1SQPJ

Crystal structure analysis of bovine bc1 with myxothiazol
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
61
structure length
61
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
total genus 18
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1sqpJ00
1NTZJ 3L74J 1NTMJ 3H1HJ 1NU1J 1BCCJ 3TGUJ 3L71J 3CWBJ 3L75J 3L73J 2FYUJ 3H1IJ 3L72J 1PP9J 3CX5I 4D6TJ 2BCCJ 1KYOI 1L0NJ 3H1JJ 3H1KJ 1NTKJ 5KLVJ 3L70J 1SQXJ 1KB9I 3CXHI 4PD4I 1SQPJ 1P84I 1EZVI 3H1LJ 1SQVJ 3BCCJ 4U3FJ 1BE3J 1L0LJ 2IBZI 1BGYJ 1SQQJ 1SQBJ
chains in the Genus database with same CATH superfamily
2LXBA 1FBMA 1OFCX 5CCGD 5CJ4A 5KJ7C 3L75J 2P10A 1GDTA 2OYIB 1PP9G 5KLIC 1GL2B 2J59M 1U7JA 4L75A 5APVA 5CCHA 3C8VA 2KP8A 1Q7YQ 1R8EA 1OWAA 1SQBJ 5APYA 2IZ1A 4H44C 3GMAA 3CWBG 1HGVA 2LR2A 4YXDC 1FZCC 2C9NY 2BCCG 1YTZT 1OXZA 2P7JA 1LTTC 2FXPA 1AQTA 1KB9D 3CXHD 1AFOA 3WUUA 1KB9I 3CXHI 2OYIC 4GIFA 2KOGA 1GL2C 1H0TA 1PP9E 1VQ6P 1RF1A 1BGYD 1VDFA 3TK1A 4M3LA 1JY3N 3D6YA 2YKOA 1N86A 2E75D 1RQVA 5APXA 2H8PD 3H1ID 1BSHA 3JCUE 1R5LA 2QM8A 1RF0C 1LWUA 3CWBE 3PTZA 1JMBA 4Y99C 3VTPC 1IO4A 4DOJA 2B87B 1YJ9P 1N7SA 3V5BA 1EDLA 1AV1A 3RBZA 2QJKB 1L0NK 1RH5B 2Q3EA 1SQPK 1TU3F 2MJZA 3GF7A 2HYNA 5KTBA 1NU1K 2LKMA 2PFXA 1JCDA 2OGUA 5B66H 1VPCA 5AW4B 3H1JJ 4D6TD 1NTME 2HODB 1JY2P 2ZXEB 3MUDA 3L4FA 4JYBA 3ABVC 4PJ0H 2QJKC 2JO1A 2KB7P 1IJDB 5AW9B 2IFMA 3WU2E 3L75D 1OZHA 1OVVA 4KHXA 1NTZJ 2K1AA 5GTHE 1SQBD 1KQSO 1LTBC 3WU2H 3V6IA 3FX0A 5DJUB 1FOSE 4GODA 1QGKB 2OARA 1GW3A 4JQ0D 3AE6C 2A06D 5GTHH 1PPJD 2PRRA 3CD6P 2FBWC 3AE2C 1PGOA 3G9RA 3OA7A 4TT3H 2W90A 1L4AA 3CCQP 1SFCB 1S4XA 3GLMA 1X0TA 3VMAA 3L72G 3CCLP 1YBKA 2KS1B 1NH4A 3B5ND 4GOEA 1PP9J 2WMMA 4IOIH 1X9VA 2I1JA 1JY3O 2QG4A 2POHA 3AE8C 1LT9B 2N1TB 4XE5B 1FE6A 1L0LK 1SLQA 3S1KA 2XZRA 3CWBJ 4EIJA 3VMXA 1KILD 1PV3A 3E1IA 3AE3C 1EXJA 2BCCJ 1LTJA 2YO2A 3BASA 3H1JD 1OVRA 1Y9BA 3FXDA 1GK6A 1JB0J 1LGHB 3CPWO 5KAIE 4ASWA 1LT1A 1Q81Q 4UB8E 3PHLA 1PGQA 1LT9C 2N1TC 2OYHB 3EQ2A 3HE4A 3GG2A 2QJYB 3P8CE 2ITAA 4KT0J 1GK4A 3D6ZA 2KK7A 3OJAB 5KAIH 1LNQA 1RQUA 1NTZD 1SQPE 2WSEH 1LP1B 4WY4C 4PV1D 2QRXA 1CW5A 1S5LH 4ZNCA 3TNUB 2E42A 1E79H 3E7KA 1IFJA 1NU1E 1EZVD 1Y47A 3L73E 1ZP0C 3MGNA 1CSBA 2OYHC 4QMAA 3K5BA 2YKQA 3AEGC 1ZLLA 5EFWB 1VQ4P 2WSCH 5CJ0A 3AEEC 3RK2B 2HFED 4ZKUA 1SQVG 4EDFA 5AW3B 5DJTB 2FFDA 4GOFA 1URQB 2R32A 2WT7A 4RESB 2QSIA 2YMKA 1S72P 5KAFE 4I1LA 3OAKA 2BEQD 1HTLC 1FOSF 2BASA 4Z1MH 3BATA 1PP9D 3A3YB 1S2EA 1N8RQ 3HUSB 3Q5RA 2KIKA 3RK2C 5KAFH 1S9KE 2FKWB 2B88A 3B8EB 1G1IA 1URQC 3CWBD 2IZ0A 4WY4A 2BCCD 5CCGC 1ZW0A 1M1KQ 1DEEG 3AECC 2JR8A 1LTSC 1FC2C 2G3AA 1X79B 3TGUG 3ITKA 2FYUG 2IFNA 5AVQB 1KFMA 3HUSC 2E75B 2H88C 2B89A 3W67A 2E74C 1GW4A 1KYOE 1A02J 3HD7D 2XV5A 2W6AA 2XNDH 1JNMA 3CI9A 2E5TA 2W83C 2QM7A 3L72J 2Z4EA 1AVOA 1NTKG 1ZR4A 1NVOA 1DX7A 1KYOH 1FDMA 1YJNP 3TGUE 2WSEJ 2E75C 1HVVA 1YITP 2BEZF 4W7YA 2N9BA 3I55P 2Q7CA 2HLOA 3H1LG 1HJ0A 4C7NA 2WSCJ 2RH0A 1M57D 1OVUA 3IN6A 1IFPA 4N78E 3CCSP 3CLQA 1NTKE 5KLVE 1JUNA 3O8ZA 4CPGA 4IFDK 4A7PA 2WZ7A 5M1BA 2E76D 1S3JA 3HTKA 1UIXA 2O1JA 2YXQB 5E79H 2OTKE 1NTZG 5APQA 1JY2N 1DIPA 1Z56A 3H1LE 1QLED 1ZRTE 1J1DB 5CBNA 2JJLA 1VQ7P 3M91A 3KZIE 1W5CE 2HPCB 4BRYA 1MZ9A 4BXLA 1VL2A 2KLVA 3EWKA 2C0XA 3L71G 1KMIZ 2FYZA 2YMYA 5L8RJ 1MUUA 2I1KA 3KZIH 2AXTE 3BCCG 5BVZA 1N73B 1SQVJ 1T6AA 1ZN5A 1J1DC 3CMEP 2AXCA 3TF5A 2V7QH 1YI2P 3B5NB 5AVRB 1J1EC 4GDOA 1Q2NA 3V2QA 3L72D 1YTZI 1N2DC 2AXTH 3AE4C 5APUA 2JWDA 5AVWB 1EDIA 3L71E 4GKGA 3RK3D 1WMKA 4U7JA 3Q5PA 1BCCG 3KQGA 3BVHA 1N73C 2W27A 1U7MA 1KILB 3BCCE 3V4QA 3P8CD 1KORA 1FDIA 1Q90D 2D2CD 4UB6E 1FJKA 3GHGA 2NPSA 3B5NC 4JF7A 3TSIA 1KQGB 2V4HA 3AE7C 3TGUJ 2GUSA 4RKUJ 2FYUJ 3GF3A 4L76A 1YIJP 1T8ZA 2K9JA 4UB6H 1KQFB 1BCCE 1KILC 1SQXK 2K88A 1NTMG 1USDA 3RBXA 5AW1B 1KN7A 1RE4C 4PV1B 3HE5A 3IFMA 3USSA 5KJ7A 2R44A 2WSSH 3JCUH 1NTKJ 5KLVJ 3CC2P 1QX8A 3CCUP 2KNCA 1NWQA 3O6QB 3D71A 1KC8Q 4EI2A 1JMMA 3M9QA 1FZCA 2WQYC 4JPZB 4I2LC 1JY2O 3IF4A 3H32A 3H1LJ 2YIUB 4BWNA 1SQQG 4PV1C 5CCHD 2Y0EA 3PRJA 1SQVD 3B4SA 2OYIA 1D7MA 1JTHB 5B5EE 1GL2A 3T97B 1NJIQ 2RN0A 1XTGB 2V7QJ 1YQ4C 4DZOA 3L74G 2ZYAA 2I8DA 3NMDA 5B5EH 1RF0A 3KDPB 2R5DA 2YIUC 4OGQD 1KYOD 1NHLA 1KYOI 5APSA 3N7NA 1JEKA 1SQQE 3H1HE 3A2AA 2AEFA 3KHUA 4WB4A 2QJPB 1AA0A 5APWA 1T3JA 2GUVA 1PGPA 2M3BA 1KV4A 3C1LA 3MZWB 3L71J 1HWTC 4LLHA 1PFIA 3TGUD 1FU1A 1HBWA 1N7SD 2FYUD 1H89A 3KPEA 2AEJA 3L74E 1KD1Q 1QVFO 1M56D 5AW5B 3BCCJ 1H8AA 1K73Q 2B87A 3HD7B 3OW2O 1XTCC 2QJPC 4WBAA 1YJWP 1NTKD 5KLVD 1JCCA 1VQOP 2A45G 1NKNA 3V2PA 2WT7B 1MKMA 1SQBK 1BCCJ 1G2CB 2ZVOB 1SFCC 1L0NG 2HODA 5AVXB 3HD7C 3H1KE 3PJSK 4W7ZA 1SQPG 3SWFA 3II6A 3L37A 3H1LD 1NU1G 3L73G 1K04A 1M7LA 2KSEA 2O3JA 5AVUB 2IYPA 3W68A 1RE3C 2E76B 1CZQA 3RL0g 1FAVA 2C9LY 1FJPA 2PP6A 1GU4A 3M0DC 1L0NE 1NTMJ 4EYYQ 4UB8H 5AW2B 2W6JH 4XFJA 3L70G 2SPZA 2A45H 1OIPA 1T3UA 1BE3G 1K9MQ 1L4AD 3IR9A 1YHQP 4W80A 1KB9E 2ZYDA 3MHVA 1VQMP 2QJYC 3L71D 3E1RA 2NRGA 3CC4P 4N3YB 3RL0D 2JEEA 4U3FG 3CMAP 2M0BA 1DH3A 1SQQJ 2OTLP 3BCCD 2KS1A 3L70E 1S5LX 1AQ5A 1BE3E 2YO3A 1Y8AA 3VP9A 2K37A 1LT9A 2N1TA 1SVFA 1RE3A 1OW7A 1M1JB 3KYQA 2Q5UA 3RK3B 3L74J 1NTZK 3AE5C 1N7LA 3CC7P 4ASVA 3M0DA 2HR3A 4U3FE 1BCCD 1EQ7A 2WPVB 2IBZG 2D2CB 2E43A 2IYOA 1L0LG 3UIAA 4D6TE 1VQNP 1NKZB 1BDDA 1QEXA 2M5AB 3RGUA 1LTIC 3WMM0 2OYHA 1M1JC 5AVYB 3RK3C 3CL3D 4RJTA 4Y28J 4EOTA 3M0AA 2C0WA 4R4MA 3I5CA 3ZDMA 2VRSA 3L36A 1LP1A 2IBZE 1NTMD 2MKVA 2JP3A 3TNUA 1L0LE 5H2FE 1MV8A 2R5BA 5KLVG 2IX7C 3FWNA 3JSVC 1LJ2A 3PP5A 4C46A 3TDKA 4IL6X 2FXOA 1CI6B 2Q9IA 4OWFA 4YPCA 5H2FH 3Q1MA 2YNYA 1L0NJ 4L74A 1URQA 1SQPJ 2W6BA 2GM4A 2QVAA 2O1KA 5CCGA 3R2PA 1NU1J 1SQQD 2WWWA 3EFFK 1VQLP 3L73J 1QVGO 3VN0A 3S9OA 1FZEA 4LGDE 1OMIA 4RO0A 2K9YA 3HUSA 3AEDC 4WY4D 2CK3H 3GHGB 3MIWA 3P7KA 3PH0A 4I6MC 2Q1KA 1P84E 1H0TB 3A7OA 3QH9A 2KYVA 2Z5IA 3L74D 1RF1B 1ZXGA 2KI7B 3AEBC 1EXIA 4OGQB 5GTIE 1GD2E 5CCHC 3P32A 2KZIA 1KILE 1S1CX 3L70J 1H88A 3A0HE 1WT6A 2J58A 4WVZA 1BE3J 1NOHA 1LWUB 3H6PA 1P84H 5AVTB 5AW7B 3U1CA 1IK7A 5GTIH 1FDOA 3PLNA 1N7SB 3CCMP 3A0HH 1RF1C 2ZT9D 4U3FJ 4AUWA 2Q6QA 1Q86Q 4MN4C 1VQPP 3D70A 1EDJA 3V2RA 1PL5A 3M9HA 2KLUA 1LWUC 2ZJSE 3SWKA 4XA4A 3NFQA 3CX5E 5AW6B 3U59A 1PZQA 1N7SC 1EZVE 3CCJP 1M90Q 3LW5H 3AEAC 2A45I 3P8MC 1R5SA 2KXPB 5CMZA 3CX5H 2FY8A 2QE7H 1L0ND 2JKVA 1W2BO 1L0LJ 2H7HA 3M9BA 1SQPD 2E74D 1L2PA 1NO4A 2XU6A 1VF5D 1NU1D 3MUDC 1KFNA 4Y99B 5BU8B 3L73D 1T2KD 2JDIH 3Q5SA 3EFGA 2P2UA 2Q3IA 4NPFX 3G6EP 2DW3A 4H0LD 5AW0B 3NXSA 2HPCA 2ZAEB 2OQQA 1ZV8A 2OTJP 1YQ3C 3CCEP 1L4AB 3L70D 3V4WA 2BCCE 1FZAA 1BE3D 1DD4A 4H13D 2WPQA 2ZFCA 1Q82Q 1IC2A 4HKZH 2ZYGA 5B66E 2ZXXA 5APTA 1N73A 1RY3A 4JYCA 3RL0B 2B9BA 1S9KD 4IFFA 4LC1A 4U3FD 3H1HG 3FGAD 4DJGA 4PJ0E 3B5NA 3BRTB 2IPPA 1L4AC 1KZUB 1IFMA 3V2NA 1LTJB 3G4SP 3VMYA 1ZMEC 3F5HA 3SFEC 2NPSD 1IZNB 2K3RA 1IFDA 3Q3DA 4ZMDA 4K3AA 1K05A 1KILA 4GT1A 3RL0C 2KSJA 1FZGA 1JM0A 4NPDA 2WTYA 1LTAC 5AVSB 2Z5HA 3LW5J 1W2EA 1RE4A 5CBOA 3HE4B 2IBZD 3JC22 4WWIA 4OVNF 2IBZI 4ZKPA 1L0LD 2M8RA 4TLFA 1LTJC 3A5TA 1USEA 1GTWA 3FWLA 2W8ZA 3SWYA 2WPSA 5KJ7D 3SFDC 3H1KG 3F89A 1VQKP 5TJHA 1SQVK 3CCVP 2FYNB 1X22A 2P67A 1HH0A 2WITA 4HJGH 2QEXP 2IDBA 4HH2A 1M8OB 3MD0A 4L73A 4H44D 5KKZB 1SQXG 4N78D 1E5WA 2FXMA 2FFDB 2P58A 4PD4E 1GMJA 3O6QA 2P1JA 4KJMA 1GL2D 2N9YB 2FYNC 1BDCA 2OYOA 1P84D 1JY3P 1P84I 1K8AQ 4PD4H 1JTHA 5KKZC 3R4YA 1ZRTD 3T97A 1FS0E 2AEMA 1SQXE 3CCRP 1OX3A 1YYCA 2FYUK 2FFDC 1HJBA 2WVRA 3AE1C 3L72E 4WY4B 1BGYG 1HF9A 2J5UA 1WRGA 1FZBA 2WSFH 3H1IG 1IFIA 3GW6A 2CPSA 3WUVA 3RK3E 1QL2A 3AE9C 2NZ2A 1S5LE 3B71A 5AVZB 1NTKK 2Y0DA 5KLVK 3G3ZA 3CXHE 2GA1A 5TISE 1RHZB 3TYYA 2E76C 2QIWA 2O01H 2PGDA 3CX5D 1IK9A 3C9IA 3CX5I 5BU5A 5K5GB 1OW6A 1BGYE 2M3EA 3MP7B 1ZR2A 3N4XA 1SFCA 4AQRD 1SP4A 2XNXA 2XKMA 3HD7A 1EZVI 2ZT9B 3H1IE 1KB9H 3CXHH 5TISH 3M06A 4B86A 3H1HJ 1HGZA 1BSNA 3G71P 4D6TG 1QL1A 2RKLA 2Y0CA 3LIEA 1X8YA 1OW8A 2UWJE 1KQLA 1SS1A 4DCKA 4R4LA 3NTNA 1G2CA 4YTPC 4C7NB 3L75G 2KZJA 2LXCB 3HRNA 4I7ZB 1HUCA 2ZT9C 2WPRA 3L35A 2QA4P 1NAYA 3KXDA 1GU5A 3WUTA 3BRVB 3HTKB 1SQBG 1G1JA 2E74B 4IL6E 1SQVE 1VF5B 1LTGC 1GZLA 2Y9YA 3FXEA 4I7ZC 1UIIA 2A06G 3VP8A 3L75E 1PPJG 2R3CA 5CHXA 4HB1A 3H1KJ 4BRYB 4IL6H 2D2CC 3I56P 2YXRB 1U57A 2XDJA 1PGJA 4H0LB 2H43A 1SQBE 2WSFJ 1IFNA 1SQXJ 1SFCD 2YKPA 2ZVNB 1DD3A 1VF5C 3VOPA 4IFMA 1T2KC 4H13B 1AJYA 1A02F 3U1AA 2A06E 2O01N 1PPJE 1NAFA 2O01J 1NGMB 2L91A 3QWOC 2FYUE 4O9BA 3Q2YA 2N1TD 4H0LC 2R3SA 2Y9ZA 3A0BE 1J2JB 5AW8B 4AYCA 2G8YA 3H1HD 3S4RA 4NPEA 3IAOA 3H1JG 4JBZA 1MFTA 4H13C 3VMZA 1ZOYC 1M1JA 5E79E 2JWAA 2CPBA 3A0BH 3VYIA 1BGYJ 2NPSB 1FZFA 1JOCA 1KTMA 1NTMK 2PAJA 3H1IJ 1NYHA 3MTUE 2E5YA 4HYTB 4N6JA 1VQ8P 2K9JB 4OH8B 1VQ9P 2M5AA 2H89C 3H1JE 4YXWH 5C39A 3GHGC 1JO5A 1EZVG 2L5GB 2NPSC 3AEFC 3HE5B 4PD4D 1AVYA 4PD4I 5KLIB 1J1EB 4OGQC 2RMZA 1EC5A 4DT0A 2KNCB 3LIDA 1VQ5P 1SQQK 3H1KD 2HG5D 1MFZA 5AVVB 3SSUA 1PIXA 4C7RA 4D6TJ 4K35A 1EDKA 3RK2D 4H44B 1DEBA 1NTZE 2KUBA 1FZCB 1URQD 1SQXD 3H32B 1CI6A 3H25A
chains in the Genus database with same CATH topology
1NTZJ 3L74J 1NTMJ 3H1HJ 1NU1J 1BCCJ 3TGUJ 3L71J 3CWBJ 3L75J 3L73J 2FYUJ 3H1IJ 3L72J 1PP9J 3CX5I 4D6TJ 2BCCJ 1KYOI 1L0NJ 3H1JJ 3H1KJ 1NTKJ 5KLVJ 3L70J 1SQXJ 1KB9I 3CXHI 4PD4I 1SQPJ 1P84I 1EZVI 3H1LJ 1SQVJ 3BCCJ 4U3FJ 1BE3J 1L0LJ 2IBZI 1BGYJ 1SQQJ 1SQBJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTZ J;  3L74 J;  1NTM J;  3H1H J;  1NU1 J;  1BCC J;  3TGU J;  3L71 J;  3CWB J;  3L75 J;  3L73 J;  2FYU J;  3H1I J;  3L72 J;  1PP9 J;  3CX5 I;  4D6T J;  2BCC J;  1KYO I;  1L0N J;  3H1J J;  3H1K J;  1NTK J;  5KLV J;  3L70 J;  1SQX J;  1KB9 I;  3CXH I;  4PD4 I;  1SQP J;  1P84 I;  1EZV I;  3H1L J;  1SQV J;  3BCC J;  4U3F J;  1BE3 J;  1L0L J;  2IBZ I;  1BGY J;  1SQQ J;  1SQB J; 
#chains in the Genus database with same CATH topology
 2LXB A;  1FBM A;  1OFC X;  5CCG D;  5CJ4 A;  5KJ7 C;  3L75 J;  2P10 A;  1GDT A;  2OYI B;  1PP9 G;  5KLI C;  1GL2 B;  2J59 M;  1U7J A;  4L75 A;  5APV A;  5CCH A;  3C8V A;  2KP8 A;  1Q7Y Q;  1R8E A;  1OWA A;  1SQB J;  5APY A;  2IZ1 A;  4H44 C;  3GMA A;  3CWB G;  1HGV A;  2LR2 A;  4YXD C;  1FZC C;  2C9N Y;  2BCC G;  1YTZ T;  1OXZ A;  2P7J A;  1LTT C;  2FXP A;  1AQT A;  1KB9 D;  3CXH D;  1AFO A;  3WUU A;  1KB9 I;  3CXH I;  2OYI C;  4GIF A;  2KOG A;  1GL2 C;  1H0T A;  1PP9 E;  1VQ6 P;  1RF1 A;  1BGY D;  1VDF A;  3TK1 A;  4M3L A;  1JY3 N;  3D6Y A;  2YKO A;  1N86 A;  2E75 D;  1RQV A;  5APX A;  2H8P D;  3H1I D;  1BSH A;  3JCU E;  1R5L A;  2QM8 A;  1RF0 C;  1LWU A;  3CWB E;  3PTZ A;  1JMB A;  4Y99 C;  3VTP C;  1IO4 A;  4DOJ A;  2B87 B;  1YJ9 P;  1N7S A;  3V5B A;  1EDL A;  1AV1 A;  3RBZ A;  2QJK B;  1L0N K;  1RH5 B;  2Q3E A;  1SQP K;  1TU3 F;  2MJZ A;  3GF7 A;  2HYN A;  5KTB A;  1NU1 K;  2LKM A;  2PFX A;  1JCD A;  2OGU A;  5B66 H;  1VPC A;  5AW4 B;  3H1J J;  4D6T D;  1NTM E;  2HOD B;  1JY2 P;  2ZXE B;  3MUD A;  3L4F A;  4JYB A;  3ABV C;  4PJ0 H;  2QJK C;  2JO1 A;  2KB7 P;  1IJD B;  5AW9 B;  2IFM A;  3WU2 E;  3L75 D;  1OZH A;  1OVV A;  4KHX A;  1NTZ J;  2K1A A;  5GTH E;  1SQB D;  1KQS O;  1LTB C;  3WU2 H;  3V6I A;  3FX0 A;  5DJU B;  1FOS E;  4GOD A;  1QGK B;  2OAR A;  1GW3 A;  4JQ0 D;  3AE6 C;  2A06 D;  5GTH H;  1PPJ D;  2PRR A;  3CD6 P;  2FBW C;  3AE2 C;  1PGO A;  3G9R A;  3OA7 A;  4TT3 H;  2W90 A;  1L4A A;  3CCQ P;  1SFC B;  1S4X A;  3GLM A;  1X0T A;  3VMA A;  3L72 G;  3CCL P;  1YBK A;  2KS1 B;  1NH4 A;  3B5N D;  4GOE A;  1PP9 J;  2WMM A;  4IOI H;  1X9V A;  2I1J A;  1JY3 O;  2QG4 A;  2POH A;  3AE8 C;  1LT9 B;  2N1T B;  4XE5 B;  1FE6 A;  1L0L K;  1SLQ A;  3S1K A;  2XZR A;  3CWB J;  4EIJ A;  3VMX A;  1KIL D;  1PV3 A;  3E1I A;  3AE3 C;  1EXJ A;  2BCC J;  1LTJ A;  2YO2 A;  3BAS A;  3H1J D;  1OVR A;  1Y9B A;  3FXD A;  1GK6 A;  1JB0 J;  1LGH B;  3CPW O;  5KAI E;  4ASW A;  1LT1 A;  1Q81 Q;  4UB8 E;  3PHL A;  1PGQ A;  1LT9 C;  2N1T C;  2OYH B;  3EQ2 A;  3HE4 A;  3GG2 A;  2QJY B;  3P8C E;  2ITA A;  4KT0 J;  1GK4 A;  3D6Z A;  2KK7 A;  3OJA B;  5KAI H;  1LNQ A;  1RQU A;  1NTZ D;  1SQP E;  2WSE H;  1LP1 B;  4WY4 C;  4PV1 D;  2QRX A;  1CW5 A;  1S5L H;  4ZNC A;  3TNU B;  2E42 A;  1E79 H;  3E7K A;  1IFJ A;  1NU1 E;  1EZV D;  1Y47 A;  3L73 E;  1ZP0 C;  3MGN A;  1CSB A;  2OYH C;  4QMA A;  3K5B A;  2YKQ A;  3AEG C;  1ZLL A;  5EFW B;  1VQ4 P;  2WSC H;  5CJ0 A;  3AEE C;  3RK2 B;  2HFE D;  4ZKU A;  1SQV G;  4EDF A;  5AW3 B;  5DJT B;  2FFD A;  4GOF A;  1URQ B;  2R32 A;  2WT7 A;  4RES B;  2QSI A;  2YMK A;  1S72 P;  5KAF E;  4I1L A;  3OAK A;  2BEQ D;  1HTL C;  1FOS F;  2BAS A;  4Z1M H;  3BAT A;  1PP9 D;  3A3Y B;  1S2E A;  1N8R Q;  3HUS B;  3Q5R A;  2KIK A;  3RK2 C;  5KAF H;  1S9K E;  2FKW B;  2B88 A;  3B8E B;  1G1I A;  1URQ C;  3CWB D;  2IZ0 A;  4WY4 A;  2BCC D;  5CCG C;  1ZW0 A;  1M1K Q;  1DEE G;  3AEC C;  2JR8 A;  1LTS C;  1FC2 C;  2G3A A;  1X79 B;  3TGU G;  3ITK A;  2FYU G;  2IFN A;  5AVQ B;  1KFM A;  3HUS C;  2E75 B;  2H88 C;  2B89 A;  3W67 A;  2E74 C;  1GW4 A;  1KYO E;  1A02 J;  3HD7 D;  2XV5 A;  2W6A A;  2XND H;  1JNM A;  3CI9 A;  2E5T A;  2W83 C;  2QM7 A;  3L72 J;  2Z4E A;  1AVO A;  1NTK G;  1ZR4 A;  1NVO A;  1DX7 A;  1KYO H;  1FDM A;  1YJN P;  3TGU E;  2WSE J;  2E75 C;  1HVV A;  1YIT P;  2BEZ F;  4W7Y A;  2N9B A;  3I55 P;  2Q7C A;  2HLO A;  3H1L G;  1HJ0 A;  4C7N A;  2WSC J;  2RH0 A;  1M57 D;  1OVU A;  3IN6 A;  1IFP A;  4N78 E;  3CCS P;  3CLQ A;  1NTK E;  5KLV E;  1JUN A;  3O8Z A;  4CPG A;  4IFD K;  4A7P A;  2WZ7 A;  5M1B A;  2E76 D;  1S3J A;  3HTK A;  1UIX A;  2O1J A;  2YXQ B;  5E79 H;  2OTK E;  1NTZ G;  5APQ A;  1JY2 N;  1DIP A;  1Z56 A;  3H1L E;  1QLE D;  1ZRT E;  1J1D B;  5CBN A;  2JJL A;  1VQ7 P;  3M91 A;  3KZI E;  1W5C E;  2HPC B;  4BRY A;  1MZ9 A;  4BXL A;  1VL2 A;  2KLV A;  3EWK A;  2C0X A;  3L71 G;  1KMI Z;  2FYZ A;  2YMY A;  5L8R J;  1MUU A;  2I1K A;  3KZI H;  2AXT E;  3BCC G;  5BVZ A;  1N73 B;  1SQV J;  1T6A A;  1ZN5 A;  1J1D C;  3CME P;  2AXC A;  3TF5 A;  2V7Q H;  1YI2 P;  3B5N B;  5AVR B;  1J1E C;  4GDO A;  1Q2N A;  3V2Q A;  3L72 D;  1YTZ I;  1N2D C;  2AXT H;  3AE4 C;  5APU A;  2JWD A;  5AVW B;  1EDI A;  3L71 E;  4GKG A;  3RK3 D;  1WMK A;  4U7J A;  3Q5P A;  1BCC G;  3KQG A;  3BVH A;  1N73 C;  2W27 A;  1U7M A;  1KIL B;  3BCC E;  3V4Q A;  3P8C D;  1KOR A;  1FDI A;  1Q90 D;  2D2C D;  4UB6 E;  1FJK A;  3GHG A;  2NPS A;  3B5N C;  4JF7 A;  3TSI A;  1KQG B;  2V4H A;  3AE7 C;  3TGU J;  2GUS A;  4RKU J;  2FYU J;  3GF3 A;  4L76 A;  1YIJ P;  1T8Z A;  2K9J A;  4UB6 H;  1KQF B;  1BCC E;  1KIL C;  1SQX K;  2K88 A;  1NTM G;  1USD A;  3RBX A;  5AW1 B;  1KN7 A;  1RE4 C;  4PV1 B;  3HE5 A;  3IFM A;  3USS A;  5KJ7 A;  2R44 A;  2WSS H;  3JCU H;  1NTK J;  5KLV J;  3CC2 P;  1QX8 A;  3CCU P;  2KNC A;  1NWQ A;  3O6Q B;  3D71 A;  1KC8 Q;  4EI2 A;  1JMM A;  3M9Q A;  1FZC A;  2WQY C;  4JPZ B;  4I2L C;  1JY2 O;  3IF4 A;  3H32 A;  3H1L J;  2YIU B;  4BWN A;  1SQQ G;  4PV1 C;  5CCH D;  2Y0E A;  3PRJ A;  1SQV D;  3B4S A;  2OYI A;  1D7M A;  1JTH B;  5B5E E;  1GL2 A;  3T97 B;  1NJI Q;  2RN0 A;  1XTG B;  2V7Q J;  1YQ4 C;  4DZO A;  3L74 G;  2ZYA A;  2I8D A;  3NMD A;  5B5E H;  1RF0 A;  3KDP B;  2R5D A;  2YIU C;  4OGQ D;  1KYO D;  1NHL A;  1KYO I;  5APS A;  3N7N A;  1JEK A;  1SQQ E;  3H1H E;  3A2A A;  2AEF A;  3KHU A;  4WB4 A;  2QJP B;  1AA0 A;  5APW A;  1T3J A;  2GUV A;  1PGP A;  2M3B A;  1KV4 A;  3C1L A;  3MZW B;  3L71 J;  1HWT C;  4LLH A;  1PFI A;  3TGU D;  1FU1 A;  1HBW A;  1N7S D;  2FYU D;  1H89 A;  3KPE A;  2AEJ A;  3L74 E;  1KD1 Q;  1QVF O;  1M56 D;  5AW5 B;  3BCC J;  1H8A A;  1K73 Q;  2B87 A;  3HD7 B;  3OW2 O;  1XTC C;  2QJP C;  4WBA A;  1YJW P;  1NTK D;  5KLV D;  1JCC A;  1VQO P;  2A45 G;  1NKN A;  3V2P A;  2WT7 B;  1MKM A;  1SQB K;  1BCC J;  1G2C B;  2ZVO B;  1SFC C;  1L0N G;  2HOD A;  5AVX B;  3HD7 C;  3H1K E;  3PJS K;  4W7Z A;  1SQP G;  3SWF A;  3II6 A;  3L37 A;  3H1L D;  1NU1 G;  3L73 G;  1K04 A;  1M7L A;  2KSE A;  2O3J A;  5AVU B;  2IYP A;  3W68 A;  1RE3 C;  2E76 B;  1CZQ A;  3RL0 g;  1FAV A;  2C9L Y;  1FJP A;  2PP6 A;  1GU4 A;  3M0D C;  1L0N E;  1NTM J;  4EYY Q;  4UB8 H;  5AW2 B;  2W6J H;  4XFJ A;  3L70 G;  2SPZ A;  2A45 H;  1OIP A;  1T3U A;  1BE3 G;  1K9M Q;  1L4A D;  3IR9 A;  1YHQ P;  4W80 A;  1KB9 E;  2ZYD A;  3MHV A;  1VQM P;  2QJY C;  3L71 D;  3E1R A;  2NRG A;  3CC4 P;  4N3Y B;  3RL0 D;  2JEE A;  4U3F G;  3CMA P;  2M0B A;  1DH3 A;  1SQQ J;  2OTL P;  3BCC D;  2KS1 A;  3L70 E;  1S5L X;  1AQ5 A;  1BE3 E;  2YO3 A;  1Y8A A;  3VP9 A;  2K37 A;  1LT9 A;  2N1T A;  1SVF A;  1RE3 A;  1OW7 A;  1M1J B;  3KYQ A;  2Q5U A;  3RK3 B;  3L74 J;  1NTZ K;  3AE5 C;  1N7L A;  3CC7 P;  4ASV A;  3M0D A;  2HR3 A;  4U3F E;  1BCC D;  1EQ7 A;  2WPV B;  2IBZ G;  2D2C B;  2E43 A;  2IYO A;  1L0L G;  3UIA A;  4D6T E;  1VQN P;  1NKZ B;  1BDD A;  1QEX A;  2M5A B;  3RGU A;  1LTI C;  3WMM 0;  2OYH A;  1M1J C;  5AVY B;  3RK3 C;  3CL3 D;  4RJT A;  4Y28 J;  4EOT A;  3M0A A;  2C0W A;  4R4M A;  3I5C A;  3ZDM A;  2VRS A;  3L36 A;  1LP1 A;  2IBZ E;  1NTM D;  2MKV A;  2JP3 A;  3TNU A;  1L0L E;  5H2F E;  1MV8 A;  2R5B A;  5KLV G;  2IX7 C;  3FWN A;  3JSV C;  1LJ2 A;  3PP5 A;  4C46 A;  3TDK A;  4IL6 X;  2FXO A;  1CI6 B;  2Q9I A;  4OWF A;  4YPC A;  5H2F H;  3Q1M A;  2YNY A;  1L0N J;  4L74 A;  1URQ A;  1SQP J;  2W6B A;  2GM4 A;  2QVA A;  2O1K A;  5CCG A;  3R2P A;  1NU1 J;  1SQQ D;  2WWW A;  3EFF K;  1VQL P;  3L73 J;  1QVG O;  3VN0 A;  3S9O A;  1FZE A;  4LGD E;  1OMI A;  4RO0 A;  2K9Y A;  3HUS A;  3AED C;  4WY4 D;  2CK3 H;  3GHG B;  3MIW A;  3P7K A;  3PH0 A;  4I6M C;  2Q1K A;  1P84 E;  1H0T B;  3A7O A;  3QH9 A;  2KYV A;  2Z5I A;  3L74 D;  1RF1 B;  1ZXG A;  2KI7 B;  3AEB C;  1EXI A;  4OGQ B;  5GTI E;  1GD2 E;  5CCH C;  3P32 A;  2KZI A;  1KIL E;  1S1C X;  3L70 J;  1H88 A;  3A0H E;  1WT6 A;  2J58 A;  4WVZ A;  1BE3 J;  1NOH A;  1LWU B;  3H6P A;  1P84 H;  5AVT B;  5AW7 B;  3U1C A;  1IK7 A;  5GTI H;  1FDO A;  3PLN A;  1N7S B;  3CCM P;  3A0H H;  1RF1 C;  2ZT9 D;  4U3F J;  4AUW A;  2Q6Q A;  1Q86 Q;  4MN4 C;  1VQP P;  3D70 A;  1EDJ A;  3V2R A;  1PL5 A;  3M9H A;  2KLU A;  1LWU C;  2ZJS E;  3SWK A;  4XA4 A;  3NFQ A;  3CX5 E;  5AW6 B;  3U59 A;  1PZQ A;  1N7S C;  1EZV E;  3CCJ P;  1M90 Q;  3LW5 H;  3AEA C;  2A45 I;  3P8M C;  1R5S A;  2KXP B;  5CMZ A;  3CX5 H;  2FY8 A;  2QE7 H;  1L0N D;  2JKV A;  1W2B O;  1L0L J;  2H7H A;  3M9B A;  1SQP D;  2E74 D;  1L2P A;  1NO4 A;  2XU6 A;  1VF5 D;  1NU1 D;  3MUD C;  1KFN A;  4Y99 B;  5BU8 B;  3L73 D;  1T2K D;  2JDI H;  3Q5S A;  3EFG A;  2P2U A;  2Q3I A;  4NPF X;  3G6E P;  2DW3 A;  4H0L D;  5AW0 B;  3NXS A;  2HPC A;  2ZAE B;  2OQQ A;  1ZV8 A;  2OTJ P;  1YQ3 C;  3CCE P;  1L4A B;  3L70 D;  3V4W A;  2BCC E;  1FZA A;  1BE3 D;  1DD4 A;  4H13 D;  2WPQ A;  2ZFC A;  1Q82 Q;  1IC2 A;  4HKZ H;  2ZYG A;  5B66 E;  2ZXX A;  5APT A;  1N73 A;  1RY3 A;  4JYC A;  3RL0 B;  2B9B A;  1S9K D;  4IFF A;  4LC1 A;  4U3F D;  3H1H G;  3FGA D;  4DJG A;  4PJ0 E;  3B5N A;  3BRT B;  2IPP A;  1L4A C;  1KZU B;  1IFM A;  3V2N A;  1LTJ B;  3G4S P;  3VMY A;  1ZME C;  3F5H A;  3SFE C;  2NPS D;  1IZN B;  2K3R A;  1IFD A;  3Q3D A;  4ZMD A;  4K3A A;  1K05 A;  1KIL A;  4GT1 A;  3RL0 C;  2KSJ A;  1FZG A;  1JM0 A;  4NPD A;  2WTY A;  1LTA C;  5AVS B;  2Z5H A;  3LW5 J;  1W2E A;  1RE4 A;  5CBO A;  3HE4 B;  2IBZ D;  3JC2 2;  4WWI A;  4OVN F;  2IBZ I;  4ZKP A;  1L0L D;  2M8R A;  4TLF A;  1LTJ C;  3A5T A;  1USE A;  1GTW A;  3FWL A;  2W8Z A;  3SWY A;  2WPS A;  5KJ7 D;  3SFD C;  3H1K G;  3F89 A;  1VQK P;  5TJH A;  1SQV K;  3CCV P;  2FYN B;  1X22 A;  2P67 A;  1HH0 A;  2WIT A;  4HJG H;  2QEX P;  2IDB A;  4HH2 A;  1M8O B;  3MD0 A;  4L73 A;  4H44 D;  5KKZ B;  1SQX G;  4N78 D;  1E5W A;  2FXM A;  2FFD B;  2P58 A;  4PD4 E;  1GMJ A;  3O6Q A;  2P1J A;  4KJM A;  1GL2 D;  2N9Y B;  2FYN C;  1BDC A;  2OYO A;  1P84 D;  1JY3 P;  1P84 I;  1K8A Q;  4PD4 H;  1JTH A;  5KKZ C;  3R4Y A;  1ZRT D;  3T97 A;  1FS0 E;  2AEM A;  1SQX E;  3CCR P;  1OX3 A;  1YYC A;  2FYU K;  2FFD C;  1HJB A;  2WVR A;  3AE1 C;  3L72 E;  4WY4 B;  1BGY G;  1HF9 A;  2J5U A;  1WRG A;  1FZB A;  2WSF H;  3H1I G;  1IFI A;  3GW6 A;  2CPS A;  3WUV A;  3RK3 E;  1QL2 A;  3AE9 C;  2NZ2 A;  1S5L E;  3B71 A;  5AVZ B;  1NTK K;  2Y0D A;  5KLV K;  3G3Z A;  3CXH E;  2GA1 A;  5TIS E;  1RHZ B;  3TYY A;  2E76 C;  2QIW A;  2O01 H;  2PGD A;  3CX5 D;  1IK9 A;  3C9I A;  3CX5 I;  5BU5 A;  5K5G B;  1OW6 A;  1BGY E;  2M3E A;  3MP7 B;  1ZR2 A;  3N4X A;  1SFC A;  4AQR D;  1SP4 A;  2XNX A;  2XKM A;  3HD7 A;  1EZV I;  2ZT9 B;  3H1I E;  1KB9 H;  3CXH H;  5TIS H;  3M06 A;  4B86 A;  3H1H J;  1HGZ A;  1BSN A;  3G71 P;  4D6T G;  1QL1 A;  2RKL A;  2Y0C A;  3LIE A;  1X8Y A;  1OW8 A;  2UWJ E;  1KQL A;  1SS1 A;  4DCK A;  4R4L A;  3NTN A;  1G2C A;  4YTP C;  4C7N B;  3L75 G;  2KZJ A;  2LXC B;  3HRN A;  4I7Z B;  1HUC A;  2ZT9 C;  2WPR A;  3L35 A;  2QA4 P;  1NAY A;  3KXD A;  1GU5 A;  3WUT A;  3BRV B;  3HTK B;  1SQB G;  1G1J A;  2E74 B;  4IL6 E;  1SQV E;  1VF5 B;  1LTG C;  1GZL A;  2Y9Y A;  3FXE A;  4I7Z C;  1UII A;  2A06 G;  3VP8 A;  3L75 E;  1PPJ G;  2R3C A;  5CHX A;  4HB1 A;  3H1K J;  4BRY B;  4IL6 H;  2D2C C;  3I56 P;  2YXR B;  1U57 A;  2XDJ A;  1PGJ A;  4H0L B;  2H43 A;  1SQB E;  2WSF J;  1IFN A;  1SQX J;  1SFC D;  2YKP A;  2ZVN B;  1DD3 A;  1VF5 C;  3VOP A;  4IFM A;  1T2K C;  4H13 B;  1AJY A;  1A02 F;  3U1A A;  2A06 E;  2O01 N;  1PPJ E;  1NAF A;  2O01 J;  1NGM B;  2L91 A;  3QWO C;  2FYU E;  4O9B A;  3Q2Y A;  2N1T D;  4H0L C;  2R3S A;  2Y9Z A;  3A0B E;  1J2J B;  5AW8 B;  4AYC A;  2G8Y A;  3H1H D;  3S4R A;  4NPE A;  3IAO A;  3H1J G;  4JBZ A;  1MFT A;  4H13 C;  3VMZ A;  1ZOY C;  1M1J A;  5E79 E;  2JWA A;  2CPB A;  3A0B H;  3VYI A;  1BGY J;  2NPS B;  1FZF A;  1JOC A;  1KTM A;  1NTM K;  2PAJ A;  3H1I J;  1NYH A;  3MTU E;  2E5Y A;  4HYT B;  4N6J A;  1VQ8 P;  2K9J B;  4OH8 B;  1VQ9 P;  2M5A A;  2H89 C;  3H1J E;  4YXW H;  5C39 A;  3GHG C;  1JO5 A;  1EZV G;  2L5G B;  2NPS C;  3AEF C;  3HE5 B;  4PD4 D;  1AVY A;  4PD4 I;  5KLI B;  1J1E B;  4OGQ C;  2RMZ A;  1EC5 A;  4DT0 A;  2KNC B;  3LID A;  1VQ5 P;  1SQQ K;  3H1K D;  2HG5 D;  1MFZ A;  5AVV B;  3SSU A;  1PIX A;  4C7R A;  4D6T J;  4K35 A;  1EDK A;  3RK2 D;  4H44 B;  1DEB A;  1NTZ E;  2KUB A;  1FZC B;  1URQ D;  1SQX D;  3H32 B;  1CI6 A;  3H25 A; 
#chains in the Genus database with same CATH homology
 1NTZ J;  3L74 J;  1NTM J;  3H1H J;  1NU1 J;  1BCC J;  3TGU J;  3L71 J;  3CWB J;  3L75 J;  3L73 J;  2FYU J;  3H1I J;  3L72 J;  1PP9 J;  3CX5 I;  4D6T J;  2BCC J;  1KYO I;  1L0N J;  3H1J J;  3H1K J;  1NTK J;  5KLV J;  3L70 J;  1SQX J;  1KB9 I;  3CXH I;  4PD4 I;  1SQP J;  1P84 I;  1EZV I;  3H1L J;  1SQV J;  3BCC J;  4U3F J;  1BE3 J;  1L0L J;  2IBZ I;  1BGY J;  1SQQ J;  1SQB J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...