4RESB

Crystal structure of the na,k-atpase e2p-bufalin complex with bound potassium
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
288
structure length
288
Chain Sequence
IWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRFRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, hydrolase/inhibitor
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Structures and characterization of digoxin- and bufalin-bound Na+,K+-ATPase compared with the ouabain-bound complex.
pubmed doi rcsb
total genus 50
structure length 288
sequence length 288
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4resB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 4resB02
5APQA 3TNUA 4AYCA 4DZOA 4B86A 2N9BA 3OAKA 3P8MC 5APYA 5AW6B 5AVYB 3V4WA 4KHXA 2Q3IA 2VRSA 3NMDA 3WGVB 5AW7B 3IR9A 5APXA 1IO4A 3L36A 3TK1A 3A5TA 3I5CA 1H8AA 4XE5B 2WT7A 2P67A 1H88A 1CI6B 3O8ZA 3A2AA 2QM8A 4I6MC 3HTKA 3M06A 3MGNA 5AVQB 5AVZB 3M91A 1GZLA 2ZXEB 1OWAA 5AW5B 3M0AA 5AW1B 2R5BA 5AVRB 5AVSB 1YYCA 3KDPB 5AW0B 3A7OA 1DH3A 1T2KC 2ZFCA 3L35A 3P7KA 5APWA 3VMZA 1MUUA 1JNMA 3B8EB 4JYBA 3SWFA 3V5BA 1HJBA 1HWTC 2YNYA 1GU4A 2Q7CA 4M3LA 1G2CB 4C7NB 2BASA 2QM7A 5AW2B 2Q5UA 5APTA 2H7HA 3HE5A 1GD2E 3TNUB 3VMYA 3P32A 4EOTA 2Z5HA 2R32A 5AW9B 3MD0A 1X8YA 3VTPC 2P7JA 3HE4A 5APVA 2R3CA 3A3YB 3LIDA 5AVXB 3VMXA 2YO2A 1JUNA 2Z5IA 4AUWA 3NFQA 2W27A 2KP8A 2WT7B 4RESB 3UIAA 4AQRD 1MFZA 1GK4A 1NWQA 5APUA 1GK6A 1GTWA 3M9HA 5AVWB 1CZQA 1J2JB 3M9BA 4HYTB 2YO3A 1NAFA 2C9NY 1FAVA 3KQGA 2JJLA 3M0DA 4RETB 3TYYA 2R5DA 1KQLA 5APSA 3VYIA 5AW4B 2E43A 2WPQA 1HBWA 1CI6A 2XU6A 2W6AA 5AVTB 3LIEA 2WPRA 1SLQA 2XV5A 5AVVB 1S9KE 2WPSA 5AVUB 1A02F 1MV8A 2WTYA 1OXZA 5AW3B 5AW8B 1A02J 4I2LC 4GKGA 1FOSE 1SP4A 3HE5B 3VN0A 4GT1A 1FOSF 3V4QA 1GU5A 2XZRA 3L37A 1H89A 4C7NA 1HUCA 3T97A 2E42A 4LC1A 1S9KD 2IPPA 3HE4B 4C46A 1T2KD 2WWWA 4JYCA 2P2UA 5CMZA 2C9LY 3NTNA 3NXSA 3WGUB 1CSBA
chains in the Genus database with same CATH superfamily
3NRFA 4LCWD 5DO2C 5AOJA 1H6FA 2ZT9B 3OC8A 5CR1A 4QPEA 1HYRC 4LEOB 4LCYA 5C97A 2V17H 1MRDH 2QADC 5E9DA 5ESVA 2EYTB 1QLEH 4N2OA 2R2BA 1YQVH 4FLHA 2B3IA 3QQ9C 3VFWA 4XN5A 4WUKL 3W39B 5CJXA 2NMSA 2WD0A 1S5LH 3QEQE 4WVRA 2OP4L 3I02A 3LZOA 3MJGX 4AM0B 2JWDA 3B8YA 2LFEA 3Q5YA 2XC8A 1DJYA 4PRPA 1LJ2A 4DTGL 1KTDB 3MU3A 3RGVB 1OV8A 4ELME 3N85L 1RZ7H 2A7BA 4Q9QL 4Q9RH 1UQSB 1JBJA 1EEUA 1E6OL 4F15C 2OPCA 2R27A 3EWKA 5BV7C 5KS9A 4APQD 4JO5A 2AJYL 4AGQA 3VFGL 3V5KB 1VZGA 5EFIB 3ASWA 4KJPC 3PV7A 4YSSA 3U30C 1HSAB 4N8UA 4J3OG 5HHOB 3VI4B 4YIQB 1NUFA 1D3CA 3MRKB 4JG1H 4KVNL 1KGUA 4PV9A 4X6DE 5T5NF 2B59B 2J72A 3EYFB 1RZJH 2IAMD 2IOOA 4CVXA 4HT1H 4P2RD 2WLHA 5DHYB 3ULUL 4NRYB 3QNZB 1UKSA 2N7BA 4MFHA 5JR1H 3HC3H 1QHOA 2WMPA 4IHBA 5C0CE 2BP5M 4LVNB 5DSCB 1T2XA 2BP0B 1KCUH 1F0LA 4H13B 1JRHH 3WHXA 3MP7B 3GSQA 3MACH 4XWOD 3SCMA 5C0DB 2I69A 3TIEB 1E43A 1M6OA 5KJ7D 4RA0C 4LIQH 5ANMA 4DVBB 4MX7B 4ADIA 3NAAL 1EJOH 1J0ZA 1I53A 3OQRA 4X5PA 2LAAA 2MCPH 2AK4B 4U0RC 2BIHA 4X6BA 3V7MA 2FEEL 3N41F 3RK3E 2OSYA 3REVB 3UGEA 4E9TA 1C9SA 4M3KB 2WYIA 5AVUB 4KUCF 4OJDH 4KZDL 3HC4L 4UIMB 8FABB 5A43C 4JE0A 3WG7B 1FA4A 4LAQL 1NTKK 2GJJA 5EB9A 3IMRA 4Z7QE 2JB6A 1FNHA 1RK0A 1J0IA 4ES8A 1E9QB 2FX7H 4B9FA 5DJXA 3VN0A 4P2QD 3T65A 3CWBG 3WTVA 2BVPB 2I25N 4OBSA 3NIGE 3FO9A 4MTMA 2Q5BA 1GIGH 2RQEA 3BYTA 4RGNC 5CMZA 3WS3A 3BJLA 3T2LA 4IIZA 2KNCB 2EC8A 5C07E 3N1PC 3O8XA 2VZVA 2HUHA 4D9QD 3M0DC 3V6IA 4R4NC 4KQ4H 1JXFA 4AH2A 4XMKL 3PJSA 2DQHH 2HWZH 4E2OA 3MX0A 4ALAC 5C3TA 3D2UB 4X5RA 1M9SA 1NOHA 3C2SA 3O6LL 2P43B 1YY8A 4YXKH 2XN9B 1FC1A 1RP8A 1T3FB 2ENQA 4U33A 4URTB 1M9WA 5C9KA 1IEBB 3L8QA 3F7YA 3GZKA 2DQTL 4P9HC 1BVLA 5HGDA 2FQFA 1UM4H 4N2EA 2WGNB 3WMQA 4M5YH 4LP4A 4UANA 3P73A 1I3VA 3QDGD 1N5YH 4FL4C 2VABA 4HJTA 4ZXBC 3WEXB 2LXBA 3HNSL 3OZ9L 3VAEA 4DH2A 2YGPA 3JTSB 3QEHB 3WXVH 1UH3A 4OCSH 3L70G 1RKRA 5JUEL 2VLKB 4MJ2A 1DUZB 1DEEA 2L7QA 1AKJA 3QORD 5I6MA 2I7SA 2R1WA 5HHNB 4MMYA 2R8SL 3KJ4B 5FCUH 2JQMA 4BFKA 3MLYH 4ERSH 3CX5H 3B83A 4EBQL 2LTQC 3SDYH 3R7QA 1CYXA 4ANUA 1K2DB 4CMHC 2Q3ZA 2UZYA 2BNQD 4MVBD 3OQ3B 4GIAA 1XSOA 3K4ZA 4U6HB 2GUOA 5TJHA 3MRIB 5KS9F 3DOSA 2X4SA 1NC2D 2AEOA 2DYPB 2FECI 1T21B 1KB9K 5C6TH 4Z0XB 3FZUD 2NY0D 1FHNA 1Q72H 1JHKL 4Z3HA 1XGQB 3IXTB 4LSDA 3FT4A 3U83A 1G7LA 1GMEA 2H8PA 3AXHA 5G2NA 3SDCB 5C7XL 3AEAC 1HE8A 2FT6A 4QCIA 2YGVA 2QLVB 4K7FB 5DHVB 4F7CA 4NM4H 1MCOH 4FFVD 4NFDA 5DQDH 1IILE 4KKLC 4N22A 1OEZW 3WNPA 1TTCA 3DX4A 2CKBB 1ZVYA 3HI1B 5KBNC 1RJLA 1HI6B 2E7DA 2H0EA 3A22A 1GXEA 2QR0B 2OL3A 1F1GA 1SMOA 3O6FB 4U3SA 3MBEC 3VXSA 3MUJA 2P80A 4RDBA 2AXTH 1R8EA 3GMNB 3TEWA 4BWUA 1EMTL 4Y16D 2YMXH 5D70H 5ICUA 1M2VA 2X6BA 3MOBH 4HK0A 5TE6H 5IROD 4OZFB 4JPWH 4GXUN 4XMLL 3QYMA 2W0FB 1OP5K 1I8UA 4CSSA 3OJDB 3FHQA 3RDTA 3ZQWA 3INOA 4N9GA 2DDQH 1YEFL 3D6YA 4WKZA 5IB4B 2UV3A 1UWYA 3BD4A 3UAJA 2B77A 1FO0B 4AVJA 1FRGH 5B3JE 3QHFH 2JH2A 1PP9J 4MXQD 1F11A 5GGSY 4TULL 4I1NB 3TBWB 3GMRB 5D4IA 2A9NH 2NY2B 2CK2A 3SBRA 4S0HA 2NQ3A 1KGXA 4H1LG 1ZT7A 4RBPK 2JXMA 5A16A 3WSQL 3W9DA 4LEEA 1U8NB 1RJYB 4J8QA 3BWUC 2MQGA 3I74A 3KVQA 4XMVA 1NL0L 1KJVA 3CFDB 4ZUUB 3MGNA 4MJIA 3I6GA 1USQA 1NCWL 3D06A 1NKZB 4F80A 2NUPB 1AI1H 3MV9D 3N1QC 2FEEI 2P4AB 3NOIA 2HB0A 3TU6A 5JHDE 3GK8L 1I85A 4B9YA 5HYQA 1YQ4C 5L9DH 1B2YA 4XN9A 3K4DA 1RVFL 4NQDA 4GRMB 4KKPA 1UXSB 2JKJA 2QFRA 4HUWB 5H35B 2FFDB 2MCG1 2DWEA 4KRPB 3V52H 4C56B 3IDJB 2PW1A 5DD5L 4IK6A 2NY1D 3HVDA 4U1KA 1G5AA 2WTPA 4JFEB 3U6XA 4B9PA 3BP5B 1RE4A 3KPRE 4XNXH 5FHBL 1BE3G 3Q7JA 3RL2A 3HZVA 1N67A 5GRUH 4OD3L 2Z6FA 5I2IA 3D09A 3E80A 5HYSG 4QY8A 5TDNB 1Z32X 5AYQA 3B9KD 1OGAE 2BP8A 2UUDH 2HPTA 5KYWB 2CJTA 4D8PB 3G5VB 4CL7A 3BZ4A 3ZMEA 2QQLL 4NC2B 5C09A 2EP6A 4IFFA 4HS8L 1N8RQ 1JV5A 4TRPL 5JHMA 5KVEL 3VMPA 4GKNA 5AAMA 1SRDA 1AGFB 4RRPA 1S9WB 4EUPB 2H6UA 4BUQA 2DEWX 3L3DA 4LQFL 5FM4A 3Q2NA 4L3EB 4PB0H 2Q2LA 2AK1L 2EKSB 4K3DH 3VG0H 4P4RA 4YHNB 2GHZA 3EF4A 3FUJA 1T04B 5GZNA 2EDMA 4KKCD 4F8NA 1WF5A 1ZANH 2Z31C 2EDWA 1BIIA 3CUPB 2GEEA 1FFRA 4HGKC 4R2GD 2VKWA 2IGFH 4OW6A 4UQBA 5DQJA 3USSA 2WLLB 5EIIA 3IE9A 3DVIA 1FSKC 1U8IB 4KGJA 2BX5A 2HJKA 2X42A 4XRCA 4S10A 2CPBA 3MRLA 3SQBB 1U58B 1CGWA 5D1QC 2GM4A 2VW6A 3MGOB 2ENSA 4A2HA 4GT1A 3SDXB 3TT1L 5JIDA 2NY3B 4PJ7B 4ZMXA 4YDKL 2F58H 4K8RD 4XE0A 3F12B 3ZE1E 5CSZA 4EE2A 1U42A 1T5WB 5ADOL 5A2KH 5M94B 3HD7A 3LAFA 4FKHA 1TTBA 3QO1A 4JY4A 2EINB 2OZ4H 4EI6B 3B3BA 5BQ7A 2X2IA 5IJVA 1S7TB 5IQ7H 2DLEA 2X4UA 2X3CA 1Y47A 2WLYA 3P8CE 1JZ7A 5I1LA 2PPAA 2P5ED 1V7NH 2CSPA 1VZIA 4L4TA 3C60C 1RY7B 5D6CA 1S78C 1MEXH 4YHIA 3UGXA 4Z7NB 3EOAB 2VLRE 4QYOB 2X4PA 3LRHA 2AS5M 1HQRB 3HZKB 1IEAA 1QLED 4R3SA 3W82A 4KNSA 2CIKB 4W70A 1CLCA 5MI0C 1EZUA 1S7WB 2XI9A 2YKLL 5ITFB 5I1EH 3KWXA 2UX7A 3BW9B 2OMZB 5JOPD 3VMZA 1IAIL 1FZJA 2EDHA 3F8UB 3PAZA 2OYHA 2DBJA 1OB1A 3UAEA 4OCMC 1RHHA 3LYRA 1UWFA 5GGUB 4LHUB 4GINA 3HRZA 2W07A 1URQC 2XWTB 3MOAH 1DTUA 4OJAA 4QD2E 3U1CA 4NPJA 3X1GA 3OHXA 5T1LB 3MJ8B 4MD4B 1ADWA 3QG7L 1X3DA 3VFSA 4BK5A 3HG4A 5BW7C 5APTA 2BIMA 2C9PA 3JTTB 5TPWL 1RUPH 1PEWA 3BEVB 1YEIL 5I17A 2K9FB 1Y6MR 4G7YL 3HBPA 5KJRL 5FGBA 2XTSA 5AYUL 4J3XA 5IBUB 3SPCA 1TZHA 4XBMA 3VXMB 4HWZA 2Z9TA 3DI2B 1HSBB 1MELA 1G7PB 1T0OA 3KLAB 5EU6B 5KVGL 2XNXA 3NJNA 4BHUI 4YHML 4DCQB 1AG6A 1KCRL 3WE1A 4X5XA 2E6PA 2VXVL 3BYYA 2QTEA 1AVAA 3VMOA 5DHMC 4WUUB 4XAWL 2XVBA 3H6AA 4HLZH 3TPUB 2CJSA 5CCHD 1L0YA 1OAKH 5CSGA 4XVJH 3IAGC 4DCKA 1LJMA 3HIZA 1RZQA 3STBA 5F88B 6FABL 2MWCA 5EBLB 4ONGH 2OQJB 4W93A 1USEA 1ZMYA 3LIEA 4NCC1 2VMDA 1FNEA 1ML0A 3H9SA 5JPNA 3WAJA 3RL0g 1UXWA 4S1DC 3CG8A 1UACL 2JB5H 2BFVH 1JMZA 4BH7B 4XXCC 3AEFC 1ETB1 1B4JL 3WL9B 4PJ0H 2EDRA 3KBPA 5DS8A 3V6ZA 3PFUA 6TAAA 5I66B 5GGTA 5AOZA 1MFAL 3K71B 2EVGA 4NQVB 3WDJA 3KEDA 3OLDA 1RFDL 2ICWI 2HLAB 3VH8G 4EI0A 3KPMB 2YFOA 1I1FB 4IW4C 2O6PA 2ZZUT 4ENEC 4Y0GA 3SY6A 3NJJA 3NACL 4GSRA 1NTKG 1TNNA 3U2IA 5FUZL 3LRGA 3WMM0 4P59H 2Z91B 2ZAHA 5HDBF 3U2SA 3MCKA 5CZKA 5E6SB 4PJ5B 1NAMH 5KSBE 4MJ5A 1EO8L 2J59M 4AX3A 1BFVH 1NGWA 1A7QH 4H8WH 2EC9T 5IR1A 3PWJA 1VFMA 1M7IA 2J5LC 3RTLA 1H8NA 1E9OA 2XQYG 4GBXB 4NZUH 4ZUTB 3VWKB 3D33A 1HQ4B 4PREA 3D1MC 2VLJD 2XWCA 4UAOB 3RZCD 4GQZA 3SEPA 1PY0A 5GTHE 2E75B 3ELAT 4N0YH 4CC1A 3FQTB 3RFZA 4AJ0A 5HYEA 1SQQJ 4WFGD 1L4AC 3MLTB 2ZXQA 1W0YT 5AVRB 3CBRA 3F2LA 1AA0A 1Z9OA 5A6IA 3ATEA 3UIZA 3Q44A 1FCCA 3RJOA 1CBJA 4OIBA 4ELDA 5I1IH 3DYOA 1JV2B 5DJTB 3JXAA 2EYRA 2KLRA 1K04A 3L75G 2F61A 3FB6B 2E7CA 2JQZA 3BP6A 3LV3B 2OXGA 4P5TD 1YPZB 1DQJB 3VM7A 3REWA 4LBEA 1TKWB 3WUWA 1PPJG 5BS0A 4YK4B 1CD1B 3EJRA 2CO7A 3MV8D 3CSYA 5ACLA 2VUYA 3TT3H 1IGIH 4J2XA 1G87A 1XB3A 3FSWA 3T0EE 3M17B 1B88A 1FLRL 2ESVB 3EOYG 1FG2B 3HOGA 4HH8A 4Q56A 2DQEH 1HDMA 1D2OA 4CAGA 1ACZA 2ATPA 3CX5D 2HODA 2CKBH 1N73A 1AANA 2DTML 4BZ1H 3MBXL 3T2OA 1KLFA 1A64A 1WAAE 1O6SB 4OVUA 4JGMA 3NPZB 2J1YA 2DQ6A 2W9DL 5CGYC 3VU1A 4A2MA 3M9QA 5KBLA 5F6HJ 5L2JB 1L2PA 2FLMA 4NQSB 4EI5D 4AGPA 3M9BA 3MROB 3PGDA 4OZFH 4DP9X 1FAVA 3KVDD 4Q6IB 1MLCA 1PCXA 3FU3A 1EK3A 3HPLA 5ESAB 4GUOA 1TPXB 3O9WC 1BMZA 1CI6A 1TQVA 4ZTOH 3ZDXE 5CZRA 5GS1C 4N26A 1B4LA 5E94A 5IBLC 2CUAA 1PAMA 1JTHA 2IFGA 3LH8A 2KK7A 4MJ6B 3TVMA 5GRJH 4QRPA 1WH0A 3ZUCA 5E24E 1PU0A 1FGVL 4FTVB 4D0DB 3MJ9H 1FO0H 1DLFL 1EWHA 2A99A 2FO8A 2P5WD 1HH6B 4PVLA 3W2DL 1KZYA 4BUGA 1C8PA 5FGRA 4NQEA 4IIQC 3ZTNH 1RF0C 5JW4Q 3EGXA 4XP9L 1KCWA 3H3PH 5E8EA 4N8VB 1ZVSA 2GI0A 4Q2ZB 3EYUH 3T0VA 2R29L 4NIYE 1BM3L 4W9CC 1Y18B 2OCJA 1DQKA 3TZVA 2TSAA 5F1NA 4WEBL 1I1RA 2G4GA 2Q8BL 1A5FH 1UCBL 4X9FA 2OTUB 4G7VH 5MHSD 2WITA 3HE4B 4KHXL 4R7LA 3L5HA 1MLBB 3S2AA 4G1MB 2BCCE 2VDQL 4GW5B 1EEQA 4I0KA 4QTHB 4B53A 5C8JA 5DLLA 3HG1E 2XXGA 4XO9A 4ATWA 4FRWA 3T5WA 1SYVA 4TSAH 4LLYA 3BP7A 1O0VA 4PRAB 1M1JA 4LCIL 5EC1A 1JZEA 1R0AH 1MCPL 1GGIH 1F86A 3QUGA 4POYA 5GS0D 1FZCC 4MGXA 4MYPA 3B2UC 1KJ2L 3AM8C 4MA7H 5E5UB 3WE6B 5J13B 5CEZE 3OKOB 2NW3A 2XXFA 3RWGB 1OANA 4ZUVB 2VSKB 2XZAH 3QXDB 4G71B 2KHAA 4JM2A 1XR9B 1XCXA 3K6SB 2LR2A 1BQ5A 3QJFA 2MPVA 2X10A 1ACYH 2BSSA 3HUJB 4KK6C 3V0HA 4ABWA 3V7AE 1TZGH 2BCKA 1OP3H 1QFWL 1A6WH 3QUMB 4NN6B 5IV2A 1U36A 2NXZC 4ZAKA 2YEQA 1ANUA 1N26A 5J1SC 1V8HA 2C7UA 3GMOA 1G94A 3KPSD 4NNYA 4NQCA 4P3CL 3ULVH 1I9RL 3CFKA 1I7ZA 4AGLA 2DQCL 1IFHH 1L0XA 2YHGA 3M1BA 4JFFE 4M3HA 1WG3A 4FF9A 5SWQB 2KH2B 1CW5A 4ZBJA 1LEIA 1M8OB 4C7NB 4EUPH 4PWHA 1BF8A 4ASVA 1XGUB 2HT4C 1JCVA 3VXPA 4GODA 3N7NA 1QSZA 3UYOD 1L6ZA 5T3XH 3TNUB 3ZKND 1UD2A 3RL0B 1P7QD 4K8RL 4YX2L 1S7QB 4D3CL 5F7LB 5LB1A 3FSAA 1CGSL 1NFIB 3VFVA 3OMAB 3VD7A 2D3VA 4HK3N 5HHME 4P57A 1TU3F 4KO9A 2WWMD 4QR7A 2FYYA 3DSNB 5I19L 5D7LE 3HB3C 2IIJA 4OM1L 2ZOOA 3QDMB 3FWNA 1GYAA 4Z3FA 4TQEL 4P05A 3OB0H 1N64L 3CH1B 1NAFA 1CICB 3RGBA 3CFCH 1DBKH 4LLMB 4JS7A 3I9GH 1WWBX 1L0LD 2XWBA 3QXVA 4QF1A 2J6EA 3QIWA 3APDA 3TYFA 2V17L 1MRDL 3CFBB 3EG9B 4PG9B 5JHAA 1QLEL 4ZO6A 2OJZH 3A0BH 3BDXA 5TF0A 2O93L 3FCUB 3UTSD 4IOFC 1YQVL 3KH4A 4PRIE 4LEXH 1G0YR 4W9DC 2DLTA 3MUHL 3NG5A 3RZWA 4N5EC 5MENA 5AZEH 2NX5A 4RMTA 1UM6H 4F7TA 1M2OA 4UYPA 3SBWA 1CCZA 4J6IA 4MQ7A 5D1XA 3RE0A 2MTAA 4UDTA 5KANI 1AZRA 4GXFA 5J6HA 2E76D 4HUVB 3PGFH 2ZT9D 3NYKA 4J28A 1MFNA 4Q9RL 1FBMA 1OCRB 5AL8A 4W7YA 5BJTA 4DETA 3IJ7A 3TJHD 1M53A 1H5BB 4OAWA 4QHLB 1M7DA 2ID5A 2VT0A 2A2QT 1OTSC 1E28B 4PJBE 4WHCA 2HT2D 2XTJB 1J8HE 5DZJA 4TQPA 1KB5B 1WITA 4ZW8A 3GTNA 4Z9KB 3RTQB 4JG1L 4TVUA 4PIBA 1SOSA 5TISE 2HLEB 1EAOA 1RZJL 4FA6A 2C7FA 4PJHE 3IK2A 2QADB 4HT1L 3TBCA 2A4ZA 5I73C 2W9EL 3CXHJ 1IQDB 3DGCR 3HC3L 5JR1L 2FYUE 3NEEA 3TC9A 1IC2A 4JPKH 4XCFH 4XPHH 2DD8H 1KCUL 1NU1G 5KANG 3WV0A 1FAIH 3WI9A 1YMHA 1JRHL 2YR3A 3O41A 3MACL 4JO8A 4Z0BH 3TGUD 1MUJB 2DV6A 3APMA 4WSGA 2LVCA 3UYPA 2KS1B 5HHOD 4HKZB 1TU2A 1Q7YQ 1EZVX 5C0EA 4YSCA 1ED3A 4WF7A 1NTMK 4CNIA 3WNLA 4F33A 4JM2F 2SEBB 5LAPA 1EJOL 3QNYA 5IMKB 4F15B 2QZQA 4PRIA 4CW1A 3EH3B 4RIRB 4L3AA 3O8XC 1KJMB 3I3BA 2V7QH 1YG9A 2D31B 4JGNA 5FO8A 5DF0A 3PWNA 4K7PH 2BVOA 4Z7OE 3U30B 5DDHA 2Q6WA 4Z7UB 3N4XA 5DD6B 4H13D 4LMQE 4GO6B 1D5ZA 4ZSOE 5GGVH 4XCEA 2FX7L 1LP1A 4JX0A 4JKKA 2A73A 4X0NA 1WUZA 1F6LL 3KLKA 1RUMH 5H94A 4F1SA 4IKIA 4J3OF 1A8ZA 4UCFA 1JF6A 1L0LJ 3IMTA 3LQAH 1ZGLB 3HTKB 1GIGL 1J8HA 2AK4D 2JFCA 1PGRB 3I50H 5CLXA 5C0BD 3TA3C 3LNEA 2F54B 4NBZB 2FR4A 2CRIA 5SWZD 2OTWA 1RQVA 2C5DC 3BLBA 1XR8A 1RY3A 2WUCH 3BGFC 4FFTA 4X83A 1HBWA 1E90A 4KQ4L 2PP6A 3GEWB 5T1MA 3ULUE 4LCCB 2DQHL 2HWZL 3UYRH 5LGJB 5IQ9B 2F7IA 1BVNT 1KN4H 2B1AH 1D9KA 1E8WA 3WN6A 5I1KH 4U0RB 4IKNA 4YXKL 4HOXA 2HVJA 3TTSA 4A63A 4N78D 4UM8A 2DIAA 2D4FA 1FL6B 3I6LD 1LMIA 4NPYA 1ZV2A 4Y4FC 4M5YL 1V54B 3ZTDC 3KPQB 2VRQA 1N5YL 2QPFA 1VZHA 3HRNA 4NI6A 4JRYE 3NGBC 3ABZA 4A7VA 2XZZA 1A9EB 1OKEA 1WWCA 2VH5H 5BZWA 4ZNCA 2C9LY 2HN7A 4LOVA 4MNHA 4OCSL 2HFFB 3JWNH 3NXSA 4PJAE 4Y1AB 4F58H 1MAJA 4G6MH 2XN9D 1NM4A 5FCUL 4OCWH 3MLYL 4ERSL 3UBXI 4KT0J 2C26A 2AW2A 4G43B 4H1LA 3WO3B 4AL8C 4ZQTA 3SDYL 3TURA 5D7KE 2ERJC 1CXEA 5LWYH 5A2BA 5BZXA 5BPPA 2TAAA 2FJSA 2QGBA 4J4PD 5F7DA 3U7AA 3EYVA 4Y5VA 3JV6B 4N24A 3ALWA 1UJTA 1ZA3B 2FD6H 1QSFA 3E1RA 1ZS8A 3IGAB 3J07A 4GRLB 3OAZH 1WFOA 1WCBB 4HLJA 5C6TL 2HJLB 2VLKD 1L6XA 2QG4A 1NOAA 2XVKA 3QIBA 2BDNH 2G3XA 2Q86A 3F7VB 1Q72L 4OFIA 2HPCB 4WEEA 2HG5B 4N2BA 4OCXH 3HEIB 3PV6B 5DJYA 1JP5A 4BRVA 4OCLC 1ONQA 2C1PA 3IU3B 5EN2A 4YQXH 4ZXBB 1PDKA 1JWSA 2H26B 1WHOA 2K1MA 4WI3A 1PV3A 5EFWB 3FCGA 5B1BB 1MCOL 3UAJC 2C9SA 1D6EA 5DQDL 1AR1C 1NIAA 1QTPA 4Y7OC 1XBDA 4AYFA 4F7MB 1H0TA 3P4OA 3UBXG 1BSHA 4FX5A 5HYSA 2DQUH 4F92B 4RVBA 5B5EH 2Y25A 4Y19B 2DYPD 1MZZA 2Q3XA 1S7VB 1FDLH 5A6LA 7PAZA 3K1DA 5D70L 2YMXL 3G6JA 4H26A 4JJOA 5EBWB 4OLUH 2WP3O 4KITB 3MOBL 4CMHB 5TE6L 2YPVH 5EEVA 4KJYB 2BOCB 4JPWL 3V0JA 2I9TB 4J8RA 5IWLA 1A6VH 2P8LA 1DN2A 2VWEE 5HJDA 5I6PA 3S35X 2C4FU 4AENA 2V0AA 4XP1H 5KOVC 4QJ4B 1BVOA 4FQHB 5E8OA 1A9BB 1G9NC 2DDQL 1T1XB 1I85C 4YEFA 2JR8A 1EAPA 1GTWA 4ODHH 4N0UE 1L9PA 3E6HA 5GS0L 3OR6A 4QGTA 1MFTA 2DBLH 3O6FD 3TN0C 4ODTH 1FRGL 1NIEA 3QHFL 1FZEA 1U8PB 1CD9B 3IGLA 3MV01 1HVXA 1QW8A 3DIVA 1EVUA 4X4YA 3GUTB 1JRHI 1YI2P 1PL5A 5IM7B 2F15A 3QPKA 4I8DA 1BP3B 3MBWA 3FSOA 5CBNA 1Z6JT 4JM0A 2WZ7A 4QRSB 4MNQA 3DK0A 2A4CA 3OXSA 4XC1H 5DYFA 1PTZA 1E3FA 3MBEB 2YN5A 3O2DA 5EDSA 5GGRB 4TTDC 3DBXB 3WNNA 3VGDA 5CBEB 3FNKA 1WEJH 1X9QA 2HT3D 3ZY7A 1J05A 1AI1L 1KPVB 1U95A 4J3TA 5IVXB 3BAEH 5CF3A 1BZOA 2R7EA 5L9DL 1JNLH 1AZBA 4GO9A 1S6NA 1VRSA 4MBOA 4HAFA 5C0JB 1UXLA 3OTTA 5EPMB 3SPVB 3VD4A 1ZHLB 4ZMWA 2NY2D 3V52L 2CNZA 2VC2B 4GSXA 4ZMYA 3ETBJ 4GOSA 3IMWA 4P3DA 2G30A 4LLQB 3QUMH 4R5XA 4KZEH 3BFQG 4XNXL 4Z3GA 2XBDA 4E9LA 5GZNC 1N0XH 3NCFB 3PLYA 5GRUL 1MFDH 3MHVA 3NK4A 2M1KA 3WNJA 3ZHDA 1NCNA 4NI3A 3WHE0 1N6UA 2Z7YA 3B5NA 5F0PB 2W65B 3LVTA 2P47B 5DZAA 4AC2A 1K73Q 4KDTA 1RK7A 1ZCRA 3CCEP 4HDIB 1JCCA 2BO0A 3BCCE 2OMNA 4TQHA 5IFJA 5IMOB 1KPUA 1CLOH 4C56D 1IFPA 1OIPA 3ZZQA 3FCSA 4P4KC 1G7MB 1OFCX 4G8GA 1SXNA 3VX0A 4JFED 4BKLA 1YEGH 1NBZA 1FFTB 3AROA 4CMMA 4I0PB 4JK0D 1KY7A 3U4BH 3VG0L 1MFMA 2NY6C 2JKIS 4Z23A 3KCPA 5TK4A 5E79H 2DZEA 3HD7C 2WSCJ 2A6KA 1MNUH 1ZANL 3J2PA 2M26A 4YH6A 4ETQA 2I32A 2IGFL 2G60H 4HKJB 3ULVD 3CU7A 4DN4H 4RLDA 1L0NE 1AAJA 1H0DB 4JVWA 1U3HA 5I26A 5DJZA 1KILC 1JYXA 2YUWA 3GXPA 1U91A 4J3UA 3THMH 1OHQA 1P5VA 5SWSA 3QCUL 3EO9H 2ZYHA 3VCLA 4LO9A 4EXPX 5T3XD 1M1SA 1QRNE 1UB5A 1XXDC 2CM6A 1MFZA 2F58L 3EOBB 3MJ6A 3KZIH 1PNDA 5DJAB 3TFKC 3S35H 1JZFA 1PMYA 1U2CA 1CZQA 1HHIB 2AKRB 1MHEB 1HOEA 3KQGA 1FS0E 1IMHC 3G6JF 3U9UA 4DW2H 2OZ4L 1S5IH 1XH2A 3X1FA 4G8EA 4V1DA 4R4BB 3N43B 3T6WA 3M07A 2VN7A 3CFTA 3I6KA 4N0CC 5LGYA 1FJ1B 1MDAA 5GHWH 1MXGA 1ZK5A 3DTXA 3H1LJ 1B0RB 1V7NL 3OHXC 2Z31B 5JLZB 5KVEE 5I0WA 1OXZA 5AW3B 1MEXL 3Q2LA 2WBXA 4OLXH 4UTAH 1CLZH 3FT2A 4LCWE 4H20H 1W0WA 4YC2B 1FSKB 1I7RB 2AV7B 2ARJB 3H42H 1IFNA 4DQOH 4AITA 5I0ZA 1KB5H 1KULA 5FGBC 3G6DH 4ZPTB 3L74D 1SMDA 1OCZB 3ROOA 1WIOA 1HYSD 4K5NA 3VH8A 4BHUA 1CVRA 5D1QB 3HE7B 5I1EL 5KVFH 3OWEA 3CH8A 5GSVA 4UU9B 3T97A 3Q3GB 2GUYA 5IF0A 3SO3B 3C5XA 3IWUA 3RGUA 4EYYQ 1AXIB 1TR7A 2EEXA 3GINA 3PWPA 4HKXB 1X6LA 2SPZA 1JI2A 1NIFA 1YMMD 4B86A 1OK8A 3MOAL 4PLKC 4TXVB 3FO1B 4E9VA 2GBUA 2VM9A 5LBSH 2F53B 2PTTB 4FI7A 4WI0B 1RUPL 2MRYA 2XQYA 3RL1A 2FYUK 2CR3A 3MYJB 2HX8A 4XO3A 4CDGC 3H1KJ 4YO0A 1NTZJ 1B0WA 3L3IA 5H4ZA 4P46C 2QMJA 1KC5H 2P24A 2QKSA 3OMNB 3QDJB 1J0JA 2JI3A 4PGEB 5K9KB 3L16A 3C6LA 2XJLA 3AQZA 2GHWB 1UWXH 1IIKA 1AE6H 1QLFB 2ICWA 1Z0NA 1V3JA 3T6ZA 4FJZA 3P7KA 2A6JB 2A06G 3FO0H 4LHUD 4P2RE 3E7KA 1PYWB 4WKXA 4HEMA 4WFEE 5T1LD 5MI0B 3MQIA 3QUXA 2CBQA 3B2MA 4DVRH 1HHHB 1XDTT 1ERNA 3QDAA 5JA9A 1OAKL 3IJSA 1DVFC 3L5JA 4XVJL 5DYOB 1QFUH 4IRSC 1HILB 4PJCA 4M6MH 4JFZH 4ONGL 1MY5A 3FT3B 3OW2O 5I1DA 5C6WH 1JI1A 1URQB 1UURA 3VXMD 5KJ7E 1SQXK 2NR6C 5EU6D 3SDDC 2JB5L 2BFVL 3DGDA 3ZTEA 4V11A 5E2UH 5GSRB 1ZE3C 3CD6P 4HKBA 4IHOB 1NTMG 3RIFF 3F62A 1BQHB 5HYFA 4WUUD 4JFUA 4LRNH 4DOHB 3J27A 1HTLC 4PRHA 3RFZC 3L72D 3V0DA 5F2FA 5ESQB 1WBXB 1TG8A 4OZGA 3OA7A 5E4EC 5HY9A 1J9RA 5AOIA 5E0QA 5F1IA 4ZX3A 3LRMA 5CCGA 2CR0A 3K5RA 2C9NY 5LBGA 4ZFOB 1TMQA 4P2QE 4PWJA 3RVWD 2CXKA 4MA1C 2KDYA 2W1NA 3VU2A 5DMGD 4PW9A 3DROB 5AVTB 1M4KA 1NBQA 1NAML 2ZG1A 3HR5A 4H25B 4XCYB 1BFVL 4WHYH 1A7QL 1G1JA 1MCLA 3PL6A 4H8WL 5GJTH 4B5EA 4DZ8B 2D0HA 2H45A 2WP3T 2LLLA 4NZUL 1L7IH 3JYCA 3K81A 5KVGE 4HAKA 4BQBA 3WIFA 2BS9A 4D9QE 4N0YL 4U1LB 5ID1A 1Z9SA 5FYKU 2CZNA 5L4MA 1FDMA 5C0AB 3OLEA 3D0AA 2KZIA 4RGOH 4OUOA 5I0XA 4DP7X 1Q0XH 5I1IL 4AYGA 1T7XA 2GK0A 4M8RA 4ALAH 2P8MB 4YXWH 3CFJA 2OCFD 4J2QA 1QX8A 4PJ5D 3BEWA 4QHMA 3CMGA 5APQA 2GFBA 3PTZA 4GBXD 4HIIA 3QDGE 2Y6SC 3GMQB 4JQIL 4P9HH 3V55A 5AW6B 2IEPA 2GC4C 1H3XA 4ZFFB 2E75D 1IFMA 2G5BA 3S5LG 1ES0B 1T20A 3TT3L 4ZMOA 1IGIL 1ZR4A 3NTCH 3GMMB 4LQ1A 3DTDA 4AYID 2ZTBA 2HSIA 4UT7H 4K5OA 5EU7C 4EQ3A 2DQEL 3HJ0A 1S7RA 3VJ6B 2J5LB 3DHJA 1W9XA 2CKBL 5GPRA 1Q82Q 3BXNB 4BZ1L 3CPLB 4CPGA 3T8XA 3QQ3A 1MHPH 3H2WA 4PJFE 1U2HA 3KYNB 4JDZB 2BNQE 1HE7A 4RAUB 2WTRA 2ZOLB 3TZVC 1L4AB 2HMID 1OCOB 4JPQA 4U7SA 1SM3H 5E6UB 3RIAK 4JHWL 3DECA 2QDVA 5A3ID 5JW5B 1G7QB 5BZDB 3LEVH 1CFVH 1J0KA 2EDNA 3BUYA 2YZ1A 2OMYA 4LT7A 2ESVD 4U2ZA 4ZTOL 3O3EA 5EEZA 3CAFA 4RISH 4U49A 2FNBA 1C1EH 1RQ5A 1M1JC 5GRJL 3MRRB 1O9VA 1FHGA 3OWRA 1LWRA 1CS6A 4OZIA 3WS6A 3MJ9L 1FO0L 3C6SA 4RAHA 2VCOA 4BXLA 1U8LB 4TQIA 1YO4A 3RQ3A 5D2LA 4IBVA 4GT0A 5T3ZH 2P5PA 3ALPA 3Q06A 2EH8H 2FLRT 2G75A 3RPIB 2N0KA 3EYUL 2CRMA 3GBEA 3NABH 4PJCF 1SQBK 2HKFH 2WOBA 4MB4A 3B2XA 1EZLA 1A5FL 3DV4B 4XCNB 32C2A 1CG9B 2VXSH 2ENJA 3BIAX 3LZNA 4WK0B 2ZP9A 4G7VL 1XF5A 1GDTA 2Y23A 4P9MH 5EO9A 3ZZSA 4ZAKC 1VQ7P 1DDHA 3T6XA 5CD3B 4N8CL 5E6RB 4NZDA 3BLPX 3ISRA 2ZG3A 2X4RA 2DM7A 2K9UA 1KBGH 2LLGA 3OXRB 1FL3A 1N5AB 4FTVD 4EZJA 1R3LB 2X6CA 4OBRA 1QFPA 5BO0D 3L7EA 3AE1C 4ZODA 5JW4R 1R0AL 1GGIL 4JFQB 5C7ZA 1KT2A 3O9WB 3AQYA 3BH4A 4I48A 4OQTA 4OZGF 2IPKA 1FVEA 3P0VL 2VC2H 4JRWA 4MA7L 2EVIA 4JFOB 3L3HB 5GS1B 5I9QC 4HX1B 4NUPA 4WU5B 4LPUA 4PYHA 2XZAL 2CDGB 4PJFA 3R1GL 2F7QA 5KSUA 2YBRB 4RMQA 3OSVA 2NYYC 1ACYL 4W9KC 4AJWA 1TZ8A 4KRMB 4NYLA 1FOSF 2JE8A 4IIQB 2FE0A 4L8DA 2B7DT 4O58H 4J39A 2WVTA 4N6QA 1G2CA 4O9BA 4HIJB 4OZ4B 4F2MB 1BF2A 3ULVL 2E42A 3VFTB 4C46A 5H2FE 4LF3B 1IFHL 4K35A 2Y9ZA 3N41B 3ISYA 3SE4A 1HJCA 3MV9E 4N1EA 2XZCH 1JYWA 3Q1MA 1ZK9A 2ZCHH 3O2VH 4B7IA 4MHHI 3QR1A 3PRZA 3TX4A 4BYHA 1ITBB 3QWRD 3P4NB 4MAUH 3C6EA 4LAJH 3CN4A 3QIWC 1NOFA 1N70A 3U0TB 3Q8CA 5T3XL 2X4QB 1HXYB 5I76B 3SJVB 1JPGB 3PNWA 4L37B 4AIZB 4YBLC 3GSXB 1FZCB 2B1OA 4UT9H 1ZY9A 4G8FA 3DVGB 2GYSA 3QR0A 1R47A 2VLLA 3UEQA 5L8KB 4NBYB 5IHZA 3UEZA 5EOCH 4X2UA 3SBWC 4ZQKB 2ZSWB 4E5XB 2R0LH 2YARA 1BBDH 3PWLB 3I56P 1JCDA 3B8EB 3N3EA 2AQ2A 4MMXA 2NXZB 5KUKA 3L17A 1F4WH 3TFBA 5FXCH 2G0KA 3CFCL 2PNDA 3ML8A 1DBKL 5MP6H 2PWEA 4Z7AA 3VWJB 3I9GL 4QOKA 3RL0D 1ORSB 2N7SA 2WBWB 4MHHG 1BFTA 1NCHA 2WZ0A 2G3MA 3BQUC 1KYAA 3RWIB 2UZIH 1FLTX 3KXFB 1M1XA 1SBSL 3NIFF 2YUVA 5CZXC 4KTEL 5FUCE 2IZ0A 3NQKA 2X89D 4FXGC 4LEXL 4XI5C 4G8AC 3C8HA 5BU5A 2ZAGA 5KVDH 4LCYB 5AZEL 2XG5A 5E9DB 5ESVB 5EDXA 4U1MA 4X80H 3QJOA 3ZYZA 4ZNEE 3AS2A 1CICD 2K1AA 3CDGA 3VFWB 4C4KO 1C5DA 3ZDYE 2QSIA 1I4FA 5KSAC 4F7EA 3A4DA 2H2PD 3PGFL 4J3WA 2DI8A 1GYUA 3HB3B 4OZIF 2EABA 1V55B 4PRPB 3KVPA 3D69A 3DV6A 4RFNB 2VJ0A 4RMRA 3RY6A 4PWKA 3BH9A 4JHZA 3SO5A 4U31A 4E0RA 1JE6A 4U7MA 1FC2C 5DMYA 2XSKA 4J23A 1M90Q 3WFZA 5IW6A 3MYZA 1QABA 1TQCC 2ZXBA 2E9JA 2D8KA 3MLWH 5DK3A 4NHCH 1WBZB 3INUH 4WDIA 3RJQB 1O7DC 3TWCL 1WP6A 2QVIA 4KVCH 4XBPA 3L4WA 2EE3A 4NO0A 1GW6A 2BNUA 3SQOH 3L48A 5F3BA 3QAQA 1IE4A 4F9LC 1JGEA 2HVBA 2XHNA 4TLSA 2P5EE 4PV9B 4JPKL 4XCFL 2BH0A 2DD8L 3HAEG 1FAIL 4AQEA 3BGMA 5CJQH 1QEWA 4Z0BL 3F01A 2XTJD 1SPDA 2XX1A 3EDJA 1D5RA 2J57A 1SFDA 2WMPB 2DKUA 2QQNH 5LLIC 3G71P 4KMTH 4QJ3B 2LU4A 1A25A 1CDUA 3B8SA 5DO2D 4HJJH 2VKXA 1IJ9A 3RTQD 4PJFF 2PR4H 3WHXB 3V8OA 2QADD 3MLRH 5FGCB 5JOPE 2D7TH 1M6OB 2A45I 1BQUA 4G70B 1WPCA 3FF7A 3QQ9D 2ITFA 2AVFA 2JCCA 4A7TA 4HXBH 1TQWA 4K3EL 3B4NA 1SEQH 2V5YA 3BDBA 2C0WA 1FL5A 4OM0H 1NSNH 2J1XA 4NPDA 4X6BB 1GZLA 1TO4A 1XMEB 4X8XA 5EBMB 3U9WA 3GLMA 3PHOA 4A2EA 3KGRA 4ZMVA 1RUML 5I73B 5CU9A 1LXMA 1ZR2A 1BWWA 1NBYA 5K1JA 1MJUH 1RZ8B 4OGXH 2CXGA 3LQAL 2GSGA 4X7CC 1OAXH 1U8QA 1RK0B 3HZMB 3I50L 5J7CC 3BRFA 1JNNH 1U4FA 5DJXB 3VSUA 5EU3A 4KQ0A 3M1CA 3OB8A 3T65B 4A39A 3UIYA 3MKKA 3H8NA 1QPKA 2YN3A 1GTNA 2WUCL 1C5BH 3FO9B 4LLAA 2LU5A 4TVPH 1IUZA 3AE5C 4KV5E 4WWPA 3UBXA 1BGYD 3UYRL 2A45G 3NCYS 4G6KH 3WS3B 3Q13A 1KN4L 2B1AL 1NH4A 4BE6A 7CGTA 4PJXE 1KENH 1S9XB 4H5SA 4HV8A 1MCSA 2Z8RA 3O8XB 4Y2OA 5CCHE 4BFNA 5CGMA 2WHVA 1MQ8A 3L45A 4AH2B 3PJSB 1IBGH 1VFUA 1PLCA 4FQQA 2OI9C 3MX0B 4MNGA 2WXPA 1LILA 4IJ3C 2EIZA 3U6XS 5ACZA 1IX2A 5JXEC 2F54D 3ML9A 1QVFO 3KG5A 4AQOA 2WY3B 3H9ZA 4EO5A 1TUPA 3IVKA 5KSVA 4PV8A 4PY7A 3BN9D 3RY5A 1YY9D 1HH0A 1ULVA 2BSTA 2H41A 2KZWA 3QIBC 5B7EA 5HGDB 1BVLB 2VH5L 3MNWA 1SQXG 3QQDA 2Q3EA 1QATA 1HK6A 1QSVA 3P73B 4F58L 5E8PA 4RMVA 4G6ML 3U9PL 3C5ZA 2GJPA 1OW7A 1FZMA 1X5HA 3HNTH 3TONA 5F7UA 1FNAA 4OCWL 3IBOA 1SF3A 5BUPA 1NBVH 3BGFB 2ZX6A 1M3JA 3CFEA 3IDGA 4BXSV 2A74A 1DEEB 2XYBA 1AMYA 3P4MA 5E99H 5LWYL 1T1WA 3UOAB 4HSAC 2ISDA 5KWYC 5LG6A 3DOHA 1YHQP 1JG9A 1R5WA 2FD6L 2P3YA 1SHSA 3G5ZA 3FUHA 1IT9H 5B1JC 3K91A 5GGQL 1MWAH 5TDPA 2QMKA 3L13A 4PR5A 2M8XA 3P0GB 2BDNL 4IYKA 5IWLC 5F7FA 2ZKHH 3CSBA 5LCVA 2GUOB 4OCXL 4HFWA 4AYEC 4Y4FB 2VLJE 3VXRA 3ARED 4LE8A 2R4RH 4AQAB 1XIWA 4YQXL 1BD2B 5KZCB 4WFGE 3NGBB 1LO0H 3WFEH 5DMKA 3L95B 5EU4A 5H37H 4PJXA 5APYA 1G7LB 3S6CA 3EDDA 2CA3A 4F9PA 4QCIB 1HH9A 2DQUL 4GRLD 4FULA 5JQHC 1FDLL 2IANA 4TYUA 4WJ5B 3WFDL 4EAEA 2ZOKA 3KGUA 2EIMB 4CADB 1TYRA 1ZS2A 4OLUL 2EILB 4KO7A 1RJLB 2CO2A 2ERJB 4XN7A 2YPVL 3BD3A 4A67A 4BIKA 2X0WA 5ACMA 3FT9A 3MOQA 3MV8E 1AD0A 1YEEH 2BZCA 4ZOEA 1A6VL 3W67A 5F7NC 4WO4D 2AAVA 4JHUA 1FZKA 4XP1L 1EQ7A 2KKQA 1PL3A 4HK0B 4HIXL 2JCCF 5T5FH 1F3RB 4DNLA 2EO9A 4ODHL 3CX5E 2OXHA 5DJDA 1A1MA 5AD0A 1JXJA 2DBLL 1GL2A 4ODTL 4Y19D 1N12A 3KWVA 4GSUA 4ICXA 4N9GB 1F90H 4AZUA 3HUSA 4CVZA 1O7VA 4FFWC 5F7YC 5IK3A 1LQSR 1BVNP 1YC8A 4PM1A 4R4MA 1AR1B 1U93A 1HHKA 2VDNB 3QIUC 4ANKA 1P7KB 3FPXA 4XC1L 1F11B 3G6AA 1AIFB 4QWWC 3B5NC 2VUKA 1SOXA 3CVBA 1A66A 1N8ZA 4Z3EA 1HAUA 1ZT7B 4KDTC 1RZGA 2JXMB 2VXUL 5A16B 1ROWA 2XWRA 3BAEL 1I1YB 1YVLA 3W9DB 1CK0L 3C2AH 1EC5A 3L3OC 1JNLL 4H0GA 3TBSA 2XZQH 4U3FG 1U8JA 2P5WE 2WXJA 5T3ZD 1UD5A 3H85A 2VQ1A 2YPLA 3R4YA 1H3PH 1AY1H 1ZXGA 1VQNP 4X8CA 2QIWA 3K6OA 3I75A 3VDAA 4KKLD 1QQDA 2V2XA 4J3VA 3VYIA 1IGTA 5HYQB 4O9HH 3TJEH 1XGPA 2X38A 2AXTE 3QUML 2Y5TA 4KZEL 4NQDB 3DI3B 5JIKA 3TN0B 1AP2A 1N0XL 3MBED 1MQKH 3UP6A 3WYRA 3ZE2E 1MFDL 1JEKA 1SQBG 4WY4A 1TQSA 2DWEB 1VF5C 4OJYA 3P54A 3AEDC 3L4VA 1W0VA 5B7FA 1TQBC 2BNRB 1U3HC 2X3BA 3EO0A 4XNAA 5J1AA 2BK8A 4GQPH 1I1AC 3RL2B 2IVFC 2Y69B 4NC1C 4RAVA 3HZVB 2VDPB 2I9LB 4G8IB 1S9VA 1PW3A 4QY8B 1CLOL 4TNGA 4UQ3A 3DX8A 1I7UA 2BP8B 4QRQA 2A4EA 2UZXA 4P5RA 4TL5A 3LEXA 5IG7A 1YEGL 3BZ4B 3BIKB 1E5CA 1ZPUA 1JV5B 1NC4A 5FOJA 3U4BL 3F5WA 4GKNB 4YHPA 1A02N 2KZKA 2VDLB 3CVCA 2B4CC 1MNUL 4LL1A 3L3DB 1NDTA 3SZKC 1IC0A 2G60L 3WU2H 2HRPH 4JGJA 1D5MA 3KPSE 4DN4L 5AFAA 3SYOA 4DGIH 1TO5A 5GXBB 3K6DA 2A6IA 2VOTA 3AT8A 1AGCA 1V3LA 4PP1C 3THML 1BIIB 4U1IA 2WQYC 5I6LA 3VFOA 4PWGA 4B0MM 3M06A 3BO8A 5DQJB 1LEGA 3EO9L 3VACA 2GJ6A 4GAYA 1A4BA 2H2SC 2ZF9A 1HCFX 3V0IA 2B9AA 4HCRA 1GGTA 4I0PD 2R0KH 1IZNB 4PJXF 5I30H 3OHMB 4XRCB 2B39A 5CHXA 4BSJA 1BOYA 2LE9A 3MRLB 1X4ZA 3NRPA 2D7MA 5DVMA 3S37X 5HDBB 1X7SA 4TOYH 2F8XC 3S35L 2R56H 3L5IA 4FNQA 3PAYA 4MDJA 3IFMA 4P4KB 1KB3A 3F7QA 4ZS6C 4DW2L 2QJKC 3SGDI 3FU7A 1S5IL 5CSZB 2G8YA 1T4WA 4JDVB 4LSVH 5EZIH 5ABZA 4AYBA 3JV0A 2NY6B 1JTPA 4TTGA 1JIBA 5EA0H 3UP1A 3HD7B 4HISA 3LPFA 2E46A 5FDWA 4N2FA 4RFEA 1A4CA 3QO1B 1ET7A 1PLGH 4JY4B 5IJVB 5BQ7B 5J9PA 3R19A 4UTAL 1CLZL 2X4UB 2KSJA 1L0LE 1F3JB 3MUGB 4LDEB 1KILB 2O3JA 3H42L 4G9FA 1CYGA 2OA9A 2H0JA 4LCUA 1EZVI 2K78A 2YAEA 1KB5L 3AWFA 4AE0A 4AK2A 3G6DL 4L4TB 5K5GB 1LT9C 5D6CB 1P5UA 5JIMA 3DRQA 1G1OA 2GK2A 4YHIB 2GITA 2X4PB 3UTSE 4FYTA 2ICCA 3PABA 4M93C 5KVFL 1TITA 5J56B 2BMKA 1X6NA 4LARH 3D48R 3GQFA 1IEAB 4L5FH 1DN0A 5C0FA 3F83A 3ABGA 1ZT4A 1XB8A 1HWWA 4EF3A 2R69A 1FZJB 1G4RA 3BVDB 1OB1B 4UQIM 1MCIA 4G5AA 5LBSL 2P7TA 2P9RA 3UZQA 3NCJL 4KXZH 3HRZB 5I82A 3RAJH 1KXQA 3EYQC 5FF6A 4YE4H 3OHXB 5D1QD 3HE7D 3QUHA 1KC5L 2WLNA 3VFSB 2ZYAA 2PMZA 4NO3A 3L73D 4UIKH 3LW5J 3POCA 4QRRA 5I17B 3F6JA 2MKWA 1AE6L 4AGOA 1SY6A 3SE8H 1T0NA 1U8KA 2NNCA 2QFPA 1GJUA 1IGCH 1ID5I 1TZHB 2H1PH 4HWZB 3FJTA 2WQXA 4BQ9A 4DVRL 3K0YA 4OKVA 4WI9A 5FEBA 5INDA 2F53D 5E5RB 3WFHB 1SQQK 1YEKH 1S72P 5E6ZA 1QFUL 4X5XB 3VSVA 4M6ML 4JFZL 4B3VA 4YHLH 3TGUE 2APFA 3B37A 1D2PA 5DS2A 1S78D 3S5LA 3L1OH 5HHOE 3TS8A 4LDOB 3G9VA 1HWHB 3QDJD 3VI4E 9PCYA 1MPAH 2ZYGA 4L8SC 1RZIA 3T3MF 3SWKA 5J6GA 4DP0X 2LKMA 3FQUA 3JT0A 3BRVB 3MRNA 5E2UL 3WUVA 4HMEA 3E2HB 5F1SA 1FNEB 4IQHA 5F44A 5JPNB 2ZWLT 4LRNL 1UXWB 2VLMD 3CCHB 4N2GA 2BXYA 4K3AA 4G6FB 4Y2DA 3SPIA 1CFMA 2Z1KA 4A1RA 2OTLP 4Q97A 3EFDH 5DS8B 5IB5B 3V6ZB 2XOTA 2YSSA 3QCTH 1URQD 3AACA 1NCTA 1CDYA 4HMDA 3S96A 1PX3A 1KQFB 1GC1C 1WGVA 3GF7A 2HX7A 5B39G 2JLPA 3PHAA 2AQ1A 5GJTL 2AK4E 1IGJB 5GS3A 5C0BE 4BM7A 1LTSC 2WSEH 4JZOA 4OSUH 4IRSB 5SWZE 3V6BR 1L7IL 3CIQA 2HKAA 1VEMA 1ASOA 5D2NA 3U2SB 2HXAA 4QRUA 3NN8A 3U79A 1KTDA 2PYFA 3P02A 5DZOA 4MJ5B 3ZT7A 2FAUA 3RGVA 1SVBA 2OYPA 5IR1B 5D5MB 1M7IB 4U6TA 4I5BA 4RGOL 4HH9A 2WOYA 4I2XB 3RFRA 3EH5B 4PREB 3CHQA 4F8OA 2XDHA 1UQSA 1RU9H 1Q0XL 5FUOH 1HL4A 2IOMA 3DO7B 1N4XH 4NENA 5ENWB 4N78E 4ALAL 2QE7H 1EBAA 2OMBA 5ALCH 5B8CC 4XX1E 3RFZB 4WI2A 4AT6A 1CR9H 2WZAA 4JPZB 5EFIA 4FYQA 4MMZC 2R39A 1C7TA 3I6LE 5E4EB 4DP6X 2E43A 1DBMH 3VFUA 4GQ9H 1OT1A 2EE0A 2Z4EA 1R9FA 4P9HL 1UM5L 1GW4A 2O72A 3MRKA 1BJMA 3BESR 4LBAA 4QXTA 2PPEA 2HP4A 5ECGA 2EYRB 3QUYA 4MA1B 4S1DD 3L73J 4OUUA 3NTCL 4KXAA 1IC7H 3ILPA 1W6LA 5DHYA 2DJMA 5DZNA 5FYKH 4UT7L 3WUWB 3E9UA 4PMEA 2FWSA 3PWVA 5BS0B 5CIPB 4WK4B 2WSSH 2XN9E 2BP0A 2CO7B 3CSYB 1FWXA 1XTCC 2EDOA 4JM4H 4O2FA 2E7HA 4WRLA 1RD6A 4PV1C 1HDMB 2YQGA 2ATPB 1MVYA 1VCBC 2HODB 1SM3L 1C12A 1XD1A 1N73B 2WNGA 4BH8A 1KLFB 2OL3H 3CC5A 3HPJA 3LEVL 4NKQB 1CFVL 2VLKE 4AYSA 1PP9G 1HCVA 4GS7B 4Y2NA 2WTOA 4WW1B 5AZ2H 4G6AC 4RISL 8FABA 1C1EL 3PGDB 1ETZB 2X12A 3H9HB 1MFBH 1MLCB 4ONHA 5F8RC 4YGAB 4XMXA 1CI6B 1KFGA 4U2YA 3AE3C 1I31A 2H88C 1NDGA 3WN5A 1JWMA 1L4AD 2AP2A 5E94B 5T3ZL 3NSXA 5BO1H 1JTHB 2EH8L 3GXDA 3TVMB 4QRPB 2WBJA 3CSTA 3NABL 2HKFL 3FTWA 3A7OA 5IJKC 2VDNH 4LVHB 3II2A 2V37A 2VXSL 1DJIA 4NQEB 4TV3A 1JOIA 1KTLB 3FRPB 2KLVA 4P9ML 5C39A 2WIMA 1W8OA 3PP3H 5E8EB 1ZVSB 4MCNA 5HSFA 4GP5B 1KD1Q 3TZVB 5F1NB 1B3JA 1KBGL 2JI2A 4J3BA 1UZ6F 3D2UA 3RX7A 1IC1A 1SXZA 3QQNA 3GXIA 1HJ0A 3L9YA 4P04A 4BFIA 2J5WA 1T3FA 2CR6A 3UJJH 3WY4A 1Y9BA 2VC2L 4F37K 2J7LA 5KBPA 2L7JA 1G9NH 2RR3A 4WWOA 3BP7B 5EC1B 1M1JB 3AU1B 3AW5A 4HOMA 2QJPC 3CPUA 2VRAA 4K73A 3WEXA 4MDRA 5CGYD 1KYOH 2NW3B 1ZLVH 1EXHA 3ERXA 4O58L 3CVDA 1PG7X 3D6GA 5JIQA 5KOMC 2HKHL 1UFUA 1KGYE 4JM2B 2EDBA 2W6BA 3QJFB 2BSSB 2VDPH 2IJ0C 5HHNA 4QMAA 2BCKB 5KYNA 1YECH 3O9WD 4MMXC 5IV2B 2WLMA 4ZAKB 4Z78A 2XZCL 5TH2A 3O2VL 4WW2A 2C7UB 2XFGB 3FFDA 3GMOB 4NNYB 4NQCB 1YYML 3CFKB 2VMCA 1I7ZB 1ZRUA 4MAUL 3KWTA 3L3KA 4OD2A 1DR9A 2APBA 1K5NA 4F8PA 4M9PA 2ZOTA 3P3UA 3MRIA 1EHAA 1LEIB 5ISZD 2V5RA 4XP5H 2X7LB 3GZQA 2M5AA 2YD3A 4TS6A 4EJ1C 2VN5A 2W5PA 4GKGA 4Z0XA 4F57H 4JQIA 5I9QB 1BJ1H 3VI4F 1R1CA 3VXPB 1XGQA 4OI9A 2FUQA 3IXTA 5KTBA 3HAEA 3IF1A 3FQYA 5EOCL 3SDCA 2IADA 3Q2VA 3LQMA 2B9BA 2R0LL 3S5ZA 3VFVB 1BBDL 4KUCD 2XYCA 5DHVA 1T2KD 4D9LH 4DT2A 1GGBH 4P57B 4DAGH 1F4WL 4WI6A 3CXHK 4C56E 5HHQA 3MUZ1 5MP6L 3GS4A 4H40A 1CL7I 1HI6A 2VQTA 5BVPH 2W83C 1Z1WA 4LZKA 3SJVD 3EJZD 4JFEE 3FHEA 2UZIL 4P23C 2BZDA 1MSPA 3WGVB 2W6JH 1IO4A 2DQGH 3NUKA 3A5TA 4HJSA 2MSPA 4XXWC 1YC7A 3HC0B 1ZHNB 4QF1B 2QPUA 1FZBA 3QIWB 2DY2A 5KVDL 5IVNA 1EXUA 3H2PA 3OJDA 3GSUA 4UBDD 3ULVE 3ELQA 2Y0SA 3SYAA 2YA2A 3PNRB 3CZSA 1W91A 2R5BA 1W2BO 1YN6A 4YBLB 4DERA 3RK3C 1EHKB 3FN3A 4GY4A 4O51A 4X9HA 2ZFCA 3HN3A 3NZUA 3VWJD 3H7BA 5MENB 1GCFA 2NX5B 4KROB 1HKLH 4O2CA 4F7TB 1MCNA 1MDTA 3KXFD 1LQBC 5D1XB 1GOGA 5ETUA 2G9HB 4UDTB 2GVYA 2MTPA 2Y72A 4PG2C 3U46B 5T3XE 5DI8A 5HI4D 3FBQA 4QLWA 5J6HB 2ETWA 3F6LA 4X4MA 4Z3IA 5EV7A 4G7QB 4UOJA 1L0LK 1RJYA 3EH1A 5BJTB 2XXCB 3FUEA 5E9DD 3MLWL 4NHCL 3INUL 1BA9A 1B0IA 4KVCL 4JG9A 3BQUB 1UZGA 3KMDA 3LRSA 2Z5HA 3TN0A 1PGQA 3OC5A 2FWUA 4JUSA 4M1CC 3BVUA 3SQOL 4K23H 1CTOA 2X53A 1LYQA 3WD5H 1F8TH 1JK8A 2P45B 3VYOA 4A38A 2YAFA 4PRPD 1JY3P 4XNZC 2XKUA 2O01H 4L1TA 3UIAA 1E4HA 3TXAA 1UXSA 4HUWA 3SDXE 2Z8SA 3JUZA 1JFQH 2ITCB 2XX0A 5CJQL 3Q0HA 2JJVA 4MJJA 2VM3A 2V3EA 1U3ZA 1WFIA 1TZIB 2QQNL 1RK1A 1UT2A 1PG7H 5KSAB 3GDCA 3A0BE 3L74E 4HJJL 3LPPA 1IBFA 4NT6A 5A1AA 5CJBA 1MCQA 1YMHB 2PR4L 1JK9A 3O41B 3V4LA 5KLVD 3QJQB 4BGLA 3MRHA 3UYPB 1UJ3A 3MLRL 2Q7NA 2D7TL 3OPZH 5C0EB 4I77H 4XNMB 5E1IA 2W0LA 5KYUA 1U3JA 4K7PY 2QL1A 4CNIB 2ZXXA 3LKPB 4HXBL 4D8PA 4F33B 3VTTA 4N5ED 1SEQL 5I1CH 1YMME 4CW1B 4OM0L 3CBJB 3LIZA 4Z7NE 4JFVA 1NSNL 4NM8H 4HPYH 4N2CA 5J3HC 3UO8B 5FO8B 5GGVY 1SQPD 3QWOC 1BFOA 1IZJA 5B7MA 4WW2F 5C2BH 2A0LC 3IDIA 4PJGA 2EVFA 3CK0H 3FQXA 3L1EA 5DDHB 2E27H 1MJUL 4L3EA 5B1CA 2Q6WB 4OGXL 4LOFA 3CN0A 1OAXL 4Q52A 1D5ZB 3EAKA 3FL7A 3A0HH 3QT2A 4R83A 1QHQA 4WEUD 4XCEB 3SCMD 1JNNL 2OMVB 1LP1B 4DWHA 2A1WL 3AXIA 1EX0A 3GHBH 3MV7B 5HVFB 5IHHA 3HMWH 4CJ1A 1TT6A 1C5BL 3UMTA 4DEWA 4PHZA 3SKUD 4CN6A 3V0AC 2FR4B 4G6KL 2OTWB 3P40A 5GGTH 2PTUA 1XR8B 4XB8A 4BA0A 4ZFOL 2F5BH 5T1MB 4DP4X 1IBGL 4XWGH 3QBTB 4PJ7A 4DP8X 3ABMB 1SQQG 5DJ6A 2NY5C 3VXME 5AW0B 2HVJB 2VDOB 2IMNA 2BRRH 5EU6E 4FZEH 3CQQA 3A67H 2EQDA 5F6HI 3EXLA 1BMWA 3TV8A 4NPYB 4FLQA 1QYGL 1YYLH 2IFNA 3GBDA 4GXVL 4WUUE 5L2KB 4K5MA 4GIPD 1XIWC 1ZE3H 2Q7CA 3L72E 3HNTL 3O8XD 5E5LA 1K6QH 1NTDA 1E40A 5BZWB 2HN7B 2FBJL 3RVUC 1NBVL 3SYPA 2H7HA 4GG6B 3CVHA 4FQIH 4F9PC 5E99L 1OQOA 1T6BX 2AXHA 3NCEB 3H1ID 1T6WA 2NNAA 2CIKA 1X5MA 3H1HJ 4H1LB 2PO6A 2DQMA 1MWAL 2OSLA 4M3JA 1QBML 2YRLA 1NPJA 3I3EA 3QYCA 2ZKHL 4IJ3B 4JRFA 5DUJA 5KLVJ 5F7DB 3EYVB 4Y5VB 2EJ1A 3PIQA 3QVAA 4JRXB 1QSFB 1ZS8B 1RERA 4MZ3A 5GGUA 2KLTA 1E5UI 2R4RL 5DD3H 2MNJB 4JKPH 3WFEL 1LO0L 5APSA 2EDXA 3QIBB 3WAKA 1TQUA 2Q86B 3U48A 4HG4J 4YHYB 4YAQA 3QZLA 4ZD3H 5DJYB 3D50A 3EKCA 1ONQB 2C1PB 3VTAA 2GIYA 4UNVA 3K8LA 5EN2B 3U7WL 3BFOA 1PDKB 4PJ5E 5KBKA 4FG0A 1KMIZ 1JWSB 4OLWH 1ZLUK 3NRQA 4PD4I 1D6EB 3H6PA 1U7MA 4AYFB 2FIKB 1HSBA 3PYCA 5MEOA 2IBZY 3P4OB 3T4AA 5HYSB 2E74D 4YSEA 3LD8C 3JWNE 4BFGA 4YHZH 1ZKAA 2CHDA 4H0LC 4XXDA 5FYKD 5TE7L 5KZCD 3WENA 3VMNA 2QJYC 4GIOA 5JQIB 3G6JB 4H26B 1NH6A 2WO2B 2QA4P 1R3JA 1HL5A 3OKDA 3TWYA 5T5FL 3ULVF 2H8PD 1RURH 2ZKXA 3DARA 1S3KH 2P8LB 3KL3A 1U8OB 3R4DA 4AENB 2X2UA 1FNSH 2AEIT 3B2PA 1AXSA 2DQIH 3NCBB 1UXMA 4G42B 3RIKA 1YPZE 1EAPB 2QPSA 1BVKB 4YWGH 2RMZA 1DFBH 3OR7A 4PJGF 3VGEA 4MCMA 3E6HB 3OR6B 3VXSD 3GKZA 4EIUA 5DK2B 2VM4A 2P80D 2V9TA 4WY4C 2W0PA 3EQ2A 2FXPA 1LGVA 2PCYA 5TQ0H 4PB9H 4Y99C 5I66A 3VFRA 1CGVA 2A3TA 1UVQA 1ZIAA 1DANT 2ESVE 3ARBC 4DFHA 4X4YB 3K71A 2HLAA 2J8HA 2XPGA 4I88A 4NCDA 4OF7A 2FSDA 4UV4L 5HD8D 4XH2A 3RPBA 4MNQB 3C2AL 3AEGC 5D71H 1PKOA 2XZQL 4MXVE 5CJ5A 3EJYD 2Y22A 5KYYA 2F0CA 4QRAA 1J05B 1AY1L 1U95B 2Z91A 3LZRA 3LPOA 3UAJD 5B5EE 1AR1D 3D08A 1XEDA 2BW5A 2O6FA 1A7OH 3T0BA 4ZX4A 5EU5A 4PJ7F 1MQKL 1EAQA 2ZXWB 4ZUTA 3VWKA 1Q0YH 2WSEJ 2F74B 3UL4A 4P3DB 1X7QA 4I7ZC 4JW3A 1GY2A 2D03H 5FKPA 2L8AA 2LHAA 4KX7A 3FQTA 1YNKH 1NGMB 4FTVE 3MLTA 2D2CB 4P2OA 2DQJH 3CDYA 3QIUB 3FN0H 1JZHA 2JJSC 4MJID 3DJRA 4QHPA 2HZHA 2NPSA 3B5NB 3PQYA 1T22A 1FE8H 1JV2A 3N6YA 2EEFA 3DIFA 4FI8A 1RUQH 5JYMA 1LTGC 3FB6A 3LV3A 4YXHH 4NQDD 1JCKA 4J3OH 3TN0D 4JQVC 5IFJB 1KPUB 4AIOA 4GUPA 1TKWA 3RIAF 1KYOD 1QLRB 1UENA 1AS7A 3T0AA 2QSTA 4O02A 2BNRD 1BDDA 4G8GB 2CKNA 4ZMDA 3LY6A 3HR6A 4IEFA 1ZRTD 4CMMB 2HRPL 3MCG1 2J8OA 3M17A 3KWUA 1GJWA 4DGIL 3DRTA 3KPLA 3KCPB 4I87A 3RA7H 3D39A 4H7VA 2ZWKA 3DUHA 3IMVA 4IKKA 4PWFA 2A6KB 5IJDC 1AQKH 4TTDD 4ETQB 4FG6C 1FDOA 1VF5B 3CXHI 1FE6A 1TQBB 1U3HB 1VA9A 2Z4TA 5C09D 1I1AB 2R0KL 1JYVA 1SJHA 5I30L 1PGOA 2B8OT 1RIUH 3HUJE 3VYPA 3TF7C 3LHPH 4MA8L 4HVBA 1P5UC 4M7KH 1ZMEC 2J20A 3CMAP 4HA1A 5SWSB 1BW8A 4TOYL 2J6EH 1KFNA 2R56L 3VCLB 1NTZK 5ESAA 3LRKA 4UILH 1CQKA 3RBZA 4H8UA 2E86A 5GZND 2N0MA 5EZIL 4MJ6A 1LE5A 4ZZKA 2I5YH 1A7PH 5AENA 5EA0L 1G1IA 1BSNA 4FQ1H 1Q1PA 2EXYC 2KDGA 3GTVA 3BUPA 1PLGL 4POUB 3U9UB 1UT1A 1VQ4P 5JW4N 4G8EB 4V1DB 1H3TA 1XX9C 3ZIYA 2XKNA 3I6KB 4B50A 1YBKA 2O26U 3U4AA 1DVUA 3FONA 5EN3A 2V6HA 3DTXB 1R5LA 5BU8B 2WWNA 3A47A 4P4KD 1Q86Q 3BSHA 1K9MQ 1MCDA 1ODUA 5E79E 2JJUA 1QMUA 1W0WB 1F4YH 4LSUH 2GJRA 2UX6A 1EDYA 2W91A 4OZHA 3G3ZA 2X09A 4LARL 4YDLC 2DQFA 4L5FL 2NY6D 4OH8B 1R5SA 1BQKA 1N6VA 4IRJA 3HD7D 4JF7A 3CSFA 3ROOB 2FKWB 1AC6A 1BCIA 1P0SE 3S98A 3VH8B 5I71B 2K3TA 2GY5A 3NP4A 4M4RB 4R0LA 3T97B 4FMVA 5B39A 5IF0B 3GS0A 3NSDA 3WE6A 3ZDZB 2QJKB 3PWPB 3RWGA 3QXDA 4XOBA 4L4TD 4PUBH 2W9LA 5E6IC 1IBYA 1V7MH 2VERA 3RAJL 3W11C 2C9VA 3HUJA 4YE4L 1OVRA 5F7MC 3FGAD 3KZIE 3B1UA 3W57A 3GF3A 4M00A 3IFPA 1M57B 1ASQA 3D87B 4UIKL 1JF5A 4B9JA 2E6QA 2RJMA 2X0UA 1N59B 2HVKA 4JY5H 3H7LA 1PZ2A 1KYOJ 1T66C 1CJYA 2ZXGA 3SE8L 3L3IB 1L0LG 2L0DA 5FFGA 4Y5YA 5HDRA 1IGCL 1U57A 2P24B 4KKAD 4TVSa 4NUGH 2Q6QA 5E5MB 3WNMA 4BKSC 2KI7B 4HSQA 4M93B 2KL6A 3GDBA 3C6LB 2WJ7A 1XSJA 4HEPA 1VADB 2E6JA 1YEKL 1XGUA 4N0CD 5BOZG 4P5MA 4NPFX 4KGLA 4YHLL 2XTJE 3CU1A 4LXFA 3RVXC 2V2WA 2UXTA 3QUXB 5ADPH 1BF5A 1V5JA 3L1OL 2AV1A 5CD5C 3IJSB 1MPAL 3ZTJH 2XV3A 3PRJA 1RZKH 2J1ZA 4PJCB 3CSGA 4MDIA 5KVFE 1FFQA 3WUTA 5GZOA 3QJTB 1F3DH 3DSNA 5I1DB 5D2NC 2ALAA 2VXTH 5JPMA 2BERA 1CTNA 3QDMA 3ZR5A 2PP8A 1BJ1J 3Q2WA 3QZMA 2RIKA 4WO0A 3OG4B 1BBJA 1J0YA 4ISVA 2C3VA 4BWWA 2OSXA 4HKBB 3EFDL 4YPJA 1Q8MA 1D7BA 2YJLA 4HBQA 1KGJA 4PLKD 4MZRA 4PRHB 3LXCA 4OB5L 1FFOA 3WXVL 5HY9B 3EG9A 4OZGB 4KKZA 4ZW5A 2VDOH 3FQ4A 5I6NA 1VERA 1B3IA 3D0VA 5F1IB 1W6WA 3L4TA 4OSUL 1RAMA 4HD9A 4CSZA 3H9SD 3TO4A 1BCCD 1MHCB 3OLGA 4GLRI 3K2UH 1O7SA 1PGJA 3HR5B 1FZGA 5EOTB 4Z7UE 4KDVA 5AKRA 3FXIC 1BGYE 1VFOA 1MFEH 3G5YA 1CDGA 1ZXKA 4L73A 1TCRB 1RU9L 4XPGH 2UY6A 5FUOL 4Y9FA 1NGPH 1N4XL 5D8JH 3DURA 4PTTB 5CKAA 1Z9SB 3UXFA 1E28A 3EBIA 5HYJA 4H1LH 1HIMH 1GYWA 2F54E 1DBML 3M86A 5IHBA 3S9DB 4Q9QH 4GQ9L 5F71A 4ZFZB 3RVVD 1E6OH 1GZPA 1MI5B 4Y7MA 4FJ6A 1KXTA 1NCOA 2GK0B 2VQ4A 5T1JA 5LUMA 2O1JA 4JBZA 2AJYH 2HMIC 3E0GA 1Y1DA 3BPOC 4QHMB 1YJDH 5DO8A 2KERA 1IC7L 5E51A 2GFBB 1OW8A 5FYKL 4HIIB 4OZHF 4LSSH 2R23A 2OARA 1KYDA 1EAJA 1R34A 3DOIA 5CP3A 5FOBA 3FQ2A 2G5BB 1T20B 4GUCA 3CCVP 4XHJC 3WN5C 5D93C 5HPOA 1NEPA 2O01J 4HKZA 4XNUH 1S7RB 5IB3A 1BDCA 3BPCA 2YD5A 4AL8L 3CCLP 1BAFH 5AQ0A 5KAFH 2Y1YA 1RPQA 1W2KT 3HUJF 3T8XB 3QQ3B 3FYEB 1GA2A 1KJMA 2W88A 2WTRB 4L2YA 4WU7A 2AQRA 3S3CB 4MA3A 4MMZB 5DUMH 4E9SA 5BS0D 5AZ2L 4BZ2A 5KUMA 3MNZA 5JIHA 3MRCB 4MQXC 1MFBL 1J0HA 4DEPC 1EFQA 2WAQA 1E4WH 1G9HA 2D3JA 3GS7A 1FV1A 3BUYB 3ARDC 2NYZA 1XH0A 3O3EB 4ZZFA 4G80B 4KZDH 5BO1L 2F2HA 3QZWG 1AG0A 3MHZA 1OLLA 4GG8B 2NNRA 4OZIB 4EMZA 1Z3GH 3C6SB 2VDKB 2VDNL 4B95C 5D2LB 3NA4A 4HALA 4PGDB 5G4OA 2J8UA 2IPPA 4GAGH 5JIIA 2G75B 1VQMP 5BRZA 2EIBA 1OM9A 4PV1B 1CFQA 2Y6SD 4MAYC 3RPKA 4YFEA 3LS4H 1AH1A 32C2B 2EYSA 3OAZK 4ORGA 5JXAL 1WISA 5I1HH 1XF5B 2AEMA 3P4LA 1DDHB 3O2DH 3O3BA 3ZOAA 4WW2C 2X4RB 5FFOA 4FABH 3TVMD 3UJJL 4QRPD 2ZIDA 1AR2A 2X41A 1G9NL 4Y19E 2E9IA 2F7PA 5FKAA 4NDMA 1B0GB 1IU1A 3DUUA 3H54A 3NDYE 4NQED 1OK0A 1KT2B 5DEGA 4ZFGH 2HUEA 4I48B 3CX2A 3RX5A 2CQVA 2IPKB 1FVEB 2K4WA 3TZVD 3FC8A 1I8MA 3V6FA 2K4AA 3KPOB 2HFFA 2BSEA 4Y1AA 5K1NA 4UOW0 4ZX6A 1CI3M 1L9RA 2VDPL 4AZ8A 2V3DA 3QDHA 1YECL 5D1ZC 1DJWA 4L8DB 3R18A 1G2CB 2Y6TE 1JY2P 2WVVA 5AW2B 5HDOA 2IGLA 4V2CB 5T3ZE 2WAHA 1W5CE 2X28A 4N28A 2X88A 1E7UA 3BZEA 3QK0A 3FF8A 1IO4C 1JNJA 4XP5L 4L4VA 2IWGA 1WCBA 4JM2D 3H0TA 1T0MA 4F57L 1KDJA 3FX0A 2HPCA 4N9OB 2HG5A 3PV6A 1QSEA 2QJPB 5IVXE 4ZAKD 2CK3H 3IMUA 4ZXBA 4GIFA 1DBJH 1WDAA 1G9MC 2O1AA 4N2KA 4NQCD 4G8FB 3VVWA 4HHGA 4F1ZA 3W68A 1GGBL 2YO3A 4DAGL 1JHKH 2VLLB 1KGWA 5D6DC 3ZRCC 3CLFL 2G2PA 3JWOC 4YSQA 1NLDH 1A14L 4Q14A 4F7MA 5IHZB 1NCBL 4XP6H 1ZA6B 5ECJE 4HJ0C 5BVPL 1KUMA 4XMPH 2R0ZL 4MMXB 1DD3A 5FLVA 1S7VA 4J3OD 1WZ1H 1Q4NX 3H1LG 3WIAA 2DQGL 4WSKA 5CKGA 5EBWA 1B9ZA 4IKJA 4IU3B 1U8HA 2KLSA 4QOKB 5DRWA 2BOCA 4IDLA 2I9TA 2HFGH 3CN1A 4NLHA 2NYYD 4WTXA 1LO2H 3DK2A 3O11A 2R3SA 4L8BA 1EXJA 1FF5A 4FQHA 1R19A 5HXMA 1T1XA 1LL1A 2BINA 4GW1A 2YKQA 1JN6A 1HKLL 4OLVH 1LO5A 4CDHA 2N1TA 3WNKA 4U1MB 1LHZA 1UGKA 1R17A 4P49A 4D6TE 3O6MH 4Z7WA 1I4FB 2J55A 3CZFA 4F7EB 4KPHH 5IM7A 1KEGL 4QNPE 1HTYA 3ETSA 3QIWD 4LOEA 1FU1A 3D69B 2X70A 1UJ3C 1UFGA 3FUMA 1YN7A 3BH9B 3FK3A 1IAKA 1H88A 4E0RB 2J8UF 4JJHA 2JKTM 3H1KG 1Z9MA 1NTZG 5IW6B 1HZKA 2AEFA 2JJTA 3RYMA 4K23L 5MEND 1XEUA 2NX5D 4KROD 4PJEA 3WD5L 1F8TL 2F08A 3K2IA 1E3XA 3TYGL 1NL0H 4WDIB 1EJFA 3CWBD 1TETH 4UAHA 4XBPB 3DPDA 4FNSA 5D1XD 5C0JA 1T1YA 1EDKA 1ESOA 5E2WH 5EPMA 2YAOA 2EZ0C 1JFQL 1NKRA 2CHZA 3APFA 2BNUB 4NO0B 4DK5A 4HOZA 5F3BB 3RK3B 1JGEB 3WKNA 4LLQA 1JZDC 1PG7L 1OCWH 1XB6A 4KMQA 2M3BA 1KIUB 5B4MC 3UTOA 4XO5A 4AQEB 3BGMB 3BQUD 1QEWB 5L7XH 5AWNH 5KVDE 1F4XH 5CZXD 3IRCA 2W65A 3OPZL 2CO1A 3VP9A 4I77L 3TEXA 4DPBX 2KYIA 3ZL4H 2NYKA 4XI5D 1LNUA 4WJKB 2X2JA 1QGKB 5I1CL 3OAUH 5IMOA 2VAAA 3QQ4A 3CFIC 4NM8L 1H19A 3JVGA 4HPYL 4XPBL 2YO2A 4R26H 2JWYA 1ITCA 1G7MA 2GAZB 2JCCB 2WYZA 3L1GA 4XOCA 5TD4A 5C2BL 5EF1A 5KSAD 1MHHB 3WEBA 3CK0L 2E27L 1K8IA 1Q81Q 1FL5B 1NFKA 4K2UH 1AV1A 1CDCA 1GZHC 2YIUC 1T0PB 2QHLA 4XNZB 5D1QE 3PHOB 4LNRA 2DWDA 2ZQKA 4ICWA 3L70D 3GHBL 4LQFH 3L73E 1UG9A 2XA8L 4Y4HC 3HMWL 2GUSA 5G5DB 1H0DA 2AK1H 4E68A 2GSGB 5F6IC 2EUWA 1U8QB 1UTDA 5M95B 4WENB 5EU3B 1X5JA 5E1AB 3EJUA 5FC9A 5GGTL 1GW0A 1TZOA 3M88A 2F53E 4NQQA 4X8GA 2XA3A 2MMXA 1KG0A 2F5BL 3PGCB 2BCCJ 4XWGL 3UBXB 2J4WL 4Q89A 4XVSH 4GI8A 3V4QA 2BSBA 2XZRA 4Y2OB 3EJPA 3QDJE 1SOKA 3EGSA 2PO6C 3UABA 4C4BA 1W80A 2AKRA 4XPAH 3EADA 3ZBMA 4FZEL 4GKLA 3QWOB 1G6RA 4FQQB 3K8MA 3NJIA 4MNGB 5ACZB 2EIZB 2MPAH 4YDKH 3IBEA 1CF1A 1YYLL 5DVKA 3IVKB 3IGFA 3QJRB 2VLME 5KSVB 1JERA 1G7JA 2WYHA 3OAYK 4L23A 4PV8B 3WLWC 1KXVC 4XZ4A 3B7YA 4ANWA 2BSTB 1K6QL 3B71A 2Z31A 4B7LA 2MIZA 2WSKA 3MNWB 3QQDB 1ZT1B 4I85A 4YL9A 5DD1H 4HFUH 3RNKA 1P9MC 1ZV9A 5E8PB 3LDBC 2KXPB 2BCMA 1D9KD 2P49B 4FQIL 3F7RA 1FZMB 4RMSA 1BQLL 4AKQA 2EDJA 1AS6A 3FH8A 4PVMA 1KBBA 3CLEH 3CFEB 4NKDB 3IDGB 1HESA 4EKJA 5D7HA 4D7BA 1VDFA 1M56B 3P4MB 3T4AC 3W56A 1T1WB 1P7HL 5FR3A 4DOHE 4FJYA 2YUXA 3H6JA 2WC7A 4GAJH 3Q8AA 3LNFA 5E1HB 4WWKA 3F7KA 1R5WB 4KXBA 4XGZB 3FU8A 1OP5H 3G5ZB 4ZNCD 5DD3L 3MFGB 3UGUA 4JKPL 5JDSA 4PR5B 3WEMA 2I1JA 3CVIH 2ED6A 3NK3A 4RGMB 1R24A 4EN3A 4YFLI 4PJEF 1Z5YD 4ZD3L 2PTTA 1HNGA 3VXRB 1J1EC 2EDQA 5CR8A 3UADA 3MYJA 3M1OA 5F21B 4UTBA 1XIWB 1T5KA 4OLWL 5DMKB 5EU4B 1WVZA 4MYWB 3C60A 3TJPA 1SDYA 2QGCA 4DO5A 1VFBA 2J25A 1P4IH 4HOWA 3GI9H 4N6JA 5AVXB 3OKYA 3A3YB 2WVRA 1QLFA 3ZO9A 1QSFD 2DB8A 2BPBA 3P9WB 2VDMH 4KO6A 3V6OE 4YHZL 2FJFA 5CAYB 1OARH 1PYWA 2IANB 1J12A 4B9KC 2ZOKB 3QIBD 4NXKA 3RWEB 4UQAA 2WXNA 5IVZA 2I8DA 2JMRA 4XN8A 1RURL 4HYTB 1ID2A 1AD0B 1JHTB 1FNGA 1S3KL 3MA9H 1HILA 4N2NA 3TL5A 4BBWA 3WU1A 1J18A 4GRWF 3BWUF 2RCSH 4XAWH 1FNSL 3JCUH 2DQIL 1PIFA 2EDKA 2VDKH 2ZUQC 2BFGA 2CHWA 3B5HA 2QQQA 1BE3D 3WIHA 4BD4A 1UHVA 1EV2E 4YWGL 1DFBL 1SLQA 5DJDB 3U36A 3PDGA 1A1MB 4U6VH 5BW7A 5AD0B 4QRTA 4A66A 3P2TA 1WRGA 2X4TA 5I8KL 2GIXA 2GA1A 2WO3B 5FO7A 3BPLC 1ZLSH 3QZOA 5TQ0L 3RWDA 5AW8B 4PB9L 3V5HA 3HUSB 4CVZB 1X79B 5IK3B 2XNAA 1SP4A 1I3UA 1BV8A 1TEGA 1HHKB 1U93B 1I9JH 2UXFA 3L3GB 1RQUA 1HINH 1VL2A 2QVAA 4PWEA 1BLNA 1ZVNA 2NPSC 3G6AB 1ZAGA 3H4FA 5D71L 3UG3A 2XQBH 3LD8B 2Z8WC 1EXGA 2QJYB 1RZGB 4ZG1A 2DWXA 5FYJU 1BZEA 1QZNA 3FTZA 4MRCA 4OQTH 1V3MA 4YDVA 2P10A 3BDYL 4FA7B 3QUKB 3MAWA 3TBSB 1U21A 1A7OL 3DDGA 4G59C 1AJYA 1JMBA 2YPLB 2X9XA 3NCXA 1N7SC 4Y4KC 1Q0YL 2PXYA 3NA9H 4HIHA 3I75B 5AOLA 1QQDB 1IAIM 2V2XB 1IGTB 1KGCD 3DHPA 5EBGA 1B4RA 2C3GA 1XGPB 2D03L 2Y5TB 1LTJA 4DP1X 4MNQD 3FQRA 1T7WA 1YNKL 4XXCA 5C0AA 1UD8A 2IBZI 2DQJL 4IL6H 4WY4B 3FN0L 3P9MA 4EPSA 4Y99B 2XIBA 1NGZA 1W0VB 1DJZA 3EO0B 2FCBA 1FE8L 2P8MA 4M03A 3UPCA 4AXWB 1DQVA 5MEPA 2C9RA 1RUQL 3N42B 2NRGA 4RAVB 1RHZB 4YXHL 1S9VB 4E42A 4L05A 1MCEA 3VD2A 2YXVA 4UQ3B 1G1YA 1WYJA 3GMQA 3OL2A 3N06B