4RESB

Crystal structure of the na,k-atpase e2p-bufalin complex with bound potassium
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
288
structure length
288
Chain Sequence
IWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRFRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Structures and characterization of digoxin- and bufalin-bound Na+,K+-ATPase compared with the ouabain-bound complex.
pubmed doi rcsb
molecule tags Membrane protein, hydrolase/inhibitor
total genus 50
structure length 288
sequence length 288
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4resB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 4resB02
1CI6B 2WT7A 3TNUB 3HE4B 2YNYA 5AVSB 5AW1B 3V4QA 1YYCA 1FAVA 5APTA 2WPQA 3A7OA 4GKGA 3VMZA 1J2JB 2QM7A 3VMYA 3WGVB 4LC1A 2Q3IA 2YO2A 2JJLA 1HBWA 5AVQB 3M91A 2WTYA 1X8YA 4C7NA 1MV8A 4AYCA 4AQRD 3KQGA 3M06A 4KHXA 3A5TA 3O8ZA 1H89A 1HJBA 1NWQA 1CI6A 5AVZB 3TNUA 1KQLA 1GZLA 2P7JA 3HE4A 4JYCA 2KP8A 4C46A 4RETB 2ZFCA 2P2UA 3MGNA 2W27A 5AW7B 3V5BA 3L37A 4DZOA 1S9KE 2Z5IA 1T2KC 3NTNA 4GT1A 1GK4A 1CSBA 3HE5B 2BASA 1NAFA 3L36A 5AVTB 3I5CA 1HWTC 3A3YB 2R5BA 3VTPC 1S9KD 1OWAA 3SWFA 5AW5B 4M3LA 1CZQA 1GU5A 5AW2B 3WGUB 5APXA 1GU4A 1GTWA 2Z5HA 1T2KD 2Q7CA 1SP4A 2E43A 3P7KA 3LIDA 1FOSE 3UIAA 1A02F 2Q5UA 3KDPB 5AVVB 4I6MC 3TYYA 3NFQA 3HE5A 1SLQA 2WWWA 4I2LC 4JYBA 5AVYB 2R5DA 2ZXEB 5APSA 1DH3A 3P32A 1HUCA 1JNMA 4AUWA 1A02J 1JUNA 2QM8A 5AVWB 4EOTA 2R3CA 3NXSA 4XE5B 5AW3B 3VN0A 5APWA 5APQA 5AW8B 5APUA 3M9BA 5AW6B 5AVUB 3T97A 3B8EB 2C9LY 2P67A 2WPRA 3IR9A 3LIEA 3TK1A 4HYTB 2W6AA 2XU6A 1GD2E 3OAKA 2XZRA 1MUUA 5AVXB 2R32A 2IPPA 2H7HA 1OXZA 1H88A 3NMDA 2VRSA 5AW9B 3M0AA 1GK6A 5APVA 5AW0B 3V4WA 5CMZA 1IO4A 3VYIA 5AW4B 3VMXA 3M0DA 2WT7B 3P8MC 2WPSA 2XV5A 2E42A 4B86A 5APYA 2YO3A 3HTKA 1H8AA 4RESB 3MD0A 1G2CB 1MFZA 4C7NB 2C9NY 3L35A 3M9HA 3A2AA 5AVRB 2N9BA 1FOSF
chains in the Genus database with same CATH superfamily
1X5FA 2NY3D 3EYQC 3QPXH 2CAKA 4YHNB 2JF1A 2NY3B 5KJ4A 1A5FH 4TLKA 4PTTA 1FAVA 2H1PH 3SE9H 1BEYH 1CIDA 2H6OA 4C47A 4M7KH 4XHJC 5L7XH 1ZV2A 2HP4A 5EZIH 2KI7B 3RLSA 3O8XA 1AS6A 2R27A 5CGYD 1G2CA 2YRPA 4KJMA 2HYNA 4FG4A 1LEGA 2HR3A 2DWDB 4HJUA 5DRXB 4XMPH 3MCLH 4WNQB 3TN0B 2Z93A 4OGXH 1HYSD 1GVIA 3WN5A 2K6YA 3WG7B 5F1NB 4TLUA 1J0ZA 2OZ4H 2X4QB 1I3GL 1VF5D 3MJWA 4XMWA 1U2YA 1VF5B 1J10A 1XO8A 4UDUB 3CZKA 3D1MC 2X12A 3AQXA 3BEVA 5F8QC 4GEIA 2J4WL 3H9HA 2JXMA 5F89A 2XJLA 1JJUA 3WTYA 4XAWL 2BW5A 3BLBA 1JPFB 4YXKL 2VDLB 5TQ2L 1FZAA 5I76A 4DOHE 4O02H 1HWHB 1Y0LB 2HPOA 3VMPA 2DIBA 4E2OA 5KVDE 4M3LA 1NGZA 1WFOA 3S96A 2B3RA 1TZGH 4JZJA 3BCDA 2C0XA 3WJLA 5LGKA 2VITA 3EJYC 1AO7A 1F3DH 1PGRB 3NCBB 4D3CL 3SYCA 3WENA 3KGTA 2E76D 3GGWA 1FQ9C 3I3BA 4LNRB 5DR5L 2E76B 5I18H 5I15L 2I9TA 3ECUA 1L0NK 2WANA 4TNVF 3U1SL 2EC8A 4OCXL 3P54A 4FP8H 2XV0A 4QXTA 4FLHA 3RFZC 3BP5A 1P53A 1L0NE 3PYCA 1T2XA 4M61B 3GEFA 4EUPB 2WKOF 4DUWA 1QLFB 1PD6A 1RSFA 4M4RA 3FRUB 4NZDA 1P4IH 2XKSA 5DUBA 2GI0A 1UB5B 4IKNA 3KHUA 4D6TJ 3MRKB 4JFTA 1IO4C 5AAMC 1BM3H 3CLFH 3IJEA 3L71D 2ODIA 4OGYH 2EYSB 1NC4D 5TE7H 5EZLB 3WFHB 3GMQA 3UZQA 1NC4B 1Q94B 2MWCA 2EABA 4LLQB 1B90A 4OD1L 3BPLB 5JNYB 1CXIA 2HFFA 3FTWA 4U6YB 5IJDC 2Z91A 2LR4A 3IKKA 4PCKA 4PJAB 1ACXA 2IPTL 4Q74A 4W93A 2WJ5A 1RQVA 3QUYA 4EUPG 7PCYA 2E7BA 2E42A 4PU2A 1FS0E 1ZIBA 2FJHB 2APSA 2CMRH 3CE1A 3JV6B 3NDYE 1YG9A 4FMVA 3IMTA 3N1GC 4NERA 4NNYB 4WTZA 3SDXB 3TA4D 5JXAH 1T7YA 3F7YA 2DDQL 1GL2B 2VCOA 4GLRI 1WZ1L 4J6IA 4PMFA 2C34A 4TN9A 1LTIC 3QXDB 4QO1B 1XQ4A 2PP9A 1OPGH 3O4LD 2IFGA 5F7LB 4CVZB 5INDB 2LR2A 1XF2B 1GY1A 3MBXH 1QFWH 2QQKL 1E43A 1C08A 3L71G 5JW4M 3PWPE 5IHWA 1KB9J 1HCVA 2MFNA 4PP2B 1TPXB 1E28B 3OMNB 4P9MH 2FL5B 2B59A 4DGWC 1I9JH 1OCCB 3FTGA 4I18B 4DP5X 5MENE 2IBGA 2WLIB 4YBLB 3W9EB 1RH5B 3QCUL 4RAHA 4XN2A 3BKML 1UTDA 3PJSA 3F5HA 3BT2H 4NO0D 4YHMH 1FZCA 3KQGA 4NO0B 1OGSA 4Z7NF 4OZIE 1IUZA 1GGIH 3FSOA 4NRZA 5LBSL 2NY4C 1SXCA 2V7QJ 4KGJA 1TZIA 5DHVB 2P2UA 3NFPA 1KTBA 1KENL 2W27A 3GSNL 2Y7QA 1KDJA 2XDJA 9CGTA 3QQ9C 4LDCA 4DO4A 1CFQB 3WJJA 1MFDL 1ADQH 2HKFL 3TA3D 4M6NL 2F1EA 3TA3B 3OXRA 5AD0B 2O6PA 1DZ0A 4A6YB 4L4VA 3BHBA 4GRMA 1DO5A 1MG3C 5LG1A 3MLWH 1A6VL 4PWIA 1RVFH 1VL2A 2V8LA 4K7PY 4Y4HA 3C60D 3GXFA 2BCCE 4BCZA 3MLZH 4JUSA 1OE1A 5CJ4A 3C60B 3V7AE 1EO8H 1N0LA 1JTHA 1NAMB 4X6DA 3PABB 5JW4N 1RP9A 4ZQKA 3TNNA 1YJNP 2P5EE 3LNGA 3GF7A 3CSYA 4KQ4L 4BSVB 4XNUH 3FZUC 4MJID 2WSCJ 4BWNA 1WBZA 4JZOB 4MJIB 4U6XA 4G71B 3H3PL 4Z7OF 3TO4C 3GQFA 5D1XE 1RIHH 3QISA 4V11A 4POZC 4XPAH 3ZRSA 2VMEA 2A9MH 2Z6FA 1V8HA 3G3ZA 3DPBB 1MCSA 5C0GA 3FCTB 5AW6B 1G9NH 4WY4D 3LH2L 1P5UB 4WY4B 1B4RA 5K9KB 1REIA 1VPOH 4MAYD 4ODSL 5I5RA 4MAYB 4K0OA 5GISL 4KX9A 5C09A 2X2HA 1DJZA 3KCPB 4JO2H 4LFHD 3KWTA 3SQRA 3RZCA 2YAHA 4HK0A 3CUPB 3CSPA 1J05A 2Y9RT 1R5VB 1MFBL 3TBCA 3JCUH 2UY7B 4AK2A 4NQSB 3I2CL 1G6RH 2KPWA 1A7QL 2ZUQC 4P99A 1LD9B 1XCTA 5CINL 5C2UB 3D07A 2WSPA 2GM4A 2NR6A 3MJ7A 4HV8A 3U0WL 2HWZH 4HJGB 2IALA 1KJMB 4JQVA 4LKXB 4M93B 4L1SA 2YPLA 3WKQA 2MNUA 2FYNB 1IEAA 2HFGL 3RVXD 1Y1DA 3RX7A 4LU5H 4XFJA 2KC0A 2VRAA 5F6HI 4DTGL 3GUTA 3W81A 2QJKC 3ZZQA 4GW1A 1DDHB 3QQ4B 1A0QH 4PLOB 1QFWI 4ZXBD 2VMCA 4L8SA 3G5ZB 4LFHG 4ZXBB 4APQD 2FVNA 4APQB 32C2B 4LRIA 1W8NA 3ARGD 3N7NA 3PWUA 3ARGB 4UINL 2F54A 3MBWA 1QSFD 3MLVL 4ODTL 4TQHA 1A66A 2XWTA 1EGJL 1QSFB 3LQMA 3QCTL 3E1F1 1EZLA 4KXCA 3S5YA 3SKMB 1K4CB 5EBMA 4IMKC 1HTLC 1F4YH 4NQVB 3O8ZA 1R3IL 1OMIA 1VLXA 3FOLA 3SE4A 3DVGA 4EQ3A 4OI7A 3B2UC 4KRPC 4JGJA 1FIEA 3EJJX 4M62L 1E65A 5D5ME 4P2QA 1LK3H 4P05A 4PGEA 5CCGA 2P4AB 1N7LA 4MJHA 1SQQJ 4GBXC 4OCYL 5IGXH 4X6CE 4W68A 1QLRA 5GZND 3GDBA 5SX4H 1Q9KB 4HS6A 2GIMA 4TLTA 1EDHA 4UM8A 4PGBA 2EADA 3GMPB 4Z7UA 3RBSA 2XN2A 1KTDA 2F74B 3JTSA 1JFQH 4YDLB 5GS1A 1SLXA 3SWFA 2CXKA 1JPGA 3SBRA 4U1NA 2OYIA 1EANA 4JGMA 3EDFA 4NP9A 3W0WE 5F9OL 4CVXB 1KFGA 5E6UB 1IKFL 1GZQA 2BRQA 4IGBB 4CJ1A 2W60B 1PGPA 5HHNB 3TFBA 4P4KA 1M7DA 1YDPB 4BFFA 1T03L 4JB9H 4P8QA 3ILPB 2EXWD 2G8YA 1ZR4A 4JW3A 1YMHB 1A7OL 1SN5A 4LBEA 4M8QB 3KPRA 1S4IA 3RI5K 4AOFA 2EDDA 2CDGA 1XGRB 1EZUA 1UQSA 2YPVL 1A3QA 4JFUA 3L72D 1RMFH 3D12B 5CN1A 1AQDA 2VB5A 4WWNA 3BZ4B 4G1MA 2PFXA 3IYLW 4K8RL 1KBGH 5AVUB 4OLEA 4DP9X 1W8OA 3K71B 4HS3B 1BZ9A 5TISE 2BX5A 2Q8BL 3VD3A 3NN8A 5DXWA 5EU3B 3L4UA 2HJKA 4CVUA 5JW3H 3TCXA 1I4FB 3DYPA 3OLDA 5K5YA 4EN3C 2WZ6A 3F58H 1GW6A 2NLJA 5FA3B 3DJTA 3Q44A 3V4WA 4URKA 1FFNB 1N5AA 1HH0A 3ES6A 3L72G 4AV0A 2MQ3A 2GEEA 5DJ2A 4IRZH 4HH9B 5HYSA 3T6VA 1HGZA 4LSVL 5DK0B 4PD4H 1MREH 1ZJAA 2MCG1 5DUMH 3MC0A 4UNTA 4ZX4A 1IEBB 5T3ZE 2NY0D 4UB6H 1R3KB 3PHQA 1BX2A 2NY0B 3V0AC 1LTXA 4G9DA 3BZFB 2VE6A 4B60A 5KVGH 2XTLA 3VFTA 3HI6L 4WLCA 2KLRA 4O9HL 3IEAA 3P4MA 4KVCH 1JF1B 15C8L 1X6LA 4NZJA 5C3IA 5L2KD 1AXSB 2LW3A 1DQLL 4S1QH 3LN5B 5EZJA 5DRNA 5L2KB 5D7KE 2XNXA 3X11A 4UTAH 3QDHA 4N0CD 4PJGE 3O9WC 2C8NA 4UT9L 2W9LA 3RJDA 4XN1A 5AOJA 3L4TA 4AYID 5DRZA 4AEHH 2Z4EA 1I8MB 1JUFB 3SGJA 5A7EA 1D7MA 2P47B 2YQBA 4NHUA 1HHJB 3MFGB 4KAQL 3R19A 3UIZA 1KV7A 4G7YL 1JMMA 1CW5A 5ILTL 3TPUA 2C4XA 2VDOB 3NH7H 1H3PL 1EZVE 3V5BA 2W9EH 4P3DA 3EYOA 1AKJD 5GSVA 1LO4L 3L37A 1PV3A 1K3IA 1HU8A 2QHRL 3BKJH 3QJFA 5PCYA 2FYVA 3FW6A 5DVLA 5DMIL 2WWKO 4ZS6D 5E1AA 2HFED 2EVGA 4FL4C 3BGMA 2AJVL 2WYTA 3C9IA 2HFEB 1UA3A 2H3NA 3EYVA 1FI8C 4G6MH 2EJ1A 1RF1C 5DS2A 3UTSA 4TVPE 2FUTA 3BH4A 3H85A 3GHBH 4E9WA 2Q76B 4E42B 1U41A 2Q8AL 4EVNB 1AXTH 2M5AA 3CMEP 4K9JA 1FDMA 1S8DB 3L3DB 1JPSH 2IYPA 2H1XA 4KKLD 2DJMA 2DQHH 4U1MA 5PAZA 2IDQA 5AZUA 1GS7A 5D1XC 5DRWB 1PFOA 5BW7C 2HRHA 3ZT6A 2IQ9L 1ECZA 1QPKA 3GMOB 2IBBA 1SQPG 4WJG3 4PJFE 3TV3H 2L0DA 3Q3DA 1YA5A 1OW0A 3JTTB 3QA3B 3SKJL 1W72B 2WKLA 1X5HA 2BXZA 5KJ7A 5TDPB 4U1LA 5KAIH 1IGJA 3LMJL 2WTPA 5T3XD 4MJ5B 4OV5A 4HC1A 3OAKA 2LLNA 4UUJA 2NPSB 1PEWA 4D9LH 1KB5L 4A7TA 2CLRA 5AKSA 2JKSA 3IDIB 4PGDA 4FYSA 2EH8H 2X87A 3L17A 2MCAA 3PH0A 2ZOLA 5C0BB 5FA4A 2XVBA 3CVCA 5MI0B 3S3SA 2NYKA 2VH5L 3Q3GA 5E8DH 1R3HB 1QPXA 4F7PB 4EBQH 2FK9A 4PD4I 4H4NA 1B0GB 3QDGE 4O2EB 2E8YA 2XPZA 4NZUL 1FG2B 2AAAA 4OH2A 4DT2A 4JS7A 4N2KA 3TURA 1HZKA 3U1CA 5APYA 2WVTA 1P6WA 4JRXE 1O7VA 4DZ8A 2DH3A 5DWUL 5DD3L 1THAA 1URQC 1B0WA 3RY4A 2L3BA 4DQOL 3V2RA 2FJGB 3VXQA 3LHPH 1F1AA 4Q58C 3AAZB 5HHPB 4HCIA 2BVPB 3GJFK 2BJML 4FFZH 4HIHA 1JHTA 1LJMA 1FDLL 1N9PA 2CRMA 4XN4A 4D0CA 4AITA 4B95C 3LZFH 4M7JH 5L4MA 1LE5A 4XBEH 1S7WB 2MQCA 5C0AE 1JI1A 5E94B 2Z31C 3H1KE 4R83A 2ADFH 1IVTA 3DUHA 5EOTB 3FUJA 4JHBA 4XWGL 3UO1H 2P80A 1CUOA 2H2SD 3AGWA 1RUQH 1SNRA 4HBCL 5A16A 1AVYA 3VXNB 3VXRA 4ZW5A 1JN6A 1HX0A 3QG6B 2MHAB 3AM8A 4EDFA 2ZCLL 2VR8A 3DURB 1JK8A 4NFDA 2AXTE 4ATTA 1GS6X 4OLZH 4HH2A 2BVTA 3ASNB 3N0AA 4P2RA 4W1TA 3F83A 1OB1A 2CO1A 3MYJB 5LBGA 2GT9B 3MX0B 4H5SA 2NUTA 1VQ9P 3WAJA 3PGCA 5ANMA 2ZCHL 3L1OH 4NPYA 4OQTA 4D0BA 3E6FB 2FT8A 1AQMA 1RZGA 2HVJA 5DJCA 1MCPL 3CXHJ 2PR9A 4JKWA 4HEMA 4UZUA 1KGYE 1BZOA 4F27A 1TZOA 2VC2L 4H25B 4UYPA 4PJCF 4MMZC 1RY7B 1FZBA 1JGLL 1WC7B 1NH4A 2OMZB 5KVEE 1KJ2B 5EIVA 4TRPH 1FL6A 3HR5A 4LCCA 1F8TH 2BOBA 1FOSE 1FNFA 3N41B 3WNMA 3ARRA 4PJIA 3BGFB 5ALCH 4IU3B 1Y9BA 4IFDK 2YPKA 3GSOB 1B4JL 3S88H 5EOQL 3LS4L 2V2XA 5KKZB 2N0KA 2F7PA 5D2NB 3WKMH 3FHQA 4KUZH 3SDCA 4OLXL 4AEEA 1J0KA 4JFQB 3HPLB 2DMGA 3MUY1 4OLYL 3RURA 3QXAB 1AZVA 4YUEH 5KVDH 2WGXA 3GBEA 3HG0A 2V9RA 1NCNA 1P9MA 1YNKL 1XEUA 1MIEH 5E4EB 4ZFFB 4GJTB 4QMEA 2GEQA 3BIAX 1ZA3A 2I60L 3HS0A 2AK4E 2C1OB 4GNKB 2BIMA 2XZQH 3BYTA 2F7IA 4XO5A 3TEZA 2ATKB 2RGSA 1DTUA 2YS4A 4NJ9H 5EPMA 1HZHL 3RWEA 1XF4B 5DEFA 2BCCD 2HT2C 1EAPB 1OK8A 3GS0A 4RZCB 1E4HA 3SKUD 3C6LD 5T5FA 1EVTC 2P5WA 1EX0A 4G7VL 1SMDA 3IXTA 2CPSA 3QPKA 4L1TA 3RUGF 1KJVA 3U4BL 5C71A 3RK3B 5BS0E 1BJ8A 3RTLA 1VGEH 3V5KB 3AMLA 1Q0XH 3LPWA 1HKLL 2XWJA 3IJ7A 4LDEB 4MQSB 3L9RB 5KZCD 5KZCB 5JA8B 3ZDYB 4KBPA 4KTGA 1XH3A 3FFCE 3OWRA 3LZLA 4IBSA 4M43L 5HD8D 3FN0H 2XV3A 5E2TH 4K15A 4ERSH 3OW2O 2DQTL 3L74J 2BCCG 3U25A 3OKEA 4XWOC 4X5WA 4Z3IA 5KYWA 1ODAA 1F3RB 2R1WA 5C0JA 4DGIL 4WV1C 1FHNA 4QTIH 4I48B 4XXCC 1INQB 1QATA 4OCSH 4CILA 1HIML 5IVZB 2XPGA 2MNWA 1XV8A 3D4YA 4EOWL 4JG0H 2PWFA 4GRWH 5F7NC 4DN4L 1BFVH 3F7LA 2VISA 2I26N 3TT1H 2VR3A 4NIKB 2DI9A 1V54B 3KL3A 4K4KA 1UXMA 2LTQC 4XOCA 3BAEL 4F2MB 3IETA 4YN3A 2OA9A 3NFSH 3UBFA 4BKTC 3V2NA 1CF1A 3LKRA 3I6KB 3OMZA 3VWKC 1TTBA 3QC5X 2FX9L 1D7DA 2F19L 1CLCA 2K88A 3Q6FA 1DQIA 4FI8A 3U2SA 4BFJA 1E4WL 4YNYA 2IFMA 1NTKJ 4MKTA 2WUBH 1DQJA 1N26A 5IV2A 3N40F 2NX5D 4PIRF 3CZEA 1N73A 2NX5B 4M29A 2IWEA 1AQTA 1OGTA 2NY1D 1DUZA 3QDME 1JDDA 1F2QA 3HNSL 2R0LH 3K2MC 4U2ZA 4N2NA 1A4KA 5D96B 3FSZA 1YMMA 2EDFA 5FB8A 3B2PA 4PQXA 4JDZA 4M5TA 5K69A 4JYBA 3IDMB 3VCLB 2MOVA 2NYYC 2CQVA 3TGUD 1SXAA 2QKIA 1MI5E 2WKGA 2YMTA 4IK6A 4XNYL 5LCVH 1K5WA 5B3JF 1HXMB 4MRCA 3GW6A 1P1ZA 1TZHA 4EQ2A 1CR9H 1BMZA 4HGWB 2EVIA 2AHIA 3KYMB 4JFVA 5DJAB 3IGLA 3L70J 3U0PB 3PXHA 1XF1A 2IH3B 3U0TB 2VM9A 4M56A 1K6QL 4GUQA 1MHEA 5ICYB 3QCVH 3AG2B 1XGPB 5BNXD 5LWYL 1WUZA 4CU7A 4EXPX 4LCIL 5JQ6H 3GHPA 2AEQH 3BZDA 4NZTH 4QHLB 5DZPA 2R3SA 1U93A 3PL6B 3MOBH 5IT2H 1SEBA 3GIVA 3QI9D 4N8PA 3HHSB 4NENA 3TGUG 2VDLL 4JPKL 2IXQA 3QI9B 2NYZA 3DHPA 4Z1PA 1FYTD 5DJ6A 5I28A 3S9DB 1FYTB 4I89A 4M5YL 2CK0L 2YXRB 1OLZA 2HXAA 4QHNA 4AYFB 4PJBA 2AZUA 1NDMB 2XN9D 1ZHBB 2XN9B 3I85A 3QEHA 4MX7B 4OZGB 5EC2B 3Q0HA 3Q05A 2H3KA 3CU1A 3EYFB 3KD4A 2DBJA 1J8HD 4NZFA 2OX5B 5HYJA 1J9SA 4F8LA 1TSHA 1J8HB 1NCTA 3V2QA 2ICCA 3PQYE 4PJEF 4PV9A 4P5KA 4WEEA 4CADB 2YKQA 5EN3A 3FU8A 4NM8L 2M3BA 1I3GH 3OF6A 1BQSA 4HIIA 4LOVA 1BMWA 4TOYL 1DSFL 5C9JA 1WS7A 2J4WH 2LT9A 3MO1B 2PWEA 4MXQC 3VI4B 4YXKH 5C8JA 1CL7H 2IOOA 5TQ2H 2PP8A 4KJWD 1AZUA 4K8RC 1KGCD 3BDYL 1GJWA 1XR9B 2H0FA 3SOTA 1K3ZA 3CQPA 3O45B 4DSYA 4QCIA 2AXFB 4NKQB 1EFXD 2ZG2A 5EO1B 4TPRH 4M3JA 1EFXB 1HI6B 3FUDA 5IFHL 3M1BA 5ETUA 4ODUA 2YSSA 4JCWA 4BDVA 1PGQA 3JWOC 1KNOA 2HMID 1R19A 2ZUSA 2V33A 1WG3A 3BEWA 5AVTB 4D3CH 1ORSA 2R15A 1NEPA 2NW3B 4J8QA 2I8DA 2R29L 1NGXB 3RWFA 2ADGB 5DR5H 4YSCA 4HCRA 4MA7L 1U7MA 2X6MA 4HJ0D 5I15H 1CZQA 1UXSB 2BNQD 3U1SH 4OCXH 2BNQB 3FQTA 4Y1SA 5KEZA 4W9GC 3UROR 1A02F 2VLJA 5JW4R 1TENA 3QJSB 5DSCA 4NPFX 4ISVA 3FB7B 2KUBA 3I02B 3ZKXB 4WVZA 1G0DA 1PBYA 3FPYA 3HE6C 5KTBA 1K4DB 5SWSE 3L45A 3MI6A 3P32A 4HALA 1AZBA 3P4NB 3PUCA 1NMBL 3TTSA 5E00B 3ESVF 3C5XA 3S6CA 2EUXA 3BIKB 4PV1C 4R7NA 2HTLC 4E9SA 4F37F 4KKCD 1OTSC 2CO6B 5C08E 1CS6A 3F85A 4L9DA 4AENA 1CFTB 3PWVA 2HLFD 1G7PB 5C39A 1VFAA 2IPTH 4UQDA 4GG6B 4P9HL 1DVYA 1W5CE 4MCNA 1GCFA 2GSMB 3U36A 5CBAB 5IQ7L 2IGLA 2NXZD 3JV4B 2DDQH 2EE3A 4B9GA 3FXEA 1LLAA 2XTJB 3OG4B 3C8KA 3SKOA 1GHFL 3EFOA 3GBLA 3FUHA 4G82A 4AMKL 4A6YL 2QQKH 1AZCA 3BSGA 1SQXJ 3EOAA 2QPFA 4PTTB 3IVKA 1UVQA 4NSKA 3H1IJ 4JY6A 5I9QB 3F6LA 1NAML 3O8XD 4Y28J 5DS8A 1QR4A 2CRZA 1T6AA 1TLMA 2J59M 2NY6C 3HUJE 3IE4A 3O8XB 1G2CB 1DO6A 4KOBA 4ZNEA 1AXIB 1LEGB 4L3EE 3U30C 3QCUH 2IADA 2BCKA 3BKMH 1VKXA 2WB1A 1NFDE 1XGUA 4UTBL 2BIPA 5T5NF 3NUKA 3S7GA 2Z93B 5F2FA 2E9WA 1MFVA 2PLTA 3WN5B 3KDMA 2N1TE 5D1ZA 3SQOL 4TQEL 5LBSH 4GRLA 4DN3L 1G4MA 5T33L 1KENH 3CWBD 3LRHA 3GSNH 1QZNA 2VIRA 3BEVB 3H9HB 1O75A 2JXMB 5F89B 3E6HA 3ZE1F 1MFDH 2CPCA 2BHYA 2HKFH 4IBQA 2MIZA 4M6NH 5CCKL 3DHMA 1CL7I 3UZVA 1VGKA 1YEDA 2H2PC 4N86A 4H20L 1E9QB 5E5UB 3S98A 5I76B 4B5ZA 3MGNA 2K0RA 1NGZB 2PABA 1XCQA 3S96B 1ZT1A 3ZKMC 1NANH 2M8RA 2J6EL 4JZJB 4ZFGL 1A7RL 1AG6A 1AO7D 2Q2LA 3AFLA 1KPVA 1XT5A 2VITB 4LVNB 1AO7B 1PYWA 4MVBC 5LNGA 4MJ4A 3GSUA 5IVXE 4R6UA 3CWBG 3GGWB 2I9TB 4KGLA 2IJ0C 1HWTC 4FADA 3PF2A 3AS2A 3BWUC 3H3PH 1N0XL 4QXTB 3BP5B 1JXKA 3BFWA 1FA4A 1VQ4P 4ELMA 3CX2A 1FV1A 1IL1B 2XXMB 2C5DC 1PDKA 2PCYA 4M4RB 3ARVA 1TTCA 3LH2H 4U1GC 4AYGA 4DVRH 4F58H 3C09B 3MNVA 4XO3A 3S2AA 2A06D 4ODSH 3MTUE 4AQ8C 4IJ3C 5GISH 2WMMA 2FWUA 3C2AH 1OT4A 2R4SL 3OD3A 4JFEA 3IJEB 3SDDC 3QPQD 4YHYC 4K3EL 2H5UA 1B6DA 3AXIA 5HTSA 1M9SA 1N6UA 3GMQB 4FFVC 4R0LC 1Q2NA 1MFBH 2H8PA 5E4OA 4TVPH 3UZQB 1JZ8A 3BLKA 1U8OA 3QG7L 3I2CH 4X4MA 1T1WA 1A7QH 2XBDA 2D7PA 1WISA 4DGVL 4FKKA 2EDYA 1YQ4C 2HFFB 2IG2L 5CINH 4CN4A 4EI5A 2Z91B 8FABA 3U0WH 2VZVA 2FBOJ 3QUYB 2HFGH 3FBQA 4U1HB 4XVUC 1NC2D 4Y5XB 3TBTB 4N6QA 1L9OA 2AVFA 3UG3A 3Q1SH 4HX1A 1ZT7B 1AG0A 1IM9A 2NQCA 3F7YB 4TL5A 4DTGH 2ZZUT 1P5VA 3FN9A 2A06G 4FXGC 4FG6C 2ICEA 3D9AH 3DIDA 1C08B 1OL0A 4GOEA 1F6FB 4ZK8A 4IL6H 3ERXA 5HI4C 2XV5A 2CD0A 3TJHD 3KNBA 3HMXA 5KYYA 2B59B 4I1RA 1QG3A 1HH9A 3FTGB 5HHOE 5T1JA 4UINH 1USEA 4DFHA 1WCQA 2QLYA 3MLVH 2V9TA 4ODTH 1EGJH 1YITP 3SWKA 3PJSB 1QRKA 1N3NA 2E9IA 3QCTH 2ZAIA 1KXTA 1FZCB 3VH8A 2D8KA 3BASA 3CX5H 1IGCL 1PJWA 3VMOA 4Y4FC 3SPGA 4NRZB 1TQTA 5IHUH 4N2BA 3VFGL 1BAWA 4PB9L 1TZIB 5E1QA 3F05A 2V5MA 3NFPB 1KQGB 3FUMA 2YA2A 4M62H 1NCDH 2VZUA 4B3VA 1R17A 2Y7QB 4OCYH 2SEBA 3Q01A 4LMQI 1MRDL 4TVSa 2ETWA 2VXQA 4AVHA 3B7RL 3OXRB 2CDEA 4L4VD 3V0DA 3HD7C 4N0RA 2AI0L 4LCYA 4L4VB 1OT1A 3BHBB 4GRMB 3V0GA 1FGVL 1CGYA 1ZCRA 3ZQWA 4QHPA 4Y4HD 1R34A 3HI5L 5A7BA 3DNKA 1S5HA 3FO2A 4UAHA 4Y4HB 3AWFA 1NANI 4WEBL 3U6RA 1IFPA 1TETL 1N0LB 1X7TA 1JTHB 3ARFC 4X6DB 1O6SA 2AK1L 4TUKH 4ZQKB 3SO3C 5F9OH 3TNNB 4K94C 1VFMA 3DIFA 2WBWB 4HULB 3VTTA 3CSYB 1IKFH 4F9PC 4GT1A 4QWWD 1F1DA 3TH4T 1NO4A 4LSUL 1T03H 5FOBA 1WBZB 4U6XB 1A7OH 2Q5BA 3RQ3A 5KVFE 4HVBA 2XY2A 2Y7SA 1ZIAA 2YPVH 1EZVI 4OZIF 5C0GB 5T1LD 3PP3K 3BN3B 4DF9A 1VADA 4K8RH 3VWJC 5F93C 3RILA 3VGBA 4J39A 1GYCA 3TYYA 4FNTA 5C09D 2Q8BH 1S9KC 4N3YB 5C09B 1EEZA 1DVFC 3RZCB 4KOCA 3DRQA 4HK0B 1J05B 1SQBD 5C0CA 3DETD 3JWOH 1QP1A 2M3EA 3ABVC 5BRPA 4CVWA 5I5JA 2Z9TA 4LLYA 1XCTB 5TE6L 4N1CA 1FNLA 2NR6D 3T2QA 3ZO0A 4HV8B 3MJ7B 1E4XL 2IALB 2ISDA 1Q4NX 2F53D 1T1XA 4M7ZB 2YPLB 1OP3K 5BOPA 1O5PA 1IEAB 3CVBA 4I9WE 4WFFD 1YTZI 2CJ3A 3RPIA 4M7LT 1DJXA 2AV7A 3N9GL 2VDOL 2F1AA 3GUTB 2YEZA 2RH0A 3CHOA 4Y7MA 5CP3A 4GW1B 4LSVH 4U1IA 4A7GA 3ZMNA 5CMZA 1HEZB 4L8SB 2XN1A 1H9VA 4YHOL 1QSZA 4NS0A 1SQBG 1SQ2N 1JGEA 1SFCA 3EO9L 3US9A 4JG1L 1CXEA 3PWUB 4O9HH 4PUBL 5ESVA 1ASPA 2F54D 3ORJA 3QP3A 4ADJA 15C8H 4PGCA 1RAMA 3Q5RA 2F54B 3IJHA 3MBWB 3BAIA 1DQLH 2XWTB 4UQEA 3W57A 2Y6SD 4GFTB 1BLNA 1R5SA 2GIYA 1OANA 3ETBJ 5EBMB 1TQSA 3CX5I 2BVUA 3AG4B 1MI5D 1NTMD 4UT9H 4OF8A 1MRCL 4X4ZA 1HWWA 3QRLA 2ZAEB 1P0SE 3FOLB 3DVGB 4JHWL 5HY9A 1DVQA 3C8DA 4ZO6A 5B1JC 2M83A 3CCHA 4P2QB 3POCA 3RTQA 5F6IB 4KAQH 4NBZB 4G7YH 3ZTEA 5HVWA 5ILTH 1QLRB 2FJUB 4FJZA 2Q6WA 2WVVA 1H3PH 5KBDA 4HS6B 1W72L 1LO4H 1NCOA 2OR7A 4UM8B 4PGBB 3LZRA 1LJ2A 5IHLB 5T3XL 4WI6A 4Z7UB 1O7SA 1KTDB 3A4DA 3V8OA 5AQ0A 3JTSB 4W9HC 4RLDA 3DX8A 3HUSC 1NTMG 1NA8A 2AJVH 3ABKB 1W0WA 1JPGB 3HMWH 4GB9A 2OYIB 4U1NB 3RIAK 4E9RA 1B0RA 1L6XA 3CC1A 4WK4B 3JTBA 3TN0C 3UTPE 2ZP8A 1G9ML 1GZQB 4BUHA 2Q8AH 3DJ9A 4BFRA 1FC1A 2JLLA 1M7DB 4P4KB 4BGLA 2ZKHL 4KC3B 2E7LC 2EAEA 2X1OA 4LBEB 1EHLH 3KPRB 3KPNA 1VF5C 1QFHA 3DV6A 3ARYA 3KYNA 3TWYA 3T0DA 2CDGB 1UQSB 2ATPA 1GXEA 2VZOA 2X4RA 5E6RB 4ZUVA 5I66A 4DCKA 1AQDB 2IQ9H 2DQEL 1GTWA 1NKOA 1EO5A 4G1MB 2FEDD 4FFYA 3SKJH 1BZ9B 5D5MF 2X4PA 4ZBJA 2V4HA 3HB3D 3BP4A 3NIFF 3NN8B 3HB3B 4G9FA 1LO2L 2HJKB 3LMJH 3RWIA 2X88A 3A6BL 3B2DC 5HSFA 4DP4X 1HUCA 3LOWA 5HJBA 2EUZA 4R7LA 3LRSA 5F7AA 3UIYA 1KB5H 2NLJB 3HBZA 3OMIB 4N78E 1HHKA 3E2HB 2Y7NA 1N5AB 4UIMA 3ES6B 2YA0A 5DZLA 1DIPA 4WB4A 3F04A 2NSXA 4FCHA 3S48A 3BE1H 3H25A 5DJ2B 4XB3A 4ABWA 4HXAL 5DJUB 2VH5H 3UDWC 2F7OA 5HYSB 3ZZLA 4LPWA 4HJTA 4NZUH 3U1PA 1GK6A 2HG0A 2DY2A 2YQ2A 4Q14A 1LT9C 2MCPH 3PHQB 4JLRA 5LBVA 5CBEA 4G9DB 5DWUH 1MNUL 2VE6B 3O6FA 5DD3H 4G43A 3VFTB 4QYOA 1KN2L 4DQOH 1GW0A 2BOLA 2MEJB 3NCFB 3P4MB 5DMGD 3RI5F 3PWNA 2DAVA 4R97B 2GITA 5CLTA 1M2OA 3MQIA 2BJMH 5EZJB 5DRNB 5I8EA 1U30A 1FDLH 3S37L 3X11B 4JFFA 5I1LA 1KJ2L 1S9YA 3BPLC 3HBGA 1OWRM 4OIFA 5HYSG 2QVTA 3UAJC 4F7CB 1VQ6P 3H9SA 1WTGT 4XWGH 5DRZB 2DYPA 3S2CA 3WUTA 2VQ4A 4AEIL 1D2PA 5CJXA 3E8VA 4HBCH 1L0LJ 3FQUA 1IAOA 2QMKA 5AW1B 3V4QA 1NSNL 3TPUB 1GL2C 1FL3A 1KLUA 3D7PA 4B9CA 4BD4A 4P3DB 5HDLA 3U59A 5JDSA 2DWEA 3JC22 1P84K 3EYOB 1CF8L 2DJ4A 4LESA 5GSVB 5HYEA 3QJFB 4J3TA 4CL7A 2ITFA 5DD0L 3QULB 1P84E 1PF3A 1TPXC 1Z1WA 1L0YA 5DVOA 1FNEA 1ROWA 1F45A 3T3PB 1WT5C 3L73E 4I18C 2GSIA 3K91A 5E1AB 3TVMC 1MCPH 1V3KA 3BGMB 4ETYA 4QJ3B 1PPJD 3UTSD 1PZBA 2H3NB 3EYVB 4ZDHA 1HZLA 4CC4A 3UTSB 2JR8A 2VC2H 3QC6X 4R4FL 5TTRA 1WA1X 2RKLA 1JGLH 1IBHA 4N2OA 2X38A 1MEXL 2M5AB 4X83A 3VVWA 3LN4A 1BVNT 4KTYA 1OWWA 3RPKA 2OYHA 1DBBH 4U1MB 3OR7A 5AAWA 4P9HC 2YEQA 4WI9A 2KUTA 3QSKB 4PJGF 5JDJA 4WVRA 3AXLB 4AKQA 5DJZA 4MMYA 1KFNA 3H1ID 1N86A 5EOQH 4BSWA 2ZP0T 2N1TD 3N40P 2EO9A 2ZE0A 2RR3A 3TA3C 2DV6A 2ZOUA 4UM9A 2BO0A 5KJ7D 4Z7WA 1KCWA 1PPJG 4OLYH 5IMOB 2QG4A 4LOUC 3B56A 4U1LB 1IGJB 4OV5B 2WYZA 1YNKH 3MAWA 4H7VA 2IPUG 4UUJB 2YRZA 4DWHA 3D71A 4I2LC 3C60C 4K94H 1OX3A 3QQ3A 3FCBA 2CLRB 3CFEA 2I60H 4QRSA 1SY6L 2R3CA 1K72A 4PGDB 4F8TA 2PR4H 5A43C 4FQPA 2A9DA 3MXWH 2CA4A 2Z7WA 5F70A 5KANI 3M9BA 2ZOLB 5FA4B 1LL1A 1HZHH 3V5DA 1AZZC 2C9LY 2ICWA 3NIDF 3P69A 3Q3GB 2ZT9D 1SF5A 1XDTT 1T2QH 5D4QA 2ZT9B 4M7LL 5LAXA 3P4LA 3UTQA 3U4BH 1JPEA 4MQTB 3LN9A 1SJMA 2V3DA 1P5UC 1DBML 4FQLL 3FONA 2RAMA 3KLSA 4DZ8B 1HKLH 4F7TA 3QWQB 2E9BA 3V4PA 4MAYC 4YDJA 3OKKA 3FO0L 2V7HA 3VXQB 1PIFA 1CFSB 3UFIA 1Q81Q 1HKFA 3RWCA 3HG2A 1OE2A 3V52L 3H8NA 4M43H 3TH3T 4HIHB 1JHTB 3ZMEA 4D0CB 5IM7A 1T20A 4UQAA 5EZPA 2RCSL 1LE5B 5MERA 2QE7H 1YY8A 2FEEL 3QYCA 3T8XA 5IJBC 2ZUWA 1KZYA 2FX8H 4JREC 4NGHL 3RL0g 2XWEA 2FYNC 4DGIH 4ZMWA 3VXRD 5A16B 4ZNCA 2J25A 3VXRB 4Q6KA 3RVXC 1HIMH 1U4EA 2VYRE 3H4HA 1JK8B 3QJZA 2WCPA 2FHFA 3QQDA 4XX1G 1OP5H 4P2RD 3VA6A 2O5NA 4JX0A 4X0NA 4F8NA 4NOFA 4P2RB 4LOEA 3WGVB 4MSWA 3UMNA 2QJYC 1OB1B 2VR5A 3U7YH 4A7QA 5CKAA 5IQNA 2NUTB 2OMTA 3BT0A 4H5SB 3PGCB 3VFSA 4ZI8A 5ANMB 3IF4A 2WZ7A 3BAEH 1GKOA 4KT0J 1KIPA 4NPYB 4D0BB 1SHSA 1AGEA 1RZGB 1T1YA 2HVJB 5DJCB 4WQOA 2B8OT 2X53A 4AYMC 4TLFA 3LEVL 5GGTL 4Z5RA 3SSUA 2FX9H 1TTRA 4FG2A 4MDIA 3SGKC 2F19H 3KPQA 3T2LA 3BH8A 3IDNA 2NQDA 4HK3J 1Q1JL 4YSDA 1ZXKA 4BQBA 4NKIL 1BVKA 1FL6B 1S9VA 3HR5B 3OZLA 4PH8A 3GI9L 4LCCB 2BOBB 1MCLA 2WWMC 4ZW7A 1FZOA 1SBSL 1HNFA 4PJIB 3HOGA 3ZDZF 3HNSH 2YPKB 4D6TE 4L4TA 4UCFA 5A40E 4BINA 4E9YA 5GZNC 2V2XB 3SDCD 1FSKB 1VQLP 3SDCB 1OXYA 2P46B 3FO9A 5TK4A 4I88A 2XKNA 4BFBD 4EMZA 4XNYH 4Y1TA 1IAIM 3P0GB 3ZGIA 3BAWA 2OTLP 3WIFA 1RD6A 4KV5E 1G1OA 3EHBD 4YDLC 2VR6A 3EHBB 2H89C 1IZJA 5AVYB 1ZA3B 2YGQA 4N22A 3HS0B 3ZYZA 1E2VA 2JH2A 1JNNL 2HG5A 4IGBC 2HPTA 2V2TA 1K6QH 5AVWB 3SB3A 5EPMB 4ZD3L 1G7HB 5DEFB 3RWEB 4IIZA 1C1EH 1KB9K 4Y4KC 5LWYH 2P5WD 1HEHC 5DT1L 2BSCA 3MREA 2P5WB 4KI5D 1MCOL 3BVDB 4XMUA 3UBXG 5JOEA 3CIAA 3IXTB 1KB9E 4LNVA 4X6FA 1KJVB 5CEXA 5IUSA 4AQ1A 2VDLH 4JPKH 2WLJA 4JKPH 3RGBA 2XWJB 4M5YH 4RFEA 1BG1A 4FABH 2QELA 3AWEA 4XB7A 1AANA 3S4SA 1E6JL 1XH3B 3QZLA 1LDPL 2G9KA 2V0AA 4JGNA 4MZ2A 3UYPA 4FEIA 1L9NA 3QEGL 4XTRD 3P8MC 1KWKA 1J0YA 1I8IB 1QFWM 4LB8A 5JPNA 3KBPA 1GGCL 3C1LA 1YN6A 2D9CA 4BCXA 1YYLL 3OKEB 2FT6A 2E4TA 4X5WB 5KYWB 1RUML 2P9RA 1IIKA 2R1WB 2L7EA 3HI1A 3H9ZA 3II6A 3KLKA 5C0JB 5I17A 2NNAA 1BXUA 4NM8H 4U05A 3R4YA 1Y6KR 12E8L 2QVFB 4E0RA 5CBOA 1GYWA 1CYXA 2XPGB 3BAXA 4EUPH 4TOYH 2QL1A 1G1YA 3C5JA 3EF4A 5IJKC 1QVGO 3RK3E 1PTZA 1E4KA 1Y8AA 1FVDA 2VISB 4HLZH 3LH8A 3OLEA 5GTHE 4YDKL 4LSTL 4AK1A 1UD2A 3UJJL 1DN0A 2FWOA 3WU1A 4OFPA 3IETB 1IC0A 3M91A 4AX3A 4WF7A 4YSOA 1SFHA 3L4WA 3LKRB 3RIFK 4CC1A 1U7JA 5IFHH 2GQHA 4K71B 5DFAA 2XNAB 2B89A 3Q6FB 4MS6A 4XP1H 3U2SB 2J1KA 4YNYB 1I8LC 2IF7A 3QJOA 4D9RE 4XAKD 2R29H 4NO5A 4FRWA 2Q86A 5IV2B 4MA7H 2R69L 1PP9D 1UJ3A 4YWGL 1N73B 1OCRB 2XWXA 3AY4A 3RL1A 1OGTB 2BY1A 1DUZB 5BV7B 1YMMD 3L3KA 3T0EE 1A4KB 4K9EL 1YMMB 5FB8B 2FGZA 4JDZB 1LO5A 5GTIH 2R0ZL 2RMZA 3PLNA 3PIQA 4MKMA 4MXWL 3ZQ9A 1XEDA 2VN4A 2DTSA 4YPCA 2VKXA 4U1HA 1FYHB 1BZEA 3V0FA 1NMBH 3GXNA 3WBDA 1P1ZB 1EZVX 1TZHB 2NSMA 4MLIA 4RGNE 5D2LE 3KVQA 2D3NA 4JG5A 4FXTA 2B1HH 2CPBA 8CGTA 1V7MH 3P3TA 5CJ8A 4XN7A 2EDJA 1PP9G 3UAAA 4GSQA 2NNFA 1MHEB 2CA3A 3DGGA 5GRVK 5DHVH 3TU6A 1KILE 2JTYA 1OOWA 1U2HA 2CRIA 4P9HH 3CI9A 4GG8A 3ARBA 5C97A 1OGAA 5LG6A 4KKLC 4JVWA 2WSKA 3AE3C 2VN3A 4G7QB 2YJQA 3CBJB 1U93B 4PLKD 4TSCL 1SEBB 3GIVB 4NENB 4DHLA 1GHFH 2IXQB 4HAKA 1A7BA 1HHHA 2C9UA 5DJ6B 1WD8A 3BWUF 4HETA 4JNXA 3SE3C 4QHNB 4PJBB 3ZKNC 5M1BA 3K6SA 1OXZA 1FIGL 4YDMA 3QEHB 5AW0B 1OIOA 4JQIA 1NAMH 1NKNA 5DC2A 3Q13A 4H8VA 1YQVL 3EDEA 1AJYA 2NPSC 4IHBA 4M6AA 3UTOA 4WBAA 1SQQK 1AYRA 1BHGA 2VKWA 3CCJP 1HJBC 3PAVA 4UTBH 3Q9PA 4PV9B 4P5KB 3ARSA 1SQQE 1O9VA 1T0OA 3AS0A 4JO4L 2X9WA 1KF9B 2VERN 1G9MC 4TQEH 1CVRA 2V9QA 5TPWL 1ZANL 3GXUB 3WY1A 4U7KA 4HIIB 4DN3H 5T33H 3AXHA 5J6HA 5JIMA 2PO6A 1WAAF 2VLRA 3UPAA 5C9JB 4YK4B 2H3XC 3MA9H 4S2SA 4JQ0D 1PNDA 3LKOA 4W9CC 5C8JB 4JE4B 5I82A 5CCKH 1JXFA 4M5ZL 3IGKA 4H20H 1F02I 2GJRA 4YBHA 5KBMA 3O2DA 1YNTA 2EDEA 4QCIB 3IMSA 4YBQD 1YQ2A 5B4MD 5B7EA 2G5BA 4L29A 3W39A 4N0YH 4JPZB 3M1BB 4ODUB 2YSSB 2ZG3A 2J6EH 2B4CC 4ZUUA 1NU1D 1A7RH 4BDVB 1KNOB 4ZFGH 5FHAL 3BI9X 4HJGH 3BEWB 3QFJA 2PCFA 1ORSB 3RWFB 1MJUL 2YSTA 4YDIL 2MOGA 3EH4B 3L3OC 2MH4A 2D4DA 3F01A 4FFWC 4HJJH 4MN4C 5BRZD 3FQTB 2VABA 3D0LA 1CVSC 1N0XH 1WLHA 2VLJD 2A9NL 4RIRA 4OZHF 5JUEL 4K3GA 1LK2A 2VLJB 1W9XA 1KYOJ 4G5AA 2EC9T 5DSCB 4N2HA 4ISVB 3MV11 2AP2A 3VI4E 1TZ8A 2JWAA 3A21A 1UD3A 3QFDA 3OKYA 4H1LA 3IMRA 1NU1G 2R4SH 2Z8WC 5JHBA 1WPCA 1J1OL 1NUFA 2JCCE 1MJ7L 3F6IA 3IAQA 1QFPA 4K3EH 5IESH 1KC8Q 3EO0A 4R7NB 3CLWA 5KS9A 4CDHA 3QG7H 5HVGB 2H1LM 3FJTA 1L0LD 3IDXL 3SPIA 1CICA 4DGVH 3E0GA 1OVVA 4AENB 2IG2H 4H13D 2FQDA 3NSYA 3PWVB 4OFQA 3CMGA 4H13B 1VFAB 5DJ0A 4LO9A 4OVNF 1AMYA 3U36B 1T4WA 2O6FA 1F86A 4AL8H 3BGFC 1SFDA 1EHAA 4XP5L 2WWKT 3C8KB 3SKOB 3TEYA 3EFOB 2DOCA 3SJVE 2WXHA 2Z0UA 5KKZC 4MNQE 5D2NC 1DLFH 2AMGA 3EOAB 4TUOA 1FE6A 2XZRA 5KLIC 2JSFA 4JM2D 1DD3A 3IVKB 1UVQB 2UUDH 4IQHA 2K8QA 4NSKB 2R32A 1NBVH 4P46A 5IHZA 2NCMA 4EZLA 3QEQD 4OGAC 4J3OD 1T04B 1L0LG 1GZPA 3KLAA 5DS8B 4BXVA 4N2MA 2BMKA 3APFA 5E4EC 4ZAKA 1B0IA 2Q3EA 2K7QA 1IVLA 2IADB 2DIEA 2KZIA 5AW4B 2BCKB 4P0DA 1VQ7P 1VKXB 1XGUB 2OCFD 3CTTA 3EOBA 4HJEA 5D1ZD 1IGCH 1WCBA 3KDMB 2DTML 3K6FA 3PWJA 4HKBA 1M56D 1HDMA 2DYSB 5D1ZB 3SDAA 4GRLD 1M56B 2ITCA 3VFGH 4PB9H 4GRLB 4NQED 2YO3A 1PG7L 2VIRB 3DJSA 1R6VA 5I75B 2OW6A 4Q56A 5H4ZA 4HIPA 3E6HB 5GGRA 3RK3C 1QTSA 2G30A 4OZ4A 1ZLUK 2HRGA 5C3TA 3ECBB 2LAAA 4J3OG 1DSWA 1RZKL 1VGKB 1YEDB 3BUPA 4I85A 3CMAP 2YNYA 3UZVB 2AI0H 3AS3A 1ZW0A 1K8DB 3EO1A 5H94A 3TM6A 4NPJA 1D5IL 4KKZA 1CLZL 1XCQB 3HI5H 4GS7B 4J3XA 1ZT1B 2JDIH 2MKVA 4WEBH 1TETH 5FGSA 2ZKMX 4PSRA 2AK1H 5D71L 5B5EE 1KPVB 5HI3D 1PYWB 3GSUB 5CZRA 1YVLA 3J8F7 1GPOH 3MIWA 4CGTA 5DDHA 2O1JA 4LSUH 4EI6A 3HUJF 4W9FC 3ZQXA 3FN3A 5EOCL 3X1GA 3O0RL 2VR7A 2EIEA 3INUL 1NFDF 4M8VA 4ELMB 3H1HD 4PG2C 1FV1B 2D7NA 4CNIB 2MPAL 5L4FA 1FORL 4LK4A 1W0YT 2YZ8A 4S1RL 1QVFO 1PDKB 4Y5VA 5EU6A 2Y3AA 3MNVB 4G2AA 3QZWA 1JM0A 1P84H 3RX8A 4JFED 5FX3A 3KLHC 4JFEB 5AZ2L 1BD2A 1XL6A 5CSZA 2YBGA 2AEPL 2H8PD 4TXVB 4Y19A 1PKOA 4WFGD 4F2EA 5I1CL 2H8PB 4WUKL 2CALA 1U8OB 2PPCA 4LHJB 1I53A 1T1WB 3VYPA 4FC3E 5TE6H 3QO1A 8FABB 1E4XH 5HGBA 4X5LA 3R2PA 3H1HG 5F88A 3N55A 4HFWA 4AUWA 1IM9D 3MUGA 4HX1B 3N9GH 3FULA 1IM9B 2VDOH 1JOCA 2FNWA 3HN5A 2J88L 5IVXF 1P5VB 2EXTA 1YAZA 3SPHA 5D96C 3L08A 1TXKA 1TYEB 2GJPA 1DVSA 2ICEB 4CN6A 2OAAA 3VI3E 2K3TA 4DKAA 2J1WA 4HHWA 1G6VK 1UM4L 1HILA 2NZ2A 1TJHL 4PS4L 4XNZB 4YHOH 5J12B 2G2PA 5DUJA 5E6IA 3KNBB 1WRGA 5KYYB 1UASA 4JG1H 2CH8A 4MD4A 4PUBH 1LP1A 3AREA 1HH9B 4XMKH 4LEXL 3UL4A 3IPEA 4RAUA 1UA7A 4HGMA 4F8QA 2BP5M 4PWHA 1N3NB 1Y47A 1KXTB 5FS5A 3ZX1A 4K73A 3VH8B 3OR6A 3WMPA 4IBLT 3LEYL 4Y1AE 3KXFA 1MRCH 1FUNA 1TJIL 3TBBA 5D7IA 4DKFL 1KIRA 4JHWH 3RY6A 5I0ZA 5FDWA 3GJEA 2I5YH 7TAAA 1VQOP 1BGYJ 1GZHC 1MOEA 2G0LA 3PL6C 3CXHK 4LXFA 3AMKA 4CA4A 2X2IA 2B87A 3CN1A 1JYVA 2SEBB 1SXSA 4FNSA 4GP4B 1TO5A 4L48A 3CXHE 1W72H 3FHEA 3ARDA 2CDEB 3ULSA 4LCYB 1LWUC 3ALWA 3IE9A 4Z8FL 3PJSK 5T3XH 3VH8G 1OW8A 2WGNB 1S5HB 3FO2B 4HOWA 3FRPA 2XTSA 3U6RB 2G3XA 3Q5YA 5FXCH 4ZTPL 2IZ1A 1I9RL 2WD0A 4F91B 1R46A 4FDWA 3RE0A 1MFNA 1G1IA 1JYWA 3DIFB 2AQTA 4JY4A 5DGQA 5IMOA 4Z7VA 1G9MH 5T1MA 1TQWA 3P0VL 4EO5A 5J11C 4RDBA 5GGQL 5E9DE 5FOBB 1S7VA 2ZKHH 3BP6A 4W70A 3CCQP 3KYAA 2FZ3A 3HE4A 3TIDA 2XG5B 3H56A 3A4EA 2VO8A 2VW4A 3QNXA 4DPCX 5FUZL 2YD0A 5IROC 4PHXA 2JMRA 2ZWLT 5GHWH 2DW5A 4IOIA 3U4EA 1JNLL 4JK0D 2DQEH 4PJXA 2GFBA 1VADB 1P84I 2ZWKA 3N0PB 2AQ2A 4LVOB 2CHDA 5DZVA 5IBLC 1LNUA 1Y6MR 1CSBA 1KCBA 3P11L 1E40A 1EEZB 4AGQA 3QHFL 1LO2H 4FTDA 5C0CD 3DRQB 1CD1A 3MV7A 2B4CH 3A6BH 5DU7A 5C0CB 5IFAH 1EA9C 3IJ8A 1FJPA 1RF0C 5KOVC 3S8GB 4LLYB 1BREA 1T7VA 2GK0A 1DJIA 1RY3A 1E4XI 3LQAC 4NCDA 4HOXA 1T1XB 1JZFA 1TYRA 5I16A 3NFQA 2B7DT 4HJ0C 3RPIB 4U7SA 1LP9E 2OSLA 2G5RA 2XXCB 2AV7B 4HXAH 5M94B 1BOGA 5CIPA 1N68A 5F7YC 1QUNA 5KLVD 3WCYA 2YEZB 1WQVT 2HVKA 3G04A 5JQHC 3R18A 5AW3B 2DLFH 2BIOA 3QIUA 4U1IB 3S5LA 5F3BA 1MZ9A 1RHZB 3VM7A 1MNUH 1JGEB 1KTCA 2VN5A 1OW6A 1KN2H 1SFCB 2V3EA 3L74E 4GAFB 1YEIL 5ESVB 2MTAA 2P58A 4PGCB 3RVWD 3T0ED 5CEZL 3IJHB 5JPMC 3VAEA 3S37H 3CDZA 4X8GA 2YIUC 3R4DA 4QUOA 1BLNB 1JHLL 4ZSOE 4UAOB 5CZXC 4ELDA 2YPLE 5EIQA 5KLVG 1F3JA 3AUWB 5HPMA 4RGND 1RPKA 2D2OA 4AEIH 5HY9B 1OAUL 4HMEA 4KROD 3RTQD 1KCSL 3CCHB 4ZTOL 4X7EC 3RTQB 1CI5A 1NSNH 1MAML 2DIJA 2XTJC 3GLAA 4LPYA 4P59L 2Q6WB 2WVVB 2XHNA 1R5IA 2NUPA 25C8L 1MFZA 1CF8H 4K9EC 3L75D 5F1OB 2KDGA 3GMRA 1NTKK 5DD0H 4HC1L 1RHHA 5I9QC 4QNPE 3C5ZA 2E75D 1NTKE 3DX8B 3O8XC 1JVKA 2E75B 2KI6A 2V7QH 2D7QA 1W0WB 2EYRA 2X5PA 3HPJA 2Y36L 2EVHA 3MBEA 4NUMA 1B0RB 3L3GA 4HJ1A 4YHLH 5DO8A 4FQCH 4MXVE 4R4FH 4JRYE 3CNKA 3WN5C 2RBLA 1MEXH 2FTAA 1XGQA 1WFMA 2BNRA 1ETZA 4DKEL 5L88L 2B08A 3KPNB 4P2QE 3DV6B 3PXLA 3DX2A 3KYNB 2XIBA 5DVMA 5CCGE 2ATPB 4KFMA 3L75G 3QXVA 4NUGL 2X4RB 4XCFL 5I66B 4L3AA 1C5BL 5FIEA 2HJFA 4EE2A 5GTHH 1QEWA 3RU8L 4DGUA 1D2OA 4HSAC 2Y4SA 1IM3A 3T4AA 2X4PB 4A04A 3L70E 1WZAA 3BP4B 4G9FD 1ZTXE 4G9FB 4HEPA 5DC4B 3I9IA 3RWIB 4L5FL 5BOJA 4E5XA 2Y72A 2WSCH 5EF1A 4JZJC 2WO2B 1WD9A 3LRSB 4HAFA 3WJLC 4LVNC 1RURL 1A9VA 4PLJD 2XQYG 1HHKB 1SY6H 1A4AA 1I31A 4QEGA 4UIMB 5KOMC 1FCGA 3UIAA 3LB6D 1H3WM 3D06A 3TYFA 3KPRE 1IIIA 2CM5A 1XTGB 4QRRE 4ZOEA 4M7LH 3GPSA 2LU7A 3T6XA 3HS9A 3WFBL 3RIAF 3X3FL 3V4VA 5G55A 2C9AA 1FH2A 3MUDA 4PP1D 4JLRB 1Z9MA 4FQLH 1W8EA 4R5TA 3C09C 3O6FD 4OQTL 5CBEB 2KLSA 3JYCA 2KSEA 3O6FB 4G43B 4NQCE 2I1JA 4PJ0H 4I7ZB 3FO0H 4P06A 1AHKA 4Z7AA 5FCUH 2QVMA 3CCVP 2Y06H 3PWNB 3U48A 2GITB 1CWVA 3V52H 4EN2A 4JFFD 5I8EB 1JRHI 1EXGA 1U8NA 2H7HA 2E27L 2XPYA 2RCSH 4JFFB 3MNMA 4NUQA 5I1LB 1S5LE 4N90D 1SYSA 3H9SD 4ZMDA 2DYPD 3H9SB 4NGHH 3OHXA 3QUYC 2CSPA 2DYPB 4Y5XC 5DURD 3FQUB 1A64A 1D6VH 1IAOB 3N1PC 5DURB 1HL8A 1KB9I 1J0JA 2YKOA 1KN4L 1XB3A 2E5YA 1FL3B 1KLUB 4MHHG 3V7MA 5JDSB 2DWEB 5L2JA 4G6FD 4EIZC 2X2YA 5B8CA 2BRRL 5ESQA 2QLVB 1NCGA 4YZWA 3TJHC 5MEPA 3FUEA 2GSIB 3MV9A 3JVFC 3NJKA 1EUTA 1MFUA 2JWYA 4ZDHB 1NTZD 4B7IA 3TXAA 3LEVH 5GGTH 3X12B 1FZCC 4FS0A 2JQMA 1E5ZA 1RJYA 4XNQA 4OFIA 1Q1JH 2WQAA 5KYUA 4BFKA 3LN4B 5EEXA 2H26A 5T5FL 4AQRD 2OYHB 3GI9H 4RZKA 4BELD 3OR7B 5G2NA 1SBSH 2C9RA 3AB0B 1B3JA 2P24A 4PJ5A 4PBXA 3N6YA 1ILSA 4L18A 4GIPD 2VJ8A 5DJZB 4MMYB 3X1BA 5CHXA 3SFDC 2Y7OA 3WJJC 4BSWB 1HESA 1RFDL 2D3VA 3CCEP 2X3BA 4UM9D 4WENB 2J56A 4UM9B 3MZWB 4D0DA 4Y99B 4Z7WB 3NCYS 1D9KA 1NTZG 3T3PE 1KG0A 1HCZA 1ZSHA 3CQQA 3DC0A 3V6BR 4Y4HC 1KBKA 4WDIA 3T3ME 4ZPTA 1T0NA 1X9UA 5J9PA 1JY3O 1FC2D 3B2MA 5AYQA 3K8LA 4MLSA 1X6NA 3QIWA 3QQ3B 3CFEB 1IC5L 3BKCH 1ZSDA 4QRSB 4UDTB 5AYUL 1JNNH 3GG2A 4F1SA 1TITA 1CMOA 2J8HA 1SQXK 4QWWC 3EGXA 1OTTC 4HWEL 4ZD3H 1I1RA 4PJ9A 3AT0A 3V5DB 2ICWB 4PRIE 1EDLA 5DT1H 1SQXE 3D4CA 4LIQL 4ADIA 5LAXB 1RK0A 4LP5A 4XHQA 3UTQB 4K5NA 4KH2A 3K5BA 4P2AA 2J58A 1XMWA 1WWBX 3PTZA 4K5PA 4BQ8A 3FONB 1SJVA 4CSTA 2J8OA 3T04D 5KSBA 4F7TB 4NLAA 3V4PB 2OL3A 4YDJB 1RZKC 3IDUA 1E6JH 3OKKB 3FAWA 2V7HB 3RZCC 4BZ1A 1LDPH 3JV0A 3RWCB 1JZ7A 5IM7B 2ZXAA 1T20B 3DETC 4PJHE 1AR1D 3Q6GL 3QEGH 5ABDE 4HUVA 1LWRA 4JCMA 2IAMD 5MERB 1YY8B 2FEEI 3EZ8A 1AR1B 1GGCH 2DM7A 1TNNA 2ESVA 3EJRA 5BOZG 1YYLH 2NR6C 2LOEA 1OLLA 1RZFL 1RUMH 3CWGA 4J28A 4JQVC 3BX7C 4M7ZC 4PGZA 5F7DA 1E8ZA 3RGVA 2D0FA 4ZNCD 3H7BA 4H8QA 12E8H 1EJ6A 5BV7L 2ZYIA 1IBGL 3BDBA 5BVPL 2QADC 4BHUI 3WFCL 5ID1A 2WYHA 3BAYA 1X5MA 2OGUA 3QQDB 3VQLA 2P10A 1MPAL 1S7RA 4L8SC 2YUXA 3CDFA 3FQRA 1RU9H 4MSWB 4YDKH 4LSTH 5MEOA 4HPYL 1OM9A 2OMTB 5E6ZA 4R4BA 4V1DE 4LRIC 3VFSB 2ZX9A 3CCRP 1FLRH 1H8NA 1KIPB 4L1BA 2AJSL 1CFNA 1T1YB 3QK0A 2APXA 2IBZE 2OMXA 3QJTB 3FTUA 4Z5RB 5AVSB 2OK0H 4MDIB 4GQRA 3KPQB 3BH8B 3IDNB 1SVBA 3GT6A 1H6EA 5KYXA 4U33A 3ESPA 4WFHD 1IE4A 3WLWC 2R23B 1BVKB 4C4KT 2LQRA 1S9VB 1EMTL 3SE4C 1TJGL 2R69H 3B3BA 4X8JA 4YWGH 1FZOB 3Q48A 1TF4A 3T2OA 1RPUA 4YAQA 5CCGC 1VENA 3V9EA 4L4TD 2LHAA 2F0CA 4L4TB 5JHLA 4K9EH 4F7KA 1TR7A 1M1KQ 3NA9L 5AFAA 2R0ZH 1YJ9P 1MKMA 2MKWA 3B5HA 1PZUB 4MXWH 5BZZA 1TEYA 3LXCA 3FO9B 3UAFA 4M9PA 3ZE0B 2XKNB 4RO0A 1X5LA 2YD9A 3F7QA 1TVHA 5IBTL 2IDBA 2A6IA 5DWPA 5IMKA 2HTKD 2BS8A 3UEZA 2JO1A 2OYIC 2A6JA 2KQMA 3EYUL 2CKNA 4N0UE 2JB5L 4M6OL 4YE0A 2HG5D 4I0PA 2HG5B 4ZW6A 2V2TB 4RVBA 5CR1A 1MSPA 5F7FA 1Q90A 5D7JC 1EUUA 4P4KC 3TYGL 1FVCA 3H1JD 2PP6A 5JYMA 4PJIE 2R9HD 4JVUA 3S8WA 3MREB 1VAHA 4I3SL 4A7SA 1G9EA 3AEFC 4PVNA 1SUJA 4X6FB 5MEQA 3QGVA 4FQ1L 4TSCH 5EBLA 5CEXB 4AQ1B 5SV3A 5HPOA 2ZXEB 3QZBA 2EDRA 2FEDC 4RFEB 2XVGA 1MCFA 5B39G 3S4SB 3X13A 1FIGH 5EN2A 3OQRA 5D1QE 2EEDA 5I1IH 3FF8A 2WPRA 3TK1A 5JZ7D 4LSRL 2XU9A 2CJTA 5JPNB 5HDQL 3H1JG 4PRBA 1YN6B 4KMQA 1BV8A 4HCRL 1S9XA 5FFLA 4MZRA 3IBEA 3HI1B 5DYFA 5I17B 2NNAB 4KV5F 1WHPA 3N42B 1AVAA 4YSAA 4LKCA 4E0RB 4OGQD 1PG7W 1U8QA 4OGQB 3C5JB 5I74B 5JHDE 3S4SG 4OJDH 1C8QA 1FVDB 1Q72L 2FO8A 4PBWD 3F3HA 3QR1A 3ZR6A 1R33A 3I3DA 5E8EA 4ZMAT 1TKWA 3N41F 4IEFA 2HUHA 4MWFA 1BPVA 4M5ZH 1DN0B 2FWOB 4X9IA 4NC1E 2APWA 4A7UA 1I1AC 4QRTA 4C59B 4HOZA 4OJFL 4DUVA 4R97C 4NO2A 3RIKA 5EEWA 5J3HC 4ZMPA 2Q10A 2KXPB 5IW6B 2N7SA 2AJYL 5FHAH 3FUIA 3GI8L 5I1GL 3CSTA 2EUVA 5E95B 5LO7A 3CPUA 4OU3A 1UXWA 3DX3A 4IIQA 1MJUH 3GXMA 2ZX6A 4NO5B 1KY6A 4PJDE 4YDIH 3LAFA 2Q86B 2XFGB 4BH8A 1UH2A 1UJ3B 2JJLA 1CXKA 3SGJC 2ZYRA 5A3ID 2AF2A 3JYBA 3ME0A 2DKSA 3C87A 3ROLA 4CMHC 4Y7OC 2A9NH 1CDHA 3SBPA 1ROCA 3L3KB 3WELA 2GJ6A 4NQUA 4WHTA 1LO5B 3KPSA 1USQA 1IGTA 3TNUA 4L9LA 1G7MA 3PIQB 2ZFCA 2YARA 5HBBA 2YHGA 2WAQA 1ET7A 4KNSA 1CTOA 2XYBA 3WUWA 1CDJA 3L1EA 4ZPVA 2IQAA 2MPVA 1J1OH 1KXVA 1MJ7H 3ELAT 2CCLA 4RMQA 2ITAA 2WSEH 1OE3A 1RK1A 4BUGA 1XR8A 3ZDYF 1NCCL 5BVZA 1ANUA 3DGGB 5BO0D 4MA8L 4XCCL 2XZZA 2OW7A 3M86A 3NT0A 3ARBD 3MV8E 1OGAD 4GG8B 4C4BA 2PXYA 3ARBB 1OGAB 4MD0A 1JEKA 2Y1VA 1ZGLP 3EJCA 4XP5H 3RIFF 3CFUA 4O02A 1EBAA 4U3FJ 1BQHA 1U58A 4UILL 1HHHB 2X6VA 4DK3A 2QMJA 3D25A 1HSAA 3T6WA 1JNMA 3K6SB 3QIBD 3P8CE 2QGEA 4XA4A 1XAUA 3ZE2B 2X4TA 3N1QC 4A37A 1L0QA 2IMNA 1MG2C 4NUJA 5AOZA 5A2JH 3NEOA 4U31A 3HLAA 3RVUC 3QUXA 3CSGA 4FKEA 2DTMH 3G6AA 1H19A 4D8PA 1HXYA 1CDCA 2PO6D 5I6PA 3U6XS 3Q5TA 3UPCA 5IEKA 5J6HB 2KQNA 2PO6B 1PG7H 2ZT9C 2VLRB 4LLWA 5DMJB 2CO2A 3VXTA 3O4OC 4S2SB 1CTMA 1TTUA 3LKOB 1UT9A 4AVIA 2JKNA 4A66A 5I24A 1RZKH 3MLRL 1UH3A 2CIKA 1JMBA 2W0PA 6PCYA 4PJ8A 3SHSA 4KZDL 3CVHA 1D5IH 1GGBH 2GB2A 1UT1A 3UTTE 3BVTA 2G5BB 4L29B 3K6DA 3W39B 3P77A 2EQDA 5HYJE 4GUCA 2YA1A 4ZUUB 3EQ2A 4JFYA 5D71H 4IKJA 3QFJD 3VSQA 1HL9A 3QFJB 5GRZA 2PYEA 2AITA 1T89C 3V0VA 1X4XA 5GRJL 5F7WC 4JR9H 5I0VA 3DGCR 2FJFA 4S1SH 3O0RH 5EOCH 2E7MA 3EYSL 5ISZA 3S36L 1S5IH 3BIBX 2AC0A 4DNLA 2PAJA 2VABB 3D0LB 4RIRB 3INUH 5F96L 3AM8C 1RULL 2X0VA 1LK2B 4NFCA 5EEZA 4GW4A 4WO4C 1FORH 1QBML 3V10A 4S1RH 4Y2DA 5BQDA 2WZ5A 2ZQKA 3HMXL 4LF3A 1S4XA 3QFDB 1N8OE 4H1LB 4TS6A 4XB8A 1CXLA 4OCWH 4N24A 4AQOA 5AZ2H 3DBSA 5KS9B 3UADA 2AEPH 3EO0B 5I1CH 1QL1A 2OMBA 4WUKH 2VZ1A 4DZBA 2H0EA 2QZ5A 3QXUA 3S3JA 2W94A 2KIKA 5DA0B 3TSIA 1CICB 1GK4A 2GUSA 1P6FA 2IWKA 3D30A 3PFQA 3L36A 3SPJA 2DL2A 1KIUA 2X44D 5DJ0B 3KW8A 3S3CB 2F8XC 2GBUA 5GS1B 5ITBL 1A6TA 4IDJL 2KSJA 2WXFA 4LQFL 3SWYA 2X6CA 2VDRB 4RGMB 4E9XA 2B2XH 4PJCA 2ZYDA 1LQBC 4AYSA 2Y1YA 3LV3A 2J88H 2VXQL 4H1LG 4XPFL 2X05A 4BFGA 1NYHA 3DIVA 3SDCC 4TUOB 4E41A 1UM4H 4U7MA 5HGAA 3ZTCC 3M45A 4P46D 4PS4H 1JXGA 1ZTXH 4NCC2 4NQDA 4P46B 1BBJA 5IHZB 5H37A 1P9MC 1GZPB 3KLAB 1PSKL 4ZAKD 4LEXH 3BXNA 1VDFA 2BMKB 4ZAKB 1YAIA 3VI4F 3EHBC 3HE7C 1YIJP 4GT0A 3T2NL 4X99A 3HS0C 5DLML 3DYMA 1P7BA 3EOBB 3NIGB 2J1YA 5CBNA 3GINA 3LEYH 4BK5A 1WCBB 3ARWA 3PWJB 4HKBB 2QBWA 3SDAD 1HDMB 1TJIH 2JCCF 3SDAB 2BNUA 2ITCB 4DKFH 3CD6P 4DW2H 3SBQA 3S37X 5FYLD 4AUYA 3IMBA 2A4EA 2ARJQ 4HUNB 4HF5L 4PTUA 5C2BL 1E9PA 5GGRB 3CG8A 4OZ4B 5L0QC 3E3QE 4GT7A 2Y0CA 3BFOA 3MOAL 2NXYB 2B1OA 4G8IA 1IU1A 1XH2A 3GPEA 4TQPA 1G6RA 3ABMB 3EO1B 4OT1L 4LLDA 3WEOA 4F8OA 4BGDA 5H94B 3O4LA 4Z8FH 4NC1C 4ZUTB 4HFUL 3M9QA 3SDYL 4RDQG 4FQHA 3CHQA 5JOFA 2DB8A 5AOLA 2FBWC 4RESB 5E8NA 3TEWA 4PP2A 4ZTPH 1I9RH 2UWEE 1K2DA 4OFDA 1KLFA 1JGIA 1BECA 5SX5K 3VFPA 5C7ZA 4N68A 1IFHL 3P0VH 1YCSA 3R06A 5DDHB 3MRIA 3VD7A 5GGQH 1MDAA 4WUUE 4EI6B 4Z7OE 4RKUJ 4ZS7L 3S0PA 3SYQA 4YSRA 1J2JB 3DBXA 5FC9A 4LC1A 3KHOA 1IAKA 4JY5L 5CSBA 5FUZH 1BQKA 5JA9A 3DX6A 3DDFA 2VQUA 5EU6D 1JNLH 4Y5VB 5EU6B 3NJVA 5FO8A 3QZWB 1S46A 3KPEA 5FYJE 5I1KL 1LM8V 2B0SL 1BD2D 3P11H 4GOFA 3QHFH 1BD2B 4Y19D 3SCMD 5CSZB 1BF8A 4MAZA 4Y19B 2IDFA 3IKCA 4I8DA 1NDGA 5CJOL 4K71C 1T83A 4Z1MH 1YQ3C 3JSVC 3RDTC 1VZGA 2BVYA 5GGVL 2BWIA 3QO1B 4LAQH 4GY4A 4IRJD 2ED6A 5HGBB 1OKEA 1JZJA 1Y7VA 4FI7A 4PWJA 3A6CL 1NICA 5F88B 3EOTL 5F9WB 3G08A 1QZ1A 4HFWB 3MJGX 1N73C 5B1BB 1HS6A 3LKPA 3MUGB 4A63A 3VTPC 2OSYA 3TZVD 1PD0A 2KS0A 1X5XA 4BSVA 4ELME 3QZWG 5TQ0L 1RUPL 4JMNA 1IAIL 4JHAL 1XB6A 5GS0D 1JNJA 4QAMB 1HILB 2WOYA 4PRHA 4ZO8A 5E6ID 2QKIC 5E6IB 3NQKA 1N70A 1YEIH 1XX9C 4MD4B 1LP1B 3AREB 4OAWB 3HBQA 3QRFM 2ODHA 3NQIA 5CEZH 4RAUB 5B66E 3Q1EA 3SIKA 3N04A 2VQTA 2QVAA 1JZHA 2WHVA 1JHLH 1G7JA 4FYQA 3OR6B 2FIKA 4U6HA 3VFWA 3KXFD 1CK0H 1JVLA 1NKRA 3KXFB 1CJYA 1HT6A 4U0RB 5D7IB 3DXAE 1KIRB 1BCCD 4YTPC 3P1VA 1OAUH 4P5TA 1F56A 3GJEB 5FDWB 5FGRA 4JPIA 1KCSH 1QWHA 2J8UA 2DQDL 2NZ1A 2R2BA 2X9XA 4IJTA 5CJQL 1MVFA 5M95B 3VXUA 1MAMH 2B87B 3SPCA 4P59H 4RISH 4FFYL 3RP1A 2YLKA 3ARDD 5ABAA 25C8H 2KZWA 3ARDB 3D69A 3ULSB 3FT0A 4I3RH 4RAVA 4AV5A 5J5EA 2D03H 2IYOA 1DDHA 4HC1H 5ECGA 4FA8A 1CD8A 4JKKA 3FRPB 4FQ2L 4UQIM 2MCMA 3MCYA 3VI3F 3QB7C 3MR9A 2IWFA 3PAYA 3RFZA 1O9WA 4GP5B 4QY8A 5ADPL 4OCMC 5BUGA 4Z7VB 4DAGL 1BCCG 3ARGA 3F7PC 4JY4B 1KV4A 2HLAA 2VLKE 4FTVA 5T1MB 4Q97A 3FQWA 1IB5A 1OVRA 1S7VB 3BP6B 1WRFA 1C8PA 2FZ3B 3HE4B 3TIDB 4CN1A 1P7QA 3RNQA 4M1GL 4DKEH 5L88H 2VLMD 1QGKB 3L6FA 3QNXB 4PJEA 4Y9BA 5AAMA 1ZT4A 3L16A 1ZV8A 1QASA 4FG0A 4NUGH 5FKAA 5HJDA 3NVQA 5C0NC 2ENSA 4IOIB 1C5BH 3U4EB 1E27A 1OQOA 1KLGA 4PJXB 2GFBB 3RU8H 3FRPG 4U1JA 3ZN6A 5CCHA 1LNUB 2ZKWA 3DJZA 1QFUL 2GK2A 3QUGA 1VQ8P 5IBUB 4CGUB 5IB4A 4XO4A 3MV7D 2Z1PA 1CD1B 1ET8A 1MRFL 2CE6A 3MV7B 4L5FH 3L5JA 2VZ3A 5GGSB 3BAKA 5I1DA 1OAZL 2GJJA 1U9KA 2GHZA 2MKLC 2AGJH 3FUNA 3MGAA 3ML9A 5I8OL 2GK0B 5EDSA 3WEXA 4E41D 5I16B 3P2BA 3R0MA 2B5IB 1NGWA 2FXOA 2EC9U 2OSLB 3NPZB 4MJ2A 5FV1L 1BOGB 5CIPB 1QUNB 4DGYL 3G04B 2HVKB 3TPKA 3QIUD 5EO0A 3WFBH 2XA8L 2IANE 3QIUB 3X3FH 2PTUA 3S5LB 3V6ZA 5F3BB 2A45H 2X40A 2WCGA 1XD0A 4YHKH 2EVFA 4GIFA 4KO9A 4OQTH 2EP6A 4GI8A 1J1EB 1U8LA 1S3JA 4DP7X 3UZEA 4M3HA 3CZUB 1UUNA 2D2CD 3K8MA 1TQUA 3TF5A 1EXHA 2D2CB 4QHUA 1BOYA 1MQ8A 2E27H 1KYFA 1X79B 1Z5LB 4ONOA 1J0IA 5APQA 3GZQA 5DLLA 4GXUN 1F3JB 2HCZX 1D5ZA 5HPMB 2KK7A 4TV3A 4CBPA 2A9CA 1DBAL 3S5LG 1NJ9A 4OJAA 4AL8L 1CIUA 4YX2L 1T0PB 3CZJA 2BERA 5GGUA 1KN4H 2QV2A 3D39E 2D31A 1R5IB 4HP5A 2VUKA 3NA4A 4HH9A 2NUPB 4KHTL 1OZHA 2HUEA 4G6KL 2XV6B 3GMRB 1LP9F 3CCUP 3LCYA 2BRRH 3F64A 1DDTA 1J48A 1RHHB 4E9TA 4HWBA 4U6VL 5C0DA 3MJ8A 3CGTA 3C5ZB 3NJHA 4OLWL 2JI3A 1TEGA 3INOA 4KKAC 4H0LD 2EYRB 3HPJB 3MBED 3NGBB 3MBEB 1MQKH 3ARUA 3E1ZA 3TO4A 3L3GB 2OTUA 2FYUD 1C7SA 3POHA 4C56A 1QSVA 1GTFA 1BG9A 2BNRD 1N4XL 1XGQB 4FD0A 4ZMOA 2BNRB 3HZMA 2N9BA 1ETZB 5T5FH 2AXWA 3I9GL 3QNZA 4K3JL 5I6KA 5I75C 4XMLH 2IVFC 2D9QB 1F6LL 2HJFB 1A14L 1RFDH 4JFHE 3EDDA 4FULA 3V4PL 1IM3D 2BINA 3GK8L 5LGJA 2X41A 3MDJA 3T4AB 1IM3B 4YSEA 4PWKA 5IHBA 1ZLEA 1EVUA 2E9GA 2DZEA 3C6SA 2IBZI 2ZX7A 3F84A 2I32A 4ENZA 2FYUG 2MQ0A 3AITA 2CM6A 4GS7C 4NN6B 5DQDL 1AKJA 3QWNA 4E5XB 3ULVD 5BUPA 1CLYL 3B6SA 1R47A 1QR1A 1B4TA 2WLHA 2P49B 1NCAH 2YGNA 1AJ7L 1J9RA 2WNKA 3TOPA 1IC5H 1EAJA 3Q1MA 5AYUH 2BSEA 3BRGC 2ZUYA 3SKNA 1PIXA 2SPZA 5HYIA 3TYFB 2YD3A 4HWEH 2J43A 4X9YA 1U6AL 2VDNH 5HDBB 2XOTA 1SZNA 4PRPD 2JJTA 3U4AA 3G6EP 3CH8A 4KX8A 2B15A 2OP4L 4FQIL 5I0YA 3C75A 2K9JA 1OWAA 3V4VB 1MW1A 2A45I 3S5ZA 2QGCA 2NPLX 5TGBA 3GIZL 3UH8A 4E5XG 3V0HA 3UMTA 3U46A 1T2JA 1GYAA 5HVFB 1FZFA 1AGCA 4KRNA 3Q5OA 3K1DA 5KAQF 3FX0A 3U1AA 1FZKA 1KTLA 2YEVB 4KPHL 3DMMD 3ZHNA 1U8NB 2C9VA 3Q6GH 4AMXA 1N12A 1XMEB 5ICUA 4XO8A 5LNDA 4EI5C 2F8OA 1WP6A 2ZJSL 1SYSB 2DQJL 2BEZF 1RZFH 3OHXB 2IFFH 2Y0EA 1CZ8L 1E0OB 1EJOL 1QW9A 2BSDA 4RX4A 3RL0D 4K3DL 4F3FA 5BV7H 2JKJA 3I6LE 5IOPA 2C9PA 2UZYA 5BVPH 1Q9OA 5J13B 2AABH 1MUUA 3QJHA 2FO4A 1EHXA 2IWGA 1NEZG 3WFDL 3BISA 1JV5A 2KBGA 3EOYG 2ICEC 4EZJA 5L2JB 4Q9RL 1A6AA 3ZTDC 5B8CB 1JWUA 1MPAH 1ZA6A 1MIML 2BS71 4XNZC 5J12C 5ESQB 4HPYH 4F80A 3KVPA 1FG2A 3WDHA 3EBIA 3HFMH 3MV9D 5MEPB 3II1A 2AJSH 3MV9B 3RWDA 2XJKA 4IOFD 1A1NA 3B9KD 4J3BA 4QLWA 1QX8A 2J5LB 1KYOK 2D7MA 3DOIA 3QHZL 1RJYB 4L23A 4XNQB 3TEUA 3DHUA 3T08A 5KYUB 4RFOL 3Q2YA 1KYOE 2H26B 1AI1H 1EMTH 1QHOA 1TJGH 2NZIA 1AKPA 4S0TD 4AYDC 3L71J 3CVIL 2FX7H 4PJ5D 5DJ8A 3IBOA 2P24B 2Y24A 3UJIL 2PWDA 4PJ5B 1SQVD 3ZYOA 3VXOA 1B6UA 3MFFA 1YYCA 4N2IA 4A2MA 3NA9H 4RRPA 3VXNA 2HAZA 4F7EA 1LNQA 3KL5A 1Y6NR 4F15B 5DHDA 4H8WL 1JG9A 4D0DB 2OJEA 1D9KB 4L0PB 1QRNE 1KG0B 1FDIA 5IBTH 4Y8DC 4CJ0A 4I1NB 5KW9L 43CAA 3N06B 4KHXA 5F21B 4WDIB 1NWOA 2R1YA 3H42L 1T0NB 4ZPTB 2DS4A 3VG0L 4JZNA 3MRNA 4P4RA 3VD9A 3QIWD 3EYUH 2ZUXA 3N85L 3QIWB 2JB5H 4M6OH 1ZSDB 2AFNA 5GSRA 4WJKB 4JG9A 3HFFA 4OVUA 2ZUUA 1YEWA 4PJ9D 1ND0A 3TYGH 1SF3A 3EGXB 1SQVG 1E50A 1YEGL 2VWEC 4PJ9B 1FO0A 3RWJA 1M3IA 1D7FA 2X1WL 1E79H 3CPWO 3CFQA 1RK0B 4WW2C 4PYGA 3WNPA 3H1LE 4FQ1H 2ZNXA 1U33A 3IDGA 4XP9L 1AOHA 3VDBA 4WUUD 1Z9NA 1ILUA 4Z7WE 5KSBB 4DPRA 2ZICA 2OL3B 3TBTA 3SO5A 1T2KD 2YAMA 2FLBT 4TL4A 2P26A 5I8CA 2WZAA 3APMA 4X7DC 3UOAB 4MQXD 3HBPA 1WZKA 3H7LA 4XXWC 3ZVVA 4HUVB 2WQUA 4LSRH 4QXUL 1E7VA 2ESVD 2APBA 5HDQH 5IR1A 2ESVB 2YK1L 1TVDA 3T3PF 4HSCX 3NXSA 5F7DB 1N7SA 1H8SA 2OLDA 3RGVB 4ADGA 1JAEA 3T3MF 3SD5A 3H7BB 3BCCD 1NGMB 1GAFL 4WCYL 5ID1B 3QWRA 5FYKD 5FAAA 2CJSA 1N8RQ 1F41A 3G5XA 3E9TA 1BIIA 1RF1A 1S7RB 2WQRA 3FQRB 5B3NA 3C6LA 1TFHA 4M1CD 5C07E 5MEOB 3BRTB 2OI9C 2X4NA 4R4BB 2P5EA 2NW2A 1OAYL 1SFCC 1PG7X 3NCJL 2VM4A 3QDJE 2WXJA 3VDAA 3CC4P 1CFNB 2OMXB 3RG1C 4OJFH 2RQ8A 3T6ZA 4AGLA 2F8VA 4MAUH 3FTXA 5FO7A 4ZW8A 2NTSP 3JV5A 5D1XA 4UAOC 3VA2C 5BW7A 5KYXB 3GI8H 5I1GH 1JCCA 3BCCG 4Y88A 5J6GA 2X1QA 3B2VL 4H2AA 1U3ZA 3VD5A 5GJSH 4K07A 4YPJA 4UB0L 3US0A 2H9GA 4PJHF 2YR3A 4X8JB 4AEFA 3W9DA 4P23A 4YAQB 4UOZA 1XGZA 4ZUSA 1KGUA 2IH9A 3IDJB 6FABL 1LT1A 3GLMA 3OL2A 1EEUA 5F72S 5BJTA 4HB1A 2Z7UA 1JB0J 4L4JA 4JQIL 5AB1A 3N91A 1FFTB 1IGYA 1QTYT 1TVHB 2YGOA 5CCJA 2A6IB 3EW3B 5IMKB 3VD1A 1ZRTE 2E75C 1U8HA 5AEAA 1TYJA 2A6JB 2EEXA 3KJ6L 4XZUA 1OGPA 4I0PD 4QRBA 4RETB 1Q0YL 4I0PB 1Q90D 1NCCH 1AP2A 3LKQA 4K5LA 3U7AA 2GBAA 4XCCH 2NZ9D 5SX5H 1FVCB 2BLFA 4X9BA