4RESB

Crystal structure of the na,k-atpase e2p-bufalin complex with bound potassium
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
288
structure length
288
Chain Sequence
IWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRFRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Structures and characterization of digoxin- and bufalin-bound Na+,K+-ATPase compared with the ouabain-bound complex.
pubmed doi rcsb
molecule tags Membrane protein, hydrolase/inhibitor
total genus 50
structure length 288
sequence length 288
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4resB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 4resB02
2Q5UA 4HYTB 3M9BA 5AW6B 3A7OA 2WTYA 1T2KD 3LIDA 4AYCA 1DH3A 3A3YB 1GD2E 3P8MC 2Z5IA 5AVQB 3L35A 2C9LY 5AW0B 4AUWA 2WWWA 1FAVA 3TNUA 1S9KE 5AW7B 1HBWA 1SP4A 3P32A 2P7JA 1OWAA 1GTWA 4JYBA 3NMDA 5APYA 5AVRB 4I6MC 2XU6A 2VRSA 2WPQA 1SLQA 5APXA 3UIAA 5APVA 2W27A 3HE5A 2XZRA 3KQGA 1MFZA 3P7KA 4JYCA 2JJLA 1IO4A 2ZFCA 3A2AA 3MGNA 2P2UA 2QM8A 3TNUB 1OXZA 3TK1A 3VTPC 2Q3IA 1FOSE 5AW2B 3WGUB 2KP8A 2YO2A 5AW1B 5AW8B 3T97A 1HWTC 4I2LC 1G2CB 2W6AA 5AW4B 3I5CA 1GK4A 2WT7A 5CMZA 1GU5A 3L36A 2P67A 4KHXA 4RETB 2R5DA 2R32A 3NTNA 3M91A 4C7NB 4EOTA 2Z5HA 1CZQA 3VN0A 1H89A 2WPRA 2N9BA 1NWQA 2R5BA 2YO3A 1CI6A 4RESB 5AW9B 3VMZA 3M0DA 3M06A 5AVTB 2WT7B 1H8AA 1CSBA 5AVVB 2H7HA 3O8ZA 2QM7A 1A02F 3HE4A 2C9NY 3L37A 3KDPB 1HUCA 3V4QA 3VMYA 1GK6A 1H88A 4GKGA 1JNMA 2E42A 4AQRD 5AVSB 3HE5B 3M9HA 1CI6B 3V5BA 5AVXB 3V4WA 2WPSA 2YNYA 1FOSF 1KQLA 3SWFA 3B8EB 5AVZB 3NFQA 3LIEA 5AVYB 4DZOA 1T2KC 3HE4B 3TYYA 2IPPA 5AW3B 1X8YA 1MUUA 3VMXA 5APQA 5APTA 4B86A 2XV5A 1HJBA 1GZLA 2E43A 1YYCA 3WGVB 2R3CA 1NAFA 5AVUB 1J2JB 2BASA 4C46A 5APSA 5APWA 5AVWB 5APUA 3HTKA 1MV8A 1JUNA 5AW5B 3M0AA 2ZXEB 3OAKA 4GT1A 4LC1A 3VYIA 1S9KD 1A02J 2Q7CA 4XE5B 3IR9A 3A5TA 3MD0A 4M3LA 1GU4A 3NXSA 4C7NA
chains in the Genus database with same CATH superfamily
3KW7A 4WUUE 3V0IA 4MCYA 3D4ZA 1SFHA 4U1LA 5MEND 1IT9H 1WTGT 5DJYA 1DCEA 2HG5B 3QEQD 4KRLB 3I3BA 4A63A 4N5EC 4D3CH 4RA0C 1MFMA 3VUAA 1LMKA 5AW0B 4AUWA 4F37F 2J57A 1ECYA 4S0HA 1YYLH 4OBRA 1X5IA 1OWAA 5BZWA 4ANXA 3S88H 4Z8FL 2WMPA 4BUHA 4A7UA 1ZMYA 2JNZA 4XPHL 3GMMA 4QRPD 4KQ3L 3BZ5A 4U6XA 3STZB 3UIAA 2ATPB 5HHOA 4G6KL 2BX5A 4NKMA 3L1OL 3FTZA 4HUNB 4JQIA 2AV7A 4LESA 3LRHA 2KDYA 3KPOB 5FYKE 1Z1WA 2J8UE 3BCCE 5ACLA 2XSKA 3OJMB 4QHMA 4XPBL 2ADGB 4GYBA 2DQGH 4R2GD 3ARGB 2Z4EA 4MHHG 4N2FA 4ODWB 3ZU8A 4JY5H 3ATAA 3DBSA 3P40A 4ODXB 3B5NC 4HC1L 4U33A 4L8BA 3PWPD 1Z3GH 4YLCA 2LABA 3PWVB 4G7VH 3CCHB 1U91B 5DRXB 1ET8A 4E5XA 1KIPB 4UM9B 1EXIA 2A74C 3DETD 2KZ1B 2HODA 2WW8A 1AGDB 4OCRH 3U1SH 3AXLA 3CQFA 1ZA6B 4I85A 1E8XA 1CD0A 4NQCA 1UC6A 5HP5A 1YN7A 2FYNB 3P0VL 4YHNA 1GTNA 5E6IB 1M1JB 1JSYA 2XKMA 1M05B 2J55A 3DX8A 4NC1C 4ONFH 4DOHE 5L2JA 5AVSB 1FLRH 4LEBA 2WUCH 1A7QL 2C8NA 3C8VA 1WZMA 2OYIC 1ICTA 1TJHH 1N6QH 2GSGB 4FQIH 1U3NA 4L3EB 2IJ0C 2OTWB 4M7ZB 1IKNA 4PJDA 4KV5E 3AY4C 4OFVA 1BZDA 1V7ML 2X6BA 5EEXA 1XFPA 3OR7A 1C5BL 2KZIA 4QHPA 1XCWA 1HGZA 1PL3A 4JO3L 4O5LH 3SO3C 4TQ8A 3FFCA 3BIAX 2EH8L 4KPHL 2H1PH 1UQSA 2E6JA 3HPLB 1C5DA 1K9TA 2QVMA 4FQXD 4PVMA 4E42A 5ILTH 5E03A 3AEGC 3QR0A 2EECA 3MRPB 1PSKL 2E8YA 1JEKA 3L5JA 1NUGA 4HXAH 4H40A 5BXFB 1URQC 2CLRB 3NSXA 2Q7CA 2X4PA 3KGUA 3SKNB 2G2NA 1CDIA 3LQAL 1CE6B 1KXHA 3SCMA 4BCZA 1MIML 1Q0XL 1NA8A 3PY9A 5GTIE 1LQBC 4ZAKB 3LZNA 1TEGA 3NEOA 4MQXD 5KVMC 1O7VA 1K6QL 1FFQA 4IFDK 4G9FD 5JOPE 1U8QA 5ICYA 1A65A 2JO1A 3MRBB 1FG2A 3KXDA 5F2FA 1UXWA 1GKOA 4M62H 5J1AB 3L72J 3SDDC 3SBWC 5FOJA 1LWHA 3UZEA 2UX6A 4NKIL 2ENQA 1KELL 5K33A 1YEGL 3OKDB 2N1TE 2C1PB 1NUFA 2L7EA 1EDHA 2V9QA 4F24A 2H0PA 5AZEL 2BO0A 3B2DC 3KYMB 4YHOL 3ZT7A 4RX4A 3SDCA 4WW2C 1VERA 4L8CA 2CPSA 2HLFC 2NY7L 5B66E 1G0DA 3EBIA 4KKCC 4NQXB 4PSPA 5CZXC 3TO4C 2G5RA 4PLJD 4P46B 2N0MA 1XEDA 4NQDB 5BVZA 1ORSB 5D6CA 1DN2A 3CSYA 3IPFA 5MP6L 2F58L 2OQJA 5IB2A 1UYWH 4DEWA 4J12A 5IQ7H 2M8XA 4WVZA 5TQ0L 4UOW1 1IFHH 3RYMA 3LKRB 1TJMA 1T04B 1LYQA 3LEXA 3P8CE 3SHSA 4CW1B 2ALAA 1QLFB 2Y2TA 2Z8SA 2ZTBA 3VXNB 2E6QA 5FGCB 3TZVA 4CKVX 1U4EA 3HUSC 2OMBA 4WEUD 2QLVB 3HE7B 4OSUH 4OZHE 2VTFA 4BA0A 2ZOUA 1ZN5A 3HMXH 4HH9B 5CJ5A 4YXLH 1LO4L 1SQXG 1N64H 1ZR2A 3O8XA 4NZUH 3ECBA 5ICXB 1G4MA 4JHAL 3TVMC 3D18A 4C4UA 4Q9RL 2OKMA 2WGNB 3MRNB 3NRPA 4C56E 2R44A 1MCOH 5ENWA 1Y1DA 1XDTT 3OQ3B 3HG3A 4Y2DD 4FQ1H 3STBA 4YHLH 1ZIBA 4HFWB 1XTGB 3EFFA 5F8QC 5IB1A 3EGSA 3PGDB 2DYRB 5A2JH 3B8EB 2Z0BA 1TFHA 3OMIB 1R0AL 4FQ2H 3C1LA 4N2CA 5C7XL 4LLHA 3KPNB 5DZJA 1YITP 5DJ8B 3EJTA 1N26A 4RCAA 1DJYA 4H0LD 4N6JA 4UU9A 4D6TJ 4R5XA 2VLME 1JK8A 4PJIA 4AWJC 3AXHA 3VI4F 3RX7A 5CEZE 1X44A 1N5AA 4LSSH 5JXAH 2DM2A 2E5YA 3EO1B 3LPWA 4QRQA 1ZT4A 4WRLA 3U48A 3SFEC 3QC6X 4PW9A 4XVUC 5K9OB 3EO9H 1DDHB 5H2BB 3TSIA 1BVLB 5LDSA 5EWIH 5CJBA 4BIKA 4LF3B 1E8YA 1HX0A 2WYTA 3TYFB 4CDHA 5FOBB 4QXVA 5F7MC 2F54A 2OJEA 2DYSB 3LNIA 3BEWB 4HGWA 3AUVA 1A6ZA 3ZDYB 3HC3H 1AKJB 2XFXA 3QCTH 4TUOB 3IDYB 4MMZB 3CFEB 1USQA 3V2NA 3LRSA 2ICEA 3IDUA 3P4LA 4BXLA 5FUCC 2GKIA 1D6EB 5F96H 5I6KA 1Z5LB 1DQKA 2XIDA 3CFKA 3HS0C 5AKRA 4GUPB 4NKQB 4MCNA 4LHJB 5IJKA 3D51A 1ZXKA 1U92A 2PCPB 4FXGA 3WXVH 2A83B 1TVBA 3CX5K 1F1GA 4DZBA 5A6LA 4WO4B 1ZSHA 3IGAA 3CXHE 2EIJB 4EN3A 1DQTA 1KC5L 5B1JC 3O2VH 1BLIA 4YXHL 1KYOD 3FRPB 2ZXAA 3CV5A 5GISL 4P5TC 3RBSA 3VYNA 1AD9B 5DHMC 4EDWH 3QFJE 3CMAP 3ESVF 5CR8A 1DSFH 1KJ2B 1YNTB 1YVLA 2VDKL 3B9KD 3D05A 3L5WA 4I0PB 4R0LC 4Q74A 4EOWH 2WQYC 3BZ4A 3EF4A 2IADB 3E1F1 3AREC 4OZFG 1M71B 4JPKL 2I9TB 1BLNB 1VGKA 2J1KA 4KVNL 3UCRA 3DX6A 1D5RA 2YRBA 4D2NA 1L0LG 4QOKA 4IBTA 4RKUJ 5BJTB 2VH5L 1ET7A 3VH8G 3KWUA 3RWGA 5TDPA 1B0RA 4U0RC 1JDCA 2EXWD 4LEXH 5HDOA 2ZCKL 3KCPA 4W9FC 2NX5A 2WXIA 2JQAA 2QVKA 2WSSH 2EDLA 3M0DA 5C0JA 1A6WH 4B7LA 4PLKD 4G80A 4XMLL 3CDCA 4OVUA 3S34L 3KVQA 2IOOA 2Q3XA 4MA8H 5G4OA 2BVQB 1EO5A 3FU7A 4JM0A 1KN7A 3K2KA 1OCOB 4M5YH 2XN9D 1QUNB 1ZA3A 3ILPA 5MI0C 4BQCA 2BC4A 3AEBC 1JM0A 2GJ6E 1EZVD 2IC2A 3ARTA 3NIFE 1LNUA 3WKPA 5DJCA 5E8PA 4KO6A 3IDXL 4Y4FD 1ONQB 1OGTA 4N78E 2FIKB 4OU3A 3V6ZB 5C09A 3RFRA 5E95B 1DD3A 4NZTH 1NGQH 3SDXE 4DFIA 4PB0L 1TOXA 5ADPL 3N06B 5T1KD 2AEJA 2ESVB 1Y18A 4HWBA 5BRQA 2E7CA 2I9LB 4K5MA 2YAPA 5BRZB 1SQXE 1DFBH 1NCBL 4WFGD 1CDBA 5E51A 1YG9A 4PD4D 2ADJB 4P5RA 4W4NA 3VXRD 4Y89A 4DGVH 2O5YL 5KYWB 3KW8A 2E76C 3G6JF 4P2RD 2HG5A 3KM2A 1SQBD 5A2LH 5C07E 2YEQA 3LZFH 4BUGA 2WUBL 3WSQH 4WI2A 4Z7IA 4NQQA 4LSRH 3JUZA 1QRNE 3E80A 3Q01A 2FEEL 3MKGA 4EI5C 3CN0A 3L3DA 4O00A 4AYFB 2QT6A 2W38A 1JGVL 1PFCA 3MODL 3STZA 3VVWA 1Z56A 1QFWM 3A3YB 4G7QB 2LU5A 5JPMA 4HVBA 4TULL 1AC6A 4NOBA 3WEAA 1JZ4A 4R26H 2CK0L 3KPOA 4AMKL 4U6YB 4BZ1L 1W8NA 2CCLA 1GTWA 2YLKA 1RUAL 2GPZA 1PYWB 1NSNL 4NO5B 4Z18A 1CT8B 3TWCL 4KJPC 4JJ5B 1NICA 1EFXB 4IKNA 4KMTL 2ADGA 1Q90A 5EZLB 4TRPH 3UCQA 3WEOA 3ARGA 4WHYG 1Q9WB 4F8LA 4BQBA 2FX9H 2EDKA 4IBLT 1CI3M 3W81A 1ZW0A 1EA9C 4ODXA 5DU7A 3V52L 4JO4H 3V6OE 3QCVL 4BQ8A 2YK1L 5AWNL 3T1WA 3BASA 1V27A 2Q6WB 2VNCA 43C9B 3PWVA 1GL2B 5GPRA 3CCHA 1U91A 5IOPB 1KIPA 3IRPX 1WWCA 1M9WA 2CA4A 3FQ1A 4IBQA 4P59L 4UM9A 1AGDA 1M1SA 2FD6L 1UT1A 2E86A 2VM4A 5MEPB 1EERB 3AACA 1H19A 2H26B 4PEEA 2R2CA 4H13D 2Z9TA 3MUHL 5E6IA 1M1JA 3RA7L 3UBXI 1M05A 1AR1B 3K6NA 4Z7QF 2EH7L 4CUCA 3JWOC 1WAPA 2E3VA 4KGLA 2MTAA 2BSSB 2WPVB 1XCXA 3CPLB 2HT2D 4AV4A 1P4IH 4YGVB 1JZJA 4LLDB 3WV0A 3U2JA 1NO4A 2GSGA 3R2PA 4L3EA 1U8IB 2OTWA 2A77L 3EAKA 3MRLB 5FM5M 3QIWD 4KI1A 3RNKB 1JZFA 3KVDD 5CBNA 3AQDA 2XTJD 3B9VA 3PXJA 3KEHA 1A5FL 4UB0L 4WI7A 1L0LE 3P2TA 1ED3B 1OAXH 3AE2C 1LT9B 4HH8A 2HCZX 4JO5A 3HPLA 1A7PH 2H47C 2ZF9A 3KE0A 3HE6C 1MRCL 3MRPA 2QJYB 4NO3B 4DEUA 5FM4A 3BT2L 2P5WE 3PL6B 5TTRA 3VRLF 5BXFA 1OIPA 5HY9B 2IGTA 4B86A 1XR9B 2XWRA 4W9ZA 2CLRA 1DN0B 3NCMA 4FTVB 4TVPL 3MRQB 5LNGA 2W9EL 2WO2B 3SKNA 5GHWL 4NPDA 4HEMA 3H9ZA 1CE6A 4HJUA 3ZKND 4HJTA 2BSCA 4O02L 4P23C 4ECNA 4ZAKA 1L9TA 4AH2B 1EUUA 3MHVA 4M1CC 1ASPA 3GSUB 2R29H 3RPIB 5LBVA 3H9SE 4JRXB 3C2AL 3M0AA 3MRBA 1PX8A 1NIDA 3ZTDC 1QO3A 2EEFA 3CZSA 2WOYA 3WY4A 5GS0C 1MI5E 4DPBX 5HPOA 4RA3A 5J1AA 2IALB 2VXSH 4NM4H 2H2SC 2VDRH 3NP3A 2UUDK 4K5NA 2EUZA 4C7NA 4PRDB 3H6AA 2BS8A 3OKDA 3A22A 4GKOA 2C1PA 5CCGE 3ZRSA 3PNRB 3HC4H 3Q3DA 4B41A 3O6FB 5A2FA 1MW1A 2EDXA 4GQQA 1ND0B 2WJ7A 3KYMA 4FG2A 4CRPA 3OHXC 4Y16D 5CS7A 1LDPH 3MLWH 1DVFD 2JKXA 3Q8AA 3KWXA 4H26A 1B2WH 4M5ZL 4Q6IC 4YEEA 4YX2L 4ZNEA 4NQXA 2V2WB 1F8TH 1DO6A 3L95B 3T9WA 1JTOA 2C9PA 3DA0A 4P46A 4BCXA 4IKLA 1IQWL 1ORSA 4NQDA 4NI6A 4Y9GA 3B7RL 1EHXA 2UZIH 4U49A 3KLHD 2KQNA 4JQVC 4K71C 1GPOL 1FGVH 2OCCB 2BEZF 1EZVI 2Z93B 4DAGH 3CBJB 3R18A 1T04A 2XQBL 4OUUB 5IR1B 1OXZA 1UWFA 2CKBB 4MAYC 4N68A 4C8XA 4CW1A 4WUUB 1HEZB 4RDBA 3UTTE 1VESA 2W83C 5LXVA 5SX4I 1NTZK 4HH9A 5DD0L 2OXGB 3IT8D 5ICXA 4RMUA 4GEJA 4OVNF 1MJJB 3MRNA 5H37A 2FT6A 1FRGH 3MOQA 2OARA 1OE1A 2OJZL 3HNVH 2M3EA 1DE4B 1JUFB 3QPQC 1F4XH 5EOQL 1WBYB 1I9JH 1PDKB 4LLQB 3PH0A 3PGDA 4ZKPA 2Y2WA 2YN5A 1UXMA 3OD3A 1SQVG 2OI9B 1GGTA 2X40A 5B7EA 2BFVH 3KPNA 2VLJE 3AW5A 2BJML 1PIFA 2J8UB 3W37A 5HHQB 3A6CL 1IM9A 3PWLB 3O9WC 3LS5L 5FGBA 1SHSA 4MZIA 2ZUXA 1ZVHA 4I1RA 3EO1A 5IQ9A 2YOAA 3ALXA 1WWAX 1MRFH 5BRPA 5K9OA 2FXOA 1DDHA 2NY1C 5H2BA 4IOSD 2K6WA 2Z8RA 4LF3A 4BM7A 5FOBA 1AE6L 4HLZH 3VGAC 4ABUA 3AMKA 1I7RB 5DDHB 2R3CA 2X9ZA 2BXYA 2YPVH 1JV5B 2A3TA 3QWOC 1FO0B 4MMZA 3MNZB 3CFEA 4R90L 4TUOA 1X7TA 3RZCC 2HFGL 4PV1C 5TQ2L 2TAAA 1AS7A 3N5AA 1H8NA 3EHBB 1FFNB 2EIBA 1Z5LA 5I19H 4KKLD 3K80A 4M03A 4ONGH 4KNQA 2AP2A 4KDVA 4GUPA 4DOHB 3U0WH 3HD7B 4OJFL 3QXAB 1WITA 3AE8C 1J0ZA 4I9WE 4P2OD 2A83A 1MCEA 4JM2C 3WMPA 1G5GA 1PG7X 4WU5B 1X9VA 2QGDA 4FI6A 1XO8A 4UOW0 2ZX9A 3LIUA 2AAVA 4FXKC 3GI9L 1G9NL 1BD2E 3FRPA 2MCMA 1AD9A 4UT7H 4AEIL 1EGJH 1HHJA 2KLTA 4RAUA 3P8MC 1KJ2A 1OQXA 1YNTA 3N85H 3ZMNA 5T3XE 3VRJB 2IADA 4Q9CA 3L4WA 1KLFB 4UTBH 1M71A 2I9TA 1BLNA 5T8IA 7FABL 2YQGA 1EO8L 1UWGH 5FFLA 2G2PA 4LNVA 4HHGA 3PRJA 1HCYA 3L72D 1ROWA 2F5AH 3OKYA 4G8IA 2QMJA 3CC7P 4YSSA 5IWLA 4Y0GA 4A2HA 4C58B 4OLWH 5BJTA 1SY6A 3MCG1 1JXGA 4HB1A 2VZTA 3OPZL 2DLHA 4O9BA 4HJ0D 2GFBB 4PP1D 4Y1AE 4P48A 2O61B 2AEOA 5EC1B 1PIXA 3CZKA 1OCCB 2J25A 3UTQB 1BE3G 4PGDB 4NENB 2AK4E 2GA1A 4WWIA 1OSPL 1FFTB 4HSCX 5LCVL 2A4CA 3B1TA 2BVQA 2G4EA 3QUXD 2IPUK 1HJBC 1CFTB 1I82A 3VI4E 2AMUA 1RURH 4DKEL 3E0GA 1QUNA 4WBAA 1VFBB 2AZUA 2WIMA 3G7TA 5CUSL 2N1TB 2DH3A 4XNUL 5LAXB 2WMMA 3RTQC 5CKAA 1MHHB 1ONQA 1WO2A 2YA1A 5DMGD 3REWB 1N7ML 3VU2A 2FIKA 1Z9MA 3V6ZA 4Y9BA 1FAIH 5GGRB 1WK0A 4CSTA 5HYEA 1KXVC 5J4MA 1P69B 2VMJA 1J05B 2I7OA 5IOKA 2HFFB 1A9EB 2I9LA 5C6TL 4KTGA 3GHGC 5KJRL 2JJSA 1SBSL 2G4GA 3N43F 3LZRA 1M57D 3KR3L 5K9QI 2CWRA 2Z92B 2DBLH 1P9MA 2WWOA 3X13B 1SVBA 5I1AB 5KYWA 2C7UB 2V7NB 1W2BO 1H6FA 2CGYA 5D7LE 2Q8BH 4I88A 2YFNA 4N0YL 1M7DB 2C1OB 1BFSA 4OZHB 1Z3RA 1EXGA 4WFHD 3TO2B 5HDRA 2PO6D 4WLCA 3TPUB 2YXQB 1WICA 4YVUA 1IBBA 1SQVE 4D6TD 1QBLH 4AYFA 4HOWA 1SPDA 3WFBH 4C56B 1I1CA 3HHSB 5GGTA 1RAMA 4RMSA 1MDAA 1MCIA 2KT6A 3L1EA 3HHMA 2VB5A 2WBJC 2R0KL 2KZWA 4OCLC 3ESOA 1Y6NR 1L5GA 2VN4A 4UT6A 2I32A 4MXQC 1A1OB 4QWWD 1E4HA 2HLAB 1MCHA 4ZX4A 2DYPD 2Q9IA 3EGDB 1CGTA 1DQDL 4U6YA 4K23H 3SN6N 2PWHA 2VXTL 3M07A 1PYWA 5FYKH 1AFVL 3ULAB 4NO5A 3QDME 5FYLD 1CT8A 4HOXA 3WU2H 3Q5SA 3GJFK 4JJ5A 1EFXA 2V9TA 5EZLA 5GRWA 3VOPA 1Q9WA 3AS2A 4UAOC 5LBSL 3CHQA 4NHCL 4AOFA 4BKLB 3KM1A 3WIHA 2A6IB 4M02A 4B9ZA 5FCUH 4DN3L 3I2CH 1PD1A 4YSDA 4BH7B 2FEJA 4OQTA 2Q6WA 4Y2NA 4CSPA 43C9A 5I1IL 1NAMB 1GL2A 5BOZG 3CCUP 3FMGH 4HZAA 5IOPA 4M1DL 4S1RH 1DQQB 1A3QA 1YEEH 2K9FB 2JEEA 2SEBB 3HOGA 3WMSA 5JW4Q 5MEPA 5INDB 2H26A 4PS8A 2YPVA 4GO9A 2FH8A 1HOCB 3UDWC 2QM8A 4RWYL 3WO4C 5KJ7D 4A7PA 3KVPA 3OF6A 3OKMB 1CXHA 3ZZLA 2BSSA 1FNSL 4XN9A 3CPLA 4NWTL 4WHTB 1VL2A 1ESOA 1UWXH 3D07A 3NVQA 4LLDA 3AITA 4A39A 1J7VR 1DVQA 3BN9C 3SPVA 3GMAA 1I31A 4ICXA 3CHSA 3ARBD 2JELL 1U8IA 1A14H 3I9AA 3MRLA 4PRID 2HMIC 3FH5A 5D5MF 2AQTA 1QYGH 1TQVA 5I1JL 3P9LB 1OTTD 1E2WA 5IGXH 5K93A 3GKZA 1ED3A 1OO2A 1RMFL 3D3VD 4D94A 3LEVL 4BK5A 5ADOH 3G6JE 1EAPB 1JOIA 1LT9A 3QFJB 2COQA 5A43C 1YEFH 2BW4A 4QJ4B 3MZGB 1A3ZA 4UTBA 3IKCB 2E75D 2YAEA 5HY9A 3PL6A 4LIQL 4N9GB 3RZWA 1XR9A 1AQDB 1DN0A 1ROCA 1BE3E 5TISH 2APBA 3MRQA 3JT0A 3D39D 5DHVB 3T6QC 2CXKA 1AANA 3J07A 3QEHB 3CDYA 5TH2B 1IFPA 5DFAA 1AZUA 3D09A 2OP4H 3GSUA 3RPIA 4JRXA 2VXUL 1J11A 4L5FL 4TLTA 4D0BB 1SF3A 1A21A 3TF7C 2IALA 5BW7C 2P8MB 1NAFA 3QUZC 4PRDA 2X44D 2DOCA 4GH7B 4PBVC 4HKJA 3VFOB 1U8OB 4JLRB 4EIJA 1DUYA 3O6FA 4XVJL 3D85B 1ND0A 2R0LL 3GSRB 3OM3B 4FFYA 4JRLA 2GJ6B 3CFIC 2XQYK 3CLFL 4TKWA 5EIVA 3U0PB 1RULH 3UC0H 4LQFL 3NIFB 4XH2B 4P5KB 4D0DB 2V2WA 1X5FA 1Z9NA 3L95A 1BCCJ 5B66H 1E4WL 3EH3B 4R97C 2B7DT 4XXCA 1LWUB 1F3JB 3SDXB 2AQ2A 1KY6A 3BLBA 3HZ3A 4U1NA 4HAGA 4XN7A 4CJ0A 2WQSA 1CE1L 3MNVB 1A6AB 2Y22A 3IF1A 2BY0A 3B8SA 5DQ9B 2FJGB 4Z7QE 2Z93A 5HHVL 2ZXDA 4FNLH 3D8MA 1FDLH 1OT4A 3QDJD 4OUUA 5TK4A 1EXUB 5IR1A 2CKBA 1MWAL 2KQMA 2Y07L 1D9KA 4WUUA 5E4AA 3W67A 4MJID 4PTTB 2V9RA 4LVEA 2MQCA 4RGOL 3PS6A 1SQQE 5IMOA 2A9AA 3K8MA 5C07B 4K7PX 3IVKB 3UROR 2P47B 2Y3AA 4G42A 3H56A 5D1XC 5FO9B 1HHKB 1SLVA 5JMRA 2YAOA 1OF2B 1QRNB 3FC8A 2H1LM 1NTZG 1DE4A 1JUFA 3HNSL 4B3VA 5KLVK 3CCEP 1WBYA 1E5WA 1VQ8P 4LLQA 1E43A 1MREL 5CMZA 2JCWA 2OZ4L 4LKCB 3CK0H 4TL5A 5J13C 2EE6A 4X7DC 3S9OA 1X5MA 3PWNB 3VRLE 1J1EC 2DL2A 3QJFB 2ZUWA 3T8MA 5E56A 2QV4A 2J8UA 2DAVA 3N1MC 4UQIM 3D70A 3DDGA 2OL3L 5HHQA 4HWZB 1H3PH 1FVDB 3P11L 1VF5D 4YQXL 2FCBA 2R5BA 1OF0A 2VT0A 5I82A 4ZX5A 2NOYA 3U4EB 1B6DA 1E5UI 5KBMA 1NCIA 5CEZH 2D03H 2EVIA 1VEMA 4ZXBD 1KEMH 5HI4D 4RH4A 1NAMH 2WZ7A 4U6VH 5SWQB 2W6JH 3HW7A 4H2CA 4BCYA 1BVNP 4ZW5A 2R7EB 2XACC 4G82A 5FW8A 4WY4B 4XB3A 4XNMB 4PV8B 3V2PA 1I7RA 2CCWA 5DDHA 1EJOH 3FO0L 2XI9A 4QRFA 1JV5A 5DJXB 1FO0A 1GSMA 3MNZA 5GZNC 2NY6C 1EVUA 5BO1L 5KYNA 5DS8B 1ZLUK 1CC3A 1FFNA 1CBVL 4CAGA 2FXPA 3V55A 2ZOTA 3HD7A 1T6VN 4F9PC 3QXAA 5KAFH 3N55A 2CBOA 5I18H 5J89A 2D7MA 3PF2A 3FTWA 1DJGA 4WU5A 3HG0A 3HFML 4XCFL 4XRCB 4CSZA 1GH7A 4X7SL 1WT5C 5L4FA 3QYNA 1EFQA 2XNAB 3T4AC 4OZFB 2NSQA 3AAZB 5A6IA 5E8OB 2L5GB 2BNQE 1YIJP 3BKMH 4JFDE 4HG4K 4DPRA 4IRZA 3FQXB 5GJSL 4YSAA 4O9HH 1KLFA 1QI5A 1KJMB 2PW1B 3C6LC 3NJKA 4URKA 3VFVB 5H35B 1J5DA 4LLVB 3CX2A 2B8OT 2R9HD 2P5WB 5DHVH 2V5RA 4WZ9A 2WLZA 4PJXF 2FZ3B 4X7CC 1QR4A 4KJYB 2WM0A 1BBJB 5F9OL 1IV8A 4QR7A 3NCWA 3MOBH 2GFBA 1OAKL 1UKQA 3NSDA 2O61A 3TIDB 5EC1A 5L9DH 4BRYB 3UTQA 2MJWA 3CU7A 2OYLA 1QW9A 1Y7VA 3KGTA 4NENA 4PGDA 3H9SB 3W1ZA 1IC5H 2YC1B 4Z3JA 5BVPL 3BKJL 2NXZD 2VOTA 1MI5B 3OB0H 2CDFB 2E0PA 1CFTA 5DWUL 2FBJH 3DOSB 4LMQI 3GK8H 2YAMA 1OSEA 4D7PA 1LQSR 1MJUH 1VFBA 3IMRA 2AJSL 5B38B 1VHPA 2YO2A 9CGTA 2N1TA 2A9MH 5GRUL 4L4TA 5LAXA 3CXFA 3E2HB 4ZFOB 1MHHA 1VPOH 3REWA 2CNZA 4Q4IA 1MKMA 1I8UA 2IPUG 1OWRM 3FCBA 4L23A 5GGRA 3VGDA 4GRWH 1DL7H 4JMXA 3S3PA 4N5ED 3WIIH 4FJYA 1N8ZA 4DK6A 4KGJA 4X4YB 2R27A 2KDGA 3L5HA 2P8LB 4W80A 4ZUVB 5CINL 1BM3L 1A9EA 2FK9A 2HFFA 4QY8B 3X3GL 1QZ1A 4NP4L 4JM4H 2O1JA 1JK9A 2IFFH 1EBAA 1W72L 4TSCH 1X0TA 3WUTA 2Z92A 4L3FA 3CAFA 3U79A 4FHBD 5I1AA 5KSAC 4G8EB 1CL7I 2C7UA 2V7NA 3BVHA 2I24N 3GPEA 4HP5A 1D6VH 3L5IA 3OA7A 2DH2A 4PUBH 4EF3A 4F8NA 5HYFA 1H88A 2X1PA 4RBPH 3UTTB 1N8RQ 2C1OA 4OZHA 3TO2A 3V0DA 1A02N 4GRLD 3M9HA 1R3LB 1CI6B 1RZ7H 3BWAB 3QRBA 4PYHA 1HDMB 4DN4H 4MX7B 4OD1L 3VMPA 1KENH 4FRWA 2UX7A 2N56A 3HHSA 4C56A 4Z7AA 3PG2A 5I6XB 1H15A 5D1ZB 3LN4B 4OCSL 1A0QH 3IRZA 4PRHB 3B5ND 1CDUA 5DZPA 4LLYA 5K59F 1U8MB 2IDCA 1T80A 2HLAA 1P84J 3EGDA 3GF7A 2E74C 4WK2B 4XMKH 3JV6B 4L0PB 3SPHA 1Q7YQ 4MN4C 3ASOB 3CMOL 1KQFB 1SJMA 3PHLA 2ITEA 2VLJB 4NNYB 1MAMH 2EVJA 4XCEA 4G8GD 3SOBH 2O5XH 1N7SD 2PCFB 3D0VB 3EIFA 4N20A 5DC0A 5C0CD 4BKLA 4ODSL 2A6IA 1RP8A 3GMOA 2W81C 1J88A 3C5ZC 3S48A 4BH7A 2J56A 4AQEB 2J4WH 4U1JB 4ATTA 1NAMA 2QG4A 1FU1A 4HA1A 2VDNL 1DQQA 2H5UA 4HUWB 1E6OL 4Q8BA 3L70G 2SEBA 1J1DB 1ADQH 5INDA 3KHUA 4X5QA 3P3SA 1Q72L 3P77B 4KWUA 1X3DA 2BPBA 1HOCA 3K6IA 3D30A 1MFAH 2Y4SA 5KVDE 1DQLH 3DGGB 1E9PB 3VD0A 2P58A 1ZGLA 3QNXB 3AABA 2VZUA 5HDWA 2FUQA 1U21A 3NMDA 3I74A 4L3CB 1CWVA 3PUUA 4YHKH 4WHTA 3SDAA 2R0ZH 4KZ0A 2LHAA 1BXUA 1E4XI 1URQD 2C9AA 1KCKA 4Y5XB 3QIUB 5E7BA 3ZO0A 2IDUA 4NJ9H 2V8LA 3V6FB 1VCAA 3MJ9L 3AE9C 1BD2B 1CCZA 1IFRA 4JANB 1GW0A 5KANI 5ESQA 1EAPA 3ULUF 3QFJA 3UTPE 4XOCA 2CR3A 4Y7OC 2EXTA 1HS6A 1P53A 1GC1C 3H9HB 4N9GA 3SDDD 1UVQA 1AQDA 3GXUB 5HJGA 1VADB 5ACZB 3ULVL 1BMGA 2P80D 4XMUA 3MGTA 3L71J 1RP9A 1ACXA 4LFHG 3US0A 2XWXA 1YEKH 3QEHA 1T1ZB 5DEFB 1S5LE 3ARWA 5TH2A 3X1BA 2MKLC 5CFHA 3GBDA 1JF1B 1UURA 4XAWL 3SY0B 2ZKMX 5DRNA 1MCCA 1CLOH 1KZYA 4Y1AB 4KKCD 2HLFD 3I6GB 1VQ9P 2OR9L 2AEQL 3V4QA 2XX1A 1OAJA 4RGNC 3SCMC 4IGBD 4D0BA 3R8QA 1BF8A 4OT1L 5JHDA 5DZLA 2AK4B 1C8QA 5KVFL 3M88A 2P8MA 3LOWA 4I3RL 3H1IG 3HI6L 4K3DL 4ANUA 3HB3C 2CG9X 5CJQL 4Z3IA 1ZXGA 3QCUL 4IMKC 5E2UH 5DQDL 1U8OA 5L8KB 3QJSB 3VI4B 4H8QA 3HBQA 3HE4B 4KKAC 4MQ7B 4UT9A 3D85A 5DI8B 4GOEA 4N0CC 3IETB 2GJ6A 4XH2A 4P5KA 2PABA 3U30C 5HD8C 3FF7A 4HKBB 2OYHB 2QADC 1LWUA 1F3JA 1OT2A 1JGLH 3BWZA 3P1VA 2YXMA 3FXIC 2XQYG 3SDXA 3TBVB 3WY1A 4F33B 2M2DA 1A6AA 1GC1H 4K55A 1KUMA 1QI4A 4JHUA 5DQ9A 2FJGA 4UNTA 5HHPB 5CSZB 4D7BA 4JB9H 2KKQA 4QRBA 2FO4B 2GITB 3Q9QA 2MWCA 2HH0H 1E3FA 3VFSB 1D5MB 1PZDA 3G5YB 4PTTA 5EOCL 3ZE1F 1A1MB 2W9DL 2GJRA 2X4UB 4JY4B 2IFMA 2V5MA 3IVKA 2O5ZH 5D7LB 1QLRB 1IL1B 5D5ME 3UX9B 3Q2YA 1JRHL 2Y36H 3CFQA 1MW2A 5FO9A 1HHKA 2A5UA 1E0OB 2XZQL 4MJ4A 3VA6A 1Q9KB 1OF2A 3TEXA 3VFNB 3FAXA 1U33A 3O8XC 4GW4B 3TX4A 1MCDA 1NKOA 2YSSB 2MCPL 3IDIB 3HR6A 4XVUD 4JFEE 4LKCA 3INUH 5FPIA 1JOCA 5ALBH 2DRUA 1NCNA 3PWNA 5DURB 3QJFA 4HS8L 4JYCA 3RGHA 1HL4A 1N6VA 2HFEA 2KIKA 1RE4C 3NDYE 5L4IA 2EC8A 3E8VA 4HWZA 3D4YA 3QDMB 1FVDA 1W6LA 3T6WA 3L70E 3P4MB 3U4EA 5A6MA 2ZZUT 3A4DA 1A6VH 3V95A 4PLOB 4N1EA 4WHDA 4A37A 2IBZI 2UWEF 3BH4A 3UPRB 1OP3K 3MLSH 3BPOC 4JDTH 3V6OA 5SWQA 5AALA 2R7EA 1YO4A 3LN5B 3TH4T 2NPSC 2Z5HA 4B9JA 3B7UX 4JE4B 4JG9A 4PV8A 4PJ0H 32C2B 5C2UB 1PFOA 5K1NA 2YPLE 3OLEA 3T4YA 4DVBA 5DJXA 4K07A 4GT0A 1G4RA 1IAIL 3LEYH 4QI3A 4AGOA 1G1KA 3CLWA 5DS8A 3W0WE 5IZ7A 5CN2A 2ZNXA 4JBZA 2ATKB 1EC5A 3LDBB 5E8DH 4PCYA 2V4LA 3ARED 1EWHA 3L3JB 2ICEC 1X7QB 2RBLA 2ED7A 1XCTA 4BFJA 2H4EA 1NCOA 3E7JA 3AEAC 4XRCA 5JUEH 3ARDC 2A4EA 2HKFL 4HK3J 1OTUC 2RMNA 2CO3A 3KBEA 5L4MA 4JGNA 2XNAA 4OZFA 4WTQA 5IJKC 3AAZA 3TYYA 5E8OA 3EOAB 3HE7D 1OE3A 2JMRA 3RFZA 2P4AB 3FQXA 1GIGL 4DTGH 3OZ9H 5KUMA 4DKFH 5DZOA 5CBAB 3DVFA 5TGBA 2R51A 2VSKB 2DQUL 3G6JB 4A67A 4DPAX 1KJMA 2BIOA 4KK9C 3UG4A 1U6AL 4JDEA 3VH8A 3VFVA 1CYXA 2OR7A 4K94L 1ZRUA 5EUOF 3U9PH 2E7DA 2P5WA 3QG6B 4UBDC 3B2MA 2KS0A 1ZTXE 4DVRH 2FWUA 1HTLC 2FZ3A 4CVUA 4KJYA 3VG9C 4O4YH 1TLKA 1BBJA 3H1IE 1JNLL 1T0OA 2HTKC 3VXUD 1UGKA 3TIDA 4RMVA 5D7JB 4BRYA 1CYWA 4PWKA 1NLBH 3BH8A 2HRGA 2YXRB 1AZVA 3DYPA 3KPPB 3ME0B 3QDGE 1LWJA 3DHUA 3H9SA 2V5TA 5DJZB 1KCVH 2YC1A 3LKPB 3WJJC 2YUZA 3Q7JA 5A2BA 2E59A 1MI5A 1WH0A 1ZIAA 2CDFA 2E56A 2WTRB 2WWWA 1XF5B 3DOSA 3E6FB 3MFFB 2QVTA 4J3SA 4YXDC 3QHZL 4M61B 1ZY9A 5CCGA 1KYOK 1GTFA 4ZFOA 4A2EA 1JHKH 2ZYGA 4ETQB 5GS2H 2E76D 4JZOB 1YUKB 2DLTA 2JWYA 4TUUA 5JZ7C 1AKJD 1BQLH 4AI7A 1CXLA 4FZ8H 3V2AR 4X4YA 3FJTA 4G2AA 2J5UA 2P8LA 4ZUVA 4U6TA 1I8AA 4QY8A 2Q8AH 5JW5B 1G7QB 4DNLA 4EI5D 4OLXL 4ZJ9A 2F2HA 1A7OH 4OLUL 5FK9B 4Z7QB 3B37A 4EI0A 3EGXB 3O6QB 1IGCL 4WO4D 3GG2A 4G8EA 3T0EE 1UM6L 4L2YA 3VX1A 3IE4A 1SJHB 1X5GA 3VXSE 1QFHA 2D3JA 3AG3B 3UTTA 3G9VA 3O3EB 1UCBH 4OF0A 5C08D 4BELD 1R3LA 5E4OA 1CI6A 4KJPD 3G3ZA 1YQVL 4Y4KB 1ASOA 1IGIH 4I0PD 4MX7A 2XN1A 3GHEL 4LO9A 2HA1A 1JZ3A 4NN7B 3PJSK 4UAHA 2B5IB 4L1TA 1JZEA 3L37A 3LN4A 5D1ZA 3S97C 2CUIA 4PWJA 3CVHB 4XP9H 2CJUH 1WPCA 5IHUH 4P3CL 5DQJB 3RVTD 5I0DA 1U8MA 2ZUYA 4YR6B 5KTEL 3BSZL 3V5BA 2JKVA 2X88A 4PHZA 3I9PA 4FE9A 3DIFB 3EYUH 4EDFA 1U7MA 5HDBF 2JVUA 1MJ8L 3JV6A 4PJXE 3ZYOA 5JPMC 3DMMB 1LTIC 2VLJA 4NNYA 1T2KC 1LE5B 3ISWA 4OH8B 5IB5B 4KI5C 1B0WA 5CD3B 1QEWB 3D0VA 1NYHA 1LTJC 4PYGA 1HH6B 4G71B 4PB9H 4PD4K 3IYLW 4QT5A 4AQEA 4FQPA 5E08H 1CDCA 1YMHB 1JXKA 4U1JA 3VWKB 2IDQA 1KCUH 1OT1A 2Q20A 2Z7YA 4HUWA 4UM8A 2ZUVA 5C0RL 5DVLA 4YFEA 3FTUA 2IO5A 2VWEC 3K8LA 3GO1H 3FWLA 4HWEL 4I3SL 5LNDA 1BEYH 1CD9B 3SE3A 2ZVNB 1E9PA 4K0OA 3BZDA 3QNXA 3NFPB 1YEHH 4L3CA 1DJIA 2ESVD 2AJXH 2F7PA 3NEXA 1BCIA 3MGOB 1EDIA 1AO7E 2H7WA 3RVXD 2R39A 5BRZD 5E6IC 2UZXB 3FYEB 1T21B 1QSEE 1GD2E 3KD4A 1QAWA 4PJ5E 3AE7C 5AAWC 4FAAB 1L9RA 4X4KA 4Y5XA 3QIUA 5IROA 5GZOA 5JO5B 3MRRB 3BUBA 4PJ8C 3GNML 3GGWB 4HHWA 1LILA 4IRJC 3MLVH 1BD2A 4JANA 2D0HA 1QL1A 2BNQB 1H9DA 4I6MC 3VVVA 2HLEB 2Q2EB 3Q5TA 3R1GL 4BSVA 4JFDB 3DC0A 2XZRA 1MAJA 2ICWA 2VL5B 2QGEA 3MRGB 3H9HA 2WCPA 2BOCB 3U4BL 5ACZA 2H2SD 1VADA 1KB9I 1MJ7L 4OUOA 4DGIL 3BZEB 1FE8H 2F68X 1TQBB 4NFCA 5LGHH 3ZL1A 4LSVL 2FUTA 3PP4H 4HUVB 4HETA 5DEFA 1EK3A 3OG4B 4U1HA 2WVVA 4RETB 3MO1B 4U2ZA 1TDQA 1JF1A 4QRRE 3ZK0A 3IFLL 3SY0A 1VA9A 5K59E 2BSTB 1E4KA 1UFGA 1NJIQ 4JBSA 4F1ZA 2RGSA 3D33A 1HINL 1QWHA 2NT0A 3FNKA 3I6GA 2OW6A 3IFPB 3MPCA 4JKPL 4UWQB 2MCAA 5D7KE 2EADA 2AK4A 3A24A 4HULB 2N01B 3FU5A 5A7BA 3IAOA 1F42A 1XSKA 3BUYB 2FSDA 3HBPA 4MB1A 2G75A 5AVVB 1P7HL 1S7VB 3EJZC 4FYQA 3VI4A 5CNHA 3GSOB 3HE4A 5SWSE 3V9CA 4WW1B 3DXAE 3VG0L 5DFVC 5DI8A 4DGUA 1YQ2A 1QVFO 3IETA 4MAYD 5F7FA 3DJTA 1AQHA 3QI9C 5D4QA 2QVAA 1S78C 3D6YA 3IFMA 2VZ3A 1XMEB 2MHAB 1Z5HA 3WIAA 1NC2B 4HKBA 2OYHA 1N2RB 3C5JB 3UJTH 4AIXA 1IE5A 3TBVA 1AR1D 3X2QB 2M5AB 4M3JA 4F33A 3DTDA 1N2DC 3MYZA 1PIGA 4PS4L 3MJ8B 4X7TA 2EDEA 4GSQA 4QXGH 1RJYB 2YMXH 5CSZA 4BQ6A 3QPQD 4RWHA 4ODTL 4YPJA 2FO4A 2PNDA 3VGBA 1JWMB 3T77B 2BCCJ 2BASA 1D5MA 3G5YA 5GJTH 1A1MA 3PRZA 4WGVB 1JY2N 2X4UA 4UQCA 4JY4A 4YSRA 1RJLA 1JUNA 2X89A 1QLRA 5D7LA 1IL1A 2J20A 4QJ3B 25C8H 3DARA 5AZ2H 3AM8A 1Q9KA 4K8RC 4J2XA 2W07B 3IXAB 3KYNB 3VFNA 1AV1A 5BOJA 3TIEB 1IBGH 1VQ5P 3GBLA 3ULUE 1GHFH 4FI7A 4GW4A 3CVHH 4NPFX 3L13A 5D4HA 3UMNA 2YSSA 3IDIA 2V2TB 4FTVD 2ZG3A 1GJUA 1HVXA 4FF9A 5I0XA 2O26U 1KFAL 3P02A 5CZVH 2CLZB 1CDJA 1XV8A 2WQRA 1XGPB 2J71A 3A23A 5I76A 2DIBA 1B3JA 4AK1A 3RZCD 2WXPA 1W6WA 1ACYH 3P4MA 4PV1D 4PGZA 1L7TL 2J6EL 2W88A 1MIEH 3AGWA 3MTRA 4I2XE 2XU6A 1YJDC 1E3ZA 4HCRH 3C6EA 2ORBL 5FECB 5MENE 1RZGB 4Z1PA 3UPRA 4G6ML 3CZEA 3LTVA 3QEQE 3UXFA 1NBQA 3SJVE 5FGBC 3LN5A 4JM2D 4Y99C 1FYHB 2F19L 5E4IA 3X3FL 1M4KA 5C0BD 3UIYA 5EN2B 5JOFB 4AIZB 1NMAH 3VP9A 3GF3A 1Z5YD 1U41A 4F9LA 4HPYH 4NUJB 1IKFL 1JY3O 3PNWB 5DD5L 4AYMC 1KOAA 4K8RH 4KRNA 4Z23A 1OEZW 1JMBA 2ATKA 5BV7C 3VFTB 4FS0A 3CCLP 4CBZA 1RZFH 2GEEA 1GZHA 1TIUA 4JPVH 3DHPA 4S2SB 4UINL 5KBLA 2WSDA 4YVNA 1XSJA 2W60A 4M6OH 3LKOB 5FV2A 3WY2A 1JRHI 3D9AL 2H32A 2VJXA 1H8SA 2ZXQA 4HUUB 3KJ6L 3SKUD 3FT9A 2GIYA 5ESAB 3S8FB 2OSLB 3L71D 2DM4A 4J6IA 3M86A 3RQ3A 3N43B 5DD1H 1PZBA 1NOAA 2AXJA 4I7ZC 4ZNCA 2K6ZA 5EA0H 1EHLH 3FSOA 5CBAA 2X10A 3ZE1E 3NH7L 2AEWA 3PWPE 2WQXA 1ZE3C 1YJDH 5DO2D 1HSBB 3FTGB 3B1UA 1QNZL 1T5XB 3UBXG 2W1NA 1QEXA 3EDJA 2LTQC 1JNJA 2B1HL 2OPCA 3MX0B 4QRTB 3RTQD 5K9JL 2FBOJ 3H0TB 3NK3A 5FYKD 3ME0A 3QUYB 4LCUB 3KPPA 4QHKJ 4BQ9A 4CADB 5DJZA 3K3QA 1AQMA 2RHEA 2O01N 3LKPA 4MRCA 5F1IB 2QQLH 2VUKA 1KEGL 1HK6A 2RN0A 1VGEH 3BUPA 1X9LA 4PJBF 4BKSC 4CN6A 1MXGA 5JR1L 2D4DA 2WTRA 3E6FA 1MNUL 2QR0A 3MFFA 5TDNA 4XB7A 1F86A 1RIHH 3NJIA 4M61A 1II4E 4TNGA 5DF0A 2UWEE 3VFGH 5CF3A 4ELKA 4ETQA 4K3JH 2X3AA 3LIDA 5HYQB 2V37A 4JZOA 1S7QA 3E3QE 1NTMJ 2J8HA 2A6JA 2DI7A 2AQ1A 2H6PB 3LCYA 4I77L 4KTEL 3KYOB 3ARFB 3GSNH 3WLWC 2XC8A 1RIVL 3EHBD 3K5SA 4QTHA 1ZE3H 3GHBH 4CBPA 5JW5A 1J1XH 1G7QA 2WXHA 2VSMB 4B9KC 4I18B 4G6JH 4H8WC 4LAJH 2HRHA 1ZTMA 3MXVL 3ZDXF 1B4RA 2CDEB 1Z6JT 2B4CH 2WBJD 4G9FE 4UANA 2IGFL 3H3PL 3EGXA 4AEEA 3O6QA 1XGYH 2WQWA 3WJLA 1SJHA 1P6FA 4B9FA 4ZW6A 5IFHL 4LCIH 2Q3IA 1UM5L 3O3EA 3P0YH 3RKDC 1B88A 5AW4B 1JAEA 2HXAA 2OAAA 4Y4KA 2Z3FA 3R4RA 3JV4B 3MCLL 1KN2L 5D5MB 4WV1B 4BHUI 3UO1L 4M9OA 4NKOB 3M7FB 1M9SA 5H2FE 2GTQA 2AGJH 2HRPL 5ITBH 1XIWB 4JPWL 3CVHA 3U6XA 5FHAL 2HN7B 3MLRH 3BH9B 4GI6A 5DQJA 3WKNA 5H8DA 4IIQC 1P84I 2RFXB 2QELA 2MJZA 2R2EB 3EZ8A 3K6FA 4YR6A 3WMM0 4JFEB 3ZIYA 5EUOE 1AVYA 3S5ZA 3VQLA 1Q0YL 5LXGL 2BSED 2GG1A 2NPLX 3DIFA 3WNKA 2A45I 3GJFB 1AS6A 4P5MB 3K4ZA 1EZVG 1DBBH 3SE9H 3DMMA 2Q86B 1KTJA 4Z76B 3CZFB 1LE5A 3ATEA 3D6GA 1K3IA 3X1NA 3QG7L 3CG8A 5ECJE 2P5PA 2IPTH 3F3HA 4GIAA 1HH6A 1PU0A 2DWEB 1JF5A 2IIJA 3MBEC 3QIBC 2JLLA 4H8WH 5AVXB 2AJYH 3IFNH 3VWKA 3QZLA 4AL8L 2GI7A 1QUPA 4YC2C 3F7VA 1HILB 1WZKA 3BN9D 4JQXA 1CN4A 1B4TA 4E9XA 3UMTA 1WUNT 3TGUJ 4ADGA 2CGRH 4LNRB 1F6AB 3BP4B 1MZYA 2HMID 1ZT7B 1FZBA 3AVEA 3QRFM 4X6CF 3K5BA 3MAWA 4PBWD 4UQDA 2YPLB 4FOMA 4KX7A 1SZNA 3JV5A 4OLYL 1SQBG 1VRSA 5KVDH 2Y6SC 3NFPA 3AEFC 3QQ4B 1G6RB 1NH6A 2FNWA 1S7TB 1L7IL 3W0WB 1AVOA 5LWYL 1FGNL 1HOEA 2K1MA 2BINA 4J3VA 2UZXA 1MCSA 1T21A 2CPUA 5A2IH 1T83C 3KPMA 4U1MA 3V4VB 1YQ4C 1V7NH 4NPEA 4IRSC 3MV8E 4DQOL 1SQMA 2LKMA 5JO5A 3MRRA 5CJOH 5CD5C 5IEKB 1XX9C 4JG0H 4OCXL 2JR8A 1MHPL 3GGWA 4QTFA 4JUTA 1PX4A 1EQWA 4OLEA 2NY3C 1UZGA 3DOHA 1XGRB 4FL4C 4M7KL 4YFDB 3VD5A 1KULA 1NIAA 3ESMA 2D31B 4TSAL 2VZSA 4HCGA 2CAKA 3CCRP 2CBQA 2VL5A 3MRGA 4NXSA 4CU6A 1RERA 1F1AA 2QSVA 2UV3A 5KTBA 1HQRB 4DEPB 1EDQA 2BOCA 4BH8B 3JQOB 1XVSA 3BZEA 5DWPA 3QUZD 2Q7NA 4M4PA 1KZUB 1G9MC 1JGIA 4PS7A 3H1HJ 1T2XA 5L88L 4HUVA 2KYVA 1NIEA 2JB5H 4KHXH 2F74B 4KJQC 5EZOH 5FAAA 1IEBB 2F5BL 2W91A 1S5LH 1I1YA 3T08A 5IFJB 3P7KA 2BSTA 2DJSA 3HRZB 2X9XA 3EXLA 3S35H 2F53D 1IO4A 1VCBC 5CLTA 3IFPA 5FUZL 3QDGB 5AW2B 5HDBE 2N7AA 1RUKH 4M7JH 4EPSA 3BUYA 3OSKA 4NRYB 4JQIL 1FL6B 1KCRL 1S7VA 1T2JA 3EBGA 1JVLA 4U3FJ 3K72B 3GSOA 3HZMB 2EIKB 1FNGB 4OR1A 4WW1A 4DKTA 3BMVA 1VEOA 4MSWB 2AXHA 2QSIA 2K3TA 1MQKL 4WTWA 2CRZA 3G04B 2B1AH 4MRBA 4XAKD 3EJUA 4P3WA 3QQXA 5PAZA 5JW4R 2MHAA 4OTXH 1N0LB 1AZCA 1NC2A 1N2RA 2A38A 3C5JA 4XP4L 2A7BA 2WIIA 4N6RB 3TPKA 2M5AA 2B3RA 3FKUS 5D1XD 1UJ3B 1LP1B 3CC1A 3MJ8A 1RLBA 5HGHA 5EEVA 1RJYA 2ARJB 2P46B 3TEYA 2IH9A 4N2EA 5I75C 5IQLA 1ZAGA 1ZEAH 2HPTA 4JVWA 3ZVVA 3S4RA 1G9MH 4HGKC 1JWMA 3QYMA 3T77A 5F21B 1OAUL 3UG5A 3G71P 2MPAH 4JJHA 1Z9PA 2WANA 1H0DB 1WHPA 2H45A 3L4VA 3T0EB 3LIEA 1H9VA 3ESPA 4A2DA 5D9SA 4KDTA 5J5EA 4KNSA 3VXSB 5E1GA 3GSWB 2CJTA 1D9KC 4C83B 2XN9E 1NU1E 1UUNA 2W07A 1OHZA 3IXAA 3NABL 5J3HC 5JHLH 3J2PA 4KFMA 2BDNH 3TIEA 5F7HA 1EZVE 2JKNA 4ENZA 3K4DA 4JFYA 4LVOC 2V2TA 3Q5RA 4FQCL 1TKWB 3QWQB 1PGJA 3BQUB 2YIHA 4TUKL 43CAB 2AANA 2W5PA 4Y5YB 2CLZA 3U1CA 4OZGF 3JXAA 4M1GL 4R7VA 1CD1B 3DDFA 3F89A 4IL6H 3DSNA 1S5LX 4PJXB 4EZLA 3ZT5A 4WFGE 2NY6D 1XGTB 4PD4E 2JE8A 3S35X 3VXRE 3NCBB 4EIBA 1G43A 3JWDC 1BYPA 3WS6C 1LO2H 3PIQB 4NO0D 1RZGA 2OW7A 2WLHA 2ZKHL 1JWUB 4GAGL 1TZOA 4JUSA 4P2RE 3V5DA 1KT2B 1SQBE 1R6VA 1UWEH 2PF6A 3LVEA 1YNKH 1KY7A 2Z91B 1QQDB 5KAQF 2Y23A 3G4SP 4ZQKB 4G3YL 5EN2A 5JOFA 4AIZA 1BZOA 4ODVL 3BATA 4W93A 5I73C 2OYPA 5EEYA 4NUJA 3QARA 4MQSB 3PNWA 2QE7H 1WEJL 2IH3B 3O0RH 1BBDL 3VFTA 4A7SA 3GZOA 4FADA 4S2SA 1F90H 4OGZA 1OP4A 4YSUA 4HIXL 2HPCA 2BHUA 3SD5A 3LKOA 1AO7B 4XP1L 1AOHA 1N73C 4GQ9L 4ALAC 3SD2A 4HUUA 1NFDF 1QSEB 5B8CB 4N22A 3NJFA 3TDKA 4PJ5B 2OSLA 5ESAA 5DSCB 3VDAA 2X9YA 2ZYIA 2O72A 2KNCB 5HDLA 4HHAB 2ZSWA 3T3PF 3KL5A 1FC2C 5C07D 2F8VA 1I3GH 5E7FA 1IC7H 3NIGF 2YZ1A 4XPTL 2KC0A 5I28A 2GQHA 3JWDH 5CCKL 1HSBA 2BOBA 1QRND 4HQQL 3R06B 3EYQC 2CZNA 4TNEA 3FTGA 1Q8MA 2MRYA 2C9NY 1DANT 5CZKA 4XMTA 1T5XA 1WRFA 4FGMA 3UADA 1QOKA 1GGIH 2HB0A 4MAUH 5CLXA 1BGXH 4D3CL 2OMNA 4KOCA 1YEDB 4QRTA 4ABQA 1YEIL 4F2ME 3BP7A 1IFGA 2PP7A 4WENB 3VI3F 3H0TA 3Q1SH 4B6ZA 4K3EL 4QRRB 3QUYA 4LCUA 1THAA 4IHOB 4CADA 4GXUN 5D1QA 2YGQA 5F1IA 3S3BB 2ETWA 5HGAB 3D0AA 1HWGB 5D2NE 4ZOEA 3GEWB 3DECA 4H1LB 1HHGB 2NY0C 2DWXA 2C0WA 4NHUB 3II6A 1MF2H 3M1CA 3R4YA 4WY4D 2F7OA 4M3HA 2OMVB 4RZKA 4U1KB 5SWSB 3QJVB 4IYKA 5KSAD 4ASWA 3DXAB 3IF4A 2VLKD 5EMYA 4CVXB 5LQBL 4X83A 4N3TA 1IFIA 5HYQA 1UKTA 4ZMAT 3KZIH 2WKOF 3IJSB 1RUMH 3SKOB 4OFYD 4BZ2A 5DA0B 1MEXH 2H6PA 3VYIA 4N2AA 3SGKA 4JY5L 3ARFA 2MNUA 2XQ0A 4R7NB 3BJ91 4XCNB 3FPYA 2XV6B 3U6RB 4POZC 3V2RA 2VMEA 2H41A 3CCQP 3PQYD 4I18A 4ODBD 3EH5B 2WTYA 3EFFK 2CPCA 2CDEA 1R47A 3ZKMC 3N42F 1SLXA 4X6BB 4KKNA 1KCWA 3EBHA 4BFNA 3L5XL 2B59B 4WEBL 1L0QA 4TXVB 3L72G 1FZKB 2E74D 1KB5H 4FLHA 4P06A 3LV3B 2HP4A 3GBNH 4YK4C 3RIFK 1EJ6A 5HDQL 1SFCC 4RJTA 2XJLA 4YSQA 1I7TB 1EXJA 1TUPA 3ZLQC 3JV4A 1OTSC 5D5MA 5I74B 3MRDB 4APXB 4WV1A 9PCYA 4P9MH 4MD4B 4NKOA 2WUCL 4MMXB 5I1LB 4MZRA 3NK4A 1NOFA 1KDIA 1TJHL 1N6QL 4O2EA 2HLOA 1L4AB 4FTDA 3C5ZD 5EN3A 3TK1A 2HN7A 3BH9A 2YD1A 2RFXA 1NBZA 2R2EA 5J9PB 4HJ1A 1EBPA 1WBXB 3ZL2A 4JFEA 1GS6X 1KPRB 5I5MA 3SSGA 4A6YH 1OCRB 2EE0A 3DVGB 3GJFA 4U7KA 4OLVL 3LRKA 3IGLA 2WVRA 4MD5B 5CFAA 2Q86A 2FYVA 5ALCH 3LNHA 3CZFA 5ILTL 3FHAA 4Z76A 2JJVA 1Q1JH 4AIOA 2WSCH 2HVKB 1RZJC 1PMYA 5D7HA 1LHZA 4Z9KB 2DWEA 4RGMB 4I2XB 3GI8L 3ATFA 4UQEA 4YDJB 1KYUA 1IFDA 4MA1B 4MNHA 3BOVA 5MENB 2WWMC 4PJBE 3CWGA 3Q6GH 1HILA 3QEQB 4ZUSB 4FFVD 3SJVB 4Z0XB 3GMRB 1EX0A 5I9QB 3C9NA 4LNRA 1F6AA 2PTUA 3BP4A 4E9VA 1ZT7A 4CSSA 1HAUA 3GS4A 3MR9B 1EAQA 2KUTA 2YPLA 4FERA 3T2NL 5F89B 3N0PB 3NAAL 5GTHH 3GLZA 2ICES 2K78A 3LQZA 3OAYH 1B6UA 1PGQA 1RK0B 3QQ4A 4U1IB 1G6RA 4YSEA 5LBSA 1S7TA 3W0WA 3KG5A 1J0IA 3H85A 4D6TG 3AB0B 3MGAA 3V4VA 4TM9A 2FT8A 1IC4H 4B9IA 1NGPH 3GZQA 5IEKA 1QI3A 4IDJL 3ZDXE 4DKAA 3SDAC 1NUNB 4R2GB 1UIIA 5E4EC 5DK2B 4PWEA 1XGRA 3ARUA 5DUJA 3AECC 1M3JA 3WN5C 1PLGH 3KXFA 2D31A 5D6DC 3HC2A 1CFNB 1UYWL 2W80C 1RZJH 4M7LL 3RGBA 3SDYL 4RGND 5IQ7L 3ZE1B 4JFZH 4EO5A 3PWPB 3L2LA 1VZHA 1HQRA 1P1ZB 2CLVB 3ZTNH 3RL2B 3WKMH 3PABB 4M3LA 4X99B 3HB3D 4XC3L 4HYTB 5KVGH 1M8OB 2WXMA 4MXWH 4PRHD 4XO9A 4B27A 5I0ZA 4UB8H 1JCVA 4PV9A 1T22B 3Q44A 2WN2A 4KKAD 2F74A 3P3TA 1IEBA 1A4CA 3LPOA 4NWUL 4N0CD 4PVLA 5IFJA 1G1YA 5EG6C 5IW3A 3HRZA 2Q3AA 1BVKB 1JYWA 1PZ2A 2A99A 2FQEA 1QMUA 5AW7B 4GKNB 2IFGA 3QDGA 5HD8D 1G1IA 1NTMD 1YNLL 4TTGA 2OMXB 2QADD 2IH8A 2G3MA 4X42A 1HZLA 1Q9OB 4QHUA 1KBPA 1BIHA 4H1LH 1FZCC 4KTDL 2VLRD 4NRYA 1URLA 1FL6A 3SQOL 5AAMC 3H1JJ 1E28B 3L2NA 1MFZA 3K72A 3KAAA 3HZMA 1FNGA 1JCCA 5EZIH 3MNMA 4MSWA 4YBQC 3WE6B 2XQYA 1T66C 2R56H 2X0VA 3G04A 2UWEB 4M56A 4TQEH 5LGYA 4AQ1B 3VFPB 1B4LA 1N0LA 3N41F 4FQXB 4JRYD 3CFNA 4ERSH 5I5IA 3CCSP 4LSSL 3Q05A 3LH2H 4N6RA 3L72E 2FFDB 2Y1YA 3TH3T 1F6FB 3TT1L 1MFDH 4Q9QL 2A9BA 1UJ3A 1LP1A 5CP3A 4BWUA 3QC5X 4EZMA 3PTZA 1CU4H 2AXFB 4I9XA 2ARJA 3B3BA 3H1LJ 3Q5OA 1X7SA 2IBZY 8CGTA 4IBWA 4XGZB 3OJDB 1TVDA 2YXFA 4FMKA 3EUUA 5KAQG 1YYML 2LLGA 4B50A 2DQIL 5DJUB 1ILSA 4OGYH 3S3CB 3WUUA 4G9FB 1MLCB 1H0DA 3LHPL 3CQQA 3T0EA 1BSHA 3B9AA 5F0LB 4S1QH 3TJEH 1CFMA 5F96L 3VXSA 5KVEE 2CBTA 2K3RA 4I0KA 4C83A 4FG0A 4NAMA 2OMWB 4U3SB 3WD5L 4F15C 1F13A 3BPLC 3GB7B 4B7IA 3RVWC 3TF4A 3LX9A 4NBZB 2QJKB 2M83A 4P05A 4TUJB 1MOEA 1HZHL 1TKWA 4M5TA 3BQUA 3V6IA 2OTPA 1PL5A 3II2A 3O3BB 43CAA 3WTSA 2NPSD 2IGLA 2LFEA 4Y5YA 2Z4QB 3VMNA 1CD1A 2VW4A 5EUOB 3U0TB 3DSFH 4EOWL 4E36A 3MLZH 4N2DA 3DTXB 4PJXA 4L1HA 1XGTA 3FB5B 4Y1AD 1IGML 4N26A 3ML8A 4OM0L 5G5DB 3CQPA 1WV7T 5IB3B 2QEJA 3DROB 1Z9OA 3PIQA 3VNZA 4YS4A 4GIFA 4KK5C 1JWUA 4TNVK 3HLAB 1KT2A 2E9WA 2MOVA 2Z91A 2ZX5A 1QQDA 2EABA 1HCZA 4OM1L 4X8GA 3S7GA 4YJZL 4ZQKA 2RH0A 5LKNA 4WFHE 1P2CA 1W16A 2V7HB 3Q2CA 1GU4A 3ARDD 3VM7A 4YWGL 4HAKA 1UH2A 1OTUD 4XHJC 3AROA 3ZJAA 4D6TE 2KK7A 1DX7A 2R23B 2N3JA 5L8LB 3QUHA 4ZS6C 2VR9A 2H6UA 3EJRA 3FU9A 2IH3A 3MLXH 3UP6A 2D7TL 3FXEA 5SWZD 5GS1B 4WW2F 3H2QA 3P32A 2YXVA 5L7XL 4KK9D 4KQ4H 1XB3A 1F02I 3D52A 2K9YA 1ZPUA 1KMGA 1YTZI 1GGUA 4RSVA 5FYLE 4R3SB 4UBDD 2C9SA 1WRGA 5F7KC 1L9NA 1QSEA 2XZCH 2EDDA 4PJ5A 2PYFB 4XVOA 4H0LB 3MV8B 5CWSB 4QAMB 3H1HD 1VEPA 2PPFA 1I8IB 3OKOB 4PJGF 5F1SA 4HHAA 3RHWF 2IG2H 4XNXH 2HJKA 3WGUB 1NMCC 1ZK9A 1JV2B 4K9EH 3UBXB 1SDDA 3EJPA 4IQHA 1DFBL 4JKMA 1YLBB 5DMYA 3R06A 3G6AB 4XCCH 3RFZC 4KO7A 2WNKA 4BFKA 1GA2A 3O2WL 2UVFA 3HAEG 1LO3H 1DBAH 5CU5A 2GABA 4LPWA 3WSQL 5T5FA 4U3FD 2Y7SA 3I6LD 5JW3H 1UZ6E 1YEJH 1YEDA 1S7XB 3L17A 5T3ZL 3QUMH 1F97A 4QRRA 4QHKI 1CSBA 3M9QA 1SHMA 5JZ7D 5I66B 1WZLA 4IHOA 3NTCH 1OW6A 1TQCB 4OZGE 1DBML 3QDMD 4RAHA 1WGVA 2BHFA 5HGAA 3DURB 5HDBB 4DF9A 1XH0A 2Z7ZA 4PRIE 2APVA 3DBXB 3QJUB 1HHGA 3OJAB 4KC3B 5JIIA 3LD8C 3I3EA 5KANG 4NHUA 3I85A 5F70A 1TETH 3RY4A 3BPNB 3D3VE 4LLAA 1KILC 2OMVA 4U1KA 5SWSA 3DXAA 2QQKL 4CVXA 3SBQA 5I1GL 1IILE 2BXZA 3B9KB 2VDOH 3MOAL 3VGEA 5CBEB 3IJSA 1L9PA 1BXAA 3C9IA 1TPXC 1R3JB 3F6JA 4R7NA 1J9SA 4OF8A 5E24E 2HYNA 4XCNA 1UA6H 5F8RC 3U6RA 1J0JA 5I6NA 3SBPA 4C4BA 4LMQE 1C5CH 1H0TB 2K88A 1MY5A 4X6BA 1KV4A 1AXIB 1NLDH 2B59A 4NGHL 2FYUJ 1A02J 5DMJB 5B5EE 1AC0A 1X5KA 1NANI 1FZKA 1JMZA 4GSDH 4PGJA 3LV3A 2VDMB 1A7NL 2VUYA 2XBTA 2CR6A 4UV4H 1NFDE 3RAJH 4H20H 1TYEB 2Q9OA 3VNYA 4APXA 3MRDA 1T2KD 1NCDL 1P4IL 5HTSA 1PY4A 2QDWA 4I5BB 5GRJL 3WTUA 4MMXA 2JJTC 2QQNH 2XN9B 2ID5A 4G8FA 5ABAA 5H2FH 5SX5H 2AXTH 2KB7P 2BM3A 4M93C 1I1AC 4FFZH 2IPKB 5MHSD 3N9GH 4Y4FB 4KJWD 5J9PA 1WBXA 3UTZB 7TAAA 2NY4C 1IFJA 3QEGH 4YLBA 4MA7L 3MNDA 4AC2A 3NN8B 1KJ2L 3EH2A 3W39B 3IJYB 3DVGA 2X6MA 3HE5A 1UD3A 4MD5A 3KQGA 1A7PL 3O2DH 5D7JD 2PPEA 4HF5H 4JCLA 1RJZB 3WELA 2HVKA 3SYQA 3VI3E 2R69A 1DZ0A 4MQTB 3QDJE 5DD3L 4MBRA 3EFOA 3VXRB 4I2XA 3FAWA 2MTPA 3VMOA 4MJIE 1SY6L 4BK8A 5MENA 3AE6C 5AQ0A 4BFFA 4P2RB 4P07A 3IDNA 4HBCH 3MDJA 3QEQA 3QXDA 4ZUSA 5JNYA 1T20A 2Y1VA 3GMRA 5J11B 4XPGH 1WVZA 3GSQB 3DHMA 3U7WL 3MR9A 4PJ8D 1UZ8B 2O4EA 2W0KA 5F89A 1USDA 1KORA 4IRJD 5EU5B 2VISB 3NRQA 3B9EA 4UF7C 1KYFA 4RSYA 2BVPB 4QRPA 2FVNA 4U1IA 1ZLSH 1RE3A 1TTAA 2D2OA 1B0GA 4F3FB 1DQMH 4FFWD 2JK5B 4TPRL 2DQEH 2YKLL 4H0HB 4LASL 2JJWA 3HC4L 4KY1H 3OL2A 2XNXA 2M8RA 3MRKB 2FO1A 1C08B 3QH3B 1LDPL 1CGVA 1AHWB 4KOBA 1IVLA 3IU4L 1F8TL 2IF7A 4N2KA 3A6BL 1YTZT 5ABDE 4W9LC 5DK2A 1WAEA 3FT2B 5AVYB 1USEA 4HDIA 1QTYT 5JLZB 1SQQD 5HYJD 2XG5B 2K4AA 1CFNA 3RDTC 2PW2B 4AZ8B 1PG7L 4LLMB 3VD1A 3CE1A 3PWPA 4E9WA 5DK0B 4IDLA 1P1ZA 5IT2H 2ENSA 3LH8A 3RL2A 5C0ND 4ZOCA 4TLFA 3PABA 1OZUA 1J2JB 4UILL 3MHZA 4YBHA 5DVMA 1YZZA 5D7EA 2I8DA 2V4HA 2FB4L 4FQJL 3F6IA 4P9HH 5IVXA 3EJZD 1T22A 3ETBF 4OJDH 2JTYA 4G72B 2GM4A 4H13B 3L3IB 3WL9B 4XPHH 1UG9A 3JYCA 1BVKA 3QI9D 4G6KH 2ZJSL 3UYRL 4F2MB 3L1OH 3QXVA 5LHDA 2RTTA 3AC0A 4GKNA 5KUKA 2O5NA 3CWBJ 3CDFA 1P4BH 2BRQA 5FGRA 4PRBB 5GGTL 2OMXA 3RJOA 4K5OA 2ZVOB 1F4XL 2XJKA 1L0NJ 1N59B 4X9YA 1BOYA 2C7FA 4UT6L 1NDGB 4ES8A 5HGDB 5D2NB 2B88A 4XPBH 1E28A 4YDZA 3FZUC 3QIWB 2RQ8A 1ZHLB 1XAKA 3T8XB 3WE6A 2UY7B 2UWEA 4JYBA 4POUB 4L9LB 5E8EB 4AQ1A 4HC1H 1G1JA 1IGFL 4FQXA 1ZLDA 4JRWA 3WIHL 1ML0A 2WPQA 3AQZA 2E7BA 3IB4A 3LQAC 2WSCJ 2FFDA 4HJIA 5D70L 2ZQKA 2RACA 4OQTL 4B96A 4CMHC 1U8LB 5FO8B 2Q76A 4K8RD 2R4RL 4Z78B 4IKKA 2ADFH 5AKVA 2DLEA 4XGZA 3OJDA 4ZPTB 3JBG7 3P0VH 2JCCF 4G7SB 4XBPB 4PWHA 1NTKJ 4PVBA 2WSEH 3PFQA 3PWUB 4G9FA 3MV9D 2BCKB 1MLCA 1QFWL 2YPVL 3DNKA 2VDMH 2O01H 1FH2A 1OPOA 4NUQA 3L7FB 2D8KA 1A7QH 1HE8A 1O5DT 5IUSA 1JY2O 3E9TA 4ONGL 2BNQD 2K70A 2EDNA 5DJ0B 3PGFH 1V7MH 2YR3A 1NWQA 2OMWA 4JFDD 5DUML 2SODB 1C5BH 1FVCB 4ZFQA 4POYA 5HPMB 5IHHA 4JO3H 3GB7A 3MUDC 3SE4A 1JGUH 1MVYA 3ZKQD 1E9QB 4J7RA 3VB8A 3CFMA 1I9EA 5A40E 3BAWA 3TWYA 4TUJA 5F1OB 1VFUA 2OTUB 2EH8H 1KLUB 1KPUB 3AM8C 3QO0A 1BJMA 4KPHH 1DVFB 4Y16B 3N1GC 3O3BA 2WJ5A 4L75A 4NRZA 4KMQA 2DWTA 4UT7L 2Z4QA 1EGJL 3JV0A 3L6FB 3RWIB 5EUOA 4UI2A 2Y7NA 3U0TA 4CNIA 1PSKH 1RVFL 4IJ3C 3DTXA 1PF3A 4PI0A 1LJMA 3FB5A 3TURA 4UTBL 3LQAH 1UD4A 3BVNB 1I3RB 1KFNA 1MIMH 1Q0XH 1G0XA 1ODUA 3DROA 4JFFD 3QXUA 4HOMA 3OKKB 4LSPL 5IMLB 3HLAA 2ENJA 2JP3A 1PLBA 4HJJL 3CCVP 4KTYA 4YBLB 3IAPA 2VC2B 2V7HA 3RB7A 4PJBB 3L73J 3CMGA 2WO3B 3FQ2A 5JQHC 1OM3L 5AVWB 3IMWA 5F7AA 1VPCA 4K7FA 2R23A 4NKIH 3B2UC 4M6NH 1KELH 1TFPA 1YEGH 2EICA 5E6ZA 3RWDB 2EE9A 1FF5A 1KBKA 2DKSA 4Y2DA 5AZEH 2JDIH 3PP5A 4YHOH 1P5UB 2BEQD 2GSIB 5GS1A 3U4KA 2LGNA 1D7FA 3HZYB 2K37A 2NY7H 2YD6A 2BRRL 5B1KA 3QPKA 2DW3A 1TTUA 4FFYL 4R3SA 3CLEL 5MP6H 2F58H 2PYFA 1INQB 5ISZD 4G8GE 4GXFA 5CWSA 5C0CE 3ZDXB 4NC1E 1I8IA 3OKOA 3RGVC 5F3HB 3Q2WA 1JV2A 4KKBC 1ZHNB 3UBXA 4ZMZA 2A0LC 2FHFA 1AZNA 4YHYC 4LSTH 3UZQB 1OLLA 2IDTA 2WKLA 3G6AA 2CKBL 1LO4H 3LKNB 5JDSB 3L75J 4F80A 1JPTL 2BIQA 4JHAH 4PG2A 4Q9RH 2VDPB 1EZVX 1UACL 5CIPA 1QL2A 3H1JD 4HKZB 1XGQA 1OW0C 5IQMA 2Z6FA 1J0HA 5K5YA 5I66A 1QBLL 3NJJA 4N24A 5CMAA 2WNXA 2XA3A 3L4TA 5B21A 1TNNA 4EOTA 2DM7A 3DURA 4P2OB 2FYZA 2YJQA 3WLWD 3ZRFC 1R0AH 1CZQA 1SYVB 2Y1AA 3LRGA 4O2FA 1B9ZA 3DBXA 4QXUL 5DA4A 1WAAE 2F1BA 1FORH 2ITDB 3H1LD 3QAZB 5I6MA 4OCYL 1PNCA 4PJEE 1KXTB 5FYKL 3RY6A 5KOVC 4MNGE 1OWWA 3B5TA 1TJIL 3CX5H 1VFAB 3B9KA 4GBXC 1TTCA 2OJ1A 1MHEB 5CBEA 5FDWB 3C60C 2TSBA 1R3JA 3VMYA 3KEDA 4MDJA 4XN4A 3RKDD 3VW3L 4NN6B 3I56P 3JWNC 1A6UL 2YD9A 4JVPA 3S3DB 2BVEA 4PWGA 2QEXP 2XUWA 3JVFC 1VB9A 4ABWA 1KPVB 3UAJD 1TCMA 1H0TA 1I9RL 2BZCA 2G0KA 1YEEL 1MCWW 1P6AB 3RL0g 1NAYA 3BUQA 2B9BA 3AE5C 3FQTB 1FO0L 3HG5A 1VFOA 4Z7UF 5BMFL 1LP9F 4X4MA 5GQBA 1GOFA 2OS7A 1ES0B 1GCYA 4C46A 3I9GL 1PKQE 2NYYC 5I1CL 4RFEA 3BZFA 5DHEA 1FE6A 3QUXB 1EDJA 2F7RA 5EOTB 1GL4B 2YGPA 4PJGE 3RBXA 5DR5L 5DLML 1X6LA 1X4ZA 2XN9A 2X70B 3HI5L 3GBML 4YXHH 5GISH 3D1MC 1JDDA 3IKKA 3PJLA 1A14L 3MBED 3QIBD 2VDKH 2X4QB 2IPKA 3A5TA 3ZYZA 4Y4FA 3HJEA 1QYGL 4K7PL 5IBLC 3UTZA 2HX7A 3M9BA 1R75A 4KK8D 1JZ6A 2P5ED 2QSTA 4JPKH 3NN8A 4W6YB 1MZZA 4KVNH 3IJYA 3W39A 5C1MB 4AGNA 2E4TA 5T1KA 5C9JB 1CTOA 1IE4A 3ZKXC 2DTML 4HW6A 1RJZA 4ZUWB 3UGUA 3UPAA 1K3ZA 4L2LA 4RMWA 2VH5H 4AYSA 2Y6SD 3T04D 2H88C 4I89A 3VXRA 2HG0A 2YQ2A 1NAKH 2FTAA 2ZCKH 1OZTG 2J8OA 4J8RB 1X5HA 4P2RA 4FJ6A 1XR8B 1F4HA 4UNUA 1RHFA 4XMLH 1ETZA 3S34H 3WHXB 4IRSD 4EXKA 5T1DL 3GSQA 4PMEA 2MSPA 5CD5D 5MEQB 1UZ8A 1XZ0B 2VQ4A 5GGVL 2I5YH 1IIKA 2F1EA 4LL9A 2FDBP 2Q3ZA 5F9WC 5EU5A 2VISA 3L9YA 4W4OA 4JQXC 2NY3D 1RPUA 3ENEA 2BVPA 2R1WB 4WY7L 1CFSB 3RE0A 3LIZH 4F3FA 3IDXH 2JK5A 4PH8A 4AE0A 2CO4A 3JT2A 5FFGA 2ZICA 2DYPB 1KJVA 3KNBB 1ANUA 1XGZA 4NIYE 4PB0H 4XC1H 4XN8A 4YGAB 1E30A 5ADPH 3TBTB 1C08A 3JSSA 3QH3A 5J57B 4V33A 3HNTL 1AHWA 3A4AA 4GW5B 1AIZA 4HLEA 4S10A 3BUTA 3F5HA 3DWTA 2WZAA 4JREC 3SGJA 3CNKA 2EEBA 4KJQD 1NCBH 4WK4B 5FUCE 2J44A 3FT2A 4NQED 1BOGB 3MTUE 4Q2ZB 2DQHL 1J1OL 3KPSD 3RY5A 5JLZA 4G1MB 4JFXB 2XG5A 4BXSV 2PW2A 4AZ8A 2O5YH 4U7JA 2XZZA 2VO5A 4NYLB 1CFBA 2DWDB 3KCWA 4O51B 7CGTA 5DK0A 4A04A 2WUBH 2YHGA 4BINA 1BXXA 1W0VB 1XIWD 4WI5A 3ZPDA 1DCLA 1XF3B 4WFEE 8FABB 2R1YA 4HKZH 3FTXA 3F7YB 4NO2A 4OB5L 5FXCH 3F85A 5JA8B 4OZIF 3WL9A 1W2KT 1OFCX 4OJYA 4PGBB 1NGWB 5J7CC 4PW4A 3MODH 1KB3A 4Q4EA 3ZO9A 2ISDA 5B39G 3RIKA 5DZ9A 1DJXA 1FIGL 3U9UA 4QRAA 4TULH 2IV8A 3SODB 3K4AA 2WSFH 4BZ1H 2CK0H 1INEH 1F11B 2R2HA 2ZUUA 4OZGB 2XZAH 4AMKH 1N59A 4R7DB 1RXLA 1FNAA 5E2TL 3SBRA 2CA3A 3ARBB 3GINA 1NDGA 1IO4C 5HGDA 4XNZC 3TWCH 5D2NA 2J21A 4KMTH 1NL0L 3CK0L 4OJAA 3KL0A 2UWJE 4PJ7F 3QIWA 4PRIB 3K6SB 1OCWH 1ZHLA 2YWYA 4M6AA 4U31A 4TV3A 2XETA 3T8XA 3RU8L 4F7PA 4GNKB 3D3VB 3FTYA 3A0HH 3QCVH 12E8L 4L9LA 1J9QA 2VDLB 2FYUD 2YK1H 1H3PL 1F56A 1TO5A 4UDTB 5E8EA 4ZSOE 1WFJA 1AGBB 4UUJB 3V9EA 5L0QC 2YRLA 5CEZL 3GMLB 2E75B 4QNPF 2XTLA 5GGQL 4QAWA 4XMPL 4U7SA 1HL8A 3SGEI 1U8PB 1U8LA 5FO8A 5GRZA 1NAML 4Z78A 2PPCA 3IMSA 4ZPTA 1IARB 1PTZA 4KT0J 3QORC 3QK0A 4N25A 3VXUE 2EKSB 2F0CA 5AOMA 3RA7H 3NGBC 3RVVC 4XBPA 2EH7H 4KUZH 3PWUA 4YO0B 2BCKA 4X4XB 3FS9A 3AS0A 1K2DA 5APXA 4R4MA 1ZLVH 3WY3A 4D0CB 1BCCE 1JE6A 3L7FA 3BISA 1EZUA 5EO0B 3C09C 4Y19D 1CICC 4HIJB 1NFDB 2A77H 3FFOA 2OLDA 5DJ0A 3FFDB 3C08L 4TLUA 2UY6B 4LCYB 5C70A 1FVCA 3QJRB 4KDTC 1OALA 2X3BA 1A5FH 1E9QA 4UB0H 5D55A 1Q81Q 1FDOA 1E42A 2OTUA 2QDVA 1KLUA 1KPUA 4Y16A 4EE2A 3NPSB 1DVFA 3V0GA 3V10A 2ZONA 3ZL4L 1Y1UA 3RWHB 4F2FA 3T6XA 1MRCH 3HUJF 4L73A 3BT2H 4FEIA 1AZZC 1B9KA 3DJ9A 4TVPH 2MQ0A 2W9EH 4HUMB 3QULB 1SN5A 4HLZG 4LVNC 5GHWH 4ZFGL 4P2YA 3BXNB 1I3RA 4XN2A 3IXTB 4O02H 1Q4NX 3C5SB 1ZLWK 3S1KA 1TITA 2AV1B 1T7VA 3QNYB 4YZWA 3VI3B 4XI5C 3QDJB 3JTBA 3RURA 5IMLA 1GK6A 3C2AH 4A7QA 5IY5B 4MJIB 1CLCA 1BX2B 2B20A 3ECUA 5C08E 4PJBA 4PJ9B 4PFEA 2X2IA 4GI8A 5C3IA 2XXFA 1IC5L 1FFOB 4EUPG 3RWDA 3VD4A 3VD7A 1FC2D 1QKZH 3RVUC 2GBTA 1ZLEA 1S72P 1P5UA 1QFWI 2GSIA 4AQAB 1XHHA 1J5OL 3HZYA 4M5ZH 4YX2H 1U57A 2BY2A 2NDFA 4UT9L 1I8KB 3NRFA 2YFOA 4NT6B 2PYED 3EYQD 4X5LA 1IQWH 1SN2A 4HALA 3FSVA 1INQA 1UXLA 5E5MB 4U2YA 2JCCE 1ZK5A 3WIIL 1PEWA 3M7OA 5ITFA 1FCGA 4TOYL 3N42B 2YIUB 1UT9A 4YDLC 5F3HA 4LRNL 3BCFA 4PGEB 4JN1L 4LCCC 1ZHNA 5J8OA 4ZXBB 3HAEB 4JM4L 3S5LG 2PXYC 1AGFB 3GXPA 2WVSA 3CWBD 4IOSA 3EYSH 3OB0K 5DTFB 3UZQA 3BAIA 1CTMA 1I85C 3FRUB 5DD0H 1L0ND 3II3A 2I7SA 3LKNA 3QEUB 4OCMC 5FM8A 5JDSA 3RKPA 2ICWJ 2WSEJ 2NY0D 4XMZA 3LKQA 1D6VL 3VXME 1Z0NA 2OJZH 3AADB 2SPZA 4XO5A 3STLB 3S8GB 4P4KC 5EOQH 1E50A 1RZ7L 4X5XB 3LXCA 2VLLA 3MYJA 1JY3P 1KENL 5I8CB 2Y2YA 1IFMA 3PV7A 3FCSB 3K2UL 1U3YA 4J5VA 1I1FB 4P2OA 1G9NC 5KSVB 1Q86Q 5D4JA 4FZEH 1QFPA 1SYVA 1MFTA 2L7QA 3PWJA 2BJMH 3VXTB 5KS9F 2EDFA 2ITDA 3A6CH 5D1QC 4ELDA 3ZKMD 2D2CC 1BQUA 1G6VK 1KXTA 2ZSVB 4QLWA 1NTKD 3P3YA 1VFAA 4NFBA 4NAQA 1A4BA 1MHEA 3T2QA 3ZE2F 3DUUB 5FDWA 1OL0A 4RBPK 2XYCA 2O5XL 4ZI8A 3L71G 3IPEA 3NCYS 4LGRB 4GSXA 4LRIC 1SFCD 4J3UA 4EYYQ 2G5BB 1MY7A 2G9HB 1ZXQA 2BP0A 1LD9B 1OTSD 2I1KA 2YAFA 4C4KT 4PR5B 4U1GB 2ZX8A 1KPVA 1FZAA 2K7PA 1HGVA 2X3CA 3A4FA 3GRWH 5TQ2H 1R4XA 1DQIA 5T1MB 1AO7D 1TU2A 3TNMB 3HC0B 3FQTA 3O11A 3RWJB 4GAFB 3I50L 3REVB 1WFTA 1CZ8L 4NZRL 2DQTL 3MCKB 4X0KB 1EMTH 4OJFH 1MFAL