  1H89 A;  3BRT B;  3CMA P;  2O01 J;  3AEC C;  3RL0 g;  4H0L D;  2KLU A;  5AVY B;  4U3F J;  4QMA A;  1OXZ A;  2YIU B;  1MFT A;  3EFG A;  1AJY A;  1L0N K;  3CPW O;  1DIP A;  3BAS A;  3TGU G;  2M5A A;  3L71 J;  1BE3 J;  1JNM A;  2WSE H;  1YHQ P;  1P84 H;  2OYI B;  2YKO A;  1IFD A;  2W6J H;  4DZO A;  1LWU B;  1NKZ B;  1LTT C;  1OZH A;  2YIU C;  2A45 G;  2KYV A;  4UB6 E;  3RK2 C;  3CCR P;  2BAS A;  3NMD A;  2NPS B;  5AW1 B;  1Q81 Q;  1J1D C;  1URQ D;  3I56 P;  3FX0 A;  4PJ0 E;  2GM4 A;  2YKQ A;  4OGQ C;  5GTI E;  1L0L E;  2N1T C;  3VMX A;  2DW3 A;  1HUC A;  1NTK J;  3HTK B;  1NU1 G;  2ZXX A;  3S9O A;  2HYN A;  1KIL B;  3AED C;  3HE5 B;  5CCH D;  1W2B O;  1VQP P;  4BRY B;  1N7S A;  1OWA A;  1YQ3 C;  4HKZ H;  3HE4 B;  2N9Y B;  4AUW A;  1GL2 A;  3EQ2 A;  2IZ1 A;  3TGU E;  3BCC J;  2QM8 A;  4U3F G;  1FC2 C;  1KD1 Q;  1EQ7 A;  4IOI H;  3VTP C;  2KNC A;  1SQV J;  2BCC E;  2L5G B;  1JY3 N;  2P2U A;  5TJH A;  1N7L A;  3L36 A;  2FXM A;  4GOE A;  2WT7 B;  3IF4 A;  2E74 C;  1NTZ K;  3AEB C;  3MZW B;  1S1C X;  1PP9 J;  3H1L E;  4TLF A;  2ZT9 D;  1M1J C;  5APX A;  1RE4 A;  3RBZ A;  2Y0E A;  3AE4 C;  2R3C A;  2IBZ E;  3AE9 C;  3N7N A;  1Q2N A;  4JQ0 D;  2E42 A;  2POH A;  1GL2 B;  3CX5 H;  3QWO C;  3L37 A;  3V2P A;  1L0N J;  2P58 A;  2QJY C;  3D6Z A;  1KFM A;  3EWK A;  4WVZ A;  2IZ0 A;  1YJN P;  1VQ4 P;  1Y47 A;  2KSJ A;  4CPG A;  2GUV A;  1NH4 A;  4WBA A;  5CCH A;  1NU1 D;  2JEE A;  2QA4 P;  1JO5 A;  4H13 D;  5AVU B;  2KS1 A;  1URQ C;  1JTH B;  2HOD B;  2KZJ A;  3CX5 D;  1BCC G;  1SQB G;  3O6Q A;  5AW7 B;  4BWN A;  3FWL A;  4M3L A;  4R4M A;  3GF7 A;  1SQV E;  5KKZ C;  3HE4 A;  3A5T A;  3L75 J;  1U57 A;  1CZQ A;  3A0H H;  5CHX A;  3JCU H;  1HBW A;  1P84 D;  1QLE D;  1RF0 A;  1FOS F;  1NTZ G;  3H1L J; 
#chains in the Genus database with same CATH homology
 1NTK K;  4WB4 A;  3GHG B;  4LLH A;  1IFN A;  1NOH A;  1JY2 N;  1MFZ A;  2W27 A;  4I1L A;  1N7S C;  1GU4 A;  5CCG D;  1X8Y A;  2W6A A;  3NXS A;  4LGD E;  4W80 A;  3V5B A;  5AW3 B;  3HD7 B;  3VP9 A;  3MGN A;  2XDJ A;  5KJ7 A;  5AVW B;  2YKP A;  1AFO A;  1SFC B;  1T8Z A;  4DOJ A;  5APQ A;  1NTM K;  4N3Y B;  1SQP K;  4XA4 A;  1GD2 E;  2P1J A;  3KYQ A;  4GT1 A;  1X79 B;  2W6B A;  3B5N A;  1RE3 C;  1IO4 A;  1MZ9 A;  1JCC A;  2R5D A;  1RE4 C;  4EIJ A;  1KFN A;  1RF1 C;  1JY2 P;  3TK1 A;  4ZKP A;  2GUS A;  1SLQ A;  1XTG B;  1LTJ A;  2Z5H A;  3VMY A;  1KIL D;  1IJD B;  2O01 H;  2HLO A;  3P8C E;  3H32 B;  1X9V A;  5AW0 B;  4JF7 A;  1S9K D;  2WT7 A;  4C7N B;  5APW A;  1DEB A;  2HG5 D;  1M1J B;  2KP8 A;  2WIT A;  3P7K A;  3HRN A;  1Z56 A;  4OH8 B;  1ZR4 A;  1FZA A;  3CLQ A;  3SWF A;  1IFI A;  1FZB A;  3HUS C;  4C7N A;  3VYI A;  3B5N D;  1LTI C;  3L35 A;  1KIL C;  1LGH B;  4W7Y A;  3VOP A;  2OAR A;  2C9N Y;  4I2L C;  3M9Q A;  3RL0 D;  1J1D B;  1JY2 O;  5BU5 A;  2OYI A;  4AQR D;  1JOC A;  3HTK A;  1SQQ K;  1QL2 A;  2FFD B;  1IC2 A;  2HPC B;  3M0A A;  5AVQ B;  1CSB A;  5AW4 B;  3TYY A;  5AVR B;  2WWW A;  2KOG A;  5KLV K;  1W2E A;  4C7R A;  3V2Q A;  1SVF A;  3CL3 D;  1FZC C;  2WPR A;  1ZV8 A;  3M06 A;  5APY A;  2Q7C A;  4N78 E;  3B5N C;  2Z4E A;  1M7L A;  2IFM A;  2M3B A;  3CI9 A;  1JY3 O;  2MJZ A;  3LIE A;  5AVZ B;  5CCG C;  1DX7 A;  1L4A A;  1HGV A;  1URQ B;  2YO3 A;  2XNX A;  1IK9 A;  1LTS C;  1VDF A;  4N6J A;  3A2A A;  3N4X A;  1JUN A;  1GW4 A;  1L0L K;  3GHG A;  1GL2 C;  1JTH A;  2HOD A;  2P7J A;  2FFD A;  1VPC A;  3LID A;  3BVH A;  1XTC C;  1FBM A;  1GTW A;  1NHL A;  5AW2 B;  1WRG A;  1WT6 A;  1H8A A;  3LW5 H;  1JY3 P;  2IFN A;  1T3U A;  3VP8 A;  3IR9 A;  2NPS A;  2H7H A;  3RL0 C;  3V2N A;  5AW6 B;  1G2C A;  1N86 A;  3M0D C;  1LT9 B;  4RES B;  3WMM 0;  5AVX B;  5APU A;  2R32 A;  2WTY A;  1L4A D;  2FKW B;  5KJ7 C;  5CJ0 A;  4HYT B;  5KTB A;  3MD0 A;  2Z5I A;  4Y99 C;  3RK3 B;  1A02 F;  1LT9 A;  2H8P D;  3U1A A;  2NPS D;  3MTU E;  2FFD C;  3A3Y B;  1H88 A;  4W7Z A;  3NTN A;  1LTB C;  3M0D A;  1JCD A;  2OYH B;  1LTJ C;  3RK3 D;  1CI6 A;  2IPP A;  1HJB A;  2N9B A;  1GZL A;  1SQX K;  2ZFC A;  1L4A B;  2H43 A;  2KLV A;  3V4W A;  5CCG A;  1N73 A;  2VRS A;  2I1J A;  5AW5 B;  5KJ7 D;  2XV5 A;  1SP4 A;  2IX7 C;  1N73 C;  3RL0 B;  2WSF H;  3MIW A;  4IFM A;  1FAV A;  2M8R A;  2QM7 A;  4JYC A;  3II6 A;  4GKG A;  4EOT A;  2C0W A;  2J58 A;  1FJK A;  3H6P A;  1N7S D;  1SFC D;  1NU1 K;  1GDT A;  3HUS A;  1CW5 A;  2N1T B;  2I1K A;  5CJ4 A;  2R5B A;  1G2C B;  3KQG A;  1SQB K;  5BU8 B;  1L4A C;  1FZC A;  1FOS E;  3T97 A;  1GL2 D;  2WPS A;  1LTJ B;  1PFI A;  1J1E C;  1YTZ T;  3HE5 A;  5APT A;  2NPS C;  1GW3 A;  1E5W A;  1JMM A;  1KZU B;  1SFC C;  2HFE D;  2WPQ A;  4I6M C;  1AQ5 A;  1FZC B;  2OYI C;  1LT9 C;  4B86 A;  1FZF A;  3RK3 C;  2Q9I A;  4O9B A;  2YMY A;  1DH3 A;  1GK4 A;  1SFC A;  3M9H A;  1GU5 A;  5AVS B;  3HUS B;  1ZLL A;  1T2K C;  3BRV B;  1S9K E;  3P8M C;  2J59 M;  3V2R A;  3B8E B;  2WZ7 A;  1FJP A;  3HD7 D;  4LC1 A;  4WY4 A;  1FDM A;  1G1I A;  3P32 A;  1LTA C;  3UIA A;  5AW8 B;  1ZR2 A;  4C46 A;  3BAT A;  2YO2 A;  3KPE A;  5AVV B;  1NAF A;  3TNU A;  2E43 A;  4IFD K;  1LTG C;  1T3J A;  2P67 A;  3OAK A;  4WY4 B;  1A02 J;  2Q5U A;  4HH2 A;  3M9B A;  4XE5 B;  3HD7 A;  1HH0 A;  4WY4 D;  1FU1 A;  3P8C D;  2C9L Y;  2KB7 P;  2O1K A;  3RK2 D;  2OYH A;  3O8Z A;  1RF1 B;  5CMZ A;  1HTL C;  1HVV A;  2N1T D;  5CCH C;  2C0X A;  3A7O A;  5AW9 B;  2LKM A;  3RK2 B;  2XU6 A;  1MV8 A;  1KIL A;  1LWU C;  2HPC A;  1M1J A;  3E1I A;  1NO4 A;  1RE3 A;  2YNY A;  4AYC A;  3M91 A;  2FYZ A;  4Y99 B;  2A45 H;  3VMZ A;  3SWY A;  1ZN5 A;  1HGZ A;  3TSI A;  1KQL A;  5APV A;  1N7S B;  3GHG C;  2A45 I;  3IFM A;  2XZR A;  4KHX A;  1QL1 A;  2Q3I A;  3U1C A;  2CPS A;  1J1E B;  1G1J A;  2ZXE B;  1RF0 C;  3HD7 C;  1J2J B;  1HWT C;  5APS A;  1YYC A;  3VN0 A;  2XKM A;  1YTZ I;  3H32 A;  2JJL A;  1FZG A;  2O1J A;  3L4F A;  1SQV K;  2N1T A;  3PP5 A;  1NWQ A;  4GIF A;  3U59 A;  2WSC H;  3G3Z A;  5AVT B;  5AW7 B;  1RF1 A;  1LWU A;  2PAJ A;  2FYU K;  1N73 B;  3C9I A;  1URQ A;  3NFQ A;  4WY4 C;  5BVZ A;  3TNU B;  3OJA B;  1IFJ A;  4IFF A;  2CPB A;  3OA7 A;  3B5N B;  1T2K D;  4ZKU A;  1CI6 B;  1MUU A;  3V4Q A;  1N2D C;  1FZE A;  1RY3 A;  1GK6 A;  4JYB A;  2PP6 A;  2OYH C;  3KDP B;  3R2P A;  1IFM A;  1NKN A;  3MUD A;  3I5C A;  4N78 D;  1H89 A;  3BRT B;  5AVY B;  1OXZ A;  3EFG A;  1L0N K;  3BAS A;  1JNM A;  2WSE H;  2OYI B;  2YKO A;  1IFD A;  4DZO A;  1LWU B;  1NKZ B;  1LTT C;  2A45 G;  2KYV A;  3RK2 C;  2BAS A;  3NMD A;  2NPS B;  5AW1 B;  1J1D C;  1URQ D;  2GM4 A;  2YKQ A;  2N1T C;  3VMX A;  1HUC A;  3HTK B;  2HYN A;  1KIL B;  5CCH D;  3HE5 B;  1N7S A;  1OWA A;  4AUW A;  3HE4 B;  1GL2 A;  3EQ2 A;  2QM8 A;  1EQ7 A;  3VTP C;  2L5G B;  2P2U A;  1JY3 N;  1N7L A;  3L36 A;  2FXM A;  2WT7 B;  1NTZ K;  5APX A;  1M1J C;  1RE4 A;  2R3C A;  2E42 A;  3N7N A;  1HBW A;  2POH A;  1GL2 B;  3V2P A;  3L37 A;  1KFM A;  2KSJ A;  2GUV A;  1NH4 A;  4WBA A;  5CCH A;  2JEE A;  1JO5 A;  5AVU B;  1URQ C;  1JTH B;  2HOD B;  4M3L A;  3HE4 A;  3A5T A;  1CZQ A;  5CHX A;  1RF0 A;  1FOS F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...