2KSJA

Structure and dynamics of the membrane-bound form of pf1 coat protein: implications for structural rearrangement during virus assembly
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein G8P
publication title Structure and dynamics of the membrane-bound form of Pf1 coat protein: implications of structural rearrangement for virus assembly.
pubmed doi rcsb
source organism Pseudomonas phage pf1
molecule tags Viral protein
total genus 11
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2010-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ksjA00
1IFMA 1IFNA 2IFNA 3IFMA 2KSJA 2IFMA 1QL2A 2KLVA 2XKMA 1QL1A 1PFIA 1ZN5A 4IFMA
chains in the Genus database with same CATH superfamily
5AVYB 5KAFE 1RE3A 2ZFCA 1NTZJ 4WY4C 1IFNA 2G8YA 4H0LB 3I5CA 3CCJP 1SQVK 1H0TB 1ZRTD 4AUWA 1RF1B 1SQQG 3LW5H 3NFQA 2QG4A 1LTTC 3U1AA 1BSHA 4JYBA 1P84E 2BEZF 2Q3IA 3PHLA 2C0XA 3H1HE 1MUUA 5AW0B 3IF4A 3L71E 1VF5D 1VL2A 1SQQK 4H0LC 1CW5A 1EDKA 2OARA 4U3FG 2P10A 3L71J 2YKPA 1ZR2A 2FYNB 2KS1A 3G6EP 3H1IG 1KQFB 3O6QB 3RK2B 2KK7A 1S2EA 2R3CA 4GOFA 1AQ5A 3D71A 1SQVD 1SS1A 2YIUB 3F5HA 2A45H 2ZJSE 1L0NJ 4D6TE 4M3LA 2FYNC 1OW6A 1WRGA 1T2KD 1GK6A 1JOCA 3RK2C 3MUDC 4HB1A 1SQQD 2FYUG 1PIXA 1RE4A 1NTMK 1NU1E 3AE4C 2W6AA 4TLFA 4EYYQ 4YXWH 2LKMA 2FYUK 4U3FD 1N2DC 2NZ2A 1G1IA 3W67A 3A0BH 2H89C 2FBWC 2M3EA 3C1LA 1CZQA 4BXLA 1A02F 5E79H 2Y0CA 2A06E 2ZYGA 4L73A 2OYIB 2W8ZA 4ZMDA 1KFMA 2E5YA 1YHQP 2Q3EA 1LT9A 1S9KD 1BCCG 1K9MQ 3P8MC 1ZP0C 3GLMA 1HH0A 1OXZA 3WU2E 2PAJA 1OFCX 3C8VA 5AW8B 2H8PD 2FYUD 3MZWB 4AQRD 1NTZG 2HR3A 1LP1A 5B66E 1WMKA 3P8CE 1KILC 1HUCA 3EFGA 2QJYC 3TYYA 3M9HA 1NTZK 2MKVA 2KIKA 3V5BA 3H1LE 3TNUA 2Q5UA 3L72E 1OIPA 3L71G 2AXCA 1NJIQ 4ZNCA 3G9RA 1USEA 1YJNP 2K9JA 2OYHA 3RBXA 4WWIA 1N73B 1MZ9A 1LNQA 3H1LJ 2I8DA 2Z4EA 1HGVA 3D70A 2IPPA 1AFOA 3RL0C 2QJPB 3IR9A 5KJ7A 1L0NG 3EFFK 1FZEA 1VDFA 3QWOC 5AVWB 1X8YA 4BRYB 1JMBA 3L74E 1N73C 1NTZD 1BE3D 2HPCA 3N4XA 3RK3B 4ASVA 4D6TG 2KNCA 3S9OA 3L74J 2QJPC 1K8AQ 4I7ZB 2LXCB 1ZN5A 1QLED 1UIXA 1YI2P 3HE4B 2N1TB 1KQLA 1NU1G 1JEKA 1LWUB 1P84D 2RH0A 4NPEA 3GHGC 5APQA 3H1HD 1S3JA 3L71D 3JSVC 1WT6A 1HJBA 3OAKA 4NPFX 2IFNA 1NU1K 1JB0J 1EDJA 1SFCA 2N1TC 2D2CC 3HTKA 4W7YA 1E79H 3H32A 4A7PA 4KT0J 2A06G 1EQ7A 2JO1A 4HYTB 3A5TA 5AW7B 1QGKB 4ZKPA 4D6TD 3H1JE 5CBOA 3MTUE 1JNMA 3L35A 3M9BA 3H6PA 5APTA 2JWDA 4IFDK 1DD4A 1ZW0A 3HD7A 3H1JJ 1YQ4C 2M5AB 4PJ0E 4TT3H 3B5ND 2KXPB 1NU1D 4H44B 1NAFA 4DJGA 1M1JA 1DIPA 3TGUE 4Y99C 5KLIC 4UB6H 1VQ6P 3U1CA 4WBAA 4PD4H 2H43A 3BRTB 4YPCA 4WY4A 4L75A 2QJKC 4OH8B 3H1LG 3L72G 1DX7A 2A06D 1BDCA 2XU6A 3E7KA 2E75D 5TISE 4L74A 1YTZT 4OWFA 4LGDE 3V6IA 4IL6X 1Q2NA 1SQBK 1VQMP 1SQVJ 1H0TA 3SWYA 1RF1A 4DT0A 2B88A 4JF7A 1YTZI 4RESB 4C46A 3L74G 4RJTA 1D7MA 2QSIA 2M3BA 2YNYA 3P8CD 1NTKE 1FJPA 1ZV8A 1OVRA 1J1DB 1OW7A 1NVOA 5GTHH 1GL2D 2Q1KA 2JKVA 3JCUE 5APWA 3ZDMA 1NTKJ 1L4AC 2KP8A 1KZUB 3VN0A 1PGPA 2WSSH 5L8RJ 3O6QA 1OX3A 4KJMA 2E74B 3H1LD 3MD0A 3L72D 3R2PA 3ITKA 2NPSB 1GU5A 4IFFA 2BCCE 1N7SC 1NTME 1DH3A 3AE2C 2IBZE 4XE5B 1HWTC 1XTCC 2YO3A 4L76A 2KZIA 2J58A 5H2FH 4ASWA 5APUA 2BCCJ 1NTMJ 1VQ7P 2WSFJ 3L74D 3GF3A 3V4QA 3NTNA 1VF5C 3KHUA 3H1JG 2QM7A 2FKWB 2ZXEB 1VQPP 3OW2O 2Q6QA 3GG2A 1FS0E 3FWNA 3WUVA 2J5UA 5APSA 2OYIA 2P58A 4WVZA 3A7OA 2FFDB 3C9IA 1LT1A 1SP4A 3KDPB 2ITAA 3IFMA 3RBZA 1QEXA 4HJGH 4HH2A 1U7JA 2WPQA 3M0DA 1AV1A 2IBZI 1URQD 5AVQB 1N86A 3VTPC 2GUSA 1IO4A 2DW3A 1SQVG 3CXHE 3P32A 2Y0EA 4JPZB 3H1JD 3AECC 4R4MA 1IFIA 2I1JA 5KJ7D 1H89A 3L70E 2WWWA 1BE3J 1GW4A 2AEMA 3AE1C 1GZLA 3VOPA 5CCHA 1M8OB 1KQGB 2AEFA 2O3JA 3FWLA 5CHXA 3L70J 5DJTB 4N3YB 3T97B 3G3ZA 3TGUD 1N73A 1NTKG 2KYVA 4C7RA 2RN0A 3H1HJ 3CX5H 1NTKK 2IYOA 2UWJE 3KXDA 1CSBA 2Y0DA 2OTLP 2M0BA 4GDOA 4BRYA 5EFWB 3HUSB 1LTJC 4KHXA 1W2EA 1BSNA 2WTYA 1HF9A 3CCRP 1W2BO 2M8RA 1PZQA 2BCCG 3L75E 1NTMG 1FOSF 2IBZG 3CXHI 1J1EC 1X22A 2E76B 2I1KA 3Q1MA 3HE4A 2N1TA 4D6TJ 3HUSC 1LWUA 2C9LY 4IL6E 3FXEA 1RHZB 1S1CX 3HD7D 1EC5A 1LTSC 1NTKD 4XA4A 3S4RA 4K3AA 1P84I 1NU1J 2K37A 2E76C 3RL0g 1R8EA 5APXA 1KYOE 3UIAA 1EZVE 3BCCE 2O1JA 5CBNA 1ZMEC 3VMAA 3CCQP 4N78E 2OTJP 2AEJA 2QM8A 5AW1B 3MHVA 2V7QJ 3AEGC 3BCCJ 3CD6P 4H13B 2BCCD 1NTMD 2IBZD 3PP5A 2E42A 4U7JA 1KILB 2CPBA 2IFMA 2QJYB 2M5AA 3RK3E 1OVVA 3KZIE 1IFMA 3N7NA 3WUTA 4H13C 2AXTH 1BE3G 4UB8H 1IK7A 3AEEC 2R5DA 3OJAB 3MGNA 3PTZA 3L70G 1DEBA 1LGHB 5GTIE 2KSEA 2QRXA 3RL0B 3B8EB 1KYOI 1KV4A 1EZVI 3AE5C 2HODB 3H1HG 1SQBE 1HBWA 5AW2B 2KLUA 3B5NB 3HE5B 1GTWA 2Z5IA 3L72J 2O01J 1SQBJ 2B89A 2H7HA 3M91A 2KOGA 2XZRA 4EOTA 1U57A 1VQ4P 1GD2E 3CC4P 1JO5A 4BWNA 2GA1A 3B5NC 2XKMA 3VMXA 1PFIA 3CXHD 3FX0A 1T3JA 4GOEA 4MN4C 3CCSP 1L0LE 3GHGB 3L75G 3IAOA 3L70D 2E75B 1KB9H 3VYIA 1Q7YQ 1G2CB 2FY8A 1KQSO 3I55P 3WU2H 2ZT9B 1PP9E 2D2CB 4YTPC 1M7LA 2NPSA 2OQQA 1KC8Q 4UB6E 3USSA 3R4YA 1DEEG 1PP9J 3AEDC 2E75C 1K04A 1FZAA 3BRVB 2Q7CA 3AEAC 3K5BA 1Q81Q 5TJHA 1FZFA 2ZT9C 1EZVG 1SVFA 3BCCG 3D6YA 3P7KA 4Z1MH 3VP8A 1GL2B 3GF7A 1ZOYC 2QA4P 3PRJA 1EXIA 3LIDA 2MJZA 3L75D 4RO0A 2QIWA 4EDFA 1NKZB 1MFZA 4Y99B 5KLIB 1GL2C 1JTHB 4W7ZA 1VQLP 1USDA 2YXQB 1H8AA 3PJSK 2FFDA 2QJKB 2N9YB 5AVTB 2PP6A 5CCHD 4IOIH 3A3YB 3V2NA 3AEFC 1VQNP 1K05A 3CLQA 3M9QA 3Q5SA 5KKZB 5CCGA 3QH9A 1KYOD 3H1KE 1PV3A 2YKQA 1EZVD 1NWQA 3BCCD 3TGUJ 4N78D 2WSCJ 5K5GB 1LT9C 1VQ8P 3H1KJ 1LTBC 1SQBG 1FE6A 1XTGB 1MKMA 5KKZC 3BASA 1JUNA 3TF5A 1YIJP 2WSEJ 3CL3D 3RK3D 1SQXK 5C39A 2HLOA 1L4AB 1GDTA 1Q82Q 1URQB 2ZVOB 3T97A 2JDIH 1GU4A 3A0HE 1NYHA 2W27A 1S72P 2IZ1A 3TSIA 3WMM0 4EI2A 1G1JA 4B86A 1S5LH 2XNXA 1N7SB 4I2LC 1L0LK 1JY3N 3VMYA 1PP9G 2WPSA 1JY2N 2HYNA 2OYHC 1T8ZA 2K3RA 1URQC 3MUDA 3BATA 1S4XA 3HUSA 5B5EH 4PJ0H 1YYCA 3CMEP 1SQBD 1KMIZ 1M1KQ 2P67A 2PFXA 1VF5B 1FU1A 1T6AA 3H1IE 1LTGC 1VQOP 1IFJA 2RMZA 5CJ4A 3V2QA 3O8ZA 3AE8C 1AVOA 1FZCB 3CC2P 1OZHA 4HKZH 3CCVP 1Q86Q 3FGAD 1L0LD 1JCCA 1HTLC 3W68A 4H44D 2Y9YA 2IDBA 1AA0A 3E1RA 2E5TA 5AVVB 2L91A 3GW6A 1FZCC 1PP9D 3AEBC 2YMKA 3LW5J 2KB7P 5KLVK 3L4FA 4IFMA 5AVZB 3TGUG 3CX5E 3HRNA 3H25A 1IFPA 1KILA 3H1KG 3SFDC 3FXDA 1T2KC 1EDLA 1RQVA 3TDKA 2LXBA 1RH5B 3CWBE 2JJLA 1IC2A 2GUVA 2H88C 1LTAC 1FZGA 1X9VA 3CI9A 1NKNA 3HD7C 2WQYC 3CWBJ 2N9BA 1W5CE 3CMAP 3LIEA 3CCUP 4GKGA 2W6JH 1IFDA 2OTKE 3Q5PA 1BDDA 1HVVA 2QE7H 2WSFH 5AW9B 2XV5A 3G71P 1E5WA 2ZAEB 1PPJE 2HODA 3F89A 3B5NA 3HE5A 4PV1D 1N7LA 3Q5RA 2SPZA 3SFEC 1LTJB 2E74D 2WZ7A 1KFNA 3A0BE 1CI6B 1U7MA 1AVYA 1RY3A 4C7NB 3H1KD 2NPSD 5E79E 3CX5I 1VQ5P 1SLQA 1YJ9P 3RGUA 2L5GB 1J1EB 5BVZA 2ZYDA 1SQPE 1KILE 1SFCD 3GHGA 2A45I 1TU3F 1RF1C 1SQPJ 4CPGA 4DOJA 2Q9IA 1G2CA 2KZJA 3A2AA 1L0NE 1S5LX 2AXTE 5AVXB 1DD3A 4GT1A 3PH0A 4UB8E 3L75J 2FXPA 4ZKUA 1GK4A 1KN7A 5KAIH 4OGQD 1RQUA 1Y9BA 1FDIA 3AE7C 2CPSA 1NAYA 3CXHH 2RKLA 3GMAA 3L73E 3E1IA 5KAFH 2YIUC 1K73Q 1LJ2A 5AVUB 3L73J 2J59M 3V2RA 1GL2A 2Y9ZA 2WT7B 2XDJA 1YJWP 2E43A 3B4SA 5CCGD 5AVRB 1P84H 4WY4D 3BVHA 4R4LA 3G4SP 4GIFA 3H1ID 1PGQA 4K35A 1H88A 2HG5D 1JTHA 3VMZA 3M06A 2B87B 2ZXXA 2A45G 3TK1A 2OYOA 3CWBG 1UIIA 2K1AA 4H0LD 1R5SA 1KB9E 1Z56A 1PGOA 1BGYE 4WB4A 1VQ9P 1FOSE 1M90Q 2OYIC 1RF0C 2GM4A 1BGYJ 3V2PA 2Z5HA 1PPJG 3B71A 4IL6H 1IZNB 4DCKA 3CX5D 3NMDA 3M0DC 2POHA 2IYPA 1SQXE 3M0AA 3RK2D 2FYZA 1KYOH 2IX7C 1SQXJ 5CJ0A 2V7QH 1SQPG 3WUUA 3CWBD 1L4AA 3JC22 1GW3A 1URQA 2P1JA 1BCCD 2E76D 1YITP 1RE3C 1JY3O 1JY2O 2IZ0A 5CCHC 1Y47A 2WITA 3MP7B 5AW6B 1A02J 4JQ0D 3SSUA 1X79B 1NOHA 1SQPK 4N6JA 1KB9I 2KS1B 1QVFO 1N7SA 2K9YA 1L0LJ 1ZXGA 3KZIH 1QX8A 1PPJD 4I1LA 1JM0A 2LR2A 1L0NK 4OVNF 3CC7P 5DJUB 1AQTA 1JY3P 2KLVA 2PRRA 4PD4E 3CCEP 1JY2P 1FC2C 1FAVA 3L73G 5B66H 1VQKP 3V4WA 4LC1A 4QMAA 1FDMA 1OVUA 3KQGA 1HGZA 4H13D 2CK3H 2P2UA 3Q2YA 3RK3C 5GTIH 1ZLLA 1SQPD 3L36A 1FZCA 1KILD 4I7ZC 1YQ3C 2W90A 4AYCA 1N8RQ 2O01H 5BU8B 1LWUC 3PLNA 5KLVE 1RE4C 2FXMA 1M56D 4EIJA 1L0ND 2JP3A 3AE3C 2KI7B 1R5LA 5AVSB 5KLVJ 1YBKA 2O1KA 1NH4A 4GODA 1S5LE 1LT9B 1OMIA 1LTIC 1J2JB 5GTHE 1MFTA 5AW4B 1BGYG 3L73D 3RL0D 3AE9C 1ZRTE 2C0WA 2VRSA 5B5EE 4PD4I 3ABVC 2PGDA 3NXSA 1LP1B 1JMMA 2QEXP 4I6MC 1FJKA 5H2FE 1SQXG 3SWFA 3EWKA 1GMJA 1FZBA 2YO2A 2QVAA 4H44C 3OA7A 3CCLP 2FXOA 3TNUB 2OGUA 1SQVE 5KTBA 2BEQD 1HJ0A 1IJDB 2K9JB 2WPVB 1KB9D 2OYHB 2ZT9D 1LTJA 1L0LG 2KSJA 2N1TD 1X0TA 1BGYD 3U59A 1CI6A 2JR8A 2D2CD 1T3UA 4C7NA 2O01N 2C9NY 2BASA 1SQQE 2JWAA 3VP9A 4NPDA 4DZOA 1KORA 2R3SA 1FBMA 3II6A 2XNDH 1SQQJ 2W6BA 2HPCB 2YKOA 3CPWO 1OW8A 2YXRB 2R44A 1EXJA 2KNCB 4U3FE 2K88A 3S1KA 1SQXD 3KYQA 3MIWA 4PV1B 5KJ7C 2WSCH 4U3FJ 1PL5A 2KUBA 1FDOA 5APYA 5M1BA 4JYCA 4RKUJ 4Y28J 3AE6C 1J1DC 3H1IJ 1NGMB 1KD1Q 2P7JA 1MV8A 1AJYA 1NHLA 1S9KE 4PV1C 3D6ZA 2W83C 1OWAA 2WSEH 1SFCB 2E74C 3EQ2A 3SWKA 5KLVG 5TISH 3I56P 3HTKB 2FYUE 2NPSC 3H32B 5AW3B 4YXDC 1Y8AA 2WT7A 2WPRA 1VPCA 4O9BA 4XFJA 1JCDA 2HFED 2FYUJ 1PGJA 4W80A 1SFCC 4PD4D 3A0HH 2V4HA 4OGQB 5APVA 3L37A 3HD7B 3Q3DA 2R32A 2B87A 1RF0A 3JCUH 3CCMP 4LLHA 1M57D 2ZYAA 1IK9A 5BU5A 1M1JB 2WVRA 4OGQC 1BCCE 1ZR4A 5CMZA 2R5BA 1QL1A 2JEEA 2WMMA 5AW5B 5KLVD 1KTMA 1L4AD 1QVGO 4JBZA 4WY4B 1BCCJ 2FFDC 5KAIE 3IN6A 2NRGA 2ZVNB 2YMYA 1L2PA 1M1JC 1QL2A 1NO4A 1NTZE 1BE3E 3KPEA 1Q90D 2G3AA 1EDIA 2B9BA 1N7SD 5CCGC
chains in the Genus database with same CATH topology
3P7KA 1GL2D 5AVYB 5APWA 3VP8A 1GL2B 1RE3A 2ZFCA 1L4AC 2KP8A 1KZUB 4WY4C 1IFNA 3VN0A 1Z56A 3I5CA 1SQVK 4AUWA 3MD0A 1RF1B 3LW5H 3NFQA 3R2PA 4WB4A 1FOSE 1LTTC 3U1AA 2NPSB 3LIDA 2MJZA 4JYBA 2OYIC 1GU5A 2Q3IA 1RF0C 2C0XA 1MUUA 5AW0B 4IFFA 1NKZB 1MFZA 2GM4A 4Y99B 1N7SC 1DH3A 3V2PA 2Z5HA 1GL2C 1SQQK 1JTHB 4W7ZA 4XE5B 1HWTC 1XTCC 1CW5A 2YO3A 2OARA 2J58A 2YKPA 5APUA 1H8AA 1ZR2A 2FFDA 3NMDA 3M0DC 2POHA 5AVTB 3M0AA 3RK2D 2PP6A 5CCHD 2FYZA 3A3YB 3RK2B 3V4QA 3V2NA 3NTNA 2R3CA 1AQ5A 3CLQA 3M9QA 5CCGA 2IX7C 2FKWB 2QM7A 2ZXEB 2YKQA 2A45H 5CJ0A 1NWQA 1L4AA 4M3LA 4N78D 1GW3A 1LT9C 1URQA 1WRGA 2P1JA 1T2KD 1GK6A 1RE3C 1JOCA 3RK2C 1JY3O 1LTBC 1JY2O 5AW6B 5CCHC 2WITA 5APSA 1A02J 1XTGB 2OYIA 1X79B 1NOHA 1RE4A 1NTMK 1SQPK 3A7OA 3C9IA 4N6JA 2FFDB 2W6AA 1SP4A 1N7SA 3KDPB 3IFMA 3BASA 1JUNA 3CL3D 2LKMA 2FYUK 3RK3D 4HH2A 1N2DC 1SQXK 2WPQA 4I1LA 3M0DA 1L0NK 2HLOA 1G1IA 1L4AB 1URQD 1GDTA 1JY3P 2KLVA 5AVQB 1URQB 1JY2P 1FAVA 3T97A 1GU4A 1CZQA 1A02F 1N86A 2W27A 3VTPC 3TSIA 3V4WA 2GUSA 3WMM0 1IO4A 4LC1A 3P32A 1FDMA 1G1JA 2OYIB 4B86A 3KQGA 1HGZA 2XNXA 1KFMA 1IFIA 2I1JA 5KJ7D 2P2UA 3RK3C 1ZLLA 1N7SB 1LT9A 1S9KD 3L36A 1H89A 4I2LC 1L0LK 1FZCA 1JY3N 3VMYA 2WPSA 1GW4A 2WWWA 1JY2N 1KILD 2HYNA 3P8MC 2OYHC 1T8ZA 3MUDA 1URQC 3BATA 1GZLA 3VOPA 5CCHA 4AYCA 3HUSA 1HH0A 1OXZA 1YYCA 2O01H 2PAJA 5AW8B 2H8PD 5BU8B 5CHXA 1LWUC 2P67A 1RE4C 4AQRD 2FXMA 4N3YB 4EIJA 3G3ZA 1N73A 1FU1A 2KYVA 4C7RA 1LTGC 1IFJA 5AVSB 3P8CE 1KILC 5CJ4A 3V2QA 1HUCA 2O1KA 3EFGA 1NH4A 3O8ZA 1LT9B 1LTIC 3TYYA 1J2JB 1FZCB 1NTKK 3M9HA 1NTZK 1CSBA 5AW4B 3V5BA 3RL0D 3HUSB 1LTJC 1JCCA 4KHXA 1HTLC 2C0WA 3TNUA 2Q5UA 1W2EA 2VRSA 2WTYA 2M8RA 1FOSF 5AVVB 2OYHA 1N73B 1MZ9A 1J1EC 2Z4EA 1FZCC 1HGVA 3NXSA 2KB7P 2IPPA 2I1KA 3HE4A 1JMMA 1AFOA 4I6MC 5KLVK 2N1TA 3L4FA 3HUSC 3RL0C 4IFMA 5AVZB 1LWUA 1FJKA 2C9LY 3IR9A 3SWFA 1FZBA 2YO2A 5KJ7A 1FZEA 1VDFA 3OA7A 5AVWB 3HD7D 1X8YA 3HRNA 1LTSC 4XA4A 1N73C 1KILA 2HPCA 3N4XA 3TNUB 1T2KC 3RK3B 5KTBA 5APXA 3UIAA 1IJDB 2OYHB 1ZN5A 2O1JA 2JJLA 1IC2A 4N78E 2GUVA 1LTJA 2KSJA 2N1TD 2QM8A 1LTAC 5AW1B 3U59A 3HE4B 1CI6A 2N1TB 1FZGA 1X9VA 3CI9A 1T3UA 4C7NA 1KQLA 1NKNA 3HD7C 2C9NY 1LWUB 2BASA 2N9BA 3VP9A 3GHGC 5APQA 3LIEA 4GKGA 1IFDA 1WT6A 4DZOA 1HVVA 3PP5A 1HJBA 3OAKA 2WSFH 1FBMA 5AW9B 3II6A 2E42A 1KILB 2IFNA 2CPBA 2W6BA 2YKOA 2XV5A 2HPCB 1NU1K 2IFMA 1SFCA 2N1TC 1E5WA 2HODA 3HTKA 3B5NA 3HE5A 3KYQA 4W7YA 1IFMA 1N7LA 3N7NA 3MIWA 3H32A 5KJ7C 1LTJB 2WSCH 2WZ7A 1KFNA 1CI6B 1EQ7A 1RY3A 4C7NB 2NPSD 2R5DA 4HYTB 3OJAB 5APYA 5AW7B 3MGNA 3A5TA 4JYCA 4ZKPA 1SLQA 3MTUE 1J1DC 1J1EB 2L5GB 1JNMA 1DEBA 5BVZA 2P7JA 1LGHB 3L35A 1MV8A 3M9BA 3H6PA 1NHLA 5APTA 1S9KE 4IFDK 3RL0B 1OWAA 3HD7A 1SFCD 3B8EB 2WSEH 1SFCB 2A45I 3EQ2A 3GHGA 3B5ND 1RF1C 2HODB 1HBWA 5AW2B 3HTKB 3B5NB 1GTWA 3HE5B 2NPSC 4DOJA 1NAFA 3H32B 2Q9IA 1G2CA 5AW3B 1M1JA 2Z5IA 2WT7A 3A2AA 2WPRA 1VPCA 4O9BA 5AVXB 4Y99C 1JCDA 4GT1A 2HFED 2H7HA 4W80A 3M91A 3U1CA 2KOGA 2XZRA 4WBAA 4ZKUA 1GK4A 4EOTA 1SFCC 2H43A 1GD2E 3BRTB 1JO5A 4WY4A 3B5NC 2XKMA 4OH8B 2CPSA 3VMXA 1PFIA 5APVA 3L37A 1DX7A 1T3JA 3HD7B 2XU6A 2R32A 3GHGB 3E1IA 1RF0A 4LLHA 1YTZT 3VYIA 1G2CB 5AVUB 2J59M 4LGDE 3V2RA 1IK9A 5BU5A 1GL2A 1M1JB 2WT7B 2XDJA 1SQBK 1ZR4A 5CMZA 2E43A 2R5BA 3SWYA 5CCGD 5AVRB 1RF1A 1QL1A 2JEEA 1YTZI 4JF7A 4RESB 1M7LA 5AW5B 2NPSA 1L4AD 4WY4D 4C46A 3BVHA 4WY4B 4GIFA 2FFDC 1FZAA 3BRVB 2Q7CA 2YMYA 1M1JC 1H88A 2HG5D 1QL2A 2M3BA 1JTHA 2YNYA 3P8CD 3VMZA 1FZFA 1NO4A 3M06A 1FJPA 3KPEA 1ZV8A 2A45G 1J1DB 3TK1A 1N7SD 5CCGC 1SVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFM A;  1IFN A;  2IFN A;  3IFM A;  2KSJ A;  2IFM A;  1QL2 A;  2KLV A;  2XKM A;  1QL1 A;  1PFI A;  1ZN5 A;  4IFM A; 
#chains in the Genus database with same CATH topology
 5AVY B;  5KAF E;  1RE3 A;  2ZFC A;  1NTZ J;  4WY4 C;  1IFN A;  2G8Y A;  4H0L B;  3I5C A;  3CCJ P;  1SQV K;  1H0T B;  1ZRT D;  4AUW A;  1RF1 B;  1SQQ G;  3LW5 H;  3NFQ A;  2QG4 A;  1LTT C;  3U1A A;  1BSH A;  4JYB A;  1P84 E;  2BEZ F;  2Q3I A;  3PHL A;  2C0X A;  3H1H E;  1MUU A;  5AW0 B;  3IF4 A;  3L71 E;  1VF5 D;  1VL2 A;  1SQQ K;  4H0L C;  1CW5 A;  1EDK A;  2OAR A;  4U3F G;  2P10 A;  3L71 J;  2YKP A;  1ZR2 A;  2FYN B;  2KS1 A;  3G6E P;  3H1I G;  1KQF B;  3O6Q B;  3RK2 B;  2KK7 A;  1S2E A;  2R3C A;  4GOF A;  1AQ5 A;  3D71 A;  1SQV D;  1SS1 A;  2YIU B;  3F5H A;  2A45 H;  2ZJS E;  1L0N J;  4D6T E;  4M3L A;  2FYN C;  1OW6 A;  1WRG A;  1T2K D;  1GK6 A;  1JOC A;  3RK2 C;  3MUD C;  4HB1 A;  1SQQ D;  2FYU G;  1PIX A;  1RE4 A;  1NTM K;  1NU1 E;  3AE4 C;  2W6A A;  4TLF A;  4EYY Q;  4YXW H;  2LKM A;  2FYU K;  4U3F D;  1N2D C;  2NZ2 A;  1G1I A;  3W67 A;  3A0B H;  2H89 C;  2FBW C;  2M3E A;  3C1L A;  1CZQ A;  4BXL A;  1A02 F;  5E79 H;  2Y0C A;  2A06 E;  2ZYG A;  4L73 A;  2OYI B;  2W8Z A;  4ZMD A;  1KFM A;  2E5Y A;  1YHQ P;  2Q3E A;  1LT9 A;  1S9K D;  1BCC G;  1K9M Q;  3P8M C;  1ZP0 C;  3GLM A;  1HH0 A;  1OXZ A;  3WU2 E;  2PAJ A;  1OFC X;  3C8V A;  5AW8 B;  2H8P D;  2FYU D;  3MZW B;  4AQR D;  1NTZ G;  2HR3 A;  1LP1 A;  5B66 E;  1WMK A;  3P8C E;  1KIL C;  1HUC A;  3EFG A;  2QJY C;  3TYY A;  3M9H A;  1NTZ K;  2MKV A;  2KIK A;  3V5B A;  3H1L E;  3TNU A;  2Q5U A;  3L72 E;  1OIP A;  3L71 G;  2AXC A;  1NJI Q;  4ZNC A;  3G9R A;  1USE A;  1YJN P;  2K9J A;  2OYH A;  3RBX A;  4WWI A;  1N73 B;  1MZ9 A;  1LNQ A;  3H1L J;  2I8D A;  2Z4E A;  1HGV A;  3D70 A;  2IPP A;  1AFO A;  3RL0 C;  2QJP B;  3IR9 A;  5KJ7 A;  1L0N G;  3EFF K;  1FZE A;  1VDF A;  3QWO C;  5AVW B;  1X8Y A;  4BRY B;  1JMB A;  3L74 E;  1N73 C;  1NTZ D;  1BE3 D;  2HPC A;  3N4X A;  3RK3 B;  4ASV A;  4D6T G;  2KNC A;  3S9O A;  3L74 J;  2QJP C;  1K8A Q;  4I7Z B;  2LXC B;  1ZN5 A;  1QLE D;  1UIX A;  1YI2 P;  3HE4 B;  2N1T B;  1KQL A;  1NU1 G;  1JEK A;  1LWU B;  1P84 D;  2RH0 A;  4NPE A;  3GHG C;  5APQ A;  3H1H D;  1S3J A;  3L71 D;  3JSV C;  1WT6 A;  1HJB A;  3OAK A;  4NPF X;  2IFN A;  1NU1 K;  1JB0 J;  1EDJ A;  1SFC A;  2N1T C;  2D2C C;  3HTK A;  4W7Y A;  1E79 H;  3H32 A;  4A7P A;  4KT0 J;  2A06 G;  1EQ7 A;  2JO1 A;  4HYT B;  3A5T A;  5AW7 B;  1QGK B;  4ZKP A;  4D6T D;  3H1J E;  5CBO A;  3MTU E;  1JNM A;  3L35 A;  3M9B A;  3H6P A;  5APT A;  2JWD A;  4IFD K;  1DD4 A;  1ZW0 A;  3HD7 A;  3H1J J;  1YQ4 C;  2M5A B;  4PJ0 E;  4TT3 H;  3B5N D;  2KXP B;  1NU1 D;  4H44 B;  1NAF A;  4DJG A;  1M1J A;  1DIP A;  3TGU E;  4Y99 C;  5KLI C;  4UB6 H;  1VQ6 P;  3U1C A;  4WBA A;  4PD4 H;  2H43 A;  3BRT B;  4YPC A;  4WY4 A;  4L75 A;  2QJK C;  4OH8 B;  3H1L G;  3L72 G;  1DX7 A;  2A06 D;  1BDC A;  2XU6 A;  3E7K A;  2E75 D;  5TIS E;  4L74 A;  1YTZ T;  4OWF A;  4LGD E;  3V6I A;  4IL6 X;  1Q2N A;  1SQB K;  1VQM P;  1SQV J;  1H0T A;  3SWY A;  1RF1 A;  4DT0 A;  2B88 A;  4JF7 A;  1YTZ I;  4RES B;  4C46 A;  3L74 G;  4RJT A;  1D7M A;  2QSI A;  2M3B A;  2YNY A;  3P8C D;  1NTK E;  1FJP A;  1ZV8 A;  1OVR A;  1J1D B;  1OW7 A;  1NVO A;  5GTH H;  1GL2 D;  2Q1K A;  2JKV A;  3JCU E;  5APW A;  3ZDM A;  1NTK J;  1L4A C;  2KP8 A;  1KZU B;  3VN0 A;  1PGP A;  2WSS H;  5L8R J;  3O6Q A;  1OX3 A;  4KJM A;  2E74 B;  3H1L D;  3MD0 A;  3L72 D;  3R2P A;  3ITK A;  2NPS B;  1GU5 A;  4IFF A;  2BCC E;  1N7S C;  1NTM E;  1DH3 A;  3AE2 C;  2IBZ E;  4XE5 B;  1HWT C;  1XTC C;  2YO3 A;  4L76 A;  2KZI A;  2J58 A;  5H2F H;  4ASW A;  5APU A;  2BCC J;  1NTM J;  1VQ7 P;  2WSF J;  3L74 D;  3GF3 A;  3V4Q A;  3NTN A;  1VF5 C;  3KHU A;  3H1J G;  2QM7 A;  2FKW B;  2ZXE B;  1VQP P;  3OW2 O;  2Q6Q A;  3GG2 A;  1FS0 E;  3FWN A;  3WUV A;  2J5U A;  5APS A;  2OYI A;  2P58 A;  4WVZ A;  3A7O A;  2FFD B;  3C9I A;  1LT1 A;  1SP4 A;  3KDP B;  2ITA A;  3IFM A;  3RBZ A;  1QEX A;  4HJG H;  4HH2 A;  1U7J A;  2WPQ A;  3M0D A;  1AV1 A;  2IBZ I;  1URQ D;  5AVQ B;  1N86 A;  3VTP C;  2GUS A;  1IO4 A;  2DW3 A;  1SQV G;  3CXH E;  3P32 A;  2Y0E A;  4JPZ B;  3H1J D;  3AEC C;  4R4M A;  1IFI A;  2I1J A;  5KJ7 D;  1H89 A;  3L70 E;  2WWW A;  1BE3 J;  1GW4 A;  2AEM A;  3AE1 C;  1GZL A;  3VOP A;  5CCH A;  1M8O B;  1KQG B;  2AEF A;  2O3J A;  3FWL A;  5CHX A;  3L70 J;  5DJT B;  4N3Y B;  3T97 B;  3G3Z A;  3TGU D;  1N73 A;  1NTK G;  2KYV A;  4C7R A;  2RN0 A;  3H1H J;  3CX5 H;  1NTK K;  2IYO A;  2UWJ E;  3KXD A;  1CSB A;  2Y0D A;  2OTL P;  2M0B A;  4GDO A;  4BRY A;  5EFW B;  3HUS B;  1LTJ C;  4KHX A;  1W2E A;  1BSN A;  2WTY A;  1HF9 A;  3CCR P;  1W2B O;  2M8R A;  1PZQ A;  2BCC G;  3L75 E;  1NTM G;  1FOS F;  2IBZ G;  3CXH I;  1J1E C;  1X22 A;  2E76 B;  2I1K A;  3Q1M A;  3HE4 A;  2N1T A;  4D6T J;  3HUS C;  1LWU A;  2C9L Y;  4IL6 E;  3FXE A;  1RHZ B;  1S1C X;  3HD7 D;  1EC5 A;  1LTS C;  1NTK D;  4XA4 A;  3S4R A;  4K3A A;  1P84 I;  1NU1 J;  2K37 A;  2E76 C;  3RL0 g;  1R8E A;  5APX A;  1KYO E;  3UIA A;  1EZV E;  3BCC E;  2O1J A;  5CBN A;  1ZME C;  3VMA A;  3CCQ P;  4N78 E;  2OTJ P;  2AEJ A;  2QM8 A;  5AW1 B;  3MHV A;  2V7Q J;  3AEG C;  3BCC J;  3CD6 P;  4H13 B;  2BCC D;  1NTM D;  2IBZ D;  3PP5 A;  2E42 A;  4U7J A;  1KIL B;  2CPB A;  2IFM A;  2QJY B;  2M5A A;  3RK3 E;  1OVV A;  3KZI E;  1IFM A;  3N7N A;  3WUT A;  4H13 C;  2AXT H;  1BE3 G;  4UB8 H;  1IK7 A;  3AEE C;  2R5D A;  3OJA B;  3MGN A;  3PTZ A;  3L70 G;  1DEB A;  1LGH B;  5GTI E;  2KSE A;  2QRX A;  3RL0 B;  3B8E B;  1KYO I;  1KV4 A;  1EZV I;  3AE5 C;  2HOD B;  3H1H G;  1SQB E;  1HBW A;  5AW2 B;  2KLU A;  3B5N B;  3HE5 B;  1GTW A;  2Z5I A;  3L72 J;  2O01 J;  1SQB J;  2B89 A;  2H7H A;  3M91 A;  2KOG A;  2XZR A;  4EOT A;  1U57 A;  1VQ4 P;  1GD2 E;  3CC4 P;  1JO5 A;  4BWN A;  2GA1 A;  3B5N C;  2XKM A;  3VMX A;  1PFI A;  3CXH D;  3FX0 A;  1T3J A;  4GOE A;  4MN4 C;  3CCS P;  1L0L E;  3GHG B;  3L75 G;  3IAO A;  3L70 D;  2E75 B;  1KB9 H;  3VYI A;  1Q7Y Q;  1G2C B;  2FY8 A;  1KQS O;  3I55 P;  3WU2 H;  2ZT9 B;  1PP9 E;  2D2C B;  4YTP C;  1M7L A;  2NPS A;  2OQQ A;  1KC8 Q;  4UB6 E;  3USS A;  3R4Y A;  1DEE G;  1PP9 J;  3AED C;  2E75 C;  1K04 A;  1FZA A;  3BRV B;  2Q7C A;  3AEA C;  3K5B A;  1Q81 Q;  5TJH A;  1FZF A;  2ZT9 C;  1EZV G;  1SVF A;  3BCC G;  3D6Y A;  3P7K A;  4Z1M H;  3VP8 A;  1GL2 B;  3GF7 A;  1ZOY C;  2QA4 P;  3PRJ A;  1EXI A;  3LID A;  2MJZ A;  3L75 D;  4RO0 A;  2QIW A;  4EDF A;  1NKZ B;  1MFZ A;  4Y99 B;  5KLI B;  1GL2 C;  1JTH B;  4W7Z A;  1VQL P;  1USD A;  2YXQ B;  1H8A A;  3PJS K;  2FFD A;  2QJK B;  2N9Y B;  5AVT B;  2PP6 A;  5CCH D;  4IOI H;  3A3Y B;  3V2N A;  3AEF C;  1VQN P;  1K05 A;  3CLQ A;  3M9Q A;  3Q5S A;  5KKZ B;  5CCG A;  3QH9 A;  1KYO D;  3H1K E;  1PV3 A;  2YKQ A;  1EZV D;  1NWQ A;  3BCC D;  3TGU J;  4N78 D;  2WSC J;  5K5G B;  1LT9 C;  1VQ8 P;  3H1K J;  1LTB C;  1SQB G;  1FE6 A;  1XTG B;  1MKM A;  5KKZ C;  3BAS A;  1JUN A;  3TF5 A;  1YIJ P;  2WSE J;  3CL3 D;  3RK3 D;  1SQX K;  5C39 A;  2HLO A;  1L4A B;  1GDT A;  1Q82 Q;  1URQ B;  2ZVO B;  3T97 A;  2JDI H;  1GU4 A;  3A0H E;  1NYH A;  2W27 A;  1S72 P;  2IZ1 A;  3TSI A;  3WMM 0;  4EI2 A;  1G1J A;  4B86 A;  1S5L H;  2XNX A;  1N7S B;  4I2L C;  1L0L K;  1JY3 N;  3VMY A;  1PP9 G;  2WPS A;  1JY2 N;  2HYN A;  2OYH C;  1T8Z A;  2K3R A;  1URQ C;  3MUD A;  3BAT A;  1S4X A;  3HUS A;  5B5E H;  4PJ0 H;  1YYC A;  3CME P;  1SQB D;  1KMI Z;  1M1K Q;  2P67 A;  2PFX A;  1VF5 B;  1FU1 A;  1T6A A;  3H1I E;  1LTG C;  1VQO P;  1IFJ A;  2RMZ A;  5CJ4 A;  3V2Q A;  3O8Z A;  3AE8 C;  1AVO A;  1FZC B;  3CC2 P;  1OZH A;  4HKZ H;  3CCV P;  1Q86 Q;  3FGA D;  1L0L D;  1JCC A;  1HTL C;  3W68 A;  4H44 D;  2Y9Y A;  2IDB A;  1AA0 A;  3E1R A;  2E5T A;  5AVV B;  2L91 A;  3GW6 A;  1FZC C;  1PP9 D;  3AEB C;  2YMK A;  3LW5 J;  2KB7 P;  5KLV K;  3L4F A;  4IFM A;  5AVZ B;  3TGU G;  3CX5 E;  3HRN A;  3H25 A;  1IFP A;  1KIL A;  3H1K G;  3SFD C;  3FXD A;  1T2K C;  1EDL A;  1RQV A;  3TDK A;  2LXB A;  1RH5 B;  3CWB E;  2JJL A;  1IC2 A;  2GUV A;  2H88 C;  1LTA C;  1FZG A;  1X9V A;  3CI9 A;  1NKN A;  3HD7 C;  2WQY C;  3CWB J;  2N9B A;  1W5C E;  3CMA P;  3LIE A;  3CCU P;  4GKG A;  2W6J H;  1IFD A;  2OTK E;  3Q5P A;  1BDD A;  1HVV A;  2QE7 H;  2WSF H;  5AW9 B;  2XV5 A;  3G71 P;  1E5W A;  2ZAE B;  1PPJ E;  2HOD A;  3F89 A;  3B5N A;  3HE5 A;  4PV1 D;  1N7L A;  3Q5R A;  2SPZ A;  3SFE C;  1LTJ B;  2E74 D;  2WZ7 A;  1KFN A;  3A0B E;  1CI6 B;  1U7M A;  1AVY A;  1RY3 A;  4C7N B;  3H1K D;  2NPS D;  5E79 E;  3CX5 I;  1VQ5 P;  1SLQ A;  1YJ9 P;  3RGU A;  2L5G B;  1J1E B;  5BVZ A;  2ZYD A;  1SQP E;  1KIL E;  1SFC D;  3GHG A;  2A45 I;  1TU3 F;  1RF1 C;  1SQP J;  4CPG A;  4DOJ A;  2Q9I A;  1G2C A;  2KZJ A;  3A2A A;  1L0N E;  1S5L X;  2AXT E;  5AVX B;  1DD3 A;  4GT1 A;  3PH0 A;  4UB8 E;  3L75 J;  2FXP A;  4ZKU A;  1GK4 A;  1KN7 A;  5KAI H;  4OGQ D;  1RQU A;  1Y9B A;  1FDI A;  3AE7 C;  2CPS A;  1NAY A;  3CXH H;  2RKL A;  3GMA A;  3L73 E;  3E1I A;  5KAF H;  2YIU C;  1K73 Q;  1LJ2 A;  5AVU B;  3L73 J;  2J59 M;  3V2R A;  1GL2 A;  2Y9Z A;  2WT7 B;  2XDJ A;  1YJW P;  2E43 A;  3B4S A;  5CCG D;  5AVR B;  1P84 H;  4WY4 D;  3BVH A;  4R4L A;  3G4S P;  4GIF A;  3H1I D;  1PGQ A;  4K35 A;  1H88 A;  2HG5 D;  1JTH A;  3VMZ A;  3M06 A;  2B87 B;  2ZXX A;  2A45 G;  3TK1 A;  2OYO A;  3CWB G;  1UII A;  2K1A A;  4H0L D;  1R5S A;  1KB9 E;  1Z56 A;  1PGO A;  1BGY E;  4WB4 A;  1VQ9 P;  1FOS E;  1M90 Q;  2OYI C;  1RF0 C;  2GM4 A;  1BGY J;  3V2P A;  2Z5H A;  1PPJ G;  3B71 A;  4IL6 H;  1IZN B;  4DCK A;  3CX5 D;  3NMD A;  3M0D C;  2POH A;  2IYP A;  1SQX E;  3M0A A;  3RK2 D;  2FYZ A;  1KYO H;  2IX7 C;  1SQX J;  5CJ0 A;  2V7Q H;  1SQP G;  3WUU A;  3CWB D;  1L4A A;  3JC2 2;  1GW3 A;  1URQ A;  2P1J A;  1BCC D;  2E76 D;  1YIT P;  1RE3 C;  1JY3 O;  1JY2 O;  2IZ0 A;  5CCH C;  1Y47 A;  2WIT A;  3MP7 B;  5AW6 B;  1A02 J;  4JQ0 D;  3SSU A;  1X79 B;  1NOH A;  1SQP K;  4N6J A;  1KB9 I;  2KS1 B;  1QVF O;  1N7S A;  2K9Y A;  1L0L J;  1ZXG A;  3KZI H;  1QX8 A;  1PPJ D;  4I1L A;  1JM0 A;  2LR2 A;  1L0N K;  4OVN F;  3CC7 P;  5DJU B;  1AQT A;  1JY3 P;  2KLV A;  2PRR A;  4PD4 E;  3CCE P;  1JY2 P;  1FC2 C;  1FAV A;  3L73 G;  5B66 H;  1VQK P;  3V4W A;  4LC1 A;  4QMA A;  1FDM A;  1OVU A;  3KQG A;  1HGZ A;  4H13 D;  2CK3 H;  2P2U A;  3Q2Y A;  3RK3 C;  5GTI H;  1ZLL A;  1SQP D;  3L36 A;  1FZC A;  1KIL D;  4I7Z C;  1YQ3 C;  2W90 A;  4AYC A;  1N8R Q;  2O01 H;  5BU8 B;  1LWU C;  3PLN A;  5KLV E;  1RE4 C;  2FXM A;  1M56 D;  4EIJ A;  1L0N D;  2JP3 A;  3AE3 C;  2KI7 B;  1R5L A;  5AVS B;  5KLV J;  1YBK A;  2O1K A;  1NH4 A;  4GOD A;  1S5L E;  1LT9 B;  1OMI A;  1LTI C;  1J2J B;  5GTH E;  1MFT A;  5AW4 B;  1BGY G;  3L73 D;  3RL0 D;  3AE9 C;  1ZRT E;  2C0W A;  2VRS A;  5B5E E;  4PD4 I;  3ABV C;  2PGD A;  3NXS A;  1LP1 B;  1JMM A;  2QEX P;  4I6M C;  1FJK A;  5H2F E;  1SQX G;  3SWF A;  3EWK A;  1GMJ A;  1FZB A;  2YO2 A;  2QVA A;  4H44 C;  3OA7 A;  3CCL P;  2FXO A;  3TNU B;  2OGU A;  1SQV E;  5KTB A;  2BEQ D;  1HJ0 A;  1IJD B;  2K9J B;  2WPV B;  1KB9 D;  2OYH B;  2ZT9 D;  1LTJ A;  1L0L G;  2KSJ A;  2N1T D;  1X0T A;  1BGY D;  3U59 A;  1CI6 A;  2JR8 A;  2D2C D;  1T3U A;  4C7N A;  2O01 N;  2C9N Y;  2BAS A;  1SQQ E;  2JWA A;  3VP9 A;  4NPD A;  4DZO A;  1KOR A;  2R3S A;  1FBM A;  3II6 A;  2XND H;  1SQQ J;  2W6B A;  2HPC B;  2YKO A;  3CPW O;  1OW8 A;  2YXR B;  2R44 A;  1EXJ A;  2KNC B;  4U3F E;  2K88 A;  3S1K A;  1SQX D;  3KYQ A;  3MIW A;  4PV1 B;  5KJ7 C;  2WSC H;  4U3F J;  1PL5 A;  2KUB A;  1FDO A;  5APY A;  5M1B A;  4JYC A;  4RKU J;  4Y28 J;  3AE6 C;  1J1D C;  3H1I J;  1NGM B;  1KD1 Q;  2P7J A;  1MV8 A;  1AJY A;  1NHL A;  1S9K E;  4PV1 C;  3D6Z A;  2W83 C;  1OWA A;  2WSE H;  1SFC B;  2E74 C;  3EQ2 A;  3SWK A;  5KLV G;  5TIS H;  3I56 P;  3HTK B;  2FYU E;  2NPS C;  3H32 B;  5AW3 B;  4YXD C;  1Y8A A;  2WT7 A;  2WPR A;  1VPC A;  4O9B A;  4XFJ A;  1JCD A;  2HFE D;  2FYU J;  1PGJ A;  4W80 A;  1SFC C;  4PD4 D;  3A0H H;  2V4H A;  4OGQ B;  5APV A;  3L37 A;  3HD7 B;  3Q3D A;  2R32 A;  2B87 A;  1RF0 A;  3JCU H;  3CCM P;  4LLH A;  1M57 D;  2ZYA A;  1IK9 A;  5BU5 A;  1M1J B;  2WVR A;  4OGQ C;  1BCC E;  1ZR4 A;  5CMZ A;  2R5B A;  1QL1 A;  2JEE A;  2WMM A;  5AW5 B;  5KLV D;  1KTM A;  1L4A D;  1QVG O;  4JBZ A;  4WY4 B;  1BCC J;  2FFD C;  5KAI E;  3IN6 A;  2NRG A;  2ZVN B;  2YMY A;  1L2P A;  1M1J C;  1QL2 A;  1NO4 A;  1NTZ E;  1BE3 E;  3KPE A;  1Q90 D;  2G3A A;  1EDI A;  2B9B A;  1N7S D;  5CCG C; 
#chains in the Genus database with same CATH homology
 3P7K A;  1GL2 D;  5AVY B;  5APW A;  3VP8 A;  1GL2 B;  1RE3 A;  2ZFC A;  1L4A C;  2KP8 A;  1KZU B;  4WY4 C;  1IFN A;  3VN0 A;  1Z56 A;  3I5C A;  1SQV K;  4AUW A;  3MD0 A;  1RF1 B;  3LW5 H;  3NFQ A;  3R2P A;  4WB4 A;  1FOS E;  1LTT C;  3U1A A;  2NPS B;  3LID A;  2MJZ A;  4JYB A;  2OYI C;  1GU5 A;  2Q3I A;  1RF0 C;  2C0X A;  1MUU A;  5AW0 B;  4IFF A;  1NKZ B;  1MFZ A;  2GM4 A;  4Y99 B;  1N7S C;  1DH3 A;  3V2P A;  2Z5H A;  1GL2 C;  1SQQ K;  1JTH B;  4W7Z A;  4XE5 B;  1HWT C;  1XTC C;  1CW5 A;  2YO3 A;  2OAR A;  2J58 A;  2YKP A;  5APU A;  1H8A A;  1ZR2 A;  2FFD A;  3NMD A;  3M0D C;  2POH A;  5AVT B;  3M0A A;  3RK2 D;  2PP6 A;  5CCH D;  2FYZ A;  3A3Y B;  3RK2 B;  3V4Q A;  3V2N A;  3NTN A;  2R3C A;  1AQ5 A;  3CLQ A;  3M9Q A;  5CCG A;  2IX7 C;  2FKW B;  2QM7 A;  2ZXE B;  2YKQ A;  2A45 H;  5CJ0 A;  1NWQ A;  1L4A A;  4M3L A;  4N78 D;  1GW3 A;  1LT9 C;  1URQ A;  1WRG A;  2P1J A;  1T2K D;  1GK6 A;  1RE3 C;  1JOC A;  3RK2 C;  1JY3 O;  1LTB C;  1JY2 O;  5AW6 B;  5CCH C;  2WIT A;  5APS A;  1A02 J;  1XTG B;  2OYI A;  1X79 B;  1NOH A;  1RE4 A;  1NTM K;  1SQP K;  3A7O A;  3C9I A;  4N6J A;  2FFD B;  2W6A A;  1SP4 A;  1N7S A;  3KDP B;  3IFM A;  3BAS A;  1JUN A;  3CL3 D;  2LKM A;  2FYU K;  3RK3 D;  4HH2 A;  1N2D C;  1SQX K;  2WPQ A;  4I1L A;  3M0D A;  1L0N K;  2HLO A;  1G1I A;  1L4A B;  1URQ D;  1GDT A;  1JY3 P;  2KLV A;  5AVQ B;  1URQ B;  1JY2 P;  1FAV A;  3T97 A;  1GU4 A;  1CZQ A;  1A02 F;  1N86 A;  2W27 A;  3VTP C;  3TSI A;  3V4W A;  2GUS A;  3WMM 0;  1IO4 A;  4LC1 A;  3P32 A;  1FDM A;  1G1J A;  2OYI B;  4B86 A;  3KQG A;  1HGZ A;  2XNX A;  1KFM A;  1IFI A;  2I1J A;  5KJ7 D;  2P2U A;  3RK3 C;  1ZLL A;  1N7S B;  1LT9 A;  1S9K D;  3L36 A;  1H89 A;  4I2L C;  1L0L K;  1FZC A;  1JY3 N;  3VMY A;  2WPS A;  1GW4 A;  2WWW A;  1JY2 N;  1KIL D;  2HYN A;  3P8M C;  2OYH C;  1T8Z A;  3MUD A;  1URQ C;  3BAT A;  1GZL A;  3VOP A;  5CCH A;  4AYC A;  3HUS A;  1HH0 A;  1OXZ A;  1YYC A;  2O01 H;  2PAJ A;  5AW8 B;  2H8P D;  5BU8 B;  5CHX A;  1LWU C;  2P67 A;  1RE4 C;  4AQR D;  2FXM A;  4N3Y B;  4EIJ A;  3G3Z A;  1N73 A;  1FU1 A;  2KYV A;  4C7R A;  1LTG C;  1IFJ A;  5AVS B;  3P8C E;  1KIL C;  5CJ4 A;  3V2Q A;  1HUC A;  2O1K A;  3EFG A;  1NH4 A;  3O8Z A;  1LT9 B;  1LTI C;  3TYY A;  1J2J B;  1FZC B;  1NTK K;  3M9H A;  1NTZ K;  1CSB A;  5AW4 B;  3V5B A;  3RL0 D;  3HUS B;  1LTJ C;  1JCC A;  4KHX A;  1HTL C;  2C0W A;  3TNU A;  2Q5U A;  1W2E A;  2VRS A;  2WTY A;  2M8R A;  1FOS F;  5AVV B;  2OYH A;  1N73 B;  1MZ9 A;  1J1E C;  2Z4E A;  1FZC C;  1HGV A;  3NXS A;  2KB7 P;  2IPP A;  2I1K A;  3HE4 A;  1JMM A;  1AFO A;  4I6M C;  5KLV K;  2N1T A;  3L4F A;  3HUS C;  3RL0 C;  4IFM A;  5AVZ B;  1LWU A;  1FJK A;  2C9L Y;  3IR9 A;  3SWF A;  1FZB A;  2YO2 A;  5KJ7 A;  1FZE A;  1VDF A;  3OA7 A;  5AVW B;  3HD7 D;  1X8Y A;  3HRN A;  1LTS C;  4XA4 A;  1N73 C;  1KIL A;  2HPC A;  3N4X A;  3TNU B;  1T2K C;  3RK3 B;  5KTB A;  5APX A;  3UIA A;  1IJD B;  2OYH B;  1ZN5 A;  2O1J A;  2JJL A;  1IC2 A;  4N78 E;  2GUV A;  1LTJ A;  2KSJ A;  2N1T D;  2QM8 A;  1LTA C;  5AW1 B;  3U59 A;  3HE4 B;  1CI6 A;  2N1T B;  1FZG A;  1X9V A;  3CI9 A;  1T3U A;  4C7N A;  1KQL A;  1NKN A;  3HD7 C;  2C9N Y;  1LWU B;  2BAS A;  2N9B A;  3VP9 A;  3GHG C;  5APQ A;  3LIE A;  4GKG A;  1IFD A;  1WT6 A;  4DZO A;  1HVV A;  3PP5 A;  1HJB A;  3OAK A;  2WSF H;  1FBM A;  5AW9 B;  3II6 A;  2E42 A;  1KIL B;  2IFN A;  2CPB A;  2W6B A;  2YKO A;  2XV5 A;  2HPC B;  1NU1 K;  2IFM A;  1SFC A;  2N1T C;  1E5W A;  2HOD A;  3HTK A;  3B5N A;  3HE5 A;  3KYQ A;  4W7Y A;  1IFM A;  1N7L A;  3N7N A;  3MIW A;  3H32 A;  5KJ7 C;  1LTJ B;  2WSC H;  2WZ7 A;  1KFN A;  1CI6 B;  1EQ7 A;  1RY3 A;  4C7N B;  2NPS D;  2R5D A;  4HYT B;  3OJA B;  5APY A;  5AW7 B;  3MGN A;  3A5T A;  4JYC A;  4ZKP A;  1SLQ A;  3MTU E;  1J1D C;  1J1E B;  2L5G B;  1JNM A;  1DEB A;  5BVZ A;  2P7J A;  1LGH B;  3L35 A;  1MV8 A;  3M9B A;  3H6P A;  1NHL A;  5APT A;  1S9K E;  4IFD K;  3RL0 B;  1OWA A;  3HD7 A;  1SFC D;  3B8E B;  2WSE H;  1SFC B;  2A45 I;  3EQ2 A;  3GHG A;  3B5N D;  1RF1 C;  2HOD B;  1HBW A;  5AW2 B;  3HTK B;  3B5N B;  1GTW A;  3HE5 B;  2NPS C;  4DOJ A;  1NAF A;  3H32 B;  2Q9I A;  1G2C A;  5AW3 B;  1M1J A;  2Z5I A;  2WT7 A;  3A2A A;  2WPR A;  1VPC A;  4O9B A;  5AVX B;  4Y99 C;  1JCD A;  4GT1 A;  2HFE D;  2H7H A;  4W80 A;  3M91 A;  3U1C A;  2KOG A;  2XZR A;  4WBA A;  4ZKU A;  1GK4 A;  4EOT A;  1SFC C;  2H43 A;  1GD2 E;  3BRT B;  1JO5 A;  4WY4 A;  3B5N C;  2XKM A;  4OH8 B;  2CPS A;  3VMX A;  1PFI A;  5APV A;  3L37 A;  1DX7 A;  1T3J A;  3HD7 B;  2XU6 A;  2R32 A;  3GHG B;  3E1I A;  1RF0 A;  4LLH A;  1YTZ T;  3VYI A;  1G2C B;  5AVU B;  2J59 M;  4LGD E;  3V2R A;  1IK9 A;  5BU5 A;  1GL2 A;  1M1J B;  2WT7 B;  2XDJ A;  1SQB K;  1ZR4 A;  5CMZ A;  2E43 A;  2R5B A;  3SWY A;  5CCG D;  5AVR B;  1RF1 A;  1QL1 A;  2JEE A;  1YTZ I;  4JF7 A;  4RES B;  1M7L A;  5AW5 B;  2NPS A;  1L4A D;  4WY4 D;  4C46 A;  3BVH A;  4WY4 B;  4GIF A;  2FFD C;  1FZA A;  3BRV B;  2Q7C A;  2YMY A;  1M1J C;  1H88 A;  2HG5 D;  1QL2 A;  2M3B A;  1JTH A;  2YNY A;  3P8C D;  3VMZ A;  1FZF A;  1NO4 A;  3M06 A;  1FJP A;  3KPE A;  1ZV8 A;  2A45 G;  1J1D B;  3TK1 A;  1N7S D;  5CCG C;  1SVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...