1SQPJ

Crystal structure analysis of bovine bc1 with myxothiazol
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
61
structure length
61
Chain Sequence
b'VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 18
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1sqpJ00
1P84I 3CX5I 4PD4I 1NTZJ 1KYOI 1SQPJ 1L0LJ 1NTKJ 1PP9J 3BCCJ 3L70J 1L0NJ 1NTMJ 5KLVJ 3H1LJ 3H1KJ 1KB9I 2BCCJ 1BE3J 1NU1J 1SQXJ 1SQBJ 1SQQJ 1EZVI 1BCCJ 3H1IJ 2FYUJ 3L72J 3CWBJ 3L71J 4U3FJ 1SQVJ 2IBZI 3L75J 3H1HJ 3L74J 3TGUJ 4D6TJ 3L73J 1BGYJ 3CXHI 3H1JJ
chains in the Genus database with same CATH superfamily
2W27A 1VL2A 2YNYA 3OJAB 3L72G 2M8RA 1FBMA 2BCCJ 2YMKA 2B88A 1JCCA 3BRVB 3P7KA 3Q3DA 1EDLA 3B4SA 1MZ9A 2AEJA 1WMKA 1LTJC 3P8MC 2QA4P 4QMAA 1PGPA 3L71E 2A06G 2ZXEB 4KT0J 3A3YB 2IZ1A 3TGUE 1A02F 4IL6X 4MN4C 2WSCJ 3PRJA 5CMZA 4WWIA 1IFJA 3V6IA 1LGHB 4JQ0D 5AW4B 3CCVP 1MFTA 4LLHA 1T3UA 1MKMA 1LT9B 2M3BA 3QH9A 1BDCA 1BCCE 3HTKB 1RQVA 1YJ9P 1HJ0A 1M1JC 1NOHA 2FY8A 1KB9I 3Q5RA 3AE5C 2C9NY 3AE3C 3HUSA 2FFDC 3CL3D 1QX8A 4U7JA 3WUVA 1JMBA 1HH0A 1NTKD 1URQC 1L0NK 1URQB 3GHGC 1W2BO 4N3YB 1HJBA 1DEBA 2K9JB 1EXIA 2FYZA 1KYOH 2HODA 1N73B 4H44C 1VQKP 2I1JA 3RBXA 3RL0D 3RK2D 1NTZK 2ZFCA 4W80A 1LTTC 1IJDB 3HD7A 1GL2C 1RE4A 1GL2B 1KILD 1L4AC 3ITKA 1MV8A 2ITAA 2MKVA 2WPRA 5CCHD 4PV1C 1RF1C 1RF1B 1GDTA 4H0LC 2NRGA 1G2CA 3JC22 2KLUA 1S5LH 3L75G 3RK3D 3L74G 4CPGA 1KORA 3RBZA 3P8CE 4BWNA 2P2UA 1L0NG 2H89C 1GK4A 3A0BE 1M90Q 1OW8A 4DJGA 1Y9BA 1NTKJ 3R2PA 2V7QH 2KOGA 2ZVOB 5B66E 4D6TG 3A5TA 1NTZG 2E74B 3CPWO 1RF0C 5AW1B 1SQVK 4C7NA 2B87A 1IFPA 4OWFA 5AVVB 3E7KA 2L5GB 3VN0A 1L2PA 4W7YA 4NPEA 3L75J 1OZHA 4PD4H 3L74J 2E76D 1S5LX 4AQRD 1IFIA 3GF7A 1N7SC 1N7SB 4H13D 3CCRP 1L0NJ 3CWBG 5APQA 1PP9D 3FXEA 3PJSK 1KQLA 3O6QB 3EQ2A 2K9YA 2M3EA 4WBAA 1W5CE 1IFMA 2WSFJ 1OMIA 1NO4A 2D2CB 2AXCA 1L0LD 2POHA 1R5SA 5CBOA 1SQVG 1KZUB 4PD4D 1GMJA 4I2LC 1OW7A 3BCCG 2XKMA 2WTYA 5TJHA 3T97A 3V2PA 3CX5I 1KYOE 1CI6B 2Q5UA 3I56P 1GK6A 1TU3F 2FYUE 1LTGC 1BDDA 3Q5PA 1DEEG 4U3FG 2M5AB 3H1JE 3KDPB 2YXQB 1JY3P 4RJTA 2PRRA 3FGAD 2LXCB 4EYYQ 1VF5B 2H7HA 2JDIH 1BGYD 1PP9J 4L76A 2YIUC 2YIUB 1VQ7P 1NU1J 3B71A 1S5LE 1JY2O 3V2NA 3MGNA 3M9BA 1SQXK 1SQVJ 1U7JA 5AVQB 1FZGA 2QM7A 3PP5A 3NXSA 3Q1MA 2XV5A 3LW5H 1YJWP 3S1KA 5AW3B 2HYNA 1MUUA 3H25A 3CCUP 2MJZA 1NKZB 4L74A 1SQBD 1QVGO 1LP1B 3L73J 5KLIC 5KLIB 4NPDA 2KUBA 1PPJG 3H1IG 1OVVA 1KILA 3B5ND 1NHLA 2W6AA 1RHZB 1K05A 2QEXP 3ABVC 5CCHA 2G8YA 1BGYJ 2QJYC 4PD4E 1H0TA 1SQXG 1Y8AA 3PTZA 4KHXA 1KB9H 3H1HE 2KP8A 4I1LA 1SLQA 2PFXA 3AE2C 2KNCA 3OAKA 3EWKA 2R3SA 3M9HA 1SQQD 1YI2P 2P10A 5BVZA 1AVYA 2K37A 2IYPA 3H1LG 1ZR4A 4JYCA 2GUVA 3WMM0 5APWA 3CCQP 2Q1KA 2O01J 2XDJA 3H1IJ 1BE3D 1VQ4P 3V4WA 3GMAA 1K8AQ 2KS1A 1FS0E 1KN7A 1LJ2A 1KMIZ 4OGQB 1KB9D 1N7LA 1GU4A 1SQXJ 1EZVE 4WVZA 3FWNA 1NTME 2FXOA 3NFQA 2FBWC 1ZOYC 1LNQA 4RKUJ 3A0HH 4B86A 3JCUH 1RQUA 3MUDC 1URQD 3L71D 1ZLLA 3A2AA 1SQPJ 3RL0g 4GODA 3HRNA 3CC4P 3TGUG 4IFFA 3MD0A 1EDIA 4WY4B 1WRGA 3AE7C 1M7LA 2QRXA 2HG5D 3H1KE 1GL2D 5KLVG 5CCGC 2BCCG 1N8RQ 2YKQA 5CBNA 2WPSA 4NPFX 4R4LA 3E1IA 3HE4B 3C8VA 1FZCC 1R8EA 1YBKA 1BSHA 1KD1Q 1ZMEC 2OYHA 4XA4A 3L70G 2IBZG 1P84I 4IOIH 3L37A 1M8OB 3CCJP 1K9MQ 1OFCX 2WITA 3U59A 1GU5A 1KB9E 1USDA 2OARA 2QM8A 3A0BH 3TGUJ 3KPEA 1DH3A 2Y9YA 3M0DC 2E42A 2E74D 2DW3A 5B66H 1PGJA 4GOFA 5KLVJ 1VQ8P 3CLQA 1DD4A 1BCCJ 3MZWB 3AE1C 1SS1A 3CXHI 1LTJB 2C0XA 3B5NA 4Z1MH 3L70J 1H8AA 1NTKK 5M1BA 3P8CD 2FXPA 1CSBA 1N7SD 2N1TC 2KSJA 2N1TB 1YTZI 3HUSC 3G6EP 2C9LY 1IK7A 1S9KE 2JWDA 1VQPP 4IFMA 1M57D 1PZQA 1Q2NA 2A45G 2K1AA 1M1JB 1Q7YQ 2D2CD 2KI7B 2R5BA 4PJ0E 3GG2A 3A0HE 5APSA 1YHQP 1S2EA 3JSVC 3JCUE 2FFDB 4N6JA 2JR8A 1Q90D 1HBWA 2KB7P 3EFFK 5AVZB 1T2KC 3HD7C 1RE4C 2Z5IA 1RE3C 3GHGB 2Y9ZA 1EC5A 4OVNF 3AEGC 1NTKG 1LTSC 4KJMA 4AYCA 2OTLP 1AQTA 3SWYA 4H44B 1LT9A 2QE7H 3HTKA 1VF5D 1OXZA 3PHLA 2O3JA 1AFOA 3TNUB 2LKMA 2W6BA 2P1JA 1L4AB 2FKWB 2B89A 2OYIC 2OYIB 5E79H 1JEKA 1ZR2A 3MTUE 5KJ7C 2W6JH 4PV1B 1S3JA 3L72E 2H43A 3HE5B 3AECC 4H0LB 2VRSA 4ZMDA 1LT1A 1M56D 1URQA 5APVA 2K9JA 1KYOD 1AQ5A 2FYUD 3CMAP 1N73A 4K3AA 1ZXGA 2A06E 1KV4A 3H1JD 2HPCB 4ZNCA 3C9IA 2JKVA 2Z4EA 1GL2A 3Q2YA 1VQMP 1NU1K 3KYQA 2IBZI 1JUNA 1OW6A 3M91A 1IZNB 5AW6B 2J58A 1IO4A 5H2FH 1JY3O 4D6TD 3FWLA 1PV3A 1RF1A 1NTZD 5AW0B 1N86A 1LTAC 3W67A 1HGZA 2BEZF 1EDKA 4I7ZC 1GW4A 3G71P 1K04A 2LR2A 1ZN5A 1HF9A 4EIJA 5GTIH 3O8ZA 3CD6P 2FYUJ 1YJNP 1PP9G 3H1JJ 5KAFE 3N4XA 1RF0A 4WB4A 2R3CA 2PGDA 3TF5A 1NU1G 3VYIA 1ZW0A 4OGQD 2NPSC 2ZT9C 2NPSB 2ZT9B 3C1LA 1U7MA 1L0LG 1XTCC 2ZAEB 3H1HD 1UIIA 4ASVA 2A45I 1IK9A 1K73Q 3E1RA 4ZKUA 4C7RA 3L75E 3OA7A 1N7SA 3CCSP 3L74E 3BCCD 2ZYDA 3IFMA 3N7NA 3L73G 3SFEC 4BRYB 2ZVNB 2E75C 1S4XA 2E75B 1L0NE 1SQBK 1P84H 4K35A 2V7QJ 1PFIA 3O6QA 4Y99C 4Y99B 4YXDC 5E79E 1NJIQ 2I1KA 1KQFB 2OTJP 2XNDH 4D6TE 5KTBA 1NTZE 1BGYG 2J5UA 1FDIA 3V4QA 1ZV8A 1Q86Q 4WY4D 1L0LJ 2H88C 1KILC 1CI6A 4YXWH 3QWOC 2KXPB 1EZVD 5CCGD 2M5AA 5CCHC 1NTMD 2WMMA 3TSIA 3CXHH 3H32B 1SQQK 1IFDA 1NGMB 3D6YA 1JTHB 5TISH 3RK3C 3D6ZA 1U57A 1OVRA 1RY3A 5H2FE 1SQBG 3CWBE 1SQPK 3SWFA 2Z5HA 1JOCA 4ASWA 1FDMA 1A02J 2R32A 2BASA 1FOSF 2CPSA 3VMXA 2YKPA 2QJYB 1SVFA 1SQVE 3SFDC 1RH5B 3KXDA 3M06A 4LC1A 2RKLA 1DD3A 1JCDA 1VQ9P 3H1KD 1JY3N 5BU8B 5GTIE 3BCCE 1SFCC 5AW2B 1SFCB 1LP1A 2E5TA 3NMDA 1SQQG 3UIAA 1FZEA 4U3FE 1M1KQ 2IZ0A 3CC7P 2O01N 1NTMJ 3AEAC 3L36A 2E76C 5DJUB 1KTMA 2N9YB 2E43A 1SQBJ 2KZJA 5AW7B 1SQPG 1CZQA 5B5EH 1USEA 2KSEA 4L75A 1NH4A 2SPZA 2N1TD 3AEDC 1BE3G 3L4FA 2IDBA 3PLNA 2WT7B 2WSEH 2WPQA 3Q5SA 2HR3A 1QLED 5KLVK 1KQSO 2OYOA 1AJYA 3IR9A 2W83C 3LIEA 1P84E 2G3AA 1EQ7A 3LW5J 4TT3H 1CW5A 1LWUC 4GIFA 2ZYGA 1AVOA 5KKZC 4PJ0H 5GTHE 5KKZB 1SQQJ 2Q3IA 1T2KD 4HJGH 2Q7CA 1LTIC 1X0TA 1JM0A 3V2QA 2JWAA 1PPJE 3S9OA 1KFNA 3MIWA 1YITP 3GLMA 3FX0A 1J1EC 3L71G 1J1EB 1QL1A 4H44D 4LGDE 2P67A 1BE3J 4DOJA 1VQNP 1S9KD 2OYHC 3IF4A 2YKOA 2WSCH 1BSNA 3BVHA 3CXHE 2CPBA 4BXLA 3CI9A 1SQXE 1L4AD 5EFWB 3PH0A 3AE6C 5TISE 1JMMA 1BCCG 1S72P 2JJLA 4HH2A 5KJ7D 3SWKA 4PV1D 1JO5A 4H0LD 1EDJA 5AW8B 4R4MA 1FZCB 4TLFA 5AW9B 3H1LE 4GDOA 3K5BA 4XE5B 3AE8C 3H6PA 4L73A 1DX7A 3V5BA 2OGUA 2WWWA 2IBZD 2OQQA 5APYA 3L71J 2E5YA 4WY4A 1FJKA 2AXTE 3B5NC 2ZJSE 4JBZA 5CCGA 1J1DC 3G4SP 2NZ2A 5AVYB 1X8YA 2JEEA 1GZLA 3HE4A 5CHXA 1JB0J 1HWTC 3CX5H 3L72D 2IX7C 5B5EE 2JP3A 1GD2E 2J59M 3CC2P 2PAJA 4DZOA 2XZRA 1XTGB 3B8EB 4HYTB 3MP7B 5AW5B 1VPCA 3HUSB 4A7PA 2A06D 1HVVA 1GTWA 2M0BA 2W90A 2GUSA 3M0DA 1NKNA 2IFNA 3G3ZA 1FJPA 4DT0A 1PGOA 1QEXA 2IYOA 3U1AA 4ZKPA 2C0WA 3IAOA 3CX5D 2IPPA 5KAFH 2HODB 5KLVE 1LT9C 2FYNC 2BCCE 2NPSD 2ZT9D 2FYNB 3EFGA 3VP9A 1LTJA 4YTPC 3F5HA 2YXRB 3CMEP 1FZFA 3HD7B 3L72J 3L70E 2N1TA 1QGKB 2IBZE 2FYUK 4M3LA 1YTZT 2E75D 1G2CB 1X79B 2AEMA 3W68A 4EOTA 3V2RA 5AVRB 3ZDMA 5CJ4A 1M1JA 1VQ6P 4GKGA 1X22A 2K3RA 2WZ7A 1E5WA 1IFNA 1N73C 1FZAA 1H88A 3CCLP 2FFDA 2P7JA 1S1CX 1ZRTE 2WSFH 1YIJP 1OWAA 3GHGA 1RE3A 3USSA 3FXDA 4C7NB 3AEEC 2B87B 3TYYA 3L75D 4IL6E 3L74D 1J2JB 2OTKE 2FYUG 3D70A 2ZXXA 2RMZA 1L0ND 1FOSE 3H1JG 3TNUA 1T8ZA 1L4AA 1Q81Q 1OX3A 2OYIA 3CX5E 1T6AA 5KJ7A 1KQGB 3HE5A 1L0LK 1X9VA 1AA0A 3CCEP 2JO1A 4Y28J 2E74C 2Q9IA 1VQOP 5C39A 1MFZA 4JPZB 4I7ZB 4C46A 3CCMP 4YPCA 3OW2O 2LXBA 4IFDK 3LIDA 3BASA 1SFCD 2HPCA 4JF7A 2Y0EA 3BATA 4OH8B 4GOEA 1NTKE 1QVFO 4JYBA 3T97B 4DCKA 2KK7A 2B9BA 3CWBD 4UB8H 2QJPC 2WSSH 2QJPB 1LTBC 1HTLC 5AVWB 4HB1A 2CK3H 3M9QA 2YO2A 3WUUA 3WU2H 4RESB 1NU1D 1AV1A 2O1KA 2KZIA 1QL2A 1T3JA 4RO0A 4D6TJ 1KILE 1SQVD 1NTZJ 3II6A 1UIXA 1PGQA 2D2CC 3R4YA 2YMYA 1ZP0C 1WT6A 3H1HG 1NTMK 3IN6A 1OVUA 4UB6H 5AVXB 2XNXA 3RK3E 2W8ZA 3A7OA 1NAFA 4U3FD 3L73D 2XU6A 5GTHH 2QSIA 1YYCA 3MHVA 5K5GB 2NPSA 1R5LA 3CWBJ 3D71A 1KFMA 2AEFA 3RL0C 3RK2C 2O01H 3RL0B 3RK2B 2HLOA 2KYVA 1VF5C 3WUTA 1KILB 3S4RA 1Q82Q 2K88A 1VQLP 4HKZH 1VDFA 1D7MA 4BRYA 1P84D 1EZVG 2R5DA 3G9RA 3H1HJ 3BRTB 3M0AA 1W2EA 1NTMG 3F89A 3RK3B 2QIWA 1H0TB 3KZIH 3BCCJ 3GF3A 5AVTB 3NTNA 2KNCB 2YO3A 3KQGA 1PP9E 2IFMA 4U3FJ 1FZBA 1PPJD 3AEFC 3H1ID 1DIPA 2I8DA 4AUWA 2UWJE 2QG4A 3VOPA 1NU1E 1KYOI 1E79H 2QJKC 2QJKB 2Q6QA 5APUA 1JNMA 3VP8A 2H8PD 1YQ3C 1L0LE 2AXTH 3CXHD 1OIPA 1SQXD 1G1JA 2KS1B 3P32A 3H32A 4N78D 5L8RJ 1HGVA 1JTHA 3H1KG 2Q3EA 4EI2A 4UB8E 1Z56A 5KAIH 2FXMA 2GA1A 3I5CA 3L73E 3RGUA 2E76B 3H1LD 4H13C 4H13B 4O9BA 3AEBC 3WU2E 1H89A 3GW6A 2V4HA 1FAVA 1SP4A 1SQPD 1JY2P 1BGYE 4I6MC 2QVAA 3SSUA 3VMYA 5AVUB 4UB6E 2P58A 1SFCA 2Y0CA 3I55P 4OGQC 1NYHA 1GW3A 1NWQA 1LWUB 1NVOA 3H1KJ 1G1IA 5DJTB 5BU5A 5AVSB 2O1JA 3HD7D 2WPVB 1SQBE 2RH0A 4PD4I 1IC2A 2L91A 2BEQD 3H1IE 5APXA 3AE9C 3TDKA 3VMAA 2Y0DA 3H1LJ 2HFED 2WT7A 3KHUA 4EDFA 2OYHB 1HUCA 4GT1A 1KC8Q 3TGUD 5APTA 3U1CA 2PP6A 4N78E 2R44A 1EXJA 1LWUA 2ZYAA 3KZIE 2GM4A 4WY4C 5KLVD 1N2DC 2RN0A 2BCCD 2KIKA 1BCCD 3MUDA 1SQQE 1Y47A 1FC2C 2KLVA 1JY2N 4XFJA 3TK1A 3L70D 2N9BA 1SQPE 1EZVI 3AE4C 1PIXA 3VMZA 4IL6H 1PL5A 3B5NB 1BE3E 1FDOA 3L35A 2WSEJ 1J1DB 1NAYA 2WVRA 1FU1A 3VTPC 4W7ZA 5KAIE 1VQ5P 2WQYC 1YQ4C 1FZCA 5CJ0A 1FE6A 2A45H 1ZRTD
chains in the Genus database with same CATH topology
1P84I 3CX5I 4PD4I 1NTZJ 1KYOI 1SQPJ 1L0LJ 1NTKJ 1PP9J 3BCCJ 3L70J 1L0NJ 1NTMJ 5KLVJ 3H1LJ 3H1KJ 1KB9I 2BCCJ 1BE3J 1NU1J 1SQXJ 1SQBJ 1SQQJ 1EZVI 1BCCJ 3H1IJ 2FYUJ 3L72J 3CWBJ 3L71J 4U3FJ 1SQVJ 2IBZI 3L75J 3H1HJ 3L74J 3TGUJ 4D6TJ 3L73J 1BGYJ 3CXHI 3H1JJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P84 I;  3CX5 I;  4PD4 I;  1NTZ J;  1KYO I;  1SQP J;  1L0L J;  1NTK J;  1PP9 J;  3BCC J;  3L70 J;  1L0N J;  1NTM J;  5KLV J;  3H1L J;  3H1K J;  1KB9 I;  2BCC J;  1BE3 J;  1NU1 J;  1SQX J;  1SQB J;  1SQQ J;  1EZV I;  1BCC J;  3H1I J;  2FYU J;  3L72 J;  3CWB J;  3L71 J;  4U3F J;  1SQV J;  2IBZ I;  3L75 J;  3H1H J;  3L74 J;  3TGU J;  4D6T J;  3L73 J;  1BGY J;  3CXH I;  3H1J J; 
#chains in the Genus database with same CATH topology
 2W27 A;  1VL2 A;  2YNY A;  3OJA B;  3L72 G;  2M8R A;  1FBM A;  2BCC J;  2YMK A;  2B88 A;  1JCC A;  3BRV B;  3P7K A;  3Q3D A;  1EDL A;  3B4S A;  1MZ9 A;  2AEJ A;  1WMK A;  1LTJ C;  3P8M C;  2QA4 P;  4QMA A;  1PGP A;  3L71 E;  2A06 G;  2ZXE B;  4KT0 J;  3A3Y B;  2IZ1 A;  3TGU E;  1A02 F;  4IL6 X;  4MN4 C;  2WSC J;  3PRJ A;  5CMZ A;  4WWI A;  1IFJ A;  3V6I A;  1LGH B;  4JQ0 D;  5AW4 B;  3CCV P;  1MFT A;  4LLH A;  1T3U A;  1MKM A;  1LT9 B;  2M3B A;  3QH9 A;  1BDC A;  1BCC E;  3HTK B;  1RQV A;  1YJ9 P;  1HJ0 A;  1M1J C;  1NOH A;  2FY8 A;  1KB9 I;  3Q5R A;  3AE5 C;  2C9N Y;  3AE3 C;  3HUS A;  2FFD C;  3CL3 D;  1QX8 A;  4U7J A;  3WUV A;  1JMB A;  1HH0 A;  1NTK D;  1URQ C;  1L0N K;  1URQ B;  3GHG C;  1W2B O;  4N3Y B;  1HJB A;  1DEB A;  2K9J B;  1EXI A;  2FYZ A;  1KYO H;  2HOD A;  1N73 B;  4H44 C;  1VQK P;  2I1J A;  3RBX A;  3RL0 D;  3RK2 D;  1NTZ K;  2ZFC A;  4W80 A;  1LTT C;  1IJD B;  3HD7 A;  1GL2 C;  1RE4 A;  1GL2 B;  1KIL D;  1L4A C;  3ITK A;  1MV8 A;  2ITA A;  2MKV A;  2WPR A;  5CCH D;  4PV1 C;  1RF1 C;  1RF1 B;  1GDT A;  4H0L C;  2NRG A;  1G2C A;  3JC2 2;  2KLU A;  1S5L H;  3L75 G;  3RK3 D;  3L74 G;  4CPG A;  1KOR A;  3RBZ A;  3P8C E;  4BWN A;  2P2U A;  1L0N G;  2H89 C;  1GK4 A;  3A0B E;  1M90 Q;  1OW8 A;  4DJG A;  1Y9B A;  1NTK J;  3R2P A;  2V7Q H;  2KOG A;  2ZVO B;  5B66 E;  4D6T G;  3A5T A;  1NTZ G;  2E74 B;  3CPW O;  1RF0 C;  5AW1 B;  1SQV K;  4C7N A;  2B87 A;  1IFP A;  4OWF A;  5AVV B;  3E7K A;  2L5G B;  3VN0 A;  1L2P A;  4W7Y A;  4NPE A;  3L75 J;  1OZH A;  4PD4 H;  3L74 J;  2E76 D;  1S5L X;  4AQR D;  1IFI A;  3GF7 A;  1N7S C;  1N7S B;  4H13 D;  3CCR P;  1L0N J;  3CWB G;  5APQ A;  1PP9 D;  3FXE A;  3PJS K;  1KQL A;  3O6Q B;  3EQ2 A;  2K9Y A;  2M3E A;  4WBA A;  1W5C E;  1IFM A;  2WSF J;  1OMI A;  1NO4 A;  2D2C B;  2AXC A;  1L0L D;  2POH A;  1R5S A;  5CBO A;  1SQV G;  1KZU B;  4PD4 D;  1GMJ A;  4I2L C;  1OW7 A;  3BCC G;  2XKM A;  2WTY A;  5TJH A;  3T97 A;  3V2P A;  3CX5 I;  1KYO E;  1CI6 B;  2Q5U A;  3I56 P;  1GK6 A;  1TU3 F;  2FYU E;  1LTG C;  1BDD A;  3Q5P A;  1DEE G;  4U3F G;  2M5A B;  3H1J E;  3KDP B;  2YXQ B;  1JY3 P;  4RJT A;  2PRR A;  3FGA D;  2LXC B;  4EYY Q;  1VF5 B;  2H7H A;  2JDI H;  1BGY D;  1PP9 J;  4L76 A;  2YIU C;  2YIU B;  1VQ7 P;  1NU1 J;  3B71 A;  1S5L E;  1JY2 O;  3V2N A;  3MGN A;  3M9B A;  1SQX K;  1SQV J;  1U7J A;  5AVQ B;  1FZG A;  2QM7 A;  3PP5 A;  3NXS A;  3Q1M A;  2XV5 A;  3LW5 H;  1YJW P;  3S1K A;  5AW3 B;  2HYN A;  1MUU A;  3H25 A;  3CCU P;  2MJZ A;  1NKZ B;  4L74 A;  1SQB D;  1QVG O;  1LP1 B;  3L73 J;  5KLI C;  5KLI B;  4NPD A;  2KUB A;  1PPJ G;  3H1I G;  1OVV A;  1KIL A;  3B5N D;  1NHL A;  2W6A A;  1RHZ B;  1K05 A;  2QEX P;  3ABV C;  5CCH A;  2G8Y A;  1BGY J;  2QJY C;  4PD4 E;  1H0T A;  1SQX G;  1Y8A A;  3PTZ A;  4KHX A;  1KB9 H;  3H1H E;  2KP8 A;  4I1L A;  1SLQ A;  2PFX A;  3AE2 C;  2KNC A;  3OAK A;  3EWK A;  2R3S A;  3M9H A;  1SQQ D;  1YI2 P;  2P10 A;  5BVZ A;  1AVY A;  2K37 A;  2IYP A;  3H1L G;  1ZR4 A;  4JYC A;  2GUV A;  3WMM 0;  5APW A;  3CCQ P;  2Q1K A;  2O01 J;  2XDJ A;  3H1I J;  1BE3 D;  1VQ4 P;  3V4W A;  3GMA A;  1K8A Q;  2KS1 A;  1FS0 E;  1KN7 A;  1LJ2 A;  1KMI Z;  4OGQ B;  1KB9 D;  1N7L A;  1GU4 A;  1SQX J;  1EZV E;  4WVZ A;  3FWN A;  1NTM E;  2FXO A;  3NFQ A;  2FBW C;  1ZOY C;  1LNQ A;  4RKU J;  3A0H H;  4B86 A;  3JCU H;  1RQU A;  3MUD C;  1URQ D;  3L71 D;  1ZLL A;  3A2A A;  1SQP J;  3RL0 g;  4GOD A;  3HRN A;  3CC4 P;  3TGU G;  4IFF A;  3MD0 A;  1EDI A;  4WY4 B;  1WRG A;  3AE7 C;  1M7L A;  2QRX A;  2HG5 D;  3H1K E;  1GL2 D;  5KLV G;  5CCG C;  2BCC G;  1N8R Q;  2YKQ A;  5CBN A;  2WPS A;  4NPF X;  4R4L A;  3E1I A;  3HE4 B;  3C8V A;  1FZC C;  1R8E A;  1YBK A;  1BSH A;  1KD1 Q;  1ZME C;  2OYH A;  4XA4 A;  3L70 G;  2IBZ G;  1P84 I;  4IOI H;  3L37 A;  1M8O B;  3CCJ P;  1K9M Q;  1OFC X;  2WIT A;  3U59 A;  1GU5 A;  1KB9 E;  1USD A;  2OAR A;  2QM8 A;  3A0B H;  3TGU J;  3KPE A;  1DH3 A;  2Y9Y A;  3M0D C;  2E42 A;  2E74 D;  2DW3 A;  5B66 H;  1PGJ A;  4GOF A;  5KLV J;  1VQ8 P;  3CLQ A;  1DD4 A;  1BCC J;  3MZW B;  3AE1 C;  1SS1 A;  3CXH I;  1LTJ B;  2C0X A;  3B5N A;  4Z1M H;  3L70 J;  1H8A A;  1NTK K;  5M1B A;  3P8C D;  2FXP A;  1CSB A;  1N7S D;  2N1T C;  2KSJ A;  2N1T B;  1YTZ I;  3HUS C;  3G6E P;  2C9L Y;  1IK7 A;  1S9K E;  2JWD A;  1VQP P;  4IFM A;  1M57 D;  1PZQ A;  1Q2N A;  2A45 G;  2K1A A;  1M1J B;  1Q7Y Q;  2D2C D;  2KI7 B;  2R5B A;  4PJ0 E;  3GG2 A;  3A0H E;  5APS A;  1YHQ P;  1S2E A;  3JSV C;  3JCU E;  2FFD B;  4N6J A;  2JR8 A;  1Q90 D;  1HBW A;  2KB7 P;  3EFF K;  5AVZ B;  1T2K C;  3HD7 C;  1RE4 C;  2Z5I A;  1RE3 C;  3GHG B;  2Y9Z A;  1EC5 A;  4OVN F;  3AEG C;  1NTK G;  1LTS C;  4KJM A;  4AYC A;  2OTL P;  1AQT A;  3SWY A;  4H44 B;  1LT9 A;  2QE7 H;  3HTK A;  1VF5 D;  1OXZ A;  3PHL A;  2O3J A;  1AFO A;  3TNU B;  2LKM A;  2W6B A;  2P1J A;  1L4A B;  2FKW B;  2B89 A;  2OYI C;  2OYI B;  5E79 H;  1JEK A;  1ZR2 A;  3MTU E;  5KJ7 C;  2W6J H;  4PV1 B;  1S3J A;  3L72 E;  2H43 A;  3HE5 B;  3AEC C;  4H0L B;  2VRS A;  4ZMD A;  1LT1 A;  1M56 D;  1URQ A;  5APV A;  2K9J A;  1KYO D;  1AQ5 A;  2FYU D;  3CMA P;  1N73 A;  4K3A A;  1ZXG A;  2A06 E;  1KV4 A;  3H1J D;  2HPC B;  4ZNC A;  3C9I A;  2JKV A;  2Z4E A;  1GL2 A;  3Q2Y A;  1VQM P;  1NU1 K;  3KYQ A;  2IBZ I;  1JUN A;  1OW6 A;  3M91 A;  1IZN B;  5AW6 B;  2J58 A;  1IO4 A;  5H2F H;  1JY3 O;  4D6T D;  3FWL A;  1PV3 A;  1RF1 A;  1NTZ D;  5AW0 B;  1N86 A;  1LTA C;  3W67 A;  1HGZ A;  2BEZ F;  1EDK A;  4I7Z C;  1GW4 A;  3G71 P;  1K04 A;  2LR2 A;  1ZN5 A;  1HF9 A;  4EIJ A;  5GTI H;  3O8Z A;  3CD6 P;  2FYU J;  1YJN P;  1PP9 G;  3H1J J;  5KAF E;  3N4X A;  1RF0 A;  4WB4 A;  2R3C A;  2PGD A;  3TF5 A;  1NU1 G;  3VYI A;  1ZW0 A;  4OGQ D;  2NPS C;  2ZT9 C;  2NPS B;  2ZT9 B;  3C1L A;  1U7M A;  1L0L G;  1XTC C;  2ZAE B;  3H1H D;  1UII A;  4ASV A;  2A45 I;  1IK9 A;  1K73 Q;  3E1R A;  4ZKU A;  4C7R A;  3L75 E;  3OA7 A;  1N7S A;  3CCS P;  3L74 E;  3BCC D;  2ZYD A;  3IFM A;  3N7N A;  3L73 G;  3SFE C;  4BRY B;  2ZVN B;  2E75 C;  1S4X A;  2E75 B;  1L0N E;  1SQB K;  1P84 H;  4K35 A;  2V7Q J;  1PFI A;  3O6Q A;  4Y99 C;  4Y99 B;  4YXD C;  5E79 E;  1NJI Q;  2I1K A;  1KQF B;  2OTJ P;  2XND H;  4D6T E;  5KTB A;  1NTZ E;  1BGY G;  2J5U A;  1FDI A;  3V4Q A;  1ZV8 A;  1Q86 Q;  4WY4 D;  1L0L J;  2H88 C;  1KIL C;  1CI6 A;  4YXW H;  3QWO C;  2KXP B;  1EZV D;  5CCG D;  2M5A A;  5CCH C;  1NTM D;  2WMM A;  3TSI A;  3CXH H;  3H32 B;  1SQQ K;  1IFD A;  1NGM B;  3D6Y A;  1JTH B;  5TIS H;  3RK3 C;  3D6Z A;  1U57 A;  1OVR A;  1RY3 A;  5H2F E;  1SQB G;  3CWB E;  1SQP K;  3SWF A;  2Z5H A;  1JOC A;  4ASW A;  1FDM A;  1A02 J;  2R32 A;  2BAS A;  1FOS F;  2CPS A;  3VMX A;  2YKP A;  2QJY B;  1SVF A;  1SQV E;  3SFD C;  1RH5 B;  3KXD A;  3M06 A;  4LC1 A;  2RKL A;  1DD3 A;  1JCD A;  1VQ9 P;  3H1K D;  1JY3 N;  5BU8 B;  5GTI E;  3BCC E;  1SFC C;  5AW2 B;  1SFC B;  1LP1 A;  2E5T A;  3NMD A;  1SQQ G;  3UIA A;  1FZE A;  4U3F E;  1M1K Q;  2IZ0 A;  3CC7 P;  2O01 N;  1NTM J;  3AEA C;  3L36 A;  2E76 C;  5DJU B;  1KTM A;  2N9Y B;  2E43 A;  1SQB J;  2KZJ A;  5AW7 B;  1SQP G;  1CZQ A;  5B5E H;  1USE A;  2KSE A;  4L75 A;  1NH4 A;  2SPZ A;  2N1T D;  3AED C;  1BE3 G;  3L4F A;  2IDB A;  3PLN A;  2WT7 B;  2WSE H;  2WPQ A;  3Q5S A;  2HR3 A;  1QLE D;  5KLV K;  1KQS O;  2OYO A;  1AJY A;  3IR9 A;  2W83 C;  3LIE A;  1P84 E;  2G3A A;  1EQ7 A;  3LW5 J;  4TT3 H;  1CW5 A;  1LWU C;  4GIF A;  2ZYG A;  1AVO A;  5KKZ C;  4PJ0 H;  5GTH E;  5KKZ B;  1SQQ J;  2Q3I A;  1T2K D;  4HJG H;  2Q7C A;  1LTI C;  1X0T A;  1JM0 A;  3V2Q A;  2JWA A;  1PPJ E;  3S9O A;  1KFN A;  3MIW A;  1YIT P;  3GLM A;  3FX0 A;  1J1E C;  3L71 G;  1J1E B;  1QL1 A;  4H44 D;  4LGD E;  2P67 A;  1BE3 J;  4DOJ A;  1VQN P;  1S9K D;  2OYH C;  3IF4 A;  2YKO A;  2WSC H;  1BSN A;  3BVH A;  3CXH E;  2CPB A;  4BXL A;  3CI9 A;  1SQX E;  1L4A D;  5EFW B;  3PH0 A;  3AE6 C;  5TIS E;  1JMM A;  1BCC G;  1S72 P;  2JJL A;  4HH2 A;  5KJ7 D;  3SWK A;  4PV1 D;  1JO5 A;  4H0L D;  1EDJ A;  5AW8 B;  4R4M A;  1FZC B;  4TLF A;  5AW9 B;  3H1L E;  4GDO A;  3K5B A;  4XE5 B;  3AE8 C;  3H6P A;  4L73 A;  1DX7 A;  3V5B A;  2OGU A;  2WWW A;  2IBZ D;  2OQQ A;  5APY A;  3L71 J;  2E5Y A;  4WY4 A;  1FJK A;  2AXT E;  3B5N C;  2ZJS E;  4JBZ A;  5CCG A;  1J1D C;  3G4S P;  2NZ2 A;  5AVY B;  1X8Y A;  2JEE A;  1GZL A;  3HE4 A;  5CHX A;  1JB0 J;  1HWT C;  3CX5 H;  3L72 D;  2IX7 C;  5B5E E;  2JP3 A;  1GD2 E;  2J59 M;  3CC2 P;  2PAJ A;  4DZO A;  2XZR A;  1XTG B;  3B8E B;  4HYT B;  3MP7 B;  5AW5 B;  1VPC A;  3HUS B;  4A7P A;  2A06 D;  1HVV A;  1GTW A;  2M0B A;  2W90 A;  2GUS A;  3M0D A;  1NKN A;  2IFN A;  3G3Z A;  1FJP A;  4DT0 A;  1PGO A;  1QEX A;  2IYO A;  3U1A A;  4ZKP A;  2C0W A;  3IAO A;  3CX5 D;  2IPP A;  5KAF H;  2HOD B;  5KLV E;  1LT9 C;  2FYN C;  2BCC E;  2NPS D;  2ZT9 D;  2FYN B;  3EFG A;  3VP9 A;  1LTJ A;  4YTP C;  3F5H A;  2YXR B;  3CME P;  1FZF A;  3HD7 B;  3L72 J;  3L70 E;  2N1T A;  1QGK B;  2IBZ E;  2FYU K;  4M3L A;  1YTZ T;  2E75 D;  1G2C B;  1X79 B;  2AEM A;  3W68 A;  4EOT A;  3V2R A;  5AVR B;  3ZDM A;  5CJ4 A;  1M1J A;  1VQ6 P;  4GKG A;  1X22 A;  2K3R A;  2WZ7 A;  1E5W A;  1IFN A;  1N73 C;  1FZA A;  1H88 A;  3CCL P;  2FFD A;  2P7J A;  1S1C X;  1ZRT E;  2WSF H;  1YIJ P;  1OWA A;  3GHG A;  1RE3 A;  3USS A;  3FXD A;  4C7N B;  3AEE C;  2B87 B;  3TYY A;  3L75 D;  4IL6 E;  3L74 D;  1J2J B;  2OTK E;  2FYU G;  3D70 A;  2ZXX A;  2RMZ A;  1L0N D;  1FOS E;  3H1J G;  3TNU A;  1T8Z A;  1L4A A;  1Q81 Q;  1OX3 A;  2OYI A;  3CX5 E;  1T6A A;  5KJ7 A;  1KQG B;  3HE5 A;  1L0L K;  1X9V A;  1AA0 A;  3CCE P;  2JO1 A;  4Y28 J;  2E74 C;  2Q9I A;  1VQO P;  5C39 A;  1MFZ A;  4JPZ B;  4I7Z B;  4C46 A;  3CCM P;  4YPC A;  3OW2 O;  2LXB A;  4IFD K;  3LID A;  3BAS A;  1SFC D;  2HPC A;  4JF7 A;  2Y0E A;  3BAT A;  4OH8 B;  4GOE A;  1NTK E;  1QVF O;  4JYB A;  3T97 B;  4DCK A;  2KK7 A;  2B9B A;  3CWB D;  4UB8 H;  2QJP C;  2WSS H;  2QJP B;  1LTB C;  1HTL C;  5AVW B;  4HB1 A;  2CK3 H;  3M9Q A;  2YO2 A;  3WUU A;  3WU2 H;  4RES B;  1NU1 D;  1AV1 A;  2O1K A;  2KZI A;  1QL2 A;  1T3J A;  4RO0 A;  4D6T J;  1KIL E;  1SQV D;  1NTZ J;  3II6 A;  1UIX A;  1PGQ A;  2D2C C;  3R4Y A;  2YMY A;  1ZP0 C;  1WT6 A;  3H1H G;  1NTM K;  3IN6 A;  1OVU A;  4UB6 H;  5AVX B;  2XNX A;  3RK3 E;  2W8Z A;  3A7O A;  1NAF A;  4U3F D;  3L73 D;  2XU6 A;  5GTH H;  2QSI A;  1YYC A;  3MHV A;  5K5G B;  2NPS A;  1R5L A;  3CWB J;  3D71 A;  1KFM A;  2AEF A;  3RL0 C;  3RK2 C;  2O01 H;  3RL0 B;  3RK2 B;  2HLO A;  2KYV A;  1VF5 C;  3WUT A;  1KIL B;  3S4R A;  1Q82 Q;  2K88 A;  1VQL P;  4HKZ H;  1VDF A;  1D7M A;  4BRY A;  1P84 D;  1EZV G;  2R5D A;  3G9R A;  3H1H J;  3BRT B;  3M0A A;  1W2E A;  1NTM G;  3F89 A;  3RK3 B;  2QIW A;  1H0T B;  3KZI H;  3BCC J;  3GF3 A;  5AVT B;  3NTN A;  2KNC B;  2YO3 A;  3KQG A;  1PP9 E;  2IFM A;  4U3F J;  1FZB A;  1PPJ D;  3AEF C;  3H1I D;  1DIP A;  2I8D A;  4AUW A;  2UWJ E;  2QG4 A;  3VOP A;  1NU1 E;  1KYO I;  1E79 H;  2QJK C;  2QJK B;  2Q6Q A;  5APU A;  1JNM A;  3VP8 A;  2H8P D;  1YQ3 C;  1L0L E;  2AXT H;  3CXH D;  1OIP A;  1SQX D;  1G1J A;  2KS1 B;  3P32 A;  3H32 A;  4N78 D;  5L8R J;  1HGV A;  1JTH A;  3H1K G;  2Q3E A;  4EI2 A;  4UB8 E;  1Z56 A;  5KAI H;  2FXM A;  2GA1 A;  3I5C A;  3L73 E;  3RGU A;  2E76 B;  3H1L D;  4H13 C;  4H13 B;  4O9B A;  3AEB C;  3WU2 E;  1H89 A;  3GW6 A;  2V4H A;  1FAV A;  1SP4 A;  1SQP D;  1JY2 P;  1BGY E;  4I6M C;  2QVA A;  3SSU A;  3VMY A;  5AVU B;  4UB6 E;  2P58 A;  1SFC A;  2Y0C A;  3I55 P;  4OGQ C;  1NYH A;  1GW3 A;  1NWQ A;  1LWU B;  1NVO A;  3H1K J;  1G1I A;  5DJT B;  5BU5 A;  5AVS B;  2O1J A;  3HD7 D;  2WPV B;  1SQB E;  2RH0 A;  4PD4 I;  1IC2 A;  2L91 A;  2BEQ D;  3H1I E;  5APX A;  3AE9 C;  3TDK A;  3VMA A;  2Y0D A;  3H1L J;  2HFE D;  2WT7 A;  3KHU A;  4EDF A;  2OYH B;  1HUC A;  4GT1 A;  1KC8 Q;  3TGU D;  5APT A;  3U1C A;  2PP6 A;  4N78 E;  2R44 A;  1EXJ A;  1LWU A;  2ZYA A;  3KZI E;  2GM4 A;  4WY4 C;  5KLV D;  1N2D C;  2RN0 A;  2BCC D;  2KIK A;  1BCC D;  3MUD A;  1SQQ E;  1Y47 A;  1FC2 C;  2KLV A;  1JY2 N;  4XFJ A;  3TK1 A;  3L70 D;  2N9B A;  1SQP E;  1EZV I;  3AE4 C;  1PIX A;  3VMZ A;  4IL6 H;  1PL5 A;  3B5N B;  1BE3 E;  1FDO A;  3L35 A;  2WSE J;  1J1D B;  1NAY A;  2WVR A;  1FU1 A;  3VTP C;  4W7Z A;  5KAI E;  1VQ5 P;  2WQY C;  1YQ4 C;  1FZC A;  5CJ0 A;  1FE6 A;  2A45 H;  1ZRT D; 
#chains in the Genus database with same CATH homology
 1P84 I;  3CX5 I;  4PD4 I;  1NTZ J;  1KYO I;  1SQP J;  1L0L J;  1NTK J;  1PP9 J;  3BCC J;  3L70 J;  1L0N J;  1NTM J;  5KLV J;  3H1L J;  3H1K J;  1KB9 I;  2BCC J;  1BE3 J;  1NU1 J;  1SQX J;  1SQB J;  1SQQ J;  1EZV I;  1BCC J;  3H1I J;  2FYU J;  3L72 J;  3CWB J;  3L71 J;  4U3F J;  1SQV J;  2IBZ I;  3L75 J;  3H1H J;  3L74 J;  3TGU J;  4D6T J;  3L73 J;  1BGY J;  3CXH I;  3H1J J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...