1SQPJ

Crystal structure analysis of bovine bc1 with myxothiazol
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
61
structure length
61
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 18
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1sqpJ00
3CX5I 3H1LJ 4D6TJ 3H1JJ 3H1HJ 1BGYJ 5KLVJ 3L75J 2BCCJ 1NTKJ 3CWBJ 1BCCJ 1L0LJ 1SQXJ 1KB9I 3H1KJ 3L70J 4PD4I 1PP9J 1P84I 1NU1J 1NTMJ 1BE3J 1SQQJ 1KYOI 1EZVI 3L73J 3BCCJ 3TGUJ 3CXHI 1SQPJ 2IBZI 3L74J 3H1IJ 4U3FJ 1NTZJ 3L72J 1L0NJ 1SQBJ 1SQVJ 2FYUJ 3L71J
chains in the Genus database with same CATH superfamily
3PHLA 1SQBG 1WRGA 1LTJB 1PP9J 4Z1MH 1GL2A 2E43A 5M1BA 3W67A 4BWNA 4HH2A 1GL2D 2ZYGA 4IOIH 3TGUG 2IBZD 4IL6E 4AUWA 3NXSA 1GU5A 2FYNC 3TYYA 4WWIA 3L73D 2OARA 1VF5C 4PD4D 1YQ3C 3BCCJ 1NKNA 1L0NE 1JMBA 2FYUK 3AEBC 3NTNA 3H1HE 2N9BA 1YHQP 3H6PA 3HD7B 1LWUC 3E7KA 1NTMJ 3H1KG 3MUDA 3AE2C 4WY4A 3H1LD 4WBAA 3M06A 1LTSC 4WY4D 5KLVE 1RF1C 1CI6B 1H0TB 2IYPA 3IF4A 1T3UA 4N6JA 2SPZA 2XZRA 2BASA 3HUSA 1HJ0A 2L5GB 2OYHB 2YIUC 2A06E 4U3FD 3KHUA 2Y0DA 1BGYD 1JY2O 2HFED 2XNXA 3D6YA 3AE9C 1AA0A 3MZWB 1IJDB 2KLUA 3HTKA 2HPCB 1URQC 3AEGC 4GOEA 3TGUE 1KB9H 2R44A 4W7ZA 1BE3G 2N1TC 3R4YA 1VQNP 1G2CB 1A02F 1PPJD 3VOPA 2VRSA 3L75J 1NO4A 1NGMB 1ZLLA 2QJKC 4ASVA 2FFDA 1YYCA 4JBZA 1JOCA 3R2PA 1LTJA 1RE4C 2UWJE 3L70E 3GHGB 3H1KE 2XU6A 3A0HH 3JSVC 3H1ID 5KTBA 1FU1A 2O1JA 2BEQD 3Q5SA 1FE6A 2MJZA 3GF3A 1J1EC 2ITAA 2E42A 3Q5RA 5AW6B 1J2JB 1L2PA 3MTUE 2KYVA 4TT3H 4TLFA 1M57D 1M1JB 5CCHA 3L37A 1X8YA 5CCHD 1MUUA 5TJHA 4N78E 1M1KQ 1JY2P 3VTPC 3HD7A 5K5GB 2AEMA 4A7PA 2KUBA 3HD7D 1YI2P 2AEFA 1BE3E 1QLED 3JC22 1OX3A 5AVRB 1CI6A 1H0TA 1YTZI 1FDIA 1RY3A 1NAFA 3A5TA 1EDIA 5DJUB 2D2CC 1ZR2A 2OYHA 2W8ZA 1SFCC 4NPEA 2QE7H 4RO0A 1KFNA 1GTWA 5KLIC 2FBWC 1PZQA 1IFNA 1NWQA 4QMAA 1RE3A 2E74B 2RKLA 1EDKA 2P58A 2K3RA 4YXDC 4LGDE 1SVFA 1SQPG 1J1DC 1GD2E 1YIJP 2HPCA 3A2AA 5AW8B 1NHLA 4M3LA 3KQGA 1BDCA 3G6EP 1KB9E 1G2CA 2WSFJ 2P10A 3AE3C 4B86A 1QL1A 1DX7A 1KQGB 2WPVB 5APYA 1Y8AA 4H44B 1LJ2A 4UB6H 1ZRTE 3PTZA 2WVRA 2NPSA 1SQQJ 1FZBA 1QGKB 2NPSD 2RH0A 3GHGA 1N7LA 2O01N 4L76A 2LXCB 3LW5J 3KPEA 1FZCC 1JY2N 1DIPA 3A0HE 1K05A 1YJWP 2I1JA 4Y99B 1SP4A 5AW3B 2QEXP 5AW4B 3H1IG 3L71J 3L74G 1M1JA 2W6BA 1PP9D 2NZ2A 3P8MC 4NPFX 3N4XA 2YO2A 3M0DA 3SWKA 3CWBG 2FY8A 3K5BA 1SQPE 3B71A 3CPWO 2W27A 1KYOH 2Q6QA 3M0AA 1VQ9P 2IDBA 1NTKJ 2KZIA 3TDKA 3CCVP 2Z4EA 3BCCD 2M8RA 1S9KD 4RJTA 1AQ5A 3MGNA 1U7MA 1FDMA 1PFIA 1NVOA 2QM8A 2PAJA 3D71A 4R4MA 3L4FA 1ZMEC 3CCMP 2YKOA 1NTMD 2FXMA 1L0LJ 3I56P 1L4AB 2QM7A 4HJGH 3E1RA 2E74D 3P8CD 1AVOA 2V4HA 3C8VA 4YXWH 3KYQA 4GOFA 2ZXEB 2K9JB 1S5LH 1FOSE 1BCCG 2MKVA 3H1IE 3L74E 4O9BA 1GU4A 1PGQA 1GK4A 3CXHD 3Q5PA 5CCGC 3CWBE 1OW7A 4H44D 4UB6E 1LNQA 3WMM0 2O3JA 1BDDA 5KJ7A 4PV1B 1VDFA 1ZV8A 2K37A 2WSEJ 5KJ7D 3L75D 1MFZA 2WPSA 1S1CX 1W5CE 3CMEP 3TF5A 5AW5B 2AXTH 1OW8A 5APQA 3T97B 2NPSC 2WSSH 1VQ4P 2Y0EA 2V7QH 1BSNA 3VP9A 1IK7A 2OYIC 3VN0A 2Q3IA 1GDTA 1S3JA 2XDJA 1LGHB 2E76C 2FYUG 1QEXA 1SQXJ 3IFMA 3M9BA 1MV8A 1VPCA 4BXLA 2HR3A 2CPBA 1XTCC 3EFGA 2IBZI 2ZJSE 3RK2C 1OFCX 4H13B 1KYOE 3AE6C 1FAVA 4D6TJ 4DCKA 1BCCE 1FJKA 1ZW0A 3H1JG 1LTGC 1RF0A 1P84I 3CCSP 1HH0A 1IO4A 4KJMA 2QG4A 1NAYA 1TU3F 2KNCB 3CLQA 2HYNA 1S5LX 3RK3C 1L4AA 3VYIA 3RL0B 1DEEG 1L4AD 2JWDA 1RQUA 1FDOA 4OWFA 2YNYA 3KZIH 3S4RA 2IZ1A 2R3CA 1KILB 1L0NJ 2K9JA 1ZP0C 1ZN5A 2Q1KA 1KC8Q 2QJYB 1S5LE 1RH5B 5E79H 2WSCJ 2JR8A 1X22A 5B66H 3CCUP 2K9YA 2H7HA 1P84D 3CC2P 2FYUE 4PJ0H 1N7SC 1FBMA 5KLVJ 4NPDA 1N73B 5GTIH 1R5LA 1OWAA 3GLMA 2IX7C 4PV1D 3L70G 5BVZA 3Q1MA 5AW7B 3BATA 5H2FH 3PLNA 4GT1A 4C7RA 1SQBJ 3CL3D 3H1JE 4L73A 3T97A 2QSIA 1WT6A 2E75C 1E79H 2AXTE 1SQQD 3L75G 1Q86Q 1NU1J 1JNMA 3RK3E 3TGUJ 3CCLP 1KQLA 4H0LB 2M5AB 2PFXA 4JF7A 2A45I 2C9LY 3AEDC 1IFPA 2JJLA 3C9IA 3L72G 4JPZB 2BCCJ 4OGQC 1HWTC 2W90A 1FZFA 1GW4A 1NTMK 2YO3A 3AE8C 1EZVI 3L71D 5AW2B 4H13D 2GA1A 3SFDC 5AVUB 1E5WA 3TSIA 3GMAA 1OW6A 3H1KJ 1LT9B 4KT0J 2KNCA 2K88A 3CCEP 1NOHA 4PD4H 1K8AQ 1YTZT 2R3SA 3USSA 1NTKD 1USDA 1YBKA 2IPPA 2YMYA 1T8ZA 1X79B 3RL0D 2ZAEB 1CW5A 3SFEC 3MHVA 2M0BA 1KILA 2WSFH 1NTZD 5BU8B 1KV4A 3KZIE 1KILD 1EZVD 1T2KD 1ZXGA 2PP6A 3L75E 1L0LD 1EDLA 2WPRA 2ZT9B 1GZLA 2IZ0A 3H25A 5KKZC 1GL2C 2IBZG 5E79E 5B66E 1BE3J 2WPQA 4GODA 3L72E 1N73A 3L73G 4HYTB 4PJ0E 2IFMA 3JCUH 3VMZA 3HE4B 4HB1A 2Y9ZA 1JEKA 2L91A 1Q2NA 4I7ZC 3AECC 5GTIE 1KN7A 3B5NB 4YPCA 4KHXA 1NJIQ 2O01J 2IYOA 5H2FE 1FJPA 1FS0E 1QX8A 2QJPC 3CC7P 3H1LG 1NKZB 2B87B 5APWA 2Q3EA 1UIIA 5C39A 3MUDC 2M5AA 4WY4C 3P7KA 5AVYB 3PP5A 4H0LD 2O1KA 4JYBA 1N2DC 5EFWB 3S9OA 4U3FG 2LKMA 2K1AA 1W2BO 2FXPA 1A02J 2A45H 1BGYG 1FOSF 3HUSC 2FYNB 1KQFB 1VQMP 2J59M 3KXDA 3L35A 1M7LA 1VF5B 1HJBA 2C0WA 1PGPA 1LT9A 2IBZE 1SQXD 1OIPA 3ABVC 4DJGA 1Q81Q 3L73E 1PPJG 5GTHH 4PD4E 1LWUB 4D6TD 2JKVA 1SQVJ 3EFFK 3B4SA 2POHA 2P2UA 2LR2A 1NTKG 1RF1B 3FWLA 3TK1A 2FFDC 1KMIZ 1Q82Q 1LTAC 1SQPJ 2YKQA 2I1KA 2Y9YA 1U57A 3H1LE 2YIUB 1LTJC 2ZT9D 4GIFA 2FKWB 2PRRA 4C46A 1EDJA 2KP8A 1SQQK 2Z5HA 3BRTB 3VMXA 2WSEH 1L0ND 2JO1A 4U3FE 3HE4A 1URQB 3WUVA 3FX0A 1BGYE 3RBZA 5KAIH 3B5NA 3JCUE 3OA7A 3II6A 2N1TB 2C0XA 4DZOA 3B5ND 2QIWA 5CCHC 1HGZA 4BRYB 4I2LC 3S1KA 3SSUA 3CXHI 1G1JA 5KLVD 2H88C 1NTZJ 2QJKB 3HD7C 2JP3A 2R32A 2B87A 1PPJE 3UIAA 4XA4A 1SQBD 4EI2A 2XKMA 3L74J 3EQ2A 1OMIA 3F89A 1NTKE 2E5YA 1NTKK 3CX5I 3O8ZA 2OYHC 1J1EB 3FWNA 1NU1D 2OQQA 3CWBJ 2YXQB 4U7JA 3TGUD 1R5SA 3RGUA 1RHZB 2B89A 5APUA 1RE3C 1VF5D 3E1IA 3PH0A 2G8YA 1KILE 2ZVNB 1YQ4C 2BCCD 3CCJP 1Y47A 1L0LK 4WVZA 1H89A 1LWUA 1SQXG 4OVNF 3H32B 2M3BA 1IFDA 3AE5C 1SLQA 5GTHE 2P67A 4IFDK 4UB8H 2KI7B 2KXPB 2YKPA 1NH4A 3RBXA 3IAOA 3CCRP 1RF1A 1FC2C 3H1KD 1AQTA 2H43A 2WSCH 1DH3A 3CX5D 3F5HA 4XE5B 4OH8B 3U59A 3U1CA 3V2RA 2D2CB 1PV3A 1SFCB 2W6JH 2N9YB 3GHGC 5KLIB 3MD0A 1S4XA 3GG2A 1BCCJ 5AVZB 1J1DB 5APVA 1EC5A 3BVHA 1QVGO 5CBNA 1QVFO 4MN4C 2RMZA 4N78D 1URQA 2I8DA 1PP9G 4JQ0D 1JCDA 1URQD 1HBWA 1PIXA 1VQ6P 3QWOC 2QRXA 3KDPB 2N1TA 1M1JC 2JWAA 5KAIE 3Q3DA 3GF7A 3V2QA 2KIKA 2Q5UA 1PGJA 4BRYA 1Y9BA 1JB0J 1BE3D 3AEAC 3M0DC 5CBOA 1HTLC 2H8PD 1JY3O 3BCCG 2GUSA 1OVVA 1LT1A 3A0BH 3L36A 1KZUB 3CXHH 5AVXB 1K9MQ 1SQXE 1RE4A 1SQXK 2HG5D 5APSA 1FZCB 4RESB 3G9RA 5AVTB 5BU5A 1VQLP 1GW3A 1NTMG 1IZNB 5AVQB 2FYUJ 2JDIH 1IK9A 3H1HJ 3TNUB 2Q7CA 3LIDA 5CHXA 3CX5H 2E74C 4ZNCA 3WU2H 3M9HA 1KB9D 5AW0B 1NU1G 3VMYA 3VP8A 3H1JJ 3P32A 4EOTA 3CC4P 1ZRTD 2OGUA 1PP9E 3H32A 4WB4A 2BCCG 5TISH 2WWWA 3OAKA 3FXDA 1GK6A 1S2EA 1L0NK 2V7QJ 1VQ7P 4UB8E 3A7OA 4H44C 1UIXA 1DD4A 5APTA 1VQ5P 1JMMA 1EXIA 1M8OB 1PGOA 3O6QB 1SFCA 3AEEC 3V5BA 2D2CD 2YMKA 1SFCD 3BCCE 1VQKP 1S9KE 1JY3P 1USEA 1D7MA 5KJ7C 1N86A 1SQVD 4ZMDA 1HVVA 5KLVK 4HKZH 1W2EA 3VMAA 4Y99C 1NTME 4CPGA 1SQPD 2O01H 4YTPC 1EQ7A 2W6AA 1FZEA 2HODB 1SQBE 2OTKE 1SQBK 1JCCA 3P8CE 5KAFH 4N3YB 5B5EH 2OTLP 1NU1E 2P1JA 1NU1K 3L70J 2KSJA 4ASWA 3AEFC 4C7NB 1KTMA 3GW6A 3PJSK 3SWYA 1P84H 3G4SP 2C9NY 3U1AA 2BCCE 3A0BE 3CXHE 1FZCA 2LXBA 1JTHB 1YJNP 1RF0C 5APXA 1PL5A 4EDFA 3HE5B 1N8RQ 3AE1C 1YITP 3TNUA 2KS1B 4GDOA 2GM4A 2KK7A 2NPSB 3HRNA 5AVSB 3L72J 2WZ7A 3V6IA 2OYIB 1L4AC 1RQVA 5DJTB 2R5DA 2E76B 3CX5E 5L8RJ 4DOJA 3WU2E 3L74D 1KQSO 4JYCA 3IN6A 3AE4C 1IFJA 2J58A 3LW5H 2DW3A 2ZYAA 1JY3N 3CWBD 2ZXXA 4L74A 3RK2B 1VQOP 2XV5A 1K04A 1KORA 2Y0CA 1CSBA 5TISE 3CCQP 1KYOI 3N7NA 1H88A 2JEEA 3O6QA 1DD3A 3B8EB 1U7JA 4PV1C 1DEBA 2RN0A 1IC2A 1JM0A 4AYCA 3RK3B 1Z56A 1WMKA 1MFTA 3M91A 2WTYA 1SQQG 3G3ZA 3Q2YA 3ITKA 1LTIC 1Q7YQ 3LIEA 2WMMA 1LP1B 1SQVG 1AV1A 2QA4P 3OJAB 2G3AA 2HODA 2B88A 1VQPP 3L73J 2CPSA 5AVVB 1EXJA 1LTBC 1KYOD 4Y28J 3W68A 1ZOYC 5CCGA 1BCCD 2FYZA 2E5TA 5KAFE 1VQ8P 3D70A 5AVWB 5B5EE 1MZ9A 2ZYDA 4C7NA 3L71G 5CCGD 1OVUA 1QL2A 1N7SB 4EYYQ 2ZFCA 4H13C 3V4QA 3BASA 1P84E 1JTHA 2WITA 3H1LJ 1OZHA 1IFMA 3HE5A 1AFOA 1AVYA 2FXOA 2H89C 2KZJA 2WT7B 2KS1A 2OTJP 2OYOA 2AEJA 2E75B 5CMZA 1M90Q 2A45G 2OYIA 4U3FJ 3RL0C 4K35A 1OVRA 1NTZG 1LTTC 1BGYJ 3D6ZA 3WUTA 4I1LA 2E76D 1EZVG 1SQQE 1H8AA 1KILC 1L0LG 4OGQB 5AW9B 1T2KC 2FYUD 1NYHA 1SQVE 1SQVK 3H1HD 4IFFA 3A3YB 2QJYC 3RK2D 1HUCA 1YJ9P 3CD6P 2KOGA 4W7YA 4K3AA 3MIWA 1SQPK 2KSEA 3H1JD 1N73C 3WUUA 3L71E 1M56D 1T6AA 1GMJA 4LLHA 2HLOA 5CJ4A 1KFMA 3RK3D 2A06D 1JUNA 1OXZA 3G71P 1LP1A 3H1IJ 4XFJA 3SWFA 2B9BA 1IFIA 2J5UA 4W80A 4LC1A 3IR9A 2M3EA 3PRJA 3V2PA 2GUVA 4L75A 4H0LC 3NMDA 3I5CA 1HF9A 1NTZE 1NTZK 5KKZB 4ZKPA 1GL2B 1KD1Q 3FXEA 1R8EA 4IL6H 1EZVE 2R5BA 2WQYC 3AE7C 3BRVB 1N7SA 1L0LE 2ZVOB 4RKUJ 1N7SD 3M9QA 1JO5A 3CMAP 1X9VA 4I6MC 5CJ0A 3C1LA 4I7ZB 2CK3H 1G1IA 1AJYA 1LT9C 3CI9A 2WT7A 1MKMA 3L70D 4D6TG 3RL0g 1Q90D 2QJPB 2E75D 3FGAD 1T3JA 3V2NA 4IFMA 3QH9A 4EIJA 1FZAA 4WY4B 4R4LA 2Z5IA 1XTGB 5AW1B 2KLVA 2BEZF 3NFQA 4OGQD 1HGVA 2KB7P 3L72D 2ZT9C 3HUSB 3OW2O 2PGDA 1X0TA 1L0NG 2N1TD 3V4WA 3H1HG 1KB9I 1BSHA 3I55P 2XNDH 4GKGA 3HTKB 4DT0A 4AQRD 3EWKA 1ZR4A 3B5NC 3MP7B 3ZDMA 2Q9IA 2AXCA 1SS1A 5KLVG 2P7JA 4PD4I 2YXRB 1CZQA 2IFNA 1K73Q 1S72P 1VL2A 2NRGA 1FZGA 4IL6X 2QVAA 4ZKUA 4D6TE 2A06G 2FFDB 2W83C
chains in the Genus database with same CATH topology
3CX5I 3H1LJ 4D6TJ 3H1JJ 3H1HJ 1BGYJ 5KLVJ 3L75J 2BCCJ 1NTKJ 3CWBJ 1BCCJ 1L0LJ 1SQXJ 1KB9I 3H1KJ 3L70J 4PD4I 1PP9J 1P84I 1NU1J 1NTMJ 1BE3J 1SQQJ 1KYOI 1EZVI 3L73J 3BCCJ 3TGUJ 3CXHI 1SQPJ 2IBZI 3L74J 3H1IJ 4U3FJ 1NTZJ 3L72J 1L0NJ 1SQBJ 1SQVJ 2FYUJ 3L71J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CX5 I;  3H1L J;  4D6T J;  3H1J J;  3H1H J;  1BGY J;  5KLV J;  3L75 J;  2BCC J;  1NTK J;  3CWB J;  1BCC J;  1L0L J;  1SQX J;  1KB9 I;  3H1K J;  3L70 J;  4PD4 I;  1PP9 J;  1P84 I;  1NU1 J;  1NTM J;  1BE3 J;  1SQQ J;  1KYO I;  1EZV I;  3L73 J;  3BCC J;  3TGU J;  3CXH I;  1SQP J;  2IBZ I;  3L74 J;  3H1I J;  4U3F J;  1NTZ J;  3L72 J;  1L0N J;  1SQB J;  1SQV J;  2FYU J;  3L71 J; 
#chains in the Genus database with same CATH topology
 3PHL A;  1SQB G;  1WRG A;  1LTJ B;  1PP9 J;  4Z1M H;  1GL2 A;  2E43 A;  5M1B A;  3W67 A;  4BWN A;  4HH2 A;  1GL2 D;  2ZYG A;  4IOI H;  3TGU G;  2IBZ D;  4IL6 E;  4AUW A;  3NXS A;  1GU5 A;  2FYN C;  3TYY A;  4WWI A;  3L73 D;  2OAR A;  1VF5 C;  4PD4 D;  1YQ3 C;  3BCC J;  1NKN A;  1L0N E;  1JMB A;  2FYU K;  3AEB C;  3NTN A;  3H1H E;  2N9B A;  1YHQ P;  3H6P A;  3HD7 B;  1LWU C;  3E7K A;  1NTM J;  3H1K G;  3MUD A;  3AE2 C;  4WY4 A;  3H1L D;  4WBA A;  3M06 A;  1LTS C;  4WY4 D;  5KLV E;  1RF1 C;  1CI6 B;  1H0T B;  2IYP A;  3IF4 A;  1T3U A;  4N6J A;  2SPZ A;  2XZR A;  2BAS A;  3HUS A;  1HJ0 A;  2L5G B;  2OYH B;  2YIU C;  2A06 E;  4U3F D;  3KHU A;  2Y0D A;  1BGY D;  1JY2 O;  2HFE D;  2XNX A;  3D6Y A;  3AE9 C;  1AA0 A;  3MZW B;  1IJD B;  2KLU A;  3HTK A;  2HPC B;  1URQ C;  3AEG C;  4GOE A;  3TGU E;  1KB9 H;  2R44 A;  4W7Z A;  1BE3 G;  2N1T C;  3R4Y A;  1VQN P;  1G2C B;  1A02 F;  1PPJ D;  3VOP A;  2VRS A;  3L75 J;  1NO4 A;  1NGM B;  1ZLL A;  2QJK C;  4ASV A;  2FFD A;  1YYC A;  4JBZ A;  1JOC A;  3R2P A;  1LTJ A;  1RE4 C;  2UWJ E;  3L70 E;  3GHG B;  3H1K E;  2XU6 A;  3A0H H;  3JSV C;  3H1I D;  5KTB A;  1FU1 A;  2O1J A;  2BEQ D;  3Q5S A;  1FE6 A;  2MJZ A;  3GF3 A;  1J1E C;  2ITA A;  2E42 A;  3Q5R A;  5AW6 B;  1J2J B;  1L2P A;  3MTU E;  2KYV A;  4TT3 H;  4TLF A;  1M57 D;  1M1J B;  5CCH A;  3L37 A;  1X8Y A;  5CCH D;  1MUU A;  5TJH A;  4N78 E;  1M1K Q;  1JY2 P;  3VTP C;  3HD7 A;  5K5G B;  2AEM A;  4A7P A;  2KUB A;  3HD7 D;  1YI2 P;  2AEF A;  1BE3 E;  1QLE D;  3JC2 2;  1OX3 A;  5AVR B;  1CI6 A;  1H0T A;  1YTZ I;  1FDI A;  1RY3 A;  1NAF A;  3A5T A;  1EDI A;  5DJU B;  2D2C C;  1ZR2 A;  2OYH A;  2W8Z A;  1SFC C;  4NPE A;  2QE7 H;  4RO0 A;  1KFN A;  1GTW A;  5KLI C;  2FBW C;  1PZQ A;  1IFN A;  1NWQ A;  4QMA A;  1RE3 A;  2E74 B;  2RKL A;  1EDK A;  2P58 A;  2K3R A;  4YXD C;  4LGD E;  1SVF A;  1SQP G;  1J1D C;  1GD2 E;  1YIJ P;  2HPC A;  3A2A A;  5AW8 B;  1NHL A;  4M3L A;  3KQG A;  1BDC A;  3G6E P;  1KB9 E;  1G2C A;  2WSF J;  2P10 A;  3AE3 C;  4B86 A;  1QL1 A;  1DX7 A;  1KQG B;  2WPV B;  5APY A;  1Y8A A;  4H44 B;  1LJ2 A;  4UB6 H;  1ZRT E;  3PTZ A;  2WVR A;  2NPS A;  1SQQ J;  1FZB A;  1QGK B;  2NPS D;  2RH0 A;  3GHG A;  1N7L A;  2O01 N;  4L76 A;  2LXC B;  3LW5 J;  3KPE A;  1FZC C;  1JY2 N;  1DIP A;  3A0H E;  1K05 A;  1YJW P;  2I1J A;  4Y99 B;  1SP4 A;  5AW3 B;  2QEX P;  5AW4 B;  3H1I G;  3L71 J;  3L74 G;  1M1J A;  2W6B A;  1PP9 D;  2NZ2 A;  3P8M C;  4NPF X;  3N4X A;  2YO2 A;  3M0D A;  3SWK A;  3CWB G;  2FY8 A;  3K5B A;  1SQP E;  3B71 A;  3CPW O;  2W27 A;  1KYO H;  2Q6Q A;  3M0A A;  1VQ9 P;  2IDB A;  1NTK J;  2KZI A;  3TDK A;  3CCV P;  2Z4E A;  3BCC D;  2M8R A;  1S9K D;  4RJT A;  1AQ5 A;  3MGN A;  1U7M A;  1FDM A;  1PFI A;  1NVO A;  2QM8 A;  2PAJ A;  3D71 A;  4R4M A;  3L4F A;  1ZME C;  3CCM P;  2YKO A;  1NTM D;  2FXM A;  1L0L J;  3I56 P;  1L4A B;  2QM7 A;  4HJG H;  3E1R A;  2E74 D;  3P8C D;  1AVO A;  2V4H A;  3C8V A;  4YXW H;  3KYQ A;  4GOF A;  2ZXE B;  2K9J B;  1S5L H;  1FOS E;  1BCC G;  2MKV A;  3H1I E;  3L74 E;  4O9B A;  1GU4 A;  1PGQ A;  1GK4 A;  3CXH D;  3Q5P A;  5CCG C;  3CWB E;  1OW7 A;  4H44 D;  4UB6 E;  1LNQ A;  3WMM 0;  2O3J A;  1BDD A;  5KJ7 A;  4PV1 B;  1VDF A;  1ZV8 A;  2K37 A;  2WSE J;  5KJ7 D;  3L75 D;  1MFZ A;  2WPS A;  1S1C X;  1W5C E;  3CME P;  3TF5 A;  5AW5 B;  2AXT H;  1OW8 A;  5APQ A;  3T97 B;  2NPS C;  2WSS H;  1VQ4 P;  2Y0E A;  2V7Q H;  1BSN A;  3VP9 A;  1IK7 A;  2OYI C;  3VN0 A;  2Q3I A;  1GDT A;  1S3J A;  2XDJ A;  1LGH B;  2E76 C;  2FYU G;  1QEX A;  1SQX J;  3IFM A;  3M9B A;  1MV8 A;  1VPC A;  4BXL A;  2HR3 A;  2CPB A;  1XTC C;  3EFG A;  2IBZ I;  2ZJS E;  3RK2 C;  1OFC X;  4H13 B;  1KYO E;  3AE6 C;  1FAV A;  4D6T J;  4DCK A;  1BCC E;  1FJK A;  1ZW0 A;  3H1J G;  1LTG C;  1RF0 A;  1P84 I;  3CCS P;  1HH0 A;  1IO4 A;  4KJM A;  2QG4 A;  1NAY A;  1TU3 F;  2KNC B;  3CLQ A;  2HYN A;  1S5L X;  3RK3 C;  1L4A A;  3VYI A;  3RL0 B;  1DEE G;  1L4A D;  2JWD A;  1RQU A;  1FDO A;  4OWF A;  2YNY A;  3KZI H;  3S4R A;  2IZ1 A;  2R3C A;  1KIL B;  1L0N J;  2K9J A;  1ZP0 C;  1ZN5 A;  2Q1K A;  1KC8 Q;  2QJY B;  1S5L E;  1RH5 B;  5E79 H;  2WSC J;  2JR8 A;  1X22 A;  5B66 H;  3CCU P;  2K9Y A;  2H7H A;  1P84 D;  3CC2 P;  2FYU E;  4PJ0 H;  1N7S C;  1FBM A;  5KLV J;  4NPD A;  1N73 B;  5GTI H;  1R5L A;  1OWA A;  3GLM A;  2IX7 C;  4PV1 D;  3L70 G;  5BVZ A;  3Q1M A;  5AW7 B;  3BAT A;  5H2F H;  3PLN A;  4GT1 A;  4C7R A;  1SQB J;  3CL3 D;  3H1J E;  4L73 A;  3T97 A;  2QSI A;  1WT6 A;  2E75 C;  1E79 H;  2AXT E;  1SQQ D;  3L75 G;  1Q86 Q;  1NU1 J;  1JNM A;  3RK3 E;  3TGU J;  3CCL P;  1KQL A;  4H0L B;  2M5A B;  2PFX A;  4JF7 A;  2A45 I;  2C9L Y;  3AED C;  1IFP A;  2JJL A;  3C9I A;  3L72 G;  4JPZ B;  2BCC J;  4OGQ C;  1HWT C;  2W90 A;  1FZF A;  1GW4 A;  1NTM K;  2YO3 A;  3AE8 C;  1EZV I;  3L71 D;  5AW2 B;  4H13 D;  2GA1 A;  3SFD C;  5AVU B;  1E5W A;  3TSI A;  3GMA A;  1OW6 A;  3H1K J;  1LT9 B;  4KT0 J;  2KNC A;  2K88 A;  3CCE P;  1NOH A;  4PD4 H;  1K8A Q;  1YTZ T;  2R3S A;  3USS A;  1NTK D;  1USD A;  1YBK A;  2IPP A;  2YMY A;  1T8Z A;  1X79 B;  3RL0 D;  2ZAE B;  1CW5 A;  3SFE C;  3MHV A;  2M0B A;  1KIL A;  2WSF H;  1NTZ D;  5BU8 B;  1KV4 A;  3KZI E;  1KIL D;  1EZV D;  1T2K D;  1ZXG A;  2PP6 A;  3L75 E;  1L0L D;  1EDL A;  2WPR A;  2ZT9 B;  1GZL A;  2IZ0 A;  3H25 A;  5KKZ C;  1GL2 C;  2IBZ G;  5E79 E;  5B66 E;  1BE3 J;  2WPQ A;  4GOD A;  3L72 E;  1N73 A;  3L73 G;  4HYT B;  4PJ0 E;  2IFM A;  3JCU H;  3VMZ A;  3HE4 B;  4HB1 A;  2Y9Z A;  1JEK A;  2L91 A;  1Q2N A;  4I7Z C;  3AEC C;  5GTI E;  1KN7 A;  3B5N B;  4YPC A;  4KHX A;  1NJI Q;  2O01 J;  2IYO A;  5H2F E;  1FJP A;  1FS0 E;  1QX8 A;  2QJP C;  3CC7 P;  3H1L G;  1NKZ B;  2B87 B;  5APW A;  2Q3E A;  1UII A;  5C39 A;  3MUD C;  2M5A A;  4WY4 C;  3P7K A;  5AVY B;  3PP5 A;  4H0L D;  2O1K A;  4JYB A;  1N2D C;  5EFW B;  3S9O A;  4U3F G;  2LKM A;  2K1A A;  1W2B O;  2FXP A;  1A02 J;  2A45 H;  1BGY G;  1FOS F;  3HUS C;  2FYN B;  1KQF B;  1VQM P;  2J59 M;  3KXD A;  3L35 A;  1M7L A;  1VF5 B;  1HJB A;  2C0W A;  1PGP A;  1LT9 A;  2IBZ E;  1SQX D;  1OIP A;  3ABV C;  4DJG A;  1Q81 Q;  3L73 E;  1PPJ G;  5GTH H;  4PD4 E;  1LWU B;  4D6T D;  2JKV A;  1SQV J;  3EFF K;  3B4S A;  2POH A;  2P2U A;  2LR2 A;  1NTK G;  1RF1 B;  3FWL A;  3TK1 A;  2FFD C;  1KMI Z;  1Q82 Q;  1LTA C;  1SQP J;  2YKQ A;  2I1K A;  2Y9Y A;  1U57 A;  3H1L E;  2YIU B;  1LTJ C;  2ZT9 D;  4GIF A;  2FKW B;  2PRR A;  4C46 A;  1EDJ A;  2KP8 A;  1SQQ K;  2Z5H A;  3BRT B;  3VMX A;  2WSE H;  1L0N D;  2JO1 A;  4U3F E;  3HE4 A;  1URQ B;  3WUV A;  3FX0 A;  1BGY E;  3RBZ A;  5KAI H;  3B5N A;  3JCU E;  3OA7 A;  3II6 A;  2N1T B;  2C0X A;  4DZO A;  3B5N D;  2QIW A;  5CCH C;  1HGZ A;  4BRY B;  4I2L C;  3S1K A;  3SSU A;  3CXH I;  1G1J A;  5KLV D;  2H88 C;  1NTZ J;  2QJK B;  3HD7 C;  2JP3 A;  2R32 A;  2B87 A;  1PPJ E;  3UIA A;  4XA4 A;  1SQB D;  4EI2 A;  2XKM A;  3L74 J;  3EQ2 A;  1OMI A;  3F89 A;  1NTK E;  2E5Y A;  1NTK K;  3CX5 I;  3O8Z A;  2OYH C;  1J1E B;  3FWN A;  1NU1 D;  2OQQ A;  3CWB J;  2YXQ B;  4U7J A;  3TGU D;  1R5S A;  3RGU A;  1RHZ B;  2B89 A;  5APU A;  1RE3 C;  1VF5 D;  3E1I A;  3PH0 A;  2G8Y A;  1KIL E;  2ZVN B;  1YQ4 C;  2BCC D;  3CCJ P;  1Y47 A;  1L0L K;  4WVZ A;  1H89 A;  1LWU A;  1SQX G;  4OVN F;  3H32 B;  2M3B A;  1IFD A;  3AE5 C;  1SLQ A;  5GTH E;  2P67 A;  4IFD K;  4UB8 H;  2KI7 B;  2KXP B;  2YKP A;  1NH4 A;  3RBX A;  3IAO A;  3CCR P;  1RF1 A;  1FC2 C;  3H1K D;  1AQT A;  2H43 A;  2WSC H;  1DH3 A;  3CX5 D;  3F5H A;  4XE5 B;  4OH8 B;  3U59 A;  3U1C A;  3V2R A;  2D2C B;  1PV3 A;  1SFC B;  2W6J H;  2N9Y B;  3GHG C;  5KLI B;  3MD0 A;  1S4X A;  3GG2 A;  1BCC J;  5AVZ B;  1J1D B;  5APV A;  1EC5 A;  3BVH A;  1QVG O;  5CBN A;  1QVF O;  4MN4 C;  2RMZ A;  4N78 D;  1URQ A;  2I8D A;  1PP9 G;  4JQ0 D;  1JCD A;  1URQ D;  1HBW A;  1PIX A;  1VQ6 P;  3QWO C;  2QRX A;  3KDP B;  2N1T A;  1M1J C;  2JWA A;  5KAI E;  3Q3D A;  3GF7 A;  3V2Q A;  2KIK A;  2Q5U A;  1PGJ A;  4BRY A;  1Y9B A;  1JB0 J;  1BE3 D;  3AEA C;  3M0D C;  5CBO A;  1HTL C;  2H8P D;  1JY3 O;  3BCC G;  2GUS A;  1OVV A;  1LT1 A;  3A0B H;  3L36 A;  1KZU B;  3CXH H;  5AVX B;  1K9M Q;  1SQX E;  1RE4 A;  1SQX K;  2HG5 D;  5APS A;  1FZC B;  4RES B;  3G9R A;  5AVT B;  5BU5 A;  1VQL P;  1GW3 A;  1NTM G;  1IZN B;  5AVQ B;  2FYU J;  2JDI H;  1IK9 A;  3H1H J;  3TNU B;  2Q7C A;  3LID A;  5CHX A;  3CX5 H;  2E74 C;  4ZNC A;  3WU2 H;  3M9H A;  1KB9 D;  5AW0 B;  1NU1 G;  3VMY A;  3VP8 A;  3H1J J;  3P32 A;  4EOT A;  3CC4 P;  1ZRT D;  2OGU A;  1PP9 E;  3H32 A;  4WB4 A;  2BCC G;  5TIS H;  2WWW A;  3OAK A;  3FXD A;  1GK6 A;  1S2E A;  1L0N K;  2V7Q J;  1VQ7 P;  4UB8 E;  3A7O A;  4H44 C;  1UIX A;  1DD4 A;  5APT A;  1VQ5 P;  1JMM A;  1EXI A;  1M8O B;  1PGO A;  3O6Q B;  1SFC A;  3AEE C;  3V5B A;  2D2C D;  2YMK A;  1SFC D;  3BCC E;  1VQK P;  1S9K E;  1JY3 P;  1USE A;  1D7M A;  5KJ7 C;  1N86 A;  1SQV D;  4ZMD A;  1HVV A;  5KLV K;  4HKZ H;  1W2E A;  3VMA A;  4Y99 C;  1NTM E;  4CPG A;  1SQP D;  2O01 H;  4YTP C;  1EQ7 A;  2W6A A;  1FZE A;  2HOD B;  1SQB E;  2OTK E;  1SQB K;  1JCC A;  3P8C E;  5KAF H;  4N3Y B;  5B5E H;  2OTL P;  1NU1 E;  2P1J A;  1NU1 K;  3L70 J;  2KSJ A;  4ASW A;  3AEF C;  4C7N B;  1KTM A;  3GW6 A;  3PJS K;  3SWY A;  1P84 H;  3G4S P;  2C9N Y;  3U1A A;  2BCC E;  3A0B E;  3CXH E;  1FZC A;  2LXB A;  1JTH B;  1YJN P;  1RF0 C;  5APX A;  1PL5 A;  4EDF A;  3HE5 B;  1N8R Q;  3AE1 C;  1YIT P;  3TNU A;  2KS1 B;  4GDO A;  2GM4 A;  2KK7 A;  2NPS B;  3HRN A;  5AVS B;  3L72 J;  2WZ7 A;  3V6I A;  2OYI B;  1L4A C;  1RQV A;  5DJT B;  2R5D A;  2E76 B;  3CX5 E;  5L8R J;  4DOJ A;  3WU2 E;  3L74 D;  1KQS O;  4JYC A;  3IN6 A;  3AE4 C;  1IFJ A;  2J58 A;  3LW5 H;  2DW3 A;  2ZYA A;  1JY3 N;  3CWB D;  2ZXX A;  4L74 A;  3RK2 B;  1VQO P;  2XV5 A;  1K04 A;  1KOR A;  2Y0C A;  1CSB A;  5TIS E;  3CCQ P;  1KYO I;  3N7N A;  1H88 A;  2JEE A;  3O6Q A;  1DD3 A;  3B8E B;  1U7J A;  4PV1 C;  1DEB A;  2RN0 A;  1IC2 A;  1JM0 A;  4AYC A;  3RK3 B;  1Z56 A;  1WMK A;  1MFT A;  3M91 A;  2WTY A;  1SQQ G;  3G3Z A;  3Q2Y A;  3ITK A;  1LTI C;  1Q7Y Q;  3LIE A;  2WMM A;  1LP1 B;  1SQV G;  1AV1 A;  2QA4 P;  3OJA B;  2G3A A;  2HOD A;  2B88 A;  1VQP P;  3L73 J;  2CPS A;  5AVV B;  1EXJ A;  1LTB C;  1KYO D;  4Y28 J;  3W68 A;  1ZOY C;  5CCG A;  1BCC D;  2FYZ A;  2E5T A;  5KAF E;  1VQ8 P;  3D70 A;  5AVW B;  5B5E E;  1MZ9 A;  2ZYD A;  4C7N A;  3L71 G;  5CCG D;  1OVU A;  1QL2 A;  1N7S B;  4EYY Q;  2ZFC A;  4H13 C;  3V4Q A;  3BAS A;  1P84 E;  1JTH A;  2WIT A;  3H1L J;  1OZH A;  1IFM A;  3HE5 A;  1AFO A;  1AVY A;  2FXO A;  2H89 C;  2KZJ A;  2WT7 B;  2KS1 A;  2OTJ P;  2OYO A;  2AEJ A;  2E75 B;  5CMZ A;  1M90 Q;  2A45 G;  2OYI A;  4U3F J;  3RL0 C;  4K35 A;  1OVR A;  1NTZ G;  1LTT C;  1BGY J;  3D6Z A;  3WUT A;  4I1L A;  2E76 D;  1EZV G;  1SQQ E;  1H8A A;  1KIL C;  1L0L G;  4OGQ B;  5AW9 B;  1T2K C;  2FYU D;  1NYH A;  1SQV E;  1SQV K;  3H1H D;  4IFF A;  3A3Y B;  2QJY C;  3RK2 D;  1HUC A;  1YJ9 P;  3CD6 P;  2KOG A;  4W7Y A;  4K3A A;  3MIW A;  1SQP K;  2KSE A;  3H1J D;  1N73 C;  3WUU A;  3L71 E;  1M56 D;  1T6A A;  1GMJ A;  4LLH A;  2HLO A;  5CJ4 A;  1KFM A;  3RK3 D;  2A06 D;  1JUN A;  1OXZ A;  3G71 P;  1LP1 A;  3H1I J;  4XFJ A;  3SWF A;  2B9B A;  1IFI A;  2J5U A;  4W80 A;  4LC1 A;  3IR9 A;  2M3E A;  3PRJ A;  3V2P A;  2GUV A;  4L75 A;  4H0L C;  3NMD A;  3I5C A;  1HF9 A;  1NTZ E;  1NTZ K;  5KKZ B;  4ZKP A;  1GL2 B;  1KD1 Q;  3FXE A;  1R8E A;  4IL6 H;  1EZV E;  2R5B A;  2WQY C;  3AE7 C;  3BRV B;  1N7S A;  1L0L E;  2ZVO B;  4RKU J;  1N7S D;  3M9Q A;  1JO5 A;  3CMA P;  1X9V A;  4I6M C;  5CJ0 A;  3C1L A;  4I7Z B;  2CK3 H;  1G1I A;  1AJY A;  1LT9 C;  3CI9 A;  2WT7 A;  1MKM A;  3L70 D;  4D6T G;  3RL0 g;  1Q90 D;  2QJP B;  2E75 D;  3FGA D;  1T3J A;  3V2N A;  4IFM A;  3QH9 A;  4EIJ A;  1FZA A;  4WY4 B;  4R4L A;  2Z5I A;  1XTG B;  5AW1 B;  2KLV A;  2BEZ F;  3NFQ A;  4OGQ D;  1HGV A;  2KB7 P;  3L72 D;  2ZT9 C;  3HUS B;  3OW2 O;  2PGD A;  1X0T A;  1L0N G;  2N1T D;  3V4W A;  3H1H G;  1KB9 I;  1BSH A;  3I55 P;  2XND H;  4GKG A;  3HTK B;  4DT0 A;  4AQR D;  3EWK A;  1ZR4 A;  3B5N C;  3MP7 B;  3ZDM A;  2Q9I A;  2AXC A;  1SS1 A;  5KLV G;  2P7J A;  4PD4 I;  2YXR B;  1CZQ A;  2IFN A;  1K73 Q;  1S72 P;  1VL2 A;  2NRG A;  1FZG A;  4IL6 X;  2QVA A;  4ZKU A;  4D6T E;  2A06 G;  2FFD B;  2W83 C; 
#chains in the Genus database with same CATH homology
 3CX5 I;  3H1L J;  4D6T J;  3H1J J;  3H1H J;  1BGY J;  5KLV J;  3L75 J;  2BCC J;  1NTK J;  3CWB J;  1BCC J;  1L0L J;  1SQX J;  1KB9 I;  3H1K J;  3L70 J;  4PD4 I;  1PP9 J;  1P84 I;  1NU1 J;  1NTM J;  1BE3 J;  1SQQ J;  1KYO I;  1EZV I;  3L73 J;  3BCC J;  3TGU J;  3CXH I;  1SQP J;  2IBZ I;  3L74 J;  3H1I J;  4U3F J;  1NTZ J;  3L72 J;  1L0N J;  1SQB J;  1SQV J;  2FYU J;  3L71 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...