4RESB

Crystal structure of the na,k-atpase e2p-bufalin complex with bound potassium
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
288
structure length
288
Chain Sequence
b'IWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRFRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Structures and characterization of digoxin- and bufalin-bound Na+,K+-ATPase compared with the ouabain-bound complex.
pubmed doi rcsb
molecule tags Membrane protein, hydrolase/inhibitor
total genus 50
structure length 288
sequence length 288
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4resB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 4resB02
1GD2E 1GZLA 2R5DA 2XV5A 1GU5A 2H7HA 5AVWB 1CI6B 4C46A 5APYA 1A02F 4RETB 3I5CA 3V4QA 1DH3A 3HE4A 3V5BA 4C7NA 2C9LY 3HE5A 4LC1A 3M0DA 5AVVB 1CZQA 3VYIA 5APSA 4JYCA 4I2LC 2W6AA 3SWFA 2C9NY 5APQA 3NTNA 5AW1B 5AW5B 4EOTA 1MUUA 5AW4B 3VMXA 3KDPB 1J2JB 3TNUB 1A02J 3T97A 2P7JA 2WT7A 1G2CB 2N9BA 2Q3IA 3NFQA 5CMZA 3M06A 4AYCA 1HJBA 2WPRA 5AW0B 1JNMA 3TNUA 1X8YA 5APWA 5AW2B 5AVSB 3KQGA 1JUNA 3P7KA 2XU6A 4GKGA 2WTYA 1H89A 4I6MC 2QM7A 2YNYA 1FOSF 3MD0A 3P32A 4AQRD 2E42A 1SLQA 1CI6A 3LIEA 3VMZA 4B86A 1H8AA 1OXZA 3M91A 1SP4A 2P2UA 2KP8A 4KHXA 3TYYA 5AVQB 5AVUB 3IR9A 1H88A 4HYTB 2R32A 3A2AA 5APXA 4AUWA 3VN0A 2WPQA 3VMYA 5AVXB 5AW7B 5AVYB 5APVA 4XE5B 2IPPA 3TK1A 2VRSA 1MV8A 3WGVB 3O8ZA 5AVTB 1NWQA 2Q7CA 3L35A 1NAFA 2R3CA 3VTPC 3B8EB 3OAKA 5AW6B 1HWTC 1HBWA 1GU4A 3LIDA 5AVZB 1YYCA 1FAVA 1T2KD 3HE4B 2ZFCA 4C7NB 3L36A 2JJLA 5AW9B 3A3YB 2P67A 2BASA 3HE5B 3NXSA 4RESB 1GK6A 1S9KD 3L37A 3M9HA 3A7OA 5AVRB 5AW8B 3M0AA 5APUA 3V4WA 3WGUB 2XZRA 1KQLA 4DZOA 3HTKA 2Q5UA 1HUCA 4JYBA 2WT7B 1T2KC 2R5BA 2Z5HA 2Z5IA 2YO3A 1IO4A 2QM8A 2ZXEB 3A5TA 1GTWA 2E43A 1CSBA 3NMDA 3P8MC 4M3LA 5AW3B 3UIAA 1FOSE 4GT1A 1GK4A 2W27A 2WWWA 2WPSA 3MGNA 1MFZA 1OWAA 3M9BA 2YO2A 5APTA 1S9KE
chains in the Genus database with same CATH superfamily
4YO0A 1CFBA 1OQOA 5F9WC 2VXUL 2ZICA 3KZIH 4FLSA 5F7HA 4XWGH 4TSAH 3V4QA 4JUTA 4PJ0H 5AOKA 4KC3B 4E5XB 3PRZA 1BAFH 3WS3A 1EHLH 1N73A 1PFIA 3FCTB 5E94B 5IF0A 1RULH 1T1XB 2EE3A 3VXTA 2ZSVA 2YPLA 3GS0A 4QOKE 2Y0EA 1GZPA 1NFIA 3AG4B 2VN7A 4R4FH 3BHBB 1IGJA 3ZTNL 1KFMA 5L7XL 4GG6F 1PY9A 5LBSA 4K3EH 2P5WA 4H2AA 2OMTB 1YEIL 4KHXH 5TQ0L 3WOVA 4JN2B 2YFOA 4AVIA 1S1CX 2HPTA 3MGOB 1CPUA 1MAML 1SHSA 4X9HA 3ULUC 3G04B 5IROD 5IJBC 2HYNA 1T7XA 2FGWL 3LKSB 2YXFA 7CGTA 2X1OA 5CR8A 1J1DB 2UY7A 5JXEA 4M5SA 3MLUL 4NRXB 4Q9CA 1HIML 1X5AA 4HIJA 1URQD 1OAKL 1TKWA 2N4IA 1B0RA 1QPXA 3EYQC 3IPFA 3U36B 3WFBL 1Y6NR 4ELMB 1NC2B 2OR8A 4HJ0D 4AQOA 1OXZA 3QEUB 4FRWA 1I7TA 4LU5H 1IM9A 1U95A 3GLEA 3TIDA 5FS5A 4IRSC 3KBFA 4NQDB 2B2XH 4PP1D 1LDSA 2HJKB 3ZR5A 3AE6C 4MNGE 3V4PH 3KZIE 2YD6A 1OALA 3RL0C 3HHRB 3IKKA 4ODHH 2W65A 4PJ0E 1V8HA 2OI9B 3VDCA 5EC1A 1E4HA 1JZ6A 1SZNA 1PZ5B 3RKDD 3TCXA 2FWSA 4XE5B 1Z9SA 1ZLSL 2PCXA 4YX2L 3FT1A 4BXVA 3FT4A 1KJ2L 3OMAB 1TTCA 2ZCLH 3DX6B 2O26U 3OAZH 4ZSOE 5JOPE 1EMTH 1JVKA 5E6RB 3S9DB 1NGXA 3HI5H 2JKSA 4L4VA 4UNVA 1CGSH 2W9EL 5GSRA 5IFHL 1DVFC 5DHEA 1TZOA 2OMUB 1WFTA 4JR9L 5T5NF 2ZKHH 3LSOA 1VQ8P 1TJGH 2P10A 4ENZA 2J58A 3EYUH 4I7ZB 3HPLA 4N0FA 3U9PL 4A2MA 1OSYA 1M9SA 4JEGB 2XWJA 4LCYA 3GHEL 2RKLA 5CBAA 2DJMA 4ZOEA 1G43A 1MCFA 2CJ3A 5I74B 1NCNA 1KIRB 1XFPA 3NCYS 5I6PA 1E43A 4RGNC 4P9MH 4XAWL 3TF7C 1FG2A 2H4EA 4UDTA 5GGSY 1OP5H 1BHGA 3EWKA 1CF8H 1DSFH 1HQRB 1YSOA 3U7WL 5IHZA 1LE5B 1R5WA 1FFPA 2BNUB 3KCPA 3KGRA 4AL8H 3OKDB 5EOTA 2DQCL 1KJ2B 3S34L 1A02F 1P4BL 3FB7B 4Z7QF 5IROA 1PIFA 2OW6A 3D52A 3C8KA 4K2UL 4UTBA 1FLRH 4ISVA 1ERNA 3WY3A 4OV6F 4M1DL 1WD8A 1VDFA 1P6FA 4FLRA 1H0TA 3CLWA 4KROD 1URQA 4LEXH 1FV1B 4EKXA 5KAQG 4Y2DD 1MCWM 1I85C 1PDKA 4UT6L 2PN5A 5IVXF 3K46A 3C5ZD 4F2MB 1KCRH 3NH7L 2HA1A 1AKJD 4G9FE 5HVWA 2JI2A 3I85A 3PUCA 1W9XA 3LDBC 4MKTA 5I1KL 4C7RA 2K37A 5L6YL 1CT8A 2XWBB 1JUNA 4MCYA 3CVIH 2JLLA 2Y3NA 3B7SA 1HNGA 4TV3A 1MJ7L 4O2EA 1D5MA 3BE1H 4XNQA 1A9EA 1PSKL 3DJTA 4FCHA 1UUNA 2UWEB 4FDWA 4YDMA 3IMTA 1KPUA 5M7QA 3UBFA 2QDVA 4OLWL 4FNRA 5D2NA 1P69B 2IOMA 4Q4EA 1EC5A 1KYOJ 1N9PA 2YLHA 3G6JA 3JTTA 5FA4A 4DGIH 5GS0L 3RBXA 2QVMA 3CCHB 2R8SL 3EQ2A 1KYOI 2YD9A 3I6LD 1K4CA 5B8CA 2DM7A 4L8BB 3MJGX 2L7UA 1AS8A 4KKLC 4L8DB 2WWMD 3PJLA 1BBDL 1KN2L 5ILTH 2EAEA 3GUTA 3I75B 4U1NB 5I8EB 4DUWA 2AXFA 2VRKA 2P8LB 2D7TL 5CHNA 1NAFA 1EXJA 5CZKA 5EA0H 1NKGA 2ITAA 1NTMG 1T0MB 2E7CA 3VXPB 1OARL 1DVXA 1NJ9A 4O02L 3SO5A 1E42A 1GHFL 4XOEA 1BYNA 3QUXD 5TDNA 1PP9E 2XOTA 3FUJA 3ESNA 4GBXD 2VDLH 4Y19B 4F7MA 2VR9A 4PMEA 4Y4HD 5CZVH 3L13A 5J7CC 3U1SL 3W2DH 5DRNB 4H8WL 1K8DB 3QPXH 3DDFA 4ZFOA 3H56A 3QJHA 1RD6A 1DVTA 1GYUA 3QWRD 3QI9C 2HT3D 1OAUH 1Q2NA 5D7KE 3HC2A 2WT7B 4AEFA 4K0OA 4XPTH 1HK6A 2J5WA 1NIDA 1ZKAA 2AQNA 1A5FL 4AJWA 3P73B 4XVTH 3K6NA 4G8AC 3TFBA 1W0VB 3FTVA 3AQZA 4PGZA 3MRGB 4TS6A 4Y2DA 4YDJA 2V17L 4DOHB 5C07D 4MMZB 3VFSA 5I75C 5E23A 3CCJP 2HFTA 3C5ZA 3G4SP 5F88B 1MFAH 1B2YA 2YD5A 5CP3A 3V7AG 2GW5A 3O3BA 1AKJA 4GRWF 1MQ8A 3I02B 1KQFB 3KEHA 5FHBL 5JUEH 4Z7UA 4RETB 2Y7QB 2AQ1A 3LKNB 4U3SA 1Q0XH 4O02B 1P84E 1BZQK 1GGTA 4D6TG 4EXKA 4UYQA 5ANMA 4WW2C 4I2LC 4PEEA 3PWLB 1M1XB 3DO3A 2X1XR 3IDMB 8CGTA 4NJAH 1D5IH 2JJSC 5FO8B 5T1KB 1INQB 2AI0L 4HVBA 3H9SA 2KS0A 2NDFA 4U7KA 2E3VA 4PJXB 3H1LE 4YK4C 1SLVA 5CN2A 5HGHB 2P28B 3HMWL 1M9WA 3MRDA 4KBPA 2HYMA 2MOQA 1PPJD 4XN8A 3V0HA 3A4FA 1A7OL 1G9ML 2R23B 1EEZA 3MOBL 3HZKB 4KQ3L 1IGFL 3H1IG 4OIFA 1U3ZA 1JWUA 3ZO9A 3KQGA 4IL6X 2ZUTA 1VL2A 1JNNH 2NZIA 4WTQA 5LKNA 2W38A 4KV5E 3H1JJ 1SMOA 1UM5L 3AWFA 1RQUA 3ARDD 1JXKA 2M8RA 2VOTA 1CI6A 4PGDB 2YEQA 5GGTA 3NFSH 2OMYA 5DSCB 4J5VA 3CMAP 3NCYP 5DZPA 3DXAE 4WNJA 5GGUA 1MCPL 3VUAA 4BGLA 3QUXA 1FZOA 1R5IA 2H3KA 4ADIA 3C8HA 3TBTA 2WO4A 2BMKB 3KBEA 4B9CA 1EAPA 2NX5D 4GBXA 1WBYB 2FJHB 4E9WA 4Y4HA 1FE6A 3FOLA 4XWGL 1DZBA 2N1TE 4TSAL 1RZ8A 4GKNA 4K7FB 3UPCA 4G5ZH 1UENA 3VNYA 3SSUA 1FVDA 3B2XA 1BAFL 3MLTA 3Q8FA 4ONFH 1AQHA 4PJAA 1JEKA 4BCZA 1EHLL 1WZMA 2W88A 1NTDA 1RULL 3NJIA 2X6MA 1S7RA 3QWRA 4GPVA 5EEXA 4Q6IC 3I2CH 3QFJD 5EEUA 3ZLQC 3MXWH 4R4FL 2BS71 1BSHA 5CINH 3GKZA 2EIMB 4NN6B 4M7LH 4G6JH 5HYQA 1F1DA 2BM3A 4K3EL 5GXBB 3TEYA 4KHXL 2WXPA 1FNSH 2OXHA 4FZEH 4LLDB 5C07A 5AW9B 3NAAH 1KILC 3NN8B 2ZWNA 4DP5X 4K07A 2R4SH 1U57A 3EO0B 4NRZA 1JGIA 1ODAA 2FHFA 1L9NA 2WWKT 3FW6A 3GHGA 4ATTA 3INOA 4NQSB 2LGNA 2XWEA 3O41B 3JCUE 1AGEA 1MCKA 4FG6D 3PL6C 2FO1A 1SJMA 4JW3A 4FYRA 2EO1A 1PD0A 4AYID 1IJDB 2YJQA 3HD7C 2IANA 4I0CC 4B41A 2I9TB 5C39A 3ES6A 2P58A 1YUKB 4LU5L 4MCZA 4MNGB 2O3JA 3TA3C 5EDSA 4ONHB 5DVLA 4N2KA 3OR6B 2VC2H 5D7JB 4ODHL 2ZZUT 3O2VL 2AEFA 5JDSA 1D3CA 4N26A 4UBDD 3C9IA 5DJ8A 4ZSOB 2OYOA 1QSFD 2NQDA 1HQ4B 1KXTB 2QSQA 3HE5A 1EZVI 2ZCLL 1YN7B 1JE6A 1OP9A 3KNBB 5D8JH 3GXUB 3S4SG 1EMTL 5ICXB 1ZLVK 1MH5B 1BPLB 4DJMA 3MYJB 1QSVA 4JRYD 3ARDA 5GIRB 1AGBA 3HI5L 5C7ZA 1CGSL 4YDLC 1CFNA 5I82A 2Y7NA 1P7BA 4AVJA 5A3IC 2J6EA 4UNIA 1FGNH 3W57A 1SXSA 3OPUA 3BH4A 2ZKHL 3QIWC 3B4NA 4I18A 4HUXA 1DX7A 5JW3H 1TJGL 3QIUB 1PLCA 2NY4B 3PH0A 2NX5A 3EYUL 3ZUNC 4NGHH 2FECL 2P5PA 3RWJB 3KJ4B 3GSUB 1G4MA 4EI2A 1F11A 4Z3EA 3L5XH 4GW4A 4ZDHA 2R27A 1FYTE 1GOFA 1CGVA 3ULUE 2NTSP 5D2LE 4P9ML 3ZE0F 1RHZB 3QFJA 1CF8L 3CSTA 4LOFA 5L0QC 3DHMA 3IDUA 1DSFL 2EDBA 1L4AD 2GK2A 4AL8L 3R8QA 1WFIA 2X4PB 5E4EB 4A7TA 3V0WH 3ROLB 1G7PA 4DP1X 2YGQA 5C0CD 2QQQA 1FJ1B 1NBZA 4AUWA 2ATKA 3TVMD 4DKFH 1JV5B 4L9DA 4HS3A 4JHAH 4WQOA 4AV5A 1FLRL 1OSZA 5E70A 1XAUA 3L75G 4LEXL 1QASA 4D0DB 2CJUH 3ELAT 3OAKA 4FGMA 4ODWB 2ADJA 4I85A 5E8DH 1Q1PA 2GJRA 5TD4A 4S1SH 3Q6FB 2Y72A 3KLAB 1TJIH 1PAMA 1KCRL 3L6FB 1QI3A 4M8VA 1IAII 1KF9B 4NO0D 1DVQA 3HLAB 2K9FB 3QH3B 2BFGA 2WQSA 5I1AB 3BRFA 5TGBB 2IBZG 1HXKA 3CVIL 1AO7D 2Y6TE 1ORQA 3CCUP 5JNYB 1VQ5P 1BE3J 1KTBA 3BE1L 4GMSH 4ZNEE 2A6IB 1QSFA 1VFUA 2BNQD 1O6VA 1GL2C 4F7TA 1NCOA 5DD6A 1ZE3C 4IFDK 3JC22 3OJ2C 1OPOA 4JRYA 4AGNA 4DGIL 5F6IB 4OM0H 2FR4A 1KACB 4J3XA 4WFHE 2DZEA 3VWKC 4RGNE 3HI1B 5GGRB 5BS0E 4P5RA 1SYVB 3BZ4B 4CSSA 1FNGB 2B5IB 2GTWA 1CVSC 4IMKC 5PCYA 4C58B 1WGOA 4KMTH 4U05A 3D2UB 3HBGA 3HMXH 5EA0L 2PCPA 3SWYA 1NGZA 1CGTA 3SPVB 3DROA 5MHSD 2CJTA 4PJFE 1EH9A 1EANA 4ELKB 5F9JA 2DIBA 2WLNA 1H5BA 3A0BH 1P5UB 3MOAH 2CDEA 3TBYA 2CO2A 1UIXA 3FO9A 5G5DA 2FIRT 2VDLL 1L4AA 5IB4A 1CW5A 1VFBB 1XF3A 4BQ6A 5CZVL 4OZIE 3W2DL 4P5TC 4WVRA 4N0CD 5ESQB 3QPXL 3HC3H 5LNGA 4DPAX 5C0CA 3MA7B 2OTPA 3QEHA 4OCNC 3TVMA 3WFHA 1UJ3A 5KVEH 2DBLH 3HB3D 4XPTL 3E8UH 1U8JB 1OSPH 2Y6SD 4W70A 2OMVA 1DDHA 3KVDD 4L4JA 4XVTL 3G71P 1PEWA 3G3ZA 4HKZH 1HT6A 2C5DC 4MCNA 2MNUA 3ILQC 4PJCE 1M1KQ 3LTVA 3SKNA 1N8RQ 4KKNA 1MFAL 2ADIB 3BCCG 3NRFA 1D7CA 2NTFB 5C7XH 1AZRA 3THMH 2IBZY 3MRNB 4JZOB 2A1WH 5E79H 1BQLH 2VE6B 3FUKA 3GPSA 4NO0A 5CJ8A 3FSZA 4ABVA 5JUEL 1XGPA 2GPZA 4XBPB 4YTPC 2I69A 3BP6B 3QS3A 1Q0XL 1AO7A 2YAPA 5LGJA 1HWGB 2ZXCA 3C9NA 3DV4A 3D0AA 4OJAA 1IJNA 2Z91B 3ZZLA 3VCLB 1BLNB 2BNQA 2W92A 4Q56A 3ATFA 1VIWA 1D5IL 2VDLB 4NJAL 5DLMH 4POUB 5ENWB 4M48L 1P4IH 5C0JB 2AV1A 1D7MA 3DX3A 3GMRB 3HE6D 6FABH 1JY3N 3CX2A 3ZTCC 1UVQB 3S2AA 3VXUD 2QQKH 5DJAA 2CHXA 2L4OA 3EZJB 2HLFD 3CDYA 2XWTA 1HGVA 2YKOA 1JNNL 2GVYA 1QVGO 4G1MB 4XX5A 2XN9E 3OLDA 3TN0C 3V2PA 1T3JA 3B2UD 3RZWA 5B5EH 1UH3A 3OZ9H 1DVYA 1I7UA 1E8ZA 1XSIA 3NFSL 3FU6A 2RAMA 1GS7A 1DEEA 1WK0A 3QFDA 3MAWA 5B4MC 1QKZH 2K70A 5CF3A 4PREA 4XRCB 2IBZX 2V2XA 1LLAA 1UM6H 2H26B 3L7FB 3P2TA 1KYAA 1UA3A 5APTA 5AL8A 4OZHE 2OX5B 1LP1A 4GT7A 4YSAA 1F3JA 2IALB 4OGXH 3VG9B 2WNKA 4G5ZL 4PLJC 4G8IB 3B8YA 1QHQA 4ONFL 5E1GA 1IBFA 1N19A 1AHWC 3MRIB 5I66B 3Q13A 2WWOA 3I2CL 3MXWL 3TNMB 1VFAA 3SWFA 3NPZB 5CINL 5FKPA 3ZHFA 4M7LL 4G6JL 3VMOA 4TNVK 1HOCA 1FNSL 3F5WA 4FZEL 1UXWA 1K2DB 1IFGA 2CDFA 3NAAL 1VEPA 1U8OA 2NY0C 5TJWK 2XU9A 4M93C 5FYLE 3WIFB 2R4SL 1JNMA 3HUJA 1AG6A 4YC2C 5F0JB 4D9LH 2P45B 1GC1C 1G9EA 3LIZL 3HTLX 1FN4A 3LRSB 5JIMA 4U1GB 3RRQA 3P4NB 1RQ5A 4MN4C 5B5EE 3T6QC 3BSGA 5DDHB 3EAKA 1Q9OA 2Q9OA 5E51A 5T5NG 2AXHA 4B96A 1SPDA 4P57A 2YXWA 3EXLA 3KXFE 4R3SA 1ZHNB 2DWSA 2XXGA 2X28A 1WA2X 3MV9E 4P8QA 2OV0A 2EDOA 2X4NA 2YAMA 4H4NA 1A7NL 3HS0A 2CUIA 4MD4A 2PP8A 1IRAY 4U6TA 4C56B 3C60C 2P2UA 4CN6A 3HE6A 1AG0A 2XDJA 2VC2L 5DC4B 4GQQA 3SCMB 1JGEA 1LHZA 2ICWB 3AY2A 4LLUB 3VXUA 2OYIB 2OSWA 1FHGA 3EJJX 1SQBD 3L1GA 3GSNA 5DYOA 4DO4A 2JH2A 3ERXA 5D8JL 4RCAA 4KNSA 4PY7B 3FH8A 3OQ3B 2DBJA 4D8PA 4JGJA 3L5HA 1XWVA 2BVQB 1AQ5A 4IU3B 3LV3A 3N40P 2A9CA 1FGNL 1SQPG 3EJSA 1EO7A 1EZSA 3C8VA 4N9GB 4Y5VA 2JJVA 4WY4B 1VGKA 4NERA 5B1JC 5JW3L 5KYYA 1TZ8A 4F9PC 4IU2B 2IVFC 2BWQA 4RSYA 5D1QD 4NGHL 1IK7A 4NNXA 3BVNB 2UWJE 3IAOA 4HIIB 5HYJE 5D2LB 1JRHH 1ONQA 2VXVH 3CQPA 4XWOC 2OJEB 1XMWA 3L5XL 5E8OA 4DWHA 3S8GB 3PFQA 2PWDA 1T2KC 1JPST 5JMRA 2EUVA 1E4XH 4U6VH 3KLHD 4G8GE 1ES0A 4WI6A 3MRLB 4JE0A 2VC2B 2HX8A 4E41E 4N3YB 4LFHD 3K6OA 5FXCH 2DQGH 2DIEA 2WTOA 2E75B 4NPYB 4OI8A 2HRPL 4X7FC 1HU8A 4GSRA 5CGYC 3V0WL 1H15B 3VYNA 4EOWH 3DK0A 1N86A 1CC3A 4XCEA 4Y4FB 5DRXB 1RF1C 4DKFL 4XO9A 4MQ7B 3LS5H 5LO7A 2CJSA 1ID2A 4WI9A 3ZXAC 4DGYH 4I1LA 3S6CA 2BIQA 3F83A 3LPWA 2CJUL 3LZPA 4TVSa 5I6NA 5E8DL 5L9DH 3CC5A 4IIZA 3ULSB 4OV5A 1TU3F 4KJWD 2K9UA 3LKPA 3ZMEA 2XPGB 4G9DA 4M56A 4S1SL 5CZXD 4JPKH 5K9KA 4G6FD 5JPNB 1TJIL 3ZTJG 4E5XA 1DLFH 1NOLA 3D12B 1KB9E 5FYKD 2L0DA 2OZNA 3O8XC 4H2CA 2A2QT 1VSCA 2IV8A 3UBXG 1NTZE 1NCGA 9PCYA 2WPRA 3IJ9A 1DIPA 4UOJA 3VXRE 4GMSL 2F74B 3B2VH 2ZWSA 1M2OA 5CU9A 1J1EB 1FZMA 2XN0A 3QDHA 5F3FA 2K1MA 3DC0A 3KPSE 5B3NA 1WAAA 3BJ91 3U6RA 2G60H 2K8MA 2H9GB 4JPIA 4PJDF 5LJYH 1BF2A 4JMNA 1NO4A 2QVIA 1T4KB 3E3QC 1RK1B 3T6VA 2V3FA 4YX2H 1Z9LA 2BOCA 4OIAA 4OT1H 5I1DB 3U36A 1YJDH 3R1GH 5J89A 2ZKMX 5KZCB 5ESAB 4TUJB 2WSCH 5CJQH 1SQXG 1CICC 3B71A 4P06A 1KIUB 5DQ9A 2Q6WA 5D1QA 2WXOA 4RFNB 4KMTL 3H1JG 4PJFB 4UZSA 3MV7E 3WGVB 2J71A 4W93A 1VEOA 4DP9X 5GS1C 1PG7X 3ETBF 2Q86B 2A3TA 4X5WB 5J1SC 1KZYA 1QFOA 3MOAL 4GEJA 3T8MA 1SMDA 3OHXA 4XBEH 4C4UA 1KYUA 4TLTA 5ADOH 3FRPB 3NEXA 1YDPB 2OPCA 1BDDA 3O6KH 3T0EE 1CE6B 5CD5C 3VH8A 1TF4A 2A9BA 4XMUA 1AMYA 2PCFA 3ATDA 1MCCA 1U2CA 3HC3L 5J6HA 1OP3H 3Q01A 3UDWA 1FE8H 1I1AC 4CJ1A 3O6FB 5KVEL 3OW2O 1JP5A 3K4ZA 2DBLL 1G7IA 1ET5A 3E8UL 1QFUH 1OSPL 1AQDA 3CBKB 3DGDA 1XR9A 2XLLA 1KELH 4R4BB 3FPYA 4PJCB 1CUOA 3OVUB 2NZ9D 3L95B 1SFCB 3NCEB 4WU5A 4QWWD 5K9OA 3UBGA 3EJCA 4APQD 3FSVA 2ROYA 2GUOB 1KFGA 4YHOH 5C7XL 1BFSA 3THML 2A1WL 1HHHA 1HI6A 1RF0A 1Y8AA 1BQLL 3GK8H 2MKVA 1YUHB 5F89B 2HVJA 5DHDA 4JFEB 4FYSA 1J0HA 5EUOA 1E4KA 5APYA 3QNYA 3U30C 2WKLA 3B9KC 2MQCA 1KV4A 2OR9H 2Z4TA 1S5LX 1TQCC 3U0TA 3P0YL 3CK0H 4POZD 2XSKA 3WU2H 4Z9KB 5JO5B 3P0GB 5D1XD 5DLML 4A37A 3MTUE 3KL5A 3T0BA 1P4IL 4F9LC 4B5EA 1GS8A 3VYPA 4QRFA 4LEBA 1CXHA 2AJVH 15C8H 2R7EB 2VDOH 4UTAH 4PRHE 2UZYA 4ZFFB 2QQKL 3L3OB 3NIGB 2CM6A 1J9TA 2CLRA 5LCVA 1MREH 1ZHKB 2CLZB 2XN9B 4P07A 2D7OA 4G1EA 5E00A 1JK8A 1JV2B 3TT3H 4DVBA 2GSIB 3LXBA 1AH1A 2CRIA 1W72H 1EBAA 4CC4A 5EEZA 1TQVA 3WS6C 3RA7H 3C6LD 4PJ7B 1KBGH 2XWBA 3CHPA 4NN7B 4C4BA 3VMZA 2NQCA 1QKZL 2KT6A 5J5EA 2MSPA 5DJZA 2AVGA 4RAVB 5F9AC 4CRPA 1GY1A 1UM6L 5IW3A 3FU8A 4F37F 1Y9BA 3DA0A 4YBLB 4P4KD 2EUXA 4FFZH 4HEPA 2DJ4A 4MNHB 4OGXL 4BJLA 3DIDA 3TS8A 4G43A 4FMFA 1IJ9A 3GBDA 2I24N 4AMKH 1VJSA 5IQNA 4Z5RA 3L2NA 1UWXH 1MFDH 4QXUH 4AYFA 5A2FA 1IGYB 1LNQA 1ZLUH 4KVPA 3BRDA 2PPFA 4FI7A 1FZGA 4R7VA 1QWNA 3ASNB 2W6BA 4U1NA 2KLRA 1YAIA 3C5JB 4APQA 2YIUC 2DI9A 2P8LA 4FQHA 2NW3A 3T0AA 3V5KA 4DQOH 2UX7A 3BZ5A 5FDWB 3RL1B 3T71A 3ZDYF 1CDUA 1SLUA 4WK4B 4ACPA 4AKQA 1J8HB 4AY0A 5FECA 3EFOA 4D9LL 3U6XA 1F6AB 1H6UA 3UTPE 4Z8FH 1BCCE 2QIWA 2NW2B 5CCGE 4M00A 2UY6B 1AFOA 4HK0A 1ZLWK 4TYUA 4JQ0D 4K94H 4WDIB 1JS4A 5KYUA 2X2HA 2IPUK 2GIYA 3W11D 1YY9C 3P77B 2CPSA 4QOKD 4JY6B 1W6LA 1Y18A 3JT2A 4FFTA 5DD5L 5D1XA 2LXCB 3U9UB 1E50A 2HPCA 4RGOH 3ULVH 5HHQA 3PGCB 3G3LA 4ICWA 3FU9A 4PRIE 1EZVY 3F00A 1VQPP 4QHUB 2ZQKA 4GIOA 1A1OA 4I2XB 3REVB 4CVZB 1YVLA 3P73A 4Z18A 3VGFA 3QJTB 3F8UB 4KXAA 1F0LA 1NAML 2FQDA 3OC8A 4IRJC 1BE3G 4Z7NF 1CZ8H 4MSWB 1FS0E 1CD9B 2OSLB 5CUSH 4P99A 3B5ND 1IGTA 3FB6B 1KD1Q 4JY4B 2QRXA 2ZUXA 4ZFGH 3I02A 5CEXB 2VCOA 1SQBK 2XTJD 1IKOP 2NNAA 4OUUB 4OD1H 3C6LA 4OJFH 3LKNA 2QSVA 1E2ZA 3NABH 4NPJA 2VJ8A 2IDSA 3L1FA 5KJRH 3ZE1F 5IV2B 2BRQA 3ECUA 4HX1A 4QYOA 2YQ3A 4XCNB 3IDMA 5DI8A 5HYJB 2HH0H 4P4KA 2ZT9C 1JHTA 3QPQC 4NO2A 3TO4C 4PG9B 2VXVL 2HZHA 2FJGB 2XI9A 1JZ8A 1ZXQA 4G8GB 5HHME 2GSGA 4XNMA 1L9SA 3DSFL 1CBVH 3JWNC 2Y2WA 4KX8A 4PHZA 4QRAA 4YVNA 1E4XL 2R23A 2DQIH 4U6VL 5KSAD 5C09D 4E41B 3IFLH 1WZ1L 4A68A 4I0PB 1TQBC 1P2CA 3PWUA 4H0GA 2EKSA 4UQEA 4JFTA 4X99B 3ZTJH 3ULVE 3Q5RA 2DQGL 2XYBA 5L8JB 1JMXA 1YNLL 2FLBT 2BLFA 2R83A 3Q9QA 2WPGA 3MV01 3GKWH 2FUQA 1CJYA 4X42A 4B95C 1NAMB 1TT6A 3HRNA 1I7ZB 2BRRH 4EOWL 1KG0A 3BZDA 3DVGA 3MHVA 3U1AA 5IVXE 4I9XA 2XWZA 2GBUA 3LS5L 2M26A 1WS8A 1AY1H 2HFEB 4DFHA 4DGYL 4QRRE 5HHNB 1QX1A 3BEWB 4Z3HA 1J8SA 3HUSC 2GFBB 2X6AA 3PGDA 5L9DL 4Z1MH 1E4JA 3JQOB 3QQ3A 3L81A 4JPKL 4K7FA 2CNYA 4V1DE 1DLFL 4QOKA 2LT9A 5ESVA 3FO2B 2PW2A 2MOVA 1ZGLP 1KY7A 5B7MA 4LZKA 1EDKA 5C0BB 4K73A 2Y22A 5T3XH 5AENA 1OTUD 3VXRB 1HH0A 3R06B 1AZUA 4R83A 2VRAA 5FF6B 1BGYG 3L4XA 1QFPA 4ZXBB 1NTKJ 1D7FA 3KPSB 3CFIC 4LLDA 2XNXA 4QCIA 2JKRM 3GSOA 4GRWH 3UAJC 2G60L 4Z23A 5E8NA 3K2KA 3QRFM 3OLIA 1GGCH 1KEMH 2VR6A 2J88H 3MKGA 3ME0B 5EIVA 1NCJA 4UWQB 4OT1L 4E0RA 3SDDD 5IBLC 1G1YA 1YJDL 3R1GL 5JW5B 2W27A 1I53A 4BZYA 2ERJB 3AU0A 4G9FD 3WDHA 4Z7OB 3CDZB 4UOW1 1QUNA 3MV7B 1KBBA 2R9HD 4MD5A 3EFFA 1F00I 1MF2H 2FEDC 1P6WA 4Y9GA 4D7BA 5IQOA 4CU6A 4JDZB 4GIFA 4KTDL 2QADD 2GJ6E 3DYOA 1T5WA 2R1XB 1YQ4C 1L9OA 4LT7A 5KSAA 4B27A 5H37G 4G6KH 5C09A 1QRNB 2BSDA 4BWWA 1MWAA 2R2BA 3T0EB 4XBEL 2DLTA 5JLZB 5ADOL 4U3CA 3D4ZA 3TNUB 4N8UA 4PW3A 3O6KL 5KG9B 3MTRA 4PLOB 1XIWD 2WINB 4DP6X 4LPYA 3QCTH 1RVFH 2NSXA 4Z76A 1FE8L 2LR2A 3LQAC 3NZSA 2WVRA 2EEAA 3UTTB 2MQ3A 4HH9B 4KO6A 4YDVA 1XH2A 3T77B 5BQ7A 4OCRH 3BPLC 2JB6A 2NLJB 1QFUL 4YNYA 4HWZB 3ATBA 3JV4A 4AIEA 1KELL 1PZ2A 2IZ0A 3VRIB 5I6LA 3WJJA 2XXCB 3TNNB 2KERA 1FFOB 4S0SD 4P2OC 3WKNA 4MAYC 1PP9D 2Z31D 4LVOB 1PMYA 5L2KE 4LO9A 3HE7D 4NFDA 3HC4L 4KJQD 1FZCA 3MR9A 3QNZB 4NT6B 4N0UB 3V4PA 3E3QE 1JD9A 2PLTA 1FNAA 3GD1C 2FYUE 5F96H 5FKAB 3RU8H 2OR9L 2BW4A 4Y28J 3L70E 1HDMB 4KK8D 4OCWH 3S5LA 3CK0L 3S96B 1FVCB 1FJ1A 4F8QA 4TOYH 1I8KA 3CPWO 1JV5A 4XCYB 1X9RA 2ARJQ 4IMLB 3MO1B 5BMFL 1U93A 3AUVA 1UKSA 3HAEA 2AJVL 15C8L 5D7LD 4UTAL 4D0DA 3FTGA 4KKCC 4PJGF 3SDDA 4BQ8A 5LQBH 1MREL 4G9FA 1CD1A 5JOFA 4AV0A 4XMPH 1CLVA 3MMEB 3TT3L 1M56B 4P23B 3ZT5A 2BHZA 5DVKA 1A1NB 4MMYA 2IH1B 1K4DA 1W72L 2V4LA 5D9SA 4I1RA 4IGBC 1L6PA 4WJ5B 1LTGC 1B88A 2WQWA 4LSTH 1P84D 3RA7L 1LK2A 5DMGC 4R97C 4APXB 12E8H 1KBGL 1FF5A 3QUMH 3BP5B 5HJDA 5DZJA 4AK1A 1SXCA 4HJGA 4TQPA 1J5OH 4YUEH 3UADA 2BVPB 4GG6B 3NJHA 5IJVA 3H1LD 5C0NC 4FFZL 4LVNC 1XIWA 3HZMB 3QUGA 1K04A 2ARJB 3GQFA 1EPFA 4K8RD 4AMKL 1A4KB 2IIJA 1YAZA 1RQVA 3OF6D 4AQ8C 3ARZA 3HBPA 4G82A 1MFDL 4QXUL 4YGVA 8PAZA 4PJ9D 4CNIB 3M0DA 2GI0A 1MRCH 2KXPB 1GMIA 1WHPA 1XVSA 5DEFB 1AP2A 3JWOH 2BXZA 3DRTB 4FNLH 4MWFA 2ZJSE 3SJVB 3KWTA 4D2NA 1YLBB 3BIKA 2WZPD 2DEWX 3OM3B 2A0LD 3DXAD 5BU5A 3GTVA 4DQOL 4BWTA 1N5AB 1U8CA 1AACA 1W72B 2XJKA 4BQ9A 1HWWA 4XA4A 2Z31A 3I9AA 4ELKA 1WMKA 1P5UA 2KLTA 4PLNC 3HE7A 4Z8FL 3ETTA 1QLEH 5KBKA 2KOGA 4GI8A 3DJRA 4JX0A 3BDBA 4G83A 2N1TD 4PWIA 3T6XA 3UX9B 5CO1A 4HIXL 4K94L 1N59B 1GXEA 2YD2A 1E30A 2L7JA 4YHPB 2ZX8A 4LOUC 3MD0A 3H1HE 1T3UA 4ABQA 2LV4A 3CVHH 4L48A 4JKWA 1NFKA 2AXTE 1ZV9A 3G6AA 4OR1A 4RGOL 3ULVL 1RE3A 3SOTA 5CCHD 2WLHA 1NHLA 5D7LA 2ZWLT 5TJHA 2FNWA 4GSQA 4NZRH 4PCSA 2O1KA 2AITA 1G9NC 1MWOA 3MIWA 1BECA 3X14B 1CZ8L 3ARRA 1FNLA 1RLBA 4N3TA 5CUSL 4L73A 4H8VA 1NPUA 3HC0A 2XCMC 2QPDB 1MN4A 4YSEA 1OE3A 4JQXC 4BK8A 5AYQA 5J13C 1G7HA 1L0YA 4W9EC 4Z7VF 5MERA 3CWBJ 4IKNA 2B9BA 4OD3H 4OD1L 3LY6A 3AS3A 5A7BA 4OJFL 4LQ1A 2A9AA 2YC1B 3NVQA 5C0DA 3SE4A 3OAYH 1KORA 3NABL 1R5VB 1SEBB 1ZHBB 4KUCF 5I28A 1OGSA 5KJRL 3N55A 1X9UA 3BP4A 4HGWA 2YRZA 3DUSA 3FMGH 4RZCA 2HH0L 3Q2WA 3DVNB 3Q5OA 4ZZKA 1XEUA 3IXTA 2ZIDA 5AVRB 3DARA 8FABA 4JQVA 5DJXB 3L71J 4HUCA 3B7TA 3WJLC 4A38A 5H2BB 4MJ6A 4Z7QB 4NKMA 4DK3A 1MLCA 1CBVL 3OF6A 2Z93A 3EFFK 2DQIL 1MIEH 3IFLL 5T5FA 1GJUA 3QHTC 4PJ9A 4LHJB 1FZFA 4YFEA 4TVUA 2QPUA 2Z7ZA 4WV1A 2BRRL 5IVXB 3H9ZA 1XTGB 2JIXD 5AUMB 2WZPA 3JWNH 3SPJA 3LXUX 3DXAA 2EDMA 3SBPA 2QGDA 2QMJA 3L4FA 1N0LA 4QRRB 5I0WA 3UO1H 1AY1L 1WUNT 4X4YB 1R9FA 1A3RH 4ODXB 3VFNB 3B34A 2HG0A 3I5CA 1IFHH 4NEHB 5DMIH 2N1TA 3MUGB 4W9DC 5MEQB 4LKCB 1QSZA 4MJ5A 4UDUB 3PWPB 4V1DB 4YHIB 4W6YB 2HRHA 1KCSH 2B4CH 1GTFA 3WHXA 5BW7A 2J7LA 3NPSC 5CSZA 1FYTD 3ULUD 3D0LB 5DCCA 3LVEA 4I5BB 1AANA 5AW5B 4QTHB 4XZ4A 3CDGB 5T3XL 4RAHA 1CGUA 4A04A 3L4ZA 1RZKH 2DMHA 3PE9A 4WAFA 3EYQD 3TNMA 3LZNA 3S9OA 4KXDA 1A6WH 3II2A 5EOCJ 5KLIB 5TDPA 3IFMA 3GSWA 4PV1B 2JQMA 4FTVE 4Y0GA 4K3HA 1J10A 5HHVH 3W82A 5CWSB 4BFFA 3N9GL 2EDKA 5IMOA 5E8PB 4F5CE 2R44A 4IRSD 2KL6A 4Z3JA 4W6WB 1VGEH 2G9KA 1KQSO 4OCXH 1OCCB 4MFHA 3USSA 4IFMA 1G7JA 3RL0D 3MNVA 5DJ0B 4Y16D 1QG3A 3F7RA 1GGCL 2GITA 1KEML 5AD0B 3UBXB 2BOBA 1NYHA 1ZT1B 2ZKWA 1QZNA 3NDYE 1NEZA 4LHUG 4GKZB 1YY8B 4XODA 1WF5A 3JWNE 2DL2A 1IBYA 4Z78B 5BVPH 3QFGA 1MLBB 1XB8A 1YPZA 3B9EA 5C71A 1VERA 3KYOA 3HZYB 4HUWB 2Q7YB 1MF2L 2GJ6B 3KW7A 1W8NA 3NIFF 2DW3A 1DVFD 2ODIA 3ESMA 4HUUB 4ODTH 2RH0A 1HHGA 5IGXH 2Z4EA 2ICWA 1R3LB 4G6KL 2K6YA 1D5BB 1UB6B 3E7JA 4Y2OB 2PRRA 4QMEA 1VADA 4O9HH 2IXQB 3BAYA 3DOSA 4O51A 3PG2A 4TQ8A 3VRJA 2X0WA 4HS8H 3SDXE 5J12B 1XCXA 3H3KA 4PJ8B 1HINH 3RL2B 3ARUA 2JIXA 3QCTL 1RVFL 1I1FB 1M7DA 4N1CA 3KBPA 4QHKJ 4WFHD 4X8XA 1MPAL 4RGND 1H9DA 1CG9A 2KB7P 5BS0D 2IQAA 4GRWB 2D7MA 3OV6A 2D3VA 4QHKI 4OLZH 3RBGA 4OCRL 4C83A 3BSZA 3WYRA 2IGTA 1N7SC 1PGOA 4DKDC 5IB3A 2FZ3B 3I3BA 1CWVA 1ASQA 2F08A 3FF8A 4RMTA 1F1GA 4LKXB 1FYTA 1HYRC 2CHWA 2R0KL 2NUPA 4XC3H 3MV8B 2H3NA 4I8DA 1ZWIA 2Z7YA 4N8VG 4HHAB 3MGNA 1BJ1H 3P69A 2VRQA 3MRLA 2YRBA 4KO9A 4NZTH 2O5NA 2VH5H 2OYMA 5F96L 1Z5LB 5INDA 3RU8L 3VU2A 1LWRA 4MA3A 3IMBA 4BSVA 5JW4M 4LDLB 2ZP9A 4OCWL 1G0XA 1H15A 1CDYA 2EVFA 2MJWA 4HJSA 4IRSA 3T3PF 1OB1B 2OMBA 4TOYL 1CZQA 4G6MH 4F58H 3IGAA 1MW1A 5CGMA 3FK3A 3BUTA 5FOJA 4Y16A 1S7XA 3TDKA 2EECA 3GRBA 2E76B 4NAJA 4JCLA 1IFDA 2F7RA 4FJ6A 4LGSB 2NY6C 4BA8A 3IKCB 5E0QA 4BFOA 5LQBL 3T0DA 3BKYH 3RZCB 3R0MA 3LXCA 4ZPTA 4OCSH 5I6XC 4XMPL 4KRNA 4AYCA 4JDEB 2VMCA 3L3HA 4AW4A 5L88H 3BI9X 2BIIA 2R59A 4Y4KC 4P49A 2L7EA 1DVFA 1WLHA 4LSTL 1N2DC 5E6ZA 3G6JF 4KH9A 12E8L 1UADC 3SE3C 4ASVA 5CXPA 3DSNB 4ZNEA 4WI8A 3SQOH 1ACZA 5ECJE 3V6BR 4ZMNA 4KKLD 5EIIG 2I7OA 1J5OL 4YUEL 1M1JC 1P84K 5F7FA 3V0IA 3RNKA 4EUPA 5I24A 4XVUC 2ENPA 1YO4A 1B0GB 1DANU 1U8KA 1PD6A 1AYRA 4BH7A 2OMWA 3AY4A 2EIZB 4F8LA 1L0LE 5BS0A 3QWNA 2APSA 4JZJB 1JZEA 3PIQA 2VUOA 3L72E 1AJYA 1Q90D 3ZKQD 1MRCL 4OGYH 5ICZA 1QBLH 2VDNH 2C3VA 3JWOL 2CO7A 1SBSH 3DMMB 3EYFB 4FNLL 4PS3A 2EYTB 1KIUA 1OGTB 1TYJA 3OKEB 3CHQA 3UC0H 5LDSA 1OF0A 3VYOA 4P2AA 1E2WA 2R4RL 3QI9D 3GIZH 4G7SB 1BD2B 3VFRA 2EADA 5CGTA 3AREC 3RWCB 1JCDA 4WEMB 5EU6B 2DWDB 3QHZH 2Q8BH 4OZIA 1I85A 5C2UB 5DZ9A 4HG4K 2EE2A 5GRWA 4LRIC 4OF5A 3L4TA 2ODHA 3X1GA 4G5AA 1EEYA 1TZHB 3K5SA 2VMEA 5IP4A 3L7EA 2PUQT 1MY7A 3HRZB 4GIPD 4X9IA 4PRAA 1BXVA 2R0WH 1IEBA 4L76A 2LTQC 3CVHL 3PNWB 4FAAB 2OL3H 5DJDB 5F3BB 2H6PA 3HS9A 3VE0A 5IQ7H 2VXSH 1NANH 4KKAC 4CSTA 3J07A 4NUGH 5DWUH 5FEBA 4Z7UF 2ZTBA 4FQIH 4GW5B 4EIGB 2BCKB 3GDBA 4NZRL 4R4BA 4AM0A 4JB9H 4K7PX 4AJVA 1YIJP 4YHLH 4Z1PA 4UB6H 4A2LA 4GAJH 5D93C 1NTKG 3WN5B 5D7EA 5FYLD 1B4JH 3CH1B 2CSPA 5AB2A 2B87B 4M3JA 3VVWA 1FNEB 2H8PB 2X4TA 2F5BH 4MB4A 3U82B 4OD3L 2IWGA 3WTTA 3HMXA 2IWFA 2LXBA 1E7UA 1OSEA 3WTWA 2BY0A 2I07A 4P9HH 2DIAA 1G1JA 3KXFD 3ZE0B 3FT2B 3IE9A 3MV9D 1KLUB 1PJ9A 2D9CA 3C09C 3GGWA 1FSKC 3WTYA 4AT6B 1SJEA 4BELD 4JHZA 3F12B 3AXHA 3UZVA 3FMGL 2X6VA 4M3HA 2QKSA 3FUHA 3KVQA 4DUXA 4QHLA 5HHPA 1B3JA 3L73J 2JKJA 1MCSA 3COOA 3QHFH 2DQMA 4JVUA 5F93C 3VSQA 2LKMA 1D5XA 4XP9H 2VNCA 4JFPA 4PRPB 3RK3C 3U0PB 3HI6H 4XP4H 3V2AR 1V55B 1MIEL 3PP3H 4LLWB 4U0RB 3WL9A 5JW4R 3D39D 4G59C 1AR1B 3U1QA 2BP0B 3FC8A 3QORB 3VFMB 3ZQXA 5CLWA 5KLVD 3S3CB 2Y7LA 1CFQA 4HKZA 1DBKH 3RBZA 2BINA 3F65A 3QI9A 1AD9B 1P7KA 5TE6H 5IEKB 4L9LB 3N42F 4PJAF 3Q5YA 5BOJA 3IRCA 2YMXL 3UO1L 1JTHA 1A3RL 4BHUA 1CTMA 3BPNB 4OZHA 3VN0A 1IFHL 5DMIL 1R3KA 4R7DB 1R47A 4XMXA 5D6CB 5HYJD 1KCSL 2B4CL 3PY9A 1KILD 1ZJAA 1XXDC 2G5UA 1NDTA 4ZX5A 1GJWA 1CLYL 1WH0A 3EYOB 1WZKA 2ZSWA 3LRLA 3S3DB 4G8GD 2AKRB 5EU5A 1MCIA 2E6QA 5IHHA 3ZDXF 3ZIYA 1RZKL 1PNDA 3EYSH 1NCCH 1BVNP 3OQRA 4GUQA 1P0SE 2JKTM 3QZWB 3PL6D 5EV7A 1UG9A 4FTVB 4G72B 1A6WL 3VQLA 3T4YB 3HD7D 3GSVB 4WW2A 5EZLB 3OZKA 1HESA 2JJSA 4UTCA 4DUVA 1JZ4A 4LCCB 4AVHA 4UV4H 3TA3D 1IAKA 4NSKA 4LASH 1VGEL 3RL1A 4OCXL 5I16B 4TQEL 3K71B 3SY0B 3BW9A 1U8PB 4XOAA 2YRLA 3HG4A 1O75A 1P6AB 4HH8A 5TH2A 1TVBB 1IAOA 3KXFA 2CU9A 1KB9D 1X5ZA 2Q6QA 1YQVH 3MV9A 5BVPL 3L3DA 3LW5H 4W9LC 1U9KA 3RWFA 4JY6A 2A7BA 1F3DJ 2R1YB 4JANB 4P2YA 1E8XA 4UM8A 1NTZD 5A3ID 4K7PH 3ZSTA 5EU7C 3MLSH 3RE0A 2YUVA 3BP7A 5DA0B 3OSVA 2WXJA 3MRHB 3QIWD 3RTQC 5IGXL 3BWAA 1I1YB 2ICEC 3F5HA 4IBSA 3SDXB 3D39A 4O9HL 2W6AA 1AAJA 4P4RB 1W16A 5HJGA 4BKTC 4CUCA 1DN2A 4KOBA 3KPLB 4E36A 5FYJH 4HS8L 2P48B 4W9IC 1HINL 3T97A 1L7TH 4H0LC 1ZSHA 3G9RA 4NQCE 3KR3H 4UMSA 2COVD 3FU5A 1IFNA 4GSDH 4Q6IA 2ENYA 3BPCB 2DYPD 2WWKO 4HT1L 4PS8A 1LP9E 1JPEA 4N2OA 4OLZL 2VZTA 3KDMB 5DJCB 3S5ZA 3VACA 5IV2A 2QA4P 4NC0B 5HYJA 1IC7H 4MZ2A 5AG9A 3L3KB 3B2MA 1MUJA 3AE1C 1KILA 1SJVA 3BD3A 3QIBB 5E5RB 5GTHE 2N56A 2X53A 5AYTA 4XC3L 3VAEA 4NNPL 4G8GA 3WUWG 3ZKMC 5CD3B 1M7XA 5IREA 4H26A 2Y23A 3UGUA 3PWNB 4E41A 3EOBB 1LD9B 3G9VA 4WFGD 1ZVHA 3VFVA 2H32H 1GSKA 1ROCA 3PL6A 4M8UA 4NZTL 3GXNA 2AJ3A 2VH5L 5DHYA 2AZUA 3HD7A 1U92B 2E47A 4NO3A 3SO3C 3TPUA 2FIKB 4FL4B 2EO9A 5CBEB 3APNA 4HMCA 5GJTH 3RPKA 3SQRA 2O01N 4V2BA 3TP4A 3DPBB 3TA3A 1U8IB 3BPOB 2J59M 2M5AB 2V7QH 4XP6H 3UPRA 3Q1MA 4G6ML 4F58L 1O5DT 3FKUS 4QJ4B 1D5RA 4PJ5B 1BWWA 2NY3B 3F89A 2X70A 3QQDB 1GAFL 1MZ9A 2BZDA 5FYJE 2C0WA 5ICYA 1BV8A 1BREA 1MXGA 2WXKA 1URLA 2WVSA 4AG4H 2ZXBA 4AIZA 1IL1B 5BVZA 2EUWA 4J3OG 1GL2D 4U3FD 2O6DA 1NC4D 3LAFA 3BKYL 4L4TD 2AXGA 4OCSL 2QVFB 2JXMA 2VITA 3KL0A 3BGFB 3L1OH 5L88L 1ED3B 2VJ0A 2OYHC 4UF7C 2JELH 2WCPA 4HK3J 4EZKA 4BRYA 1JPTH 2PR9A 1XF2B 1KJMB 1RU9H 3NACH 3VWKD 3CWBG 2YN3A 4OZGE 4AC2A 4DGVH 4L37B 3QIWA 1I8LA 3CFDA 1ZHLA 5ID1B 3GINA 1SHWA 2H7WA 4ZXBA 4WGKA 2QJKB 2P8MB 4YBHA 2NY7H 3LKQA 4N2FA 4WWKB 2JLPA 1A6PA 1RP8A 1NGQH 4FHKA 4X6CA 1J86A 4PRHD 3ABGA 2D31A 1BQHG 5FX3A 3U1CA 2DYPA 4GXFA 2Q7NA 5FUOH 1KFNA 3HNVH 3QJZA 3EH5B 1M3IA 1BEYH 1I7RB 3SD5A 4HPHA 4OGYL 4P5KB 1SOQA 1QBLL 2VDNL 3ZMNA 1SBSL 3QZPA 2OP4H 3KHOA 3MODH 4P5TD 4U1LB 4FP8H 4OJDH 3OKLB 3UC0L 4JRXE 5I0DA 1HCVA 3ZKNC 1QI5A 3GIZL 1PD1A 3AABA 1UC6A 4FC3E 3CV5A 5DS8B 3U2JA 2BHYA 5H94B 2O93L 5CEZD 2Q8BL 2DQHH 4NUJA 3NIDE 4KPHH 3QZBA 3ILQD 3TNUA 2YGNA 1EJOH 1D2PA 3MNZA 2E5TA 5CKAA 4HUVB 3FQYA 3IEAA 1IBDA 3AS1A 1OPGH 3IFOB 4I3SH 2RFXA 4LSQH 4GKGA 4NM8H 1BMWA 3CSYA 4EI5C 5C0EB 2YUZA 3Q6GH 4Z7NE 1YEGH 2R0WL 3I6GB 1H8SA 1SQMA 3M45A 2VABB 5IQ7L 2BOLA 2VXSL 2JQAA 2WKOF 1V7MH 1YMHB 2NLJA 4NUGL 4PWGA 5DWUL 2BSSB 2QVTA 2WQYC 4FQIL 4BKLB 3EGSB 3QRGL 4YDIH 4YFLI 3LN4A 5FDYA 4JB9L 4YHLL 1GL2A 3D30A 4PR5B 1NC4A 4GAJL 4L4TA 4M9PA 5LB1A 1B4JL 3BVWA 2VDNB 3UTPD 3IDIB 5DFWH 1ZS8B 3GHPA 4YPCA 2F5BL 4GY4A 4XBMA 1NVOA 2A45I 3H1KE 3VSTA 3VWKA 4K3AA 3L74E 2J56A 2GK0B 2VZOA 2Q7CA 3QNZA 4OBSA 4P9HL 1FBIH 1ZN5A 3L9RB 3WTSA 3R4YA 4L18A 2K7QA 4CSZA 5AYUH 3BASA 1U8LB 3UTQB 2A5UA 4IMKA 5E2VH 5KKZC 1Q8MA 3DIFB 4PRID 2WXLA 5E6IB 2KNCA 1NQBA 5IWLC 4NQUA 4Z77A 3F7VA 4PRHA 1AI1H 2Y9RT 2DICA 3QHFL 5C70A 5JR1H 1HOEA 5B4MD 4XP9L 4V11A 5DRZB 1JJUA 1H3TA 4XP4L 5A2LH 3SKMB 5LBVA 3LH9A 1CQKA 3F6LA 5F44A 2EVGA 1V5JA 5E99H 3MMEA 2PP9A 4P5TA 5GRJH 1G7LB 5C08B 4PLJD 3QR2A 1DBKL 1D7BA 4ZMWA 1S9KC 4PGEB 3CFEB 5D5ME 1ZRTE 5TE6L 3V4VH 4GT1A 3BQUB 3CCSP 3H4HA 1KPVB 3RWDA 4APXA 1MG2C 2CO6B 4ZUSB 2F68X 4XXDB 2AV7B 5KLVK 2IGLA 1H6TA 5HPMA 2VLKE 3KVPA 1MFEH 1T0NA 2J5LC 3L4WA 4ZD3H 3FCSB 1YQ3C 2BSRB 2BVYA 3P3TA 4N8CH 2FO4B 3JTSA 3PUUA 5K33A 2I85A 4R2GB 4E9YA 3O4LD 4U1JA 3Q2CA 3C8DA 2FT7A 5EH1A 1Y7VA 1JY2O 2NY0D 5HHMD 3UIYA 1I8MB 5I76A 1AZNA 4MDIA 1AFVL 3ABZA 3MC0A 2DM4A 3X3GH 5IEHB 3KYMB 4MVBC 1M71B 4J6IA 4PJDB 4Y7MA 2RR3A 3EYSL 3L3IA 1NCCL 3HUJF 3VMXA 5DVPA 1P4LA 1WJ3A 5EEVA 1YYMH 4W9GC 2FFDC 5HDWA 3OKNB 3CI9A 1KTKE 1M6OB 3BGMA 3WO4B 2UUDH 1DTUA 1SM3H 4A7UA 1LYQA 1CGYA 3IDYB 4QHNA 4UV4L 3UG3A 3VO0A 3G6EP 4A2GA 4ZKPA 4LASL 3QQ4B 5EOQH 5E8EB 1J5HA 1BFOA 3UMNA 3C60D 4WGWB 4Y9BA 4LNRB 1N5AA 3WY1A 2C9XA 5D1ZB 3E6FB 5DEZA 3OKOA 1ZGLB 3O45A 1N2RA 4K3JH 4OI7A 4HLEA 2FUTA 1U8MA 5E24E 5MEOB 4PTUA 1JXDA 2JE8A 3WEBA 2K3RA 4R5TA 2QSTA 3FONA 43C9B 2KPNA 2YUWA 2BCCJ 5IG7B 5FB8A 5K5YA 2W9DH 1AC0A 4RZKA 1HHKB 1F13A 1BQKA 1PNCA 5EHFA 3UC2A 3ZE2E 2NY2B 2WZ7A 4PRIA 5BJTB 3AE7C 2O5ZL 4K7PL 1ZIAA 4LCUB 1FZAA 3L5WB 1KB9K 3MLSL 4FABH 2EH8H 3JWDH 4AEHH 3S36X 4LHUB 2Z6FA 3OZLA 2DH2A 1NU1J 3AT8A 1ACYH 3EBGA 1O7VA 5DJ6A 1VKXB 4QRQA 1NTZK 3NZ8A 1WEJH 5B66H 3L4YA 3N43F 3D87B 3FTUA 5A6IA 3P3SA 2W0FA 2IX7C 2WM0A 2DW5A 4HBQA 3FQRB 4HMDA 3UCRA 4NPFX 5FYJL 2YQBA 4XWOD 3U25A 1CL7H 3WAJA 3FT0A 2UXFA 4PP2A 4H13B 5EFIA 1L7TL 5J12C 1T2KD 3VQMA 1T1YB 1AHWA 3KR3L 1DFXA 2OMXA 1ZIBA 4GSDL 5I1IH 1LO3H 5AZEH 1R17A 3EFDH 5TF1H 4ANXA 3D6GA 4NHCL 2A83B 2VZUA 3I9IA 2DRUA 5ERWA 4P2QE 2AK4B 4WW1B 1IC7L 1X7QB 3O4LA 5CGYD 4ZTOH 1JK9B 2G4GA 1C5BH 1V27A 5HVHB 1OHZA 5F1OB 3TGUJ 2CH8A 3VXSD 2F61A 2XFGB 3W9DA 5JQHC 1BOYA 1BQSA 3CXHJ 1HHJB 3JV6A 3WEXA 4MZ3A 3GMAA 2DMCA 3NZUA 1RZQA 2CZNA 4N4YB 4X4XA 1SF5A 2NZ1A 3PDGA 3CXHI 1A3LH 4NQEE 5F8QC 4HIPA 2ZF9A 5EN2A 5ISZE 1J05A 4MDRA 3I56P 1KCBA 4Y2LA 3STLA 2J1WA 3ET9F 1QTPA 3DX7A 2GC7C 2VIRB 4DN3L 2IBZE 1NMBH 5GJTL 4G80B 1IEHA 3O8XD 3AEFC 4XP6L 2XKNB 5B66E 3C60A 5I8CA 4OZFG 2GT9A 2W9LA 3CZEA 3G6DH 4AYMC 5E56A 4BZ2H 4HKJB 3LNFA 1SY6A 4AG4L 2QPSA 4QRUB 3MUGA 1IAMA 5FM4A 2DWTA 1A1MA 3U46A 3N1QC 2D7QA 4KZCA 5L2KD 3K80A 1ZLLA 3ARBB 3M1BA 1BIIA 3L1OL 3M06A 2EYSA 3IDNB 1WAAF 5CCKH 1T8ZA 2JELL 1JPTL 1G7QB 3NACL 1RU9L 4DGVL 3M8OL 5E6SB 4KNTA 3NSCA 3P1VA 5B1JA 3WMSA 4I88A 1V3MA 3GMQB 3RWGA 4F9PA 1RKRA 2DTSA 1LTTC 3FQNB 2H32B 4P5MB 4QXTA 5DJ2A 2NY7L 3TYGH 4HDIB 1J0KA 1L3NA 1MHEB 3A0HE 1NGQL 1TUPA 3DUHA 1L0ND 3V0EA 3L73G 2JI1A 1JZ7A 3ZDYB 4L3AA 2R2HB 2F19H 1H88A 5FUOL 3PS6A 3ZDZF 3HNVL 4XO8A 4P2CG 3FNKA 4HV8A 3T8XB 4LRNH 1BEYL 5CD5D 3T6ZA 4QRPD 3CPLB 4G8EB 3MODL 4FP8L 1NEPA 1Q9LB 4EPSA 4F20A 4YHNB 2CLVA 4KDTC 3DMMC 1BW8A 1I1AD 1RF1A 3MRBB 3VXSA 5DK2A 3G5VA 4E68A 1G0YR 2KHAA 3OGCB 3VI3E 1XH3A 4UM9B 3TV8A 1TCRA 1OV8A 1E5ZA 1A47A 4C57C 2A4ZA 4QY8A 3KPMA 3EJYC 1LTBC 2ATPA 4Y2OA 2IOOA 1JG9A 4CAGA 2DQHL 1I82A 3ARFB 2PETA 4DZBB 4KPHL 1IZJA 4MB3A 1YC8A 4ZW8A 1EJOL 2F1EA 4PPTA 4BE6A 3HIZA 3WNOA 4Z7NB 1OPGL 4LSQL 4I3SL 1UH2A 1LO4H 2EDNA 4WUKH 4XP5H 3ZL1A 3X11B 3O8XA 3MRQA 3Q6GL 1FJKA 1YEGL 2V37A 4PQXA 4YAQA 4AI7A 4GG8B 5L8RJ 3MRFB 4N28A 5INCA 4DCQB 1V7ML 1VESA 3B9KD 3W67A 3BLBA 3ARGB 4BXLA 4YDIL 5EUOF 4JREC 4Z7VE 5LBSH 2FXOA 4N2NA 3NJMA 3AW5A 2FBWC 5K1NA 3ZE1B 4HA1A 1KT2B 3EOAB 3W9EA 1QLFB 4WEEA 1RI8A 3IWVA 5EO0A 5L2KA 1C08B 2XX0A 2O30A 5IK3A 5EPMB 5IQ9B 4WBAA 4X9GA 1U3HB 2XHNA 4L5FH 1CS6A 3MXVH 4MXWH 1R24A 5DUBB 1FBIL 3ZYJA 1JYNA 1KMGA 4GINA 1A9BA 2QHRH 3H1HD 4JYCA 3TIEA 1K5NB 4PD4J 5AYUL 3V6ZB 2C26A 3ZT6A 5C0GB 1MUUA 2A6JA 1I8IB 2EYRB 1KTLB 5DUJA 3OXSA 3QG6A 4TUKL 4PD4I 1E6JH 3GLZA 2XZAH 4UOW0 5DRWA 4MD0A 1E9PA 5GRVL 1AI1L 2Y69B 2XPZA 1U58B 3UYRH 5GS1A 1XGQB 5CMZA 2YBRA 5FUZL 1HEZA 5HI4C 3N91A 4BFRA 5JR1L 1XTCC 3P2DA 1DJWA 3V55A 1KUMA 3VTTA 3VXNB 2VERA 3NRPA 4L8CB 3RZCA 2IGFH 4HD5A 1OVVA 4QRPA 2QM7A 2ZYDA 3X12A 5GRJL 5BV7C 2PO6C 5HBBA 3MUDC 4JJOA 4DGWC 3IS0X 5I1EH 1I1AA 3PJNA 1ZA6B 3V5DA 2P5WE 5BZDA 3CN0A 3V4VL 4M6AA 2OKMA 1TTBA 1VA9A 2HFGH 1ZLUK 1ZK9A 1NGMB 3QEQB 3D6ZA 4M7KH 1PX3A 1MFEL 2X05A 1NWOA 4ZD3L 1QLED 2O5YH 1FL6B 5JHBA 4N8CL 4QT5B 5HHOB 4B9GA 5AAWC 2LU5A 2R39A 3KL3A 1KQGB 1E9OA 3BWSA 3REWB 3H6PA 4ABUA 1FZEA 3PAYA 2V2WA 4C4KT 1BVKB 3ARWA 3X3GL 3EGXB 1IZNB 5I73B 2Y7OA 4PGJA 2I9LA 1S3JA 1EDQA 4PWJA 4F91B 3B9KA 3O3EB 1YYML 3FAXA 4LMQI 4RVBA 4ZAKB 3QJOA 1AR1D 1E5YA 3DBXA 1C5CH 1OW6A 4QMAA 1HSBB 3FU7B 1OGTA 2QELA 2VDQH 4HUNB 1SM3L 5H35B 3WKQA 2JF1A 2XNAB 2J1ZA 4OTXH 4XMWA 3MKKA 4R5VA 3BXNB 3HG3A 5AW8B 1IBBA 4G7QB 2H3XC 5F7DB 1I4FB 4F9LA 2ZYIA 3WNJA 1OEZW 3HOGA 2B7DT 4UTBH 4NN5B 1LNUA 1EEQA 5CMAB 3KPNA 4K3JL 1E40A 1WVZA 4Q2ZA 3V4VB 3R19A 4IRJD 4PRNB 3VWJC 2PWGA 3WNMA 4JE4B 3QUMA 1KYOE 4MJIE 4NAQA 2C4FT 2W9DL 3CZFA 4MS8C 2XIDA 1N3NA 3LH8A 5DJUB 1S4IA 3KZ8A 3PNWA 3WS6A 4I0KA 3B3IB 3RX9A 4O00A 3FXEA 4HLJA 1HZKA 5KN5B 3RVTC 3IDJA 1S9KE 1G7MA 2GJZB 3T4AB 4FABL 4EIJA 5CJ4A 3JSVC 2EH8L 3JWDL 3OAWA 2PXYB 4AEHL 4OI9A 4GW5A 5J1AA 3WIHH 2GI7A 1ACYL 3ISRA 2V5TA 1JY2N 1WEJL 3LEVH 1Q4NX 4JN1H 2DL9A 2JTYA 3WN5A 3QDJB 2ZT9D 1S5HB 5DK0B 5B1BB 1Z1WA 4AKOA 4ZW5A 2OTWB 3FQWA 1JHLH 3HG2A 2B87A 1S5LE 3QPQD 3TO4D 1M2VA 1FNEA 1CL7L 2CBMA 2XWDA 2YGOA 3D85B 4PY8J 4OH8B 4X50A 1RUML 7FABH 1LT1A 2VAAA 5A2KH 1OHQA 5EBGA 2ENJA 4HZLA 2WLIA 3NFNB 4PY8I 1LO3L 2NPLX 4N6QA 1OVUA 5AZEL 3EFDL 1KMIZ 5TF1L 4KK5C 4NNYB 2E8YA 1BXUA 4P2QB 5DZOA 1OF2B 2WKGA 3U2SB 2YJLA 3BDXA 4BH8B 3GRWA 5BZWB 4QHMA 3Q2NA 1AYOA 3GZQA 2WUBH 3RVUC 4PGBB 4Z7AA 4ZTOL 1C5BL 1BOGB 2X4UB 4N5EC 4KRPC 5BXFA 2E5EA 1C16B 4OCLC 2DIJA 4YLBA 3QUKB 2Z4QB 2WVVB 4LPXA 4NQEB 1FCGA 2E42A 3NJNA 5KVDH 1GR7A 1OW7A 1VENA 3CVHA 5ISZB 3EDJA 2WP3T 1OD9A 3T3PE 1A3LL 3TO2B 1TFHA 4JK0D 2PMZA 4J3WA 2Z92B 4F15C 3M91A 4WHTA 2DMGA 4PIBA 1LMKA 4KZ0A 3T09A 4PJGB 3H32A 3II1A 3TYYA 4R7NB 2XQ0A 3DOIA 1NMBL 5KOMC 1N8OE 5DVOA 1F02I 1KENH 43CAA 1O7DC 5E9DE 5L2JB 2ZXQA 4CMMB 3H53A 3IM1A 1AD9A 1LWHA 3MBWB 5GTIE 4GLRH 3WUWB 1CI3M 4WI7A 4ETQB 1U21A 4XVOA 5DC2A 2BNRD 1MRFL 4BZ2L 4ZFZB 4MX7B 1QSEE 1S9WA 2GQHA 3BRVB 1ZLEA 4JFYB 4IRJA 1ZA3B 2EIBA 4GAYB 5JA9A 4UQ3B 4X0KB 1GYCA 5D6CA 2WBJB 1KULA 1QYGH 1WA1X 2CBQA 2CO4A 2IDUA 2HT4C 1XGUA 2FEEL 3UAJD 2ALAA 4F7EA 1A4BA 1IC4H 2IFGA 3A24A 2A45G 1PIGA 5CP3H 2R15A 3X17A 2O6EA 5CCKL 3FOMB 4AGLA 5BCAA 2P7TA 1B4RA 3FH5A 7TAAA 3QZWA 5IBLD 2UZPA 3BKCH 4FTVA 1KSRA 2VR4A 5I1CH 2GIMA 4GXUM 4PMFA 4GAFB 5KAIH 1B9ZA 4LCVA 4P2RB 4RFEA 3TBWB 1WWCA 4AWJC 5C8JA 2A06G 2DM3A 1OOWA 1WBXB 4YDNA 2X4SA 1KZQA 2FEDD 3TYGL 4B7IA 3GSXA 3EBHA 3MRCA 5H4YA 3TO4A 3CUPA 5CEYB 1GA2A 3GMPA 2EABA 3JVGA 4AGQA 2BS8A 5I16A 3CX5D 1JOCA 3CN3A 2ZOKB 4JPSA 5KAFH 3K71A 1MCJA 1PEZA 1G6RH 2F19L 2FQFA 3AXLB 4OGZA 4JQIA 1YNKH 3POCA 1Q72H 3CTTA 3TT1H 1L0NK 4N78D 2X40A 1RPUA 1LTJC 5B3JF 3GZOA 4C7NA 3HW7A 4ZX4A 5KTEH 3BFOA 3OJDB 4GXVH 1AXSB 1CGWA 3UYPB 4NZJA 4H1LA 3DJZA 1U2YA 1U8NB 1CD0A 3KLSA 1AZVA 1SHXA 2YPVA 4N6RA 5CSGA 5AW4B 1IQDB 1T5XB 2CIIB 3SDCC 4JFDE 4XNBA 3H1ZA 2YMTA 1A25A 3KPOB 1HILB 3N0AA 2AQ2A 2J55A 4LGRB 3HUSA 5D7HA 3SDXA 3CVCA 1ILUA 1CFVH 2D2OA 3PHSA 4UB0H 1WDAA 4WF7A 2FE0A 3EOTH 3BZFB 5KSVB 4P2OD 1L0LD 1GMJA 3PREA 4WUKL 4XP5L 1LO4L 3VX0A 5EO1B 4MAYD 3V4LA 5M1BA 2WTRA 2CA3A 1BAWA 2KIKA 3L72D 4ODUB 3QJVB 2BNRA 2V9UA 3H9HB 4FS0A 4NQXA 4Z7VB 2HN7B 3D4CA 4L3FA 5I9QC 5LBSL 3TH4T 3QYMA 2I5YH 5KAFE 4QUOA 1AOZA 4TTGA 4XFJA 2HAZA 5IVZA 1KJ3H 1ZSDA 2LW3A 3LZRA 1LGVA 3QIBA 4NPKA 3O9WC 3I6LE 3UAJA 5AVQB 4LPVA 1EZVE 2IPKA 1KB3A 3A2AA 1AQMA 1VLXA 5SX4H 2CQVA 3RDTB 4L5FL 3DKHA 3D18B 1AD0A 1EXGA 1TYEB 1Y07A 2DI8A 3MXVL 4KKCD 4MXWL 2IPPA 4BSJA 1GTNA 1K3ZA 2MTPA 2QHRL 1QVFO 3ML8A 4GH7B 4AQ1B 2FIKA 1BPVA 2J8UE 2ENSA 5ETUB 2EDWA 1VACB 3ASOB 4YO0B 2DJSA 3GZKA 1WIPA 1KXVC 4IGBD 3L2LA 4ZMLA 1E6JL 1HEJC 2CBPA 3FFCE 2XZAL 2XICA 4F93B 5DMGD 3CNKA 4NIYE 5ECGA 4S0TD 3UYRL 3NGBB 1AQ8A 2ITCA 4M5TA 4QO1A 1N73B 3IMRA 5IF0B 2L7QA 3VXTB 2ZSVB 1NU1G 1HVXA 2YPLB 3BUBA 4KVNH 1GZPB 1NFIB 2FYVA 4J39A 5C0ND 3II6A 2IGFL 1J11A 3LKOA 1IE4A 4M4PA 5I1HH 5I6OA 3RIAK 2P5WB 1D2OA 4FI8A 4MNQE 1ED3A 4KHTL 2VLME 3CFMA 5I1EL 1S78C 1I9EA 2HVBA 4PLKC 1KEGH 3VJ6A 3EXJA 3GNMH 5IFJA 3TBBA 3WUUA 1JNJA 2YKQA 2J6EH 2YN5A 5C07E 4YHZH 2HFGL 5DTFA 3RGVC 4M7KL 1IGCH 2UY7B 4M29A 5FGCE 4ZMYA 2O5YL 4N2DA 3ZDXE 5HDBE 2CUHA 1NCDH 4HIJB 1TKWB 4OFPA 2WYIA 2CCVA 1B0RB 1WV7T 3D9AH 1ZDQA 2D7NA 2VLRE 3IETA 2W90A 5HI5D 4H7VA 4YLQT 2NXYC 4P2OA 5IW1A 3TGUG 2OAAA 3KLLA 4MAYA 1I7TB 3A4EA 1IM9B 1AMXA 4F2EA 1BX2A 1QWUA 3MJWA 4MAUH 1PYWA 3EHBB 4NKQB 4QKTA 1ZP0C 1AHMA 2FECI 1I7RA 1EAOA 2W65B 1C5CL 1U36A 5EC1B 4NQQA 2VDQL 3K72A 3OKLA 4LOUD 3F7KA 1Z9SB 3AXIA 1PPJE 2EC9T 4OTXL 2QL1A 4WSJA 2ED8A 3QSKB 1J1OL 1VQLP 2VQ1A 3NIFB 1E5WA 2E74B 3QO1A 1RZJC 4ZMZA 4UTBL 1G0DA 4L4VB 5GSRB 1GDTA 3ECVA 4IBLT 5E0FA 2EDQA 1CGXA 4LEOA 5LXVA 3LSOB 2YUXA 1MI5E 5H4ZA 4IS6A 2NOYA 1HH6A 3PABB 3HPLB 4IGBA 1X5IA 2NY5H 2QFRA 3NOIA 4N0FB 5IOPA 1FWXA 1E65A 1HS6A 2KP8A 2XWJB 4LCYB 5CBAB 3RBSA 2G5BA 3O0RH 5B1KA 1UB5A 1CI5A 4JKLA 1IFPA 3WIHL 2D0GA 4D0CA 5BUGA 4W6XB 2FAUA 3FQUA 4QXGH 1FG2B 2FQEA 1D9KC 3ALXA 2B59A 1WO2A 3KPPA 3LEVL 4UDTB 3CMOH 2XRAH 4JN1L 3ZZ1A 3AC0A 4WI5A 3QFJE 1JHLL 3B1TA 5IHZB 1R5WB 1FFPB 3KCPB 1ZS8A 7FABL 2VDQB 1KB5A 4OSUH 2V2TA 1BVNT 1KCLA 1MFVA 3WLWC 5EOTB 4AQ8A 4E5XG 4ERSL 3TTYA 4PG2C 3V6FA 1PF3A 1KCVH 3C8KB 1GIGH 2CRMA 3A3YB 3MACH 4FD0A 4ISVB 3X2QB 5BRZE 3MCG1 4JAMA 2W1NA 4K5NA 4IFFA 1H0TB 4KV5F 2A9DA 1URQB 5DHVA 4EKJA 5DFVC 1PDKB 1SQBG 3G5ZA 2Q9IA 4HS6A 4M7ZB 1PX4A 3T3PB 4A6YL 3OB0H 4YSDA 5KBNC 5KVDL 2K9JA 2OMZA 5DRZA 1VAHA 2OL3A 4BFNA 2E46A 1CT8B 2CALA 4MCYB 3FHQA 4FFYA 3L9BA 2WPSA 3AUWB 4KXZH 4NQCD 1G7LA 4O2EB 1D5MB 1DVSA 1EGJH 3RJDA 1A9EB 1KENL 4TSCH 1M3JA 2XV5A 4HBCH 1KPUB 1OAXH 3K5RA 3OKMB 2RQEA 2AQTA 2CO6A 1QHPA 5D2NB 3VM7A 4RMVA 1JGVH 5DD1H 1FZBA 3G6JB 5FA4B 4PJBE 3H2WA 3FCSA 2PABA 3V0VA 3NA4A 3UCQA 1P1ZA 2ZNWA 2DF3A 2HLAA 3S7GA 5D96C 1QYGL 1K4CB 5B8CB 4Q9BA 1NEUA 2CDGA 3TBSA 1I8MA 1IC4L 1BBJA 1JGDA 1NDGA 1WTLA 5LGYA 1DQDH 4JQXA 4UAOC 3ECBA 4TSBH 3GUTB 1W6WA 2AXFB 5IY5B 5IB1A 1PLBA 5CHNB 1OCZB 3VDBA 5AW0B 3BKJH 3BKCL 5I1CL 4H44C 4XNXH 2EIJB 1GGYA 2JJTC 3UH8A 2P9RA 3VSUA 2RMNA 3CSBA 5TDNB 4L74A 1YPZF 4FI6A 1T2JA 3PHOB 2CD0A 5JYLA 1GY2A 3E6FA 1JWMA 2BY2A 2XWXA 1AGDA 4HZAA 4N68A 3QJHB 2RMZA 1SP4A 1E6OH 1H8NA 4I89A 4N2LA 4AYEC 5DD3H 3TM6A 1YNKL 2Z35A 5AVUB 4N0RA 1Q72L 4OAWB 2H41A 4U1KA 3CX5K 3IRPX 3TT1L 1TZGH 1YC7A 4KROB 3CWGA 5F7BA 3AS2A 1AHKA 2NNFA 4Y2DB 2VWEC 4IIQA 5KTEL 2VRSA 1T89C 4YDJB 3SBWC 4L2LA 3VFSB 4GXVL 2OM5A 3C5ZB 4F7PA 1ZANH 1L7IH 2F54D 5GGTL 4XE0A 2E6PA 5EZJA 2LQRA 3O3BB 1AKJB 1NOAA 1GU4A 1X4XA 1N7SD 4MA1C 5I2IA 4Z7UB 3KGTA 3QC5X 3CZGA 1FU1A 5GRYA 2BASA 1CFVL 4UB0L 4W7ZA 3EOTL 4NQCA 3VGGA 5ANMB 1MNNA 3A6BL 4LIQH 4MAZA 2QT6A 3ULUF 1LP9A 1YITP 4R4LA 3BAEH 4Y5XC 4OH2A 5I76B 3VOPA 3MREA 5HYSB 1TEGA 4NCC1 2BNQE 4LSRH 3X3FH 4ZUTA 1L0LK 3LJ3A 1MIMH 2IDBA 1LT9C 3FO1A 2ICWJ 3CZJA 4JRXD 4W9KC 3S35H 1RK0B 2I5YL 1EEZB 3D05A 5A2AA 4X4ZA 5GRXG 1BZ7A 3W5MA 4DESA 2W0LA 2ICWI 1JWUB 1KJ3L 3CCLP 4RQQA 4DEUA 3IF4A 3O3DA 2Y4SA 4FHBD 1QA9A 2H7HA 1CI6B 5KUKA 2NY6D 4B0MB 4YLCA 2AAVA 5LGHH 1R1CA 2OMYB 5EZIH 4JKMA 1KIQA 2WB7A 4HGMA 4OGAC 4D6TD 4P46C 5GGUB 1QP1A 3QUXB 1FZOB 1R5IB 4GKOA 3TBTB 1MAKA 1DBJH 3QYCA 3VDAA 4Y4KD 1EAPB 2ESVD 4EOTA 1DEDA 3WUTA 4GBXB 2VDRH 2XKNA 4M5ZH 4Y4HB 1J0YA 3FOLB 4RMQA 1J2JB 2PWFA 3N7NA 3FCBA 3GLAA 3LNGA 1FVDB 3MLTB 1J5DA 3N42B 4PJAB 4JPQA 3G08A 1S7RB 4YE0A 2BVOA 4LEEA 1XMEB 4KVNL 4CC1A 5CBNA 3GSNH 4NX0A 1X8YA 3IU3A 4XVUD 2CM5A 5I1HL 4L75A 1B90A 5HYQB 1MCQA 2KZWA 3L74D 2OXHB 4OZGA 5C07B 1KEGL 4JFZH 2DEYX 3BRGC 2EE9A 1PJWA 3GNML 4OF7A 4ZOAA 2Q3EA 1UGKA 2F54A 2J6EL 2QSCH 5EZPA 4NHUA 5FGCB 4YHZL 3ZDXB 3RURA 4NRZB 1UJTA 2X6BA 3RVXC 1N7SA 3GHGB 1AQTA 1NCDL 4K5MA 1AGEB 3V95A 1N7LA 3D9AL 3P3UA 4WHYG 2A6DB 4N85A 4UZGA 3ES6B 2VAJA 1XD0A 1Y0LA 3LZLA 4JO8A 1E27A 3ARED 4YPGA 4MCZB 4MAUL 2JVUA 2YZ1A 1T6WA 1X5MA 4FFVC 4I3GA 2O01H 3VFGH 2C9QA 4JRXA 3Q1SH 4OGQC 5JDSB 5C3LD 3A22A 4OZIF 3CCRP 2P1JA 1L4IA 1ZRTD 1Q9LA 5K1VA 5DJ8B 2EDHA 1M05A 1QVOA 1S9VA 4WKXA 3VXUE 1C8PA 3HE5B 1RERA 2QJYC 3OGCA 5LUMA 4DEPB 2EE0A 2GC4C 2MNWA 2VLKD 1ZLWH 4KKAD 5F6HI 1ND0A 2E4FA 5FK9A 3ARDB 1JTTA 2YEZA 4QHPA 1AGBB 4K3DL 1CFNB 4FXGB 3QUZC 4EF3A 2XKSA 4QF1A 1IU1A 2GSMB 2JKXA 3NSFA 4DF9A 2V5MA 3WE6A 2E7BA 1ICTA 4URKA 4I18B 3RGUA 4HUXB 5I5RA 2WO3B 4IEFA 3AEAC 1IK9A 2MIZA 1CFSA 4Y4KA 2ESVA 2NX5B 2NY5L 3MRPA 5D7SH 3DO7A 1ODUA 5KBPA 3PV6B 3N06B 3WDIA 1D6EA 2OSYA 3SE3A 1KGCD 5AFAA 5KYWA 4DCQA 1F11B 2F2HA 1TPXC 5CJ0A 2K3HA 3O0RL 5DC0A 1TJXA 4GW4B 4KOCA 1I1RA 4ZDHB 1WFNA 1U4EA 4Q89A 3UAAA 7PCYA 4QXGL 1E9QA 4XAKE 3QFJB 1M1JA 5F7MC 3MUJA 4PJHE 1RJCA 2XRAL 1FH5H 2IYOA 4PSPA 1LVEA 4BDVA 4R4NC 2QMKA 1RHHA 4OSUL 2EC8A 2DI7A 5EMYA 3T2LA 1G7PB 1U3HA 3RK3D 4ZUVA 1NTMJ 1NBZB 1L0PA 5DUBA 2P5EE 2XWCA 1KCVL 2XVBA 1GIGL 3MACL 3D50A 1OSZB 1JOIA 2CUMA 1GKOA 1VQ4P 1I8IA 3E38A 1IAIM 4DGUA 4XMKH 4GYBA 1UGNA 2ADJB 2CKBH 2QPEB 4HWBA 2NR6C 3H25A 2BK8A 2E7HA 1PS3A 5ABAA 3N1PC 3AREA 4RMWA 3AQDA 3APCA 3P32A 2RGSA 4LXFA 2VLLA 1PZQA 4LRIA 4OZHF 3WIIH 3R0NA 2E27H 4L3CA 3NTCH 3UEQA 4EDWH 5D72H 1ORQB 5D5MA 3RB5A 1DJXA 2GKIA 3AROA 2OYKA 1EGJL 4TSCL 1QSFB 3A67H 3DX0A 4AX3A 3M7OA 4HBCL 4F7TB 1OAXL 3K2IA 1NDMA 4L05A 2VLKA 4ORZC 5DD6B 4QLRA 1LEGA 1T1ZA 1DVUA 1A22B 3UACA 4YHYB 1JGVL 5DD1L 1WAAE 2FR4B 3L75D 1X6NA 1ORSA 4KJYA 4XNZC 1JTPA 2VSCA 1GYWA 4WW2F 1XDTT 4F33A 4NKIL 5AW6B 3HHMA 1FG9C 2E5YA 3ABKB 2HG5D 2F6AA 1QI4A 2GTWB 5FYKH 4TSBL 4DNLA 1XR8A 3MCLH 2D2CC 3BIAX 2B3RA 1ZPLA 2GHZA 3ARVA 4XBGA 4BRJA 4MS6A 3BKJL 2PCPB 1SVBA 3QWOC 4OF6A 2IBZD 3DROB 4R84A 3EF7A 4XNXL 5F9JB 1HCFX 1SDDA 1H5BB 3H1IJ 1S3KH 5GZOC 3OA7A 2CDEB 3TBYB 2XNAA 3ZDZE 3U2IA 1AA0A 2FQGA 4J3OC 4J2XA 2GUYA 5G5DB 5F7DA 3QXVA 3KG5A 5IB4B 2O61A 1RUPL 3S4SA 1XF3B 2N9YB 3A5TA 4X6EA 4ZPVA 1ZT7A 2I1JA 1XV8A 5J0BA 3RTQD 5AWNH 5CMAA 4OLVH 4ZODA 5C0CB 1E6OL 3LEYH 1VCBC 1FOSE 3QEHB 3TVMB 4TNFA 3WFHB 4BYHA 3MZTA 4HJJH 5DD3L 3RIFK 1UJ3B 4JG1H 2YZ8A 5LCVH 4EQ3A 1XGZA 1LWUC 2ZUWA 1DDHB 1TZGL 4RWHA 3IPBA 2WLLA 2XV0A 1JDCA 4H0LD 3TU6A 3ARPA 4R90H 5ID0A 2O4EA 3OXRA 3EJZC 3S5LG 3HVDA 1ZANL 1L7IL 4NUMA 4WZ9A 2R2EB 2H5UA 1NFAA 1YECH 4ZO6A 5AW1B 4LLYA 4NO0B 3MJ9H 1SQ2N 3HAEG 5FYKE 1XGPB 3RWEA 1FQ9C 1BQUA 3R2PA 5B22A 3SPGA 3RIKA 3TZVC 1AO7B 3AJ7A 5IW6A 3LN5A 4YL9A 3C9NB 3DV4B 4M1GH 5LGJB 4ZFQA 4XMZA 3EGDA 3N3EA 4LIQL 3ZKMD 5IB2A 1CXLA 2BNQB 3BAEL 3D3VE 4YZWA 32C2A 2J6WA 3K1KC 4LSRL 4XNDA 1SRDA 2A74C 2AV1B 2X7LB 4P2QA 3X3FL 2DS4A 4TN9A 4B5ZA 4DP7X 1MIML 1X5LA 2NUTB 5I5JA 1XTMA 4P48A 3S35L 4C47A 4EDXA 5I18H 1BVLA 5DJAB 3CD4A 4ZT1A 3LIEA 4OQTA 2WO2B 3RX5A 2XWTB 3H7LA 2ZG1A 5HVFB 3T1FA 3BVUA 3BH9A 2HG5A 2WVVA 5IJDC 1NFDE 1W8OA 3NCWA 4JM2C 5KWYC 4Q9QH 1MFUA 5GJSH 1I7UB 2KPWA 3RDTC 5LGHL 4X5QA 1NUFA 4H0IA 1JZJA 5EZIL 1DEEB 2BH0A 5KSUA 4ZK8A 3VFPA 3G5YA 3QFDB 4UIMA 1WYJA 4G7RB 5DURD 5I71C 1NIBA 3RLSA 3O11A 4NP9A 4PREB 5FM5O 3DJSA 1DBJL 4DKEH 1N67A 1HVVA 4KQ0A 2VDRL 1PZBA 1VQ7P 4M5ZL 1F3JB 3Q3GA 5AB9A 3RTQA 3TSIA 3CZNA 4GFXA 4GIAA 2ICEA 3TYFA 5E1QA 2WZ0A 2F58H 2R2CA 4JFYA 2CRYA 4WHYH 5DEGA 4LVHC 3GSNL 3HB3B 3HPJA 3KLKA 1VFAB 5F1IA 4WTZA 1F2XK 3MGTA 4TVPD 3CCEP 2HVKA 4PTTA 4GOEA 4PN6A 1HOCB 2KZIA 3F5WB 1UXWB 4X6CF 4JFZL 2CDFB 4JF7A 4Y5YC 3CG8A 3GXDA 1U8OB 1VQ9P 2QSCL 1ZPUA 4