4RESB

Crystal structure of the na,k-atpase e2p-bufalin complex with bound potassium
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
288
structure length
288
Chain Sequence
IWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRFRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures and characterization of digoxin- and bufalin-bound Na+,K+-ATPase compared with the ouabain-bound complex.
pubmed doi rcsb
molecule tags Membrane protein, hydrolase/inhibitor
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
total genus 50
structure length 288
sequence length 288
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4resB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 4resB02
2P67A 1CI6A 3KQGA 2E42A 1OXZA 2C9LY 1HBWA 1A02J 2C9NY 2WPRA 1G2CB 1HUCA 3HE5A 2Q5UA 3HE5B 5AVVB 4DZOA 5AW2B 1GK4A 3VYIA 5AW6B 4C7NB 3KDPB 1CZQA 1IO4A 1T2KD 3VMZA 4RETB 3NXSA 2YO3A 3MGNA 1GK6A 1MUUA 2Z5HA 1YYCA 2WT7A 4EOTA 1GTWA 2Q3IA 1S9KD 1FOSE 3V4QA 3P32A 1SP4A 4LC1A 3LIEA 5AW9B 5APUA 3TNUA 1H89A 2WT7B 1KQLA 3B8EB 1FOSF 5APYA 2WPQA 4AYCA 1S9KE 2YNYA 1H88A 2P7JA 4C46A 3L35A 2WTYA 3VMYA 2VRSA 4RESB 1JUNA 3A3YB 3HE4B 3NTNA 3TYYA 4B86A 3VN0A 5AVUB 1OWAA 2KP8A 3I5CA 5AW3B 2E43A 3M91A 5AW1B 1FAVA 2Q7CA 3O8ZA 2XU6A 4KHXA 1HWTC 5AW0B 5AVQB 5AVWB 4AQRD 1JNMA 3NMDA 5AVXB 5AVSB 3A7OA 3HE4A 3HTKA 3M9HA 5CMZA 3M06A 1CSBA 3MD0A 5APTA 4GT1A 5AW4B 2W27A 1GU5A 3SWFA 2R5DA 3OAKA 2H7HA 2P2UA 1J2JB 2Z5IA 5AVRB 2WWWA 4AUWA 2BASA 1HJBA 2W6AA 3TNUB 2R32A 5AW7B 3M0DA 5AVTB 1GD2E 1CI6B 4GKGA 3VMXA 2N9BA 4XE5B 2ZXEB 3L36A 5APQA 4M3LA 2R5BA 2QM7A 5AW5B 2YO2A 2QM8A 2R3CA 3L37A 4JYCA 1H8AA 3WGUB 4JYBA 4C7NA 3A5TA 2ZFCA 3NFQA 5AW8B 3A2AA 2XV5A 1MFZA 2WPSA 2IPPA 1X8YA 1SLQA 3P7KA 3P8MC 5AVZB 3T97A 3V4WA 3M9BA 1NWQA 5APWA 3VTPC 1MV8A 4I6MC 3UIAA 1NAFA 3M0AA 3V5BA 1T2KC 2JJLA 4HYTB 1GZLA 2XZRA 5APXA 4I2LC 5AVYB 1A02F 5APVA 1DH3A 3IR9A 5APSA 3TK1A 3LIDA 1GU4A 3WGVB
chains in the Genus database with same CATH superfamily
3C87A 2P26A 1M71A 2Z7YA 4HULB 3MODH 4ZMVA 3G5VA 4NYLB 2YAMA 3MJ9L 1IFNA 5GTIE 5BPPA 1FYHB 4AVIA 1EHLH 3JZ7A 1A6ZB 1IBHA 1YEFL 1G7PB 5JPNA 1ADQA 5B66H 1KBPA 4DO4A 1B0RB 1CZQA 1MXDA 5KLVJ 3OKEB 4G42B 4BCXA 2VN7A 4YK4C 3H1JG 1IMHC 1VQ8P 1E40A 2Q8AH 1NFIA 4FAAB 4AQAB 2UZIL 3L3OB 2VR4A 1YLBB 4NZRL 4A6YA 3D12B 3B9AA 5LHDA 3VX0A 4L5FE 4LL1A 1KIUB 3N7NA 1ES0B 2QG4A 2C0WA 4XP1L 5BZDB 2BY2A 4I88A 3K7UA 5DHYA 3I9PA 3VD2A 2DD8H 3BDYL 4PEEA 1YUHA 1GS7A 4NPYA 4PJ5E 1D9KC 4PS8A 5ERWB 3K6FA 2KK7A 1EHAA 3ML8A 4WU7B 1TQCC 1XGTB 2ZAIA 3WKPA 3HBQA 2XA8H 1TQBB 2XWJA 4HJGH 5EOQH 2EUXA 1JGIA 4U1GB 4RZCB 1WAAE 4H0LD 1B6UA 3O9WB 4PW3A 4FKKA 1UA6L 2XZAL 4L1SA 1YDPA 1AG0A 4J3OH 4NKIH 4NWTL 1Y6KR 1A22B 1IC5L 3KWVA 5IB5B 1G0XA 3L1FA 2YIHA 3EADA 2W0PA 3PE9A 1SMOA 4MJHA 3G4SP 2IIJA 4HC1A 5ESAA 5FYJD 1NCNA 1GZHA 5TPWH 1ZVYA 5LGJB 4E41D 3BO8A 1A9EA 4Z7VF 4JFQB 2OKMA 3CC1A 1M2OA 3JUYA 4LCCB 2G60L 3CVHA 3TBVA 4JREB 3CV5A 4J39A 1DVZA 2VSKB 3QI9D 3QDMB 2K1MA 3CUPB 5CZXD 2ODHA 5DXWA 4YHIB 1UXLA 3RIFK 2VUOA 4BQ8A 4AUJA 1NCAH 5ACLA 4HP5A 1MUJB 3DHPA 2J43A 4RIRA 4HV8B 4WCYL 2HFEB 3FMGL 1TLMA 3QXVA 2WSFJ 4EO5A 5EN3A 1LMIA 1H9DA 5D5MA 4UB6E 4FNQA 3SCMA 3IFPA 3BKYL 2F58L 2FGWH 3UJTL 3O9WA 1AQDB 1YNKH 3SO3C 1AI1H 5LBGA 5ILTL 3QNZB 3CX5J 2H2SD 3TEYA 1MJ8H 4N8VB 4X5XB 1EGJH 1IKFH 1ROCA 4ZMTA 4YXHL 4PRHD 3MNWB 2R23B 4NQDA 4P05A 3NTCH 3HRNA 4P23A 2OTJP 1YN6B 5E5LA 4X8XA 3TLRA 1E7UA 3MZTA 3GJEA 5FO7A 1CCZA 3EDJA 1GW0A 3AU1B 3WEBA 3RUGF 3GBML 3ZUNC 4DGVL 1BD2D 2DQMA 4HWZB 1MLCA 1A6WL 4FD0A 2NMSA 4QOKB 2I7SA 3TTSA 4NAJA 5D1ZC 4M56A 2NR6A 3WLWD 1ZGLP 3CCRP 3RGVB 4HFWA 3NUKA 4GNKB 5K9JH 3Q3DA 3GKZA 3MCYA 1L3WA 5EZIH 5AFAA 1KEGH 4JN2B 2O6FA 4PI0A 1ADQL 3D6ZA 4N2NA 2WV3A 2OMNA 2YIUC 3BXNB 2GJZB 1SYSA 1GMEA 3BO8B 3Q9PA 1GMJA 1F1AA 3L3KB 4PRDA 4YDLB 3QJHB 4UQIM 5B4MD 4CILA 4LL4A 3VI3A 4ZNEE 5CBOA 2HFFB 4JPQA 3QQ9D 3H9HA 3HZMA 1QR1A 4J2XA 1U6AL 4AENA 2BFVH 4WNSA 1WSST 1JZFA 1TQTA 3QZWA 1CLOL 4E9LA 4FFWC 4R0LC 3MRMB 5TJHA 5I75C 4ZTOL 3T4YA 3FUJA 1M7LA 3Q0HA 4N2HA 2J3SA 4NN7B 4B3EA 1P6AB 3QYNA 2VO8A 4QRPE 1MCEA 4K3HA 4I5BB 1OSEA 2V2TA 4OCYL 2E6QA 3CSGA 9PCYA 3BIKB 3PWPD 4QWWC 5D7KD 4BH8B 1LWUB 5D1XA 1X5AA 4OF8A 4CVUA 1BJMA 2XV3A 4MJ6B 4D8OA 3OKDA 2CJUL 5CCHA 4UV7L 2CSPA 4DKFL 4HKJA 2EKSA 5FFLA 4RGND 4ZQKA 1OT1A 3DWTA 3E9UA 1SQMA 4QY8B 3G5ZA 2PO6D 3FW6A 3CVHL 5DJXB 1EZVX 4WV1C 1I1CA 5E2VH 5A16B 3ZTCC 4IL6H 1JK8B 2H6UA 3CC5A 4QXUL 3I75A 1H5BA 2VWEC 4YHKH 3TA3C 4Z8FH 1OMIA 3GSQA 4UQ9A 4D8PA 5H4ZA 4RRPM 4TSCH 2JF1A 2QGEA 4RGOH 4BWNA 4QRQA 1SQVE 4XNAA 2Y22A 3VXSE 3GSRA 1O7DE 4OAWB 5FYLL 1RD6A 2K8MA 2XOTA 3QFJE 3QJSB 5I8KH 4YLBA 1A0QL 2DQCH 1IVTA 1Z9OA 4JM2F 5F71A 3T0EB 1TLKA 3RWEB 4UB8E 1UB5A 2HVKA 3S5LG 5EEZA 4N0CD 3MRDB 1U8PA 3QZOA 4OM1H 5EOCJ 4HKZH 3N4XA 5JW4M 3ROLA 1LL1A 4MSWA 3MX0B 4XOBA 3BEVB 1NTZG 3M6DA 1FFRA 1I8KB 1X5FA 3GSRB 3VXME 1ZHKA 2WN2A 2OL3B 1BE3E 4FEMA 1UKTA 5L2KD 5GGTL 4RBPH 1T0MA 4ZS7L 2WTRA 3L6FB 2P80A 4F92B 5HYFA 1N2DC 4PWIA 2X6BA 5J3HD 3K8LA 3I75B 2OX5A 4W70A 4D9RD 4ETQA 4S1SL 4UTCA 2CLZA 1PF3A 1W8NA 3PG2A 1EDKA 4EI5D 2F1BA 1HXMB 3ZDZB 4AH2A 3M17A 5LGHL 4LASL 3L5IA 3VXTB 3D50A 1JXKA 1OP5H 3MTUE 3S6CA 3ZYIA 4EDXB 4ES8A 1N67A 2HZHA 1I3RB 4D2NA 4DO5A 5I6XB 1NBZB 1VAHA 1AQKL 4HFUL 4X7CC 3DDFA 2BXYA 3AB0B 4V11A 3WXWL 1KTDA 5F0PB 4F2MB 2NY1D 2Z8RA 5EZIL 4OJCA 1KTKE 1A3RH 4RFEB 1LDSA 4Y2NA 1AC6A 3NSYA 3TJHD 5FUOH 1NGPL 2OI9B 3IDNB 4ELKA 2NYYD 1PL5A 5IVXB 3WLWC 3RVUD 3DK0A 1HZKA 3OKYA 4Y9FA 3RWEA 1KOAA 3S37L 1SYVB 1Y0LB 3FN9A 2XYCA 4Y2DD 3NCXA 4GRWB 1JNNL 1N59A 3L5XL 2Q87A 2DW3A 1J9TA 4WV1B 3L4VA 4I0KA 4M1GL 4QRTB 4PJ5A 1WCBB 4CDHA 4KJQD 5CAYB 4F57L 3CX5H 1Z9MA 4WFHD 3H9HB 3HZMB 4OQTA 4KHXA 1E4XH 4BXSV 3REWB 1VFMA 1DLHB 1LE5A 1VPOL 4A6YH 2DWXA 3CWBD 4URTB 4U33A 4HMDA 1U2HA 1WAAA 3DSNB 3KHQA 2B2XL 4DKFH 3MRCB 2EVJA 3PUCA 2VSMB 4JO2L 3RZCC 2A45H 3BAWA 3OAKA 3VRIA 2WQVA 1KLFA 1R0AL 1AH1A 2ADGA 1G9NL 2MOQA 1KMIZ 4IK6A 3CH8A 5FXCH 5F88B 1INDL 3FYIB 1WICA 4IU2B 1MLCB 1W9XA 1KLGA 3JWOL 3B2XA 5H2BB 1HEHC 5JHDE 5T3ZL 2X6AA 4HS8L 2D7TL 3AU1A 3ASNB 4FFYH 4TSCL 1LP9B 4J28A 4LCWE 4O4YH 3HUSA 1NMCC 4ZG1A 2L7EA 4RWYH 2EVFA 1R3HA 1JZHA 1W91A 5C2UB 3NEXA 4QHMB 3ZZ1A 2J7LA 1AYOA 2AF2A 2IPTL 2NTFB 4FJYA 4N9GA 4LLWB 5TE4H 6PCYA 4ZFGL 3WTWA 2Q9OA 4IRSD 3DX7B 2LOEA 1ORSB 5KG9A 4KPHL 4TM9A 2BW5A 3WXVH 1KILC 2NUTA 3KVDD 3ULUF 3C09B 2WQSA 4XGZB 4OSUL 4BQ6A 3D3VD 4N6RB 1IQWL 3DIFA 4WTQA 4PJ8A 1XGQA 5FUZL 5ICYB 3HC4H 5E9AA 2COVD 4OM1L 1HH6B 5DUBB 3BZ4A 4HIEA 2RJMA 5GGTA 3MV01 3M1BA 3MOBL 4TLUA 1NFAA 4NQDE 2X6MA 5GRJL 3WUTA 3RNKB 3RRQA 1DVXA 5CP7A 5FO9B 1UOKA 1PP9G 4XRCB 1S5HB 1W0VA 4OLYL 3BISA 5EO9B 1C1EH 5D7IB 3U83A 3R8BB 1GVIA 4P4KC 3EJSA 3OJDB 3AUVA 3LEYL 4F5CE 1LO3L 4GUOA 4NNPH 1PS3A 3JV6B 1UM6H 1OCRB 1S3KH 3BAEL 1E9PB 3OZ9H 5CCGA 4Y19D 1J1XH 1EAPB 4H13B 3VQ1C 2GUYA 3EOBA 4A7GA 4J3BA 2L91A 1MHHB 5KUKA 1D6VL 1XH3B 2Y5TB 4I2XE 4R4FH 2ZVOB 2N4IA 4ZS6D 4BFIB 1FVDA 4RZCA 4H5SA 4KNUA 2PTVA 5MEND 1F4YH 1DN0A 5C0AE 1TVDA 3TIEB 1DANT 5K9QG 2CPSA 2D9CA 3RDTC 3V5DA 3ZTNL 3G6JF 4WW2A 2BY0A 4RESB 4H1LB 3A3YB 3FUFA 3HS8A 4UT9H 1J1OH 3D7PA 4LCUA 4LCWD 2DQGL 1HNYA 1YUHB 3B9KD 4KTDL 4NPYB 5ERWA 5JOEA 4YTPC 2C3VA 3EW3B 4OQTL 2NY7L 4NUMA 5E08H 4M1GH 4FQPA 1XIWA 4WFGD 3FFCA 3QCUL 4QRPA 2DQ6A 4JZJC 2QKIC 4H8WC 3FTVA 3KG5A 1BM3L 5LQBH 2UX7A 3QUGA 4TF4A 4PY8J 3V0WH 4A2EA 4OCSL 3ZT5A 4NC0B 4I89A 4K5OA 3ZIMA 2VDMH 4NSKA 1ZLDA 1CF1A 1TZAA 2BX5A 1N86A 4I3RL 4XOCA 5CCHE 2UZXA 2X1WL 1OWWA 1BYOA 3LNEA 1A65A 1JPSH 1JV5B 4JFDD 4AK2A 3WD5H 1A7NH 2XN0A 4CN1A 1P4LA 1M1JA 5DS1A 2WB1A 4YC2B 4PJ7E 1KXTB 3HR6A 2H88C 1RHFA 3CDYA 2APFA 5C0BE 2IFMA 1UD8A 2ZKYA 4D9LH 1AO7B 3B5HA 5BO1H 5K9KA 4V2BA 1A9BA 2MQCA 3OVUB 5K33A 4CC4C 3A0OA 5D70H 2V2WA 1DR9A 4HJUA 1CD1A 1H15A 4Y4FA 4YHNB 2X3CA 5GGRB 2QVFB 4HSAC 3RY6C 1QLRB 1OALA 3OV6A 3IMVA 4HS8H 3VXSA 4N3YB 5IMOB 1KTRL 3ZZSA 3O0RH 3QFJA 4NOBA 1NFKA 3MREB 4I2LC 1E3ZA 1H8NA 1QRNE 4LSSH 1FNEB 5ESQB 1A4BA 2P7TA 2MIZA 3HG4A 3EFFK 3G6JA 3BQVA 2NYYC 3KD4A 1ZANL 4QO1B 1OW6A 3GXPA 4HX1B 2LV4A 1U21A 1TR7A 4PRIE 3QXWA 3HPJA 4A7TA 4UNVA 1LEKA 2IAMA 1NKGA 4Z3FA 4ZSOA 1XXFC 2XKNB 4P04A 3RFZC 3TXAA 2H32A 5GRYA 4EIJA 1Z5YD 5I1HH 2OXGA 1NSNL 2XPGB 4G2AA 3PIQA 5FECA 1MUUA 1V5JA 4KUCF 4OJDH 4U1GC 3IT8D 4ODSH 2YPLA 1U8NA 2ZJSH 4AK1A 2DMGA 2D7MA 4EOWH 4QHKJ 2J1KA 1N6QL 4OWFA 1EEYB 2MNUA 4PGBA 1N7SD 4RGNB 2AEOA 3AY2A 2FJFA 5H2FH 2VDOL 3OKMB 3G9AB 3ZR6A 4DK3A 1P7QA 1XMWA 1A7QH 5DK0A 4BFNA 3DJ9A 5TISE 3NCWA 5IQ9A 4Y4KB 3WJLA 5JDJA 2APWA 2CQVA 2XY1A 1F90L 4WI2A 4RSVA 3QUZB 1PPJD 4PLOB 4YDVA 4HH9B 2VMJA 4BWTA 3G5WA 1XF1A 4N2FA 1CLYH 4YK4B 1A6AB 5K39B 2JCCA 4AYGA 1L0QA 4DP4X 1T6VN 1HE8A 2EEFA 3VFRB 1CC3A 2CRZA 4E0RA 1YEEL 4PU2A 4XNZC 1JHKH 4H8WH 2YOCA 4PG2A 4D0DA 4QF1B 1KJMA 2XTJE 1KN7A 3MRQB 3O3EB 1IZJA 5LCVL 3V2QA 1L2PA 4KI5E 1PP9D 4WI0B 5FW8A 3GSUB 3CI9A 3IJ9A 1VDFA 2OMZA 1MLBB 3C6LD 3UYOD 4XWOD 1QFUL 4NNPL 4N0UB 4GP4B 4RDBA 3DNKA 2Y0DA 4P9HC 4GIAA 1F45A 1IGJB 1N0XL 4PJBA 5FGCB 1EJOL 3O9WC 5I8CB 2YAOA 5JMOC 1HHKB 5CJXA 1P5VB 2CR3A 1KIPA 1QSED 2G5BB 2KZBA 1C08B 4FG4A 1VPCA 3RIKA 2VN4A 2F74B 5DHMC 4NCC1 2BPBA 4HPYL 3L2LA 4NQEE 1TNNA 5FKPA 4AZ8A 5CN3A 2JKJA 4Z7UF 3F01A 3FSVA 5CP3H 1BVLA 5C0CD 2MKWA 4TNEA 3QDGD 2VDRB 4LCWA 3CCLP 4M5YL 5AAWC 1FU1A 3KNBB 4UDUB 3U2IA 1A14L 4OLXH 1OZTG 2IDQA 5GRVK 3WUWG 3HC3L 5ENWB 1NMCB 3MV9D 5B1CA 2ED9A 1URQD 3VYNA 2CR6A 4NO0A 5MEQA 4XX5A 3MV7A 4OFYA 1BBDL 5B1JA 1ZA6A 3C8KB 1UD4A 3EJJX 2WO4A 2RFXA 3U9PH 2ADJA 3V0WL 1U30A 2V5MA 4OCWH 1SN5A 2WHVA 3EGDA 3STLA 1J9QA 3L71G 1FC2D 2PXYC 3SGKC 5JIIA 5DD0H 4HJJH 3QJXA 2AXCA 3L74E 4NQVB 3UPCA 3GM8A 4K94C 3B2DC 4H2CA 4IK7A 3UTTB 5F6HJ 3VFPA 1NAML 1XCQA 4P4RA 1OAZH 2H9GA 4GRMA 3IETA 1KYOD 2ZP9A 4X5LA 4J2QA 2LU4A 4D6TG 1J11A 2CXKA 3DO4A 4OZHE 3TPUA 5GRWA 1OAXH 1RZPA 2Z5HA 2DD8L 1BIIA 4DVBB 2I25N 1MNUL 2QIWA 5B1KA 3ZW3A 3ARDD 2R9HC 1ZSHA 2PPFA 3C5JA 1RFDH 3BKJL 4F8NA 3GSXB 4DGWC 1DBAL 4GPVA 5C07A 4HEPG 3DETC 3EJTA 4KVPA 4CRPA 4YWGL 4BH7B 3LOWA 4DN3H 8FABA 2CK0L 1NSNH 5APYA 2G4EA 4KFZC 4TVSa 3T0BA 1IO4C 2VKXA 1KEMH 4KRPC 4P4RB 2J8UB 3QXDB 5IB4B 3H3PL 1RZ7L 4JQ0D 4YFLI 2FQFA 5MEPA 3SQRA 5EO9A 1S5HA 1W0VB 3S9OA 3VD4A 4MMZB 3SGEH 5C0AA 3CXHE 5CP7B 3KPPA 2BSCA 3RVWC 3AQZA 3OPZH 3I9GL 1IL1A 3QDJB 4N2IA 4K8RC 1NTZE 3QFGA 4LSSL 7FABL 5TE4L 2Y7QA 4HLEA 5JTWA 1IEHA 1YPZE 4U1HB 3U0TB 3KHUA 3ZMNA 4D3CL 4CSTA 2P8PB 4OT1L 4ZUVA 4B9FA 3M9HA 4IRZH 3CN4A 5MEPB 4E9RA 1O6SA 3NSDA 1SHMA 1DP0A 1V55B 4OM0H 4ZPTB 3DIFB 5EC2A 2ZXQA 15C8L 5IESL 1KBKA 5JIPA 3H9SD 3ULUC 3NCYP 3FFCE 3CIAA 2YAPA 2J1WA 4Q9QL 1E5WA 2HVBA 5LCVH 4NM8L 5DQDL 4JLRA 2V0AA 4E5XB 1CF8H 1LK3H 3TGUJ 3TFKC 1HEZB 5GZOA 5DYFA 2WLIA 3GMLA 3HNVL 3D6YA 4N9GB 4XODA 1EQWA 3V2NA 3NCFB 5EORL 4NN5B 5IB2A 3MNZA 5IV2B 2OPCA 1P84I 1RJZA 3FB7A 2I7OA 1JPFB 2A06D 3L48A 1T5WA 4OI7A 4GW4B 4K23H 3L1OL 5HDLA 3V52L 2Y69B 4ZMQA 2K70A 1QBAA 1TTBA 3DMMA 4A2GA 5H37G 2OMTB 2ADGB 4HWBA 1G6VK 1SQPG 1IGTB 2N3JA 4NNXA 5C0BA 3X1EA 5C7XH 5E56A 2OYHC 4L3FA 3IAOA 3VOPA 4Z0BL 1DE4A 4W4OC 2IFFL 1JGLL 1QUPA 3Q6GL 1OM3H 1NTMG 1NCWH 2CIKB 3B71A 1ZHBA 1SLXA 3MVSA 4HS3A 1MRFL 4JQXC 1XEUA 3MFFA 4TLTA 5HYJB 3DX3A 3H7BB 2XKMA 1KTLB 1BQHA 3GHGB 2YD9A 3MGTA 2D7NA 3QUML 2NRGA 1LEIA 3GF8A 3QQ4A 4PP2A 5TF1L 3L5WA 4G6FD 1JFQL 3NZ8A 1KYOJ 3ARQA 4LF3A 1XR9A 4I1NB 1VL2A 5EU4B 3HI5H 3RL1A 3RIAK 1GJWA 4XNXH 1AOZA 1EQ7A 1WFOA 1K8IB 2Q3AA 2EECA 5F1IB 7CGTA 2P8LB 4JRYE 3VYIA 4S1QH 3L4ZA 4N20A 1PIXA 1W16A 3WNLA 3EF7A 1PX8A 4X4KA 3DMMC 4JB9L 1PDKA 1MHPH 1V10A 4NQQA 4G7VL 1NTMK 2FYNC 3AREC 5CNHA 2YXFA 4W68A 4G43B 3RPIB 9CGTA 5IQ7H 4ODBD 4HCRH 1EJOH 5B38B 2VR7A 4PREB 4ZSOE 1CLOH 1GY1A 1HHGB 1ZMYA 2VW4A 8PAZA 3CXDH 1OF0A 1VQ6P 1NCGA 3NGBB 5AWNH 1XF5B 2B87B 2ZG1A 1HX0A 1AGFB 5HDWA 3GFUA 1TJIL 4R83A 1AOHA 4IW4C 5DZVA 1LTXA 1RY7B 2NR6C 2X3BA 1W8EA 3GLEA 4MKMA 3KJ4C 3O3EA 4LVNB 3IPEA 3VXTA 4HBCL 5SV4A 2HRHA 5BUAA 3KVPA 4AC4A 2B7DT 5GS1A 1X5HA 3EGSB 1OP4A 1KBGH 3VD5A 1OQOA 4X6BB 3AGVA 5IMKA 1K3ZA 4ORGA 3AXIA 4GRLC 1NBYB 4HB1A 3BWUF 1JGEB 1JI1A 4PJGF 1FUNA 3IDIB 3INUL 1OGAB 3NCMA 4PJHB 4QXUH 2W27A 1SF3A 5CEXB 3DRTA 2JCCE 4XC1L 2DJMA 3OKMA 1SXAA 4Y4FB 1E6OH 2FLMA 5FYLE 1YEHH 2QPDB 3KXFD 4B95C 1AGCB 5FW6A 1NFDE 3ES6B 4YLQT 5F70A 2O5ZL 3P0VL 1PPIA 1UYWL 3W11D 3FT2A 5E2UL 3CXHD 1E0OB 5FA4A 2BNQB 1NU1G 2L7UA 2J73A 3ZKMD 4ZXBB 3BZEA 3F7YA 5EPMA 5BZZA 2C3XA 3P11H 3Q1MA 1HHIB 4JR9H 5ID0A 3B5TA 3KLAA 3KM2A 1BOGA 3VB8A 3T71A 2J56A 2AJVL 3LW5J 3BAYA 4LCYB 4CC0A 1EJ8A 4WW1B 3ECBA 3I3EA 4PJBE 4FL4B 5DURB 4AL8C 5GGSB 3VG0L 2FO1A 3HPJB 2E5YA 1R8EA 3B5NC 4HCGA 5GJTH 1XGYH 2EVHA 3P73A 2KH2B 1UQSB 2XICA 7PAZA 2G75A 1HI6B 1HKFA 1C5BL 3D2UD 1WWAX 2AKRA 3QHFL 1L0LJ 5APXA 3QUYB 3E3QC 2C0XA 3NH7L 3I9GH 3QUMA 3CFQA 2ZJSE 4IHOB 4V1DB 1DJHA 1NWPA 1YMHB 3L81A 3JTSA 4HJ1A 4P2QD 3D52A 1TMCB 2CE6A 1IGTA 1SFDA 4QTHA 4DH2A 1XGPA 2KI6A 4KAQL 1OSPH 3AWGA 3EFDH 3WY2A 1YVLA 4XCCH 4YHNA 3IN0A 1WE5A 4ONGL 1XX9C 1RUQL 1Y8AA 4IFFA 1AGDB 1OARH 2JKXA 2V2WB 3MV7E 2UWEF 3VRJB 3PHQA 2FBRA 1JFQH 1CF8L 1UD3A 1PZBA 1WT5A 3WU2E 4RZKA 1JZ5A 3LKRB 1PVHA 2GK2A 1YJDC 4RGMC 1S7TB 1KJVB 1HNFA 4JY6B 3OLGA 5JPMA 1RP9A 3VTTA 4HZLB 4EI6B 3QHZL 3IAQA 4B7IA 4D0BA 3K6DA 1KYOI 4O00A 2W60B 1SMDA 4FA8A 2RGSA 3V4PA 3WMPA 4KZDH 3ENEA 4GI9A 4K9EL 3WS6A 4WFED 1ZLSL 1HHHA 1JCVA 4YS4A 3QARA 2E5TA 2YXRB 3C6LB 3IDYB 4G3YL 5E7FA 2JJUA 3ATBA 5GRXG 5I1IH 2KERA 1JGLH 1TZ8A 1BXVA 3W11C 5L2KE 4KTEH 3CPLB 1OTSD 3KJ4B 4LVNC 4C47A 1LO5B 2B88A 1MW0A 5FHBH 1GL2B 5KAIH 5T1KA 4APXB 3VE0A 5I8OL 3TEZA 4Y16D 5ACMA 4MMXC 2E9IA 1A47A 4N3UA 2R44A 3HG0A 4H13C 1RE3A 5ADOH 2WM0A 2CLRB 1AR1D 1ZV5A 2N0MA 1YN7B 4QYOB 4JG9A 5DQ9B 5KTEH 1GOGA 2WSCH 3ARGD 1JAEA 2Z6FA 4WW2B 5J9PA 1YN6A 3AE1C 3B5ND 1ULVA 3MRRB 4LCIL 3M7FB 4ZMWA 5GS0L 1ASQA 2BASA 2XZCH 3L9RB 3QDGB 1E8WA 4JFFE 3RKDC 1X6LA 4AIOA 1P84H 3L74G 3LVEA 4M93B 5HVHB 2EILB 2QQNH 4Z7VB 4K35A 1IK9A 4K3EH 4CBPA 4RDQF 4FJZA 2R5BA 3LPOA 3IETB 1E9PA 5IJKA 1Z9LA 3HE6B 1SHWA 2H6PB 5E8PA 2V3EA 3RVTD 4WK2B 1JPTH 1E9QB 3BX7C 3V4VL 3AEFC 3DOIA 1WD8A 2N7SA 2MPAH 2QJKB 1E67A 5F7UA 5I1EL 2J8HA 2MHAA 3C2AL 3EGDB 3STLB 4J3UA 5GTHH 3IJSB 3TF5A 5FFGA 5HGHB 3VGDA 1N5YH 4N8CH 4R97B 3U6XS 3ATAA 1MVUA 3CVDA 4OZGF 1L0PA 4JFFB 5JR1L 1UEYA 2CD0A 4N0UE 3UAFA 5CJ8A 3BPOB 4EI0A 4TTDC 1NANH 3U0WL 5GTHE 1NBVL 3UMNA 1MCOL 3L3HA 4PJAE 1JSYA 5IF0B 1T2QH 3HW7A 2A9ML 4CMMB 1YZZA 5CD3B 4HKXB 2NUPA 2VIRA 5TPWL 2DJUA 1NCBH 2ZXBA 2R29A 5KG9B 5KVEL 4K55A 2K9JA 4WVZA 1FI8C 3VD0A 4Q9RH 4DWHA 1K4CA 2E9JA 4WTWA 3GZKA 2C9UA 1KIPB 2G5BA 4HUNB 1R3HB 5KJ4A 3TASA 1A4KA 1ACXA 1PQZA 5DC0A 2EE2A 5E6SB 1A6PA 5BRPA 2WP3T 3NJVA 4M7KH 5FK9A 1ESOA 4UBDC 1P5UC 1CDYA 3N1MC 3MHVA 4A6YB 2VLLB 4JREC 1LT9B 3GMPB 3ZE1F 5GGQH 1AHMA 4WI0A 3V0JA 3EH3B 5ALCH 1M7UA 1T04B 1S3RA 4LIQH 1NCCH 3UBXB 5L6YH 1JMMA 1G7LA 3HE4B 5KLVK 4K94H 4E41B 6TAAA 1N0LB 5CILH 3T4AB 4WI3A 1AGBA 5I6OA 2A7BA 4A7PA 4ODSL 4EE2A 1Y9BA 1F6AA 2VABA 4AQ1C 3WO4C 1EC5A 3IGAB 5C39A 4JGJA 3FSOA 4YO0A 4KVCH 1T0MB 2EIMB 3GBDA 1NTME 1MFVA 4YAQA 3SKNB 5HD8C 2XY2A 1ED3A 2V33A 4X99B 2WNGA 3MD0A 1RULL 3FU3A 4X6CE 3MRDA 3SWFA 2FJFB 4I18A 5DA0B 1AP2B 3ZQWA 4MCNA 4UU9A 4RAUB 5CJXC 3BSZH 3CNKA 3CCJP 1C16B 4Y16B 4CUCA 3CDCA 3QH9A 5T3XL 2XQYK 2OMYB 1VQLP 2M83A 3E8VA 1JTHB 1Q2NA 1J48A 4GQZA 1T4WA 2AK4D 4JPSA 6CGTA 5L88H 1TPXC 1YECL 1U8MA 2YBGA 4QRQB 3RJQB 2IWEA 3K2IA 2PLTA 2XWBA 2HJKB 2G5UA 3MSPA 5JMRA 3ULUH 4YHZL 4FQIL 1D7MA 1BE3D 4AYEC 2H3KA 4NP9A 4OJYA 1N5AB 4LOUC 2WMMA 3F5HA 5C0AD 4QJ5B 5KVGE 1MAMH 5BZXA 4IKKA 1XBDA 4E41A 1JPTL 1OSYA 2YLKA 5DJXA 3MGOA 4R5VA 5CMAA 1ACCA 4ZW6A 3W9DA 5EZPA 2ADIB 3FAXA 3VXPB 3EH5B 2ORBH 3ZPDA 1ZDQA 3V6IA 5FK9B 3AMKA 3SGDI 3OKDB 2B5IC 3Q01A 2VLKB 1EHNA 2IQAB 5A3IC 3TA4D 2NY3B 1W0YT 3FYEB 5DZJA 1IAMA 5CZKA 4F7EA 2PWEA 4OIBA 5IWLC 1BEYL 4MNQE 4PLJC 4D94A 3HS0B 4N90E 4X5RA 2OJZH 4ZMAT 4IHBA 3G04B 3IGUA 3MPCA 3RWHB 1AHWC 2HT2D 2NCMA 4W9GC 5HHOA 3KLHC 4UU9B 4APQA 2XNXA 1WPCA 2OTLP 1OCWH 2QSCH 3D3VB 3IGLA 5DLMH 2KLUA 3F2LA 1OGSA 1KGIA 2R51A 4P2OB 3TA3D 3GRGA 1A9BB 1LO4H 2K9FB 2HPTA 1VLXA 4OAWA 4MJIE 4U6HA 2C9RA 4V33A 4PJGB 3MN8A 1OAQH 4KGLA 1LGHB 5AKTA 2ZUSA 2HWZH 3ZJAA 2C3WA 2BDNH 4F33A 2HFFA 5IB1A 2GTWA 3ZDZF 2YR3A 1YYML 1AR1C 3QJHA 2GUSA 2IAMC 3KYOA 5DWUL 4X7TA 3BVHA 2VLJE 3G08A 4Y4KC 3H1IJ 3E1F1 3L72G 4C46A 1JE6A 5CU5A 3SO5A 2TSAA 5IVZB 4NPKA 5E23A 3NEOA 3QUZC 2J88H 2Z4QB 3FMGH 5CFAA 1R24B 4TVPL 3TBWA 5EIIB 2WKGA 4CJ1A 4GKLA 4K94L 3FH5A 3RGVA 1O75A 5DVNA 2KI7B 5FYKH 2B39A 4JJOA 5FIEA 1TSHA 5EU5B 5C08B 3E2HC 2F53D 1X3DA 1PQZB 1WAAF 5D1XB 1MEXL 5JW3L 5K9OA 4L76A 2FIRT 3MRFA 3GJEB 1L5GB 3UBXG 4HH8A 4LOUD 3GLAA 4B9CA 3WUZA 5BRZD 1J12A 4IBSA 5IUSA 2JV6A 5ICXB 3AAZA 3WUUA 4ELMF 1TJHH 1NMAH 5CBNA 4B27A 1F3JB 1PJ9A 5H35B 1FNGA 1N0XH 4FI8A 4XBEH 4BXLA 4ZOAA 5DJ2A 1BGXH 1CD8A 2X70A 1Z0NA 2BP5M 5EULV 1JUFA 3GK8L 2FYUK 4DKTA 5IFHL 2WMPA 2J21A 3L71E 1UXMA 3SPHA 4ZUWB 3UGXA 2IBZX 1UB6B 2PPEA 3OJAB 4H8QA 1NC4D 1TXKA 4LHUB 4APXA 1O7DC 2N59A 2FWSA 1P1ZA 5GISH 4JFFA 1ZE3H 4YHIA 3U1CA 3E7KA 4D6TE 1PD1A 2HT4D 4O5LH 3UERA 4HPOH 5I73B 3MRHB 1B0GA 2SEBA 1ZVSB 4XZUB 5DR5L 2I27N 1ILSA 1EIBA 3GSNL 2P1JA 3X3FH 4MB1A 3ECVA 5CJQL 2H3NB 1JZ2A 1T4KB 5DUBA 1MFEL 5KVDL 3WO3B 2K0RA 1SQPK 5IJVA 1SFCD 1QSEA 4KH2A 4ALAL 4FQLH 4TYUA 2B3RA 4YC2C 4JFPB 3GS4A 4MCYA 3H1JE 4YXDC 3D85A 4OZHF 4RMRA 2ZOLB 5F7LB 5GHWH 1S5LX 3FTUA 5BQDA 2NY4B 1GA2A 3L9RA 1ORSA 1SVFA 4BJLA 2IYOA 1MHEB 2AEWA 3OHXA 1HAUA 3BP6A 1B9ZA 5KSBE 4RFNB 1OGTB 3TBCA 3T0ED 4M1DH 3R0NA 1T03H 4NZTH 4ONFL 5HI3D 3VMPA 1PZ3A 3WO4B 3C6LC 3RURA 2WGXA 2AEFA 4XPGH 5E2WH 3A6BH 4GIFA 2CLRA 2BHUA 3A6CH 1KLGB 3C5ZD 2Q8BH 2GAZA 4J23A 4UQCA 2V4HA 5E4OA 5DHYB 2ITEA 5AG9A 5KYNA 3M9QA 1N3NA 4GEJA 2X2IA 2YQ3A 4P4KA 1XL6A 1JY3O 2ZOUA 4ZFFB 1IGYB 1VQMP 2ROXA 3HRZA 2KNCA 3CPLA 1PGRB 2ERJB 2K7QA 3K2UH 3P73B 3KWTA 2WUBH 2P7JA 4W6WB 4PV8A 1I7RB 4CVZB 5CN2A 7FABH 1VQ4P 1OPGL 1KCVL 1A6ZA 5B66E 2X9YA 2WK2A 1QUNA 4OCLC 2OS7A 4OSUH 1I9JL 3EYQC 2O30A 2QRXA 4X6DF 4Y5VB 4OZIA 4ZUWA 4MCZB 4C58B 1MH5A 1BV8A 4D0BB 2WVSA 2C26A 4QTIH 2PW1A 3AE6C 3QUHA 1R5WA 1DCEA 2FYYA 4LLVA 4MAYD 4MXVF 4PJGA 4TLSA 4CNIA 1P4IL 1E8YA 3FT0A 3BZFA 5FYKL 1FZBA 1JNMA 4A55A 1Z5LA 3PGCA 1CI5A 4QRRA 2RH0A 2ICEC 4YBHA 4Y5XC 4HC1H 1CICB 2EC9T 2GSIA 3QA3A 4TUKL 1NOAA 3CSFA 1F4HA 2XRAL 4F7MA 1ET5A 3VWKD 1I4FB 3LNHA 2BS71 1XGTA 3QUZD 4NKOA 3RWDB 2Z93A 3HN8A 3FO9B 2ILLA 5D7LE 2Q0ZX 5I73C 3T3PB 2AJUL 3KPRD 3JV0A 4L8CA 5L8LB 4K3DL 4XE5B 1NBYA 2N56A 4TULH 1CE1H 5EZLB 1YEWA 2BDNL 2E6PA 1U4EA 1NMAL 3CZKA 4S1SH 3GK8H 5IROA 1NC2A 2R3CA 3A67H 4NGHL 2QEXP 3QH3B 4POZC 3SY6A 5CMAB 3VXUE 1H8OA 2QV2A 4PBXA 3S8FB 3PP5A 3DVGA 1R3IH 2DQJL 2EH8L 2HFTA 3GS7A 4RMVA 4YDNA 1UOLA 3MCKA 1Y6MR 3L73D 4MVBC 2AC0A 1K05A 2LVEA 1HINH 4GI6A 5TFSL 3WU1A 1E9OB 1EX0A 1HESA 2O1AA 4JFEE 1OCZB 2YD6A 3GSNA 5GISL 5SWZB 1N10A 3FQRA 3GLZA 2ESVB 3P0YL 4NRZA 4S11A 4UOJA 2VDLB 1SQQK 3ULAB 4DTGL 3GI8H 2B1HL 1WIOA 1K72A 3V4UH 3MLXH 4RRPG 4PVBA 4E41E 4WAFA 1BJ1H 2J1ZA 3KR3L 4JFDE 4KKNA 1IGMH 4FMKA 4LBEB 5J12C 2BK8A 1BAGA 5D55A 4XCEB 4U7JA 3FU0A 5E9DD 5C0JA 4EIBA 1QLEL 2WQXA 3HMWL 2HVKB 2ZCLH 2XKUA 4PJCA 3ETSA 3G04A 3RWHA 3SY0A 5KVDE 1KYUA 4GS7C 2FO4B 1JYWA 1BAFH 3RZCD 1B90A 2HN7B 1TJHL 4MTMA 4DERA 1JHLH 1RHHA 1RH5B 1EEUA 1O5DT 4RFNC 3WENA 3MV9B 1OKEA 4L1BA 5CS7A 4YL4A 3T8XB 1S9KC 2HYNA 1NOHA 1Q81Q 4XC3L 4ORGB 4RAHA 3VFUB 4KROD 3BWSA 2MRYA 2VABB 2BHZA 2X0WA 1GAFL 1MCPH 2NX5D 1T1ZA 5D6CA 4YVNA 5IFJB 1NHLA 4WEBL 4NC1C 3RUGB 1JZDC 5E0FA 1NICA 4BV1A 3CHQA 5J12B 5FDWA 4YDJA 3BP4A 4ZQKB 3FT9A 5HGBB 1V27A 2F6AA 4R4BB 4H0LC 2Y06H 3S34H 2PCFB 2R4RL 3PL6C 5K59E 1CDHA 3T65A 3PNRB 1BXAA 4JRFA 2EIKB 2C4XA 4IEFB 4X4XA 2D4FA 5F21B 1U8MB 1LNQA 1UWGH 3X1BA 2LLNA 2P43B 1KCVH 4PJ7F 4Z78B 4ZFGH 3DC0A 3RPIA 3QUKB 3S98A 4Y16A 3FB5A 1BF8A 2W9EL 2W65A 3GW6A 5IHWA 1TZGL 3WKNA 4XO4A 3H9ZA 4HD5A 2AEPH 3QYCA 3VYOA 1FRGL 4U2ZA 5E0QA 4ZW7A 2AJXL 4RISH 1AE6L 2GC7C 1LP9F 3KBHE 3MRMA 1A2YA 3ZL2A 2BVTA 2WXLA 1DVFD 4FYRA 3ULSA 1KB9I 1CL7L 5HHVL 1R3KB 1XR9B 2YLHA 1KCSH 1NGYA 2BZDA 3DBSA 3QIBD 3ZMRA 4Z5RB 5DS8B 4JR9L 1ORQB 3NJNA 2KL6A 5CD5D 3EAKA 2FB4L 3OGCA 4DKDC 1RCYA 1L0YA 3DHJA 4ZQTA 1MN4A 3B9EA 4PLNC 3QO1A 3D2UB 3ARRA 4B50A 1O0VA 4IRSA 5A2FA 3GEFA 1GZQB 2VXUH 4CADB 4WY7L 4P2YA 1P6WA 4OZGE 1KIQB 3V10A 3MQIA 4QHKI 4YIQB 3BVDB 2ITCA 1CI3M 3DIDA 1WFTA 3KXFA 4M6NH 3P4OB 4NO2B 5E5MA 5AAPA 3ABMB 1I9JH 3V5KB 2CGRH 4LLHA 1J05B 5DT1H 1YYMH 1T5WB 4X5QA 3G5YA 4WJG3 4GI8A 1UJTA 1PY0A 4CKQA 3OXSB 1G7QA 2HVJA 4J6RH 5DCCA 1BREA 4TPRL 5SWQA 1FPTL 4JRLA 4NQCD 1JV2A 4MB5A 3PAYA 4FN0A 4TNWK 4W81A 4JKWA 4ZBJA 3J7HA 5DC2A 4IRJD 2NPSC 4TVPH 3QISA 1GGCL 5DRNA 4GUPA 2CGZA 2YFOA 2BSEA 3GI8L 4WI7A 3U79A 4A67A 1NAMA 1L9RA 2D0FA 4RGMB 5IB3A 4OV5A 5TE6H 1PIGA 2QADD 2YK1L 3MUDA 1FF5A 4WDIB 1EV2E 4ZUVB 1RE4C 1MIEL 2B5IB 2JFCA 3HAEB 3LH8A 3VH8B 4ERSH 4PY7B 2YS4A 3H54A 4O2FA 1ZA6B 2X5PA 4N68A 5KSBA 2IH9A 1LGVA 2N7BA 3CBKB 3QR0A 2XA3A 3U46B 1CYGA 3D71A 2ZWLT 5I5JA 3LKSA 2A73B 3QW9A 4ZFZA 2R0LL 1AC0A 3F6IA 4YBLC 1NCIA 1A6WH 5K1VA 3F7LA 3ULUE 5KKZC 4WDIA 3CMGA 1ASPA 3CXHK 3KL5A 1D5XA 4Y2OA 5D7JA 2Y0CA 4LAQH 3NEEA 5D1ZA 2A4CA 3B9KA 3N0AA 2AK4B 3ZIYA 2H6PA 1U3HB 2HX9A 3V9FA 1U36A 4DEPC 1ILUA 3FTYA 1H5BC 1QNZL 3IFNL 3RWFA 5KTEL 2VKWA 1W72H 4XMKL 4OCNC 3CLEL 1DBKL 4NO5A 3LNDA 4Z9KB 3MJ7A 2B1HH 1P5VA 3PWLB 4RGNC 3PPSA 1BGYJ 2E7LA 2R0KH 1FCGA 4JKPH 4XVTL 2KLRA 4JJ5B 4QXTA 3PHQB 4I1PA 3HTKA 3UTQA 4F9LA 3VI4E 2OSYA 3EBGA 3AACA 2QQKL 3LKPB 3SBRA 4JFYB 2K78A 4PJGE 2P5WE 3U1SL 1IGFL 3FCUB 3OM3B 1T5KA 3U4BL 4D3CH 1RZFH 4QRRE 2W9EH 3ZO0A 4H20L 1TZGH 4BFOA 2BZCA 2D2OA 4ZD3H 2ZWYA 3S8WA 1E5YA 2BIOA 3CZUB 5MEQB 2OK0L 1XQ4A 1UZGA 2TAAA 5DJAA 3U0PB 4WWIA 1Q0XL 3S96B 3EO9L 2Z8VC 3C1LA 2ZCKH 4PD4J 1RZKH 1WZ1L 4K7PH 5ANME 4JUSA 5AKSA 2R3SA 2Y24A 1TF4A 3FQWB 4MQ7A 1DZBA 1N5YL 5CHNA 3C2SA 2A9MH 2ALAA 1X8YA 1BVLB 3AECC 3LQZB 1NTMD 2KDYA 4OLZL 5I1KL 1YRKA 5LNEA 2F74A 1IFPA 4S1DC 3TO2A 2J55A 4UOW0 3VXUA 1W5CE 5DQJA 2BNRD 3VD1A 1B9KA 3CCHA 1WZMA 1H0DA 1PLBA 2ARJB 4PP1C 1A4AA 5KVEE 3MTRA 5CJOH 1WBYB 4L37A 1DANU 5FGSA 1S9XB 5GS0D 1W80A 4DUWA 1GYCA 1EBPA 2QJPC 2CGRL 4NP4H 3TNMA 1UACL 4E68A 2WD0A 1EFXA 4Q9RL 2PP9A 2J25A 4GQQA 2Y7MA 1L9OA 1GOHA 1MDTA 2QDVA 3N06B 1U8QA 3DYPA 4I1RA 3ZK0A 4JFDA 1KN4H 3V8OA 4D0DB 3ZMEA 1MQKH 3CVIH 3UAJD 2NY1C 2HCZX 1ZTXE 1LTJC 2IDBA 3LHPL 3U2SA 2DI9A 4EOTA 4QO1A 2OXHB 1JCKA 3S2CA 4DOJA 1CFSA 3IXTB 1X79B 3OKLA 4DPRA 3D3VE 5JW5B 1AY1H 5GIRB 2FX7H 3H1LE 4JM4H 3P8CD 3D0AA 4NO0D 2XQYG 5D7SH 3BMVA 2AVFA 5CCGD 3J27A 2ZUWA 2M3EA 1MCQA 4TN9A 3SKJH 2XWRA 5FKAA 5C09D 1BLIA 3FULA 4WHCA 3H1LD 3KLAB 4PJFA 1JXGA 3J07A 1RE3C 2MPVA 4YSUA 5CJ5A 1ZVNA 3TURA 2R0LH 5EPMB 4M5SA 1PZDA 3U9UB 1KULA 1U2YA 1KZQA 3FT2B 4WWKC 1TTGA 4G43A 2AEMA 4QI3A 3VFOA 2WPVB 1DJXA 4FABL 3MODL 5AVSB 1V7NH 2YXQB 1UUNA 1H3PL 4NRZB 1J86A 3PP3K 3CN1A 4D0CB 4JKPL 3MA7B 1F4XL 5FUOL 1IFHL 3PXLA 3QXTA 4U3FG 4OGYH 5K59F 3DX9A 1ITCA 5FYKE 3VMAA 4LPYA 1HYRC 3CFTA 5C0RL 3JC22 2H89C 1GYWA 2I07A 4AJVA 1J1EB 2XNAA 1KB5H 1E90A 3MBWA 2FTAA 3QJRB 3UDWA 1I8LC 5IQ7L 3SDAD 3ARDC 2KPNA 3T0EE 1L3NA 4JKMA 3L54A 2PR9A 5EOCH 4ELMB 2WVRA 3UG5A 1CLVA 1OTUD 5DC9B 1BE3J 5TE7H 1ICTA 3FZUD 1NAMH 2N01B 5IMOA 4BXVA 4KITB 2GSGB 2LGNA 3EJCA 5E9DB 4DJGA 2A6JA 2Q7AA 1ML0A 1L4IA 1AJYA 1R46A 4U7SA 1PEZA 3GGWA 4F15B 1I4FA 1R5IA 1S9YA 3JXAA 1KILB 3QBTB 2AJVH 4W9DC 2JJLA 4HJ0D 3ZR5A 1BDDA 1D7DA 3Q2VA 4OZGA 3TA3B 2LXCB 4M48H 2E9GA 5TDPA 4XAWH 1CGTA 4FX5A 3KXFE 3FQXA 4EF3A 2WLIB 3GMLB 1OCOB 4QGTA 4MHHI 3HC0A 4G6JH 4MAUL 5I6LA 3SQBB 4WFEE 5T1LD 1R5VB 4PTTA 3AFLA 1U3JA 1WUZA 1CB4A 3PWJB 4Z3IA 1DBBH 4PJ0H 2Q6WA 3L75D 1RI8A 3SGJC 3U4EA 2IVFC 5DD1H 3B9VA 3FQWA 1N8OE 4YHYC 5KYWA 3V79C 1IC0A 2X2HA 5AUMB 4K5NA 3H3BC 2AQNA 3T3PE 1BCCG 5HXMA 1O9WA 4RA3A 4UDTA 4KPHH 2ZSVB 2BCCG 3HRZB 2HJLB 1OSPL 3RE0A 4ZS6C 3CX2A 4QHLB 3WN5C 4X7SH 1T2XA 1RZGB 3HAEA 4MQTB 3QUYD 2ZOOA 5GS0C 1GJIA 1S78D 1XXDC 2AEJA 1B3IA 3JTTA 4CL7A 3RQ3A 5D2NE 4JFYA 5ESVA 4L5FL 4Z18A 3RFRA 3O4OC 1N8RQ 3LD8B 3LV3A 1AXSA 5T1LA 4MNGE 5D93B 1EO5A 4Q6IA 2IH1B 1V8HA 4QXTB 43CAB 2KP8A 3FU5A 3GZPA 3MP7B 3MUY1 2P8MB 1JV2B 4LLWA 5KSVA 3HG1D 25C8L 2UX6A 4K7PY 2H32H 4L2LA 1MHHA 1EVUA 3GIZL 3NCCB 4MNQD 4HS6B 1XGRA 3F3HA 1ONQB 1J05A 4WENB 2OM5A 1K73Q 5HJGA 3RU8H 4U1KB 4CAGA 3L7FB 1HCZA 2QTVA 3HE7C 4ABVA 1U8IB 4XMZA 2C9AA 1FYTE 2SEBB 3WTSA 4HT1L 1LJ2A 3AB0C 3O3DB 4PW9A 2P2UA 1UJ3A 1XSIA 3DOSA 3HBZA 1RURL 4FQCH 4U49A 2OYKA 3SCMD 3LIZH 2JO1A 2YMXL 3CSYB 1X5XA 3V7AG 3L71J 3F83A 2VXVL 2WITA 3UC2A 1S7XA 4ZFOA 1VQ9P 2E9WA 4HK0B 3KPPB 3US9A 4MMZA 1ZXGA 4PB0H 4L4TA 3WIHL 1XZ0A 3RG1C 3N1GC 3MLVL 4Z7AA 2HTLD 1LO0L 2CZNA 3QIWA 1F1DA 3KPSB 4PJ9B 3L72J 1MRCH 4IJTA 4DCQA 5H35A 1VACB 2JLLA 1GZPB 4FNLL 3VDAA 4HIJB 4LO9A 3Q5PA 1JTTA 3CN3A 3WHE0 2NTFA 3LRSA 3T0DA 3SE3A 3UCQA 43C9B 3QNYA 3BE1L 1XSJA 3SD2A 1HHKA 2YUVA 5T33H 3D39A 4Y16C 3B1UA 3V6OE 3PQYE 5ITBH 3RPBA 2OTUA 4B7LA 1PZ2A 4HMCA 2UY7B 3CWBE 3II6A 2KQNA 4G80B 2K6WA 5FA3A 5HHME 5A2CA 5CIPB 3K4AA 1MY7A 5I1DA 3IFOA 5BJTB 2KB7P 3CE1A 2VJ8A 2FEDC 4KXCA 5EMYA 1PKOA 4WSJA 3N41B 2X4PA 3FCSB 1DLFL 4Z1MH 1WRGA 1NM9A 3FRPG 1B4RA 3LNIA 2VDQH 4K3JL 3EDFA 5D70L 3HG2A 1ZV8A 4HUWA 4KI5F 3ILQD 3BUQA 2DQIH 3DSNA 2NTSP 5ALBH 1HIML 3FCTA 3VP9A 2CPBA 1QX8A 4BYHA 1AVYA 1SQQJ 2WSCJ 3GG2A 2ICWA 4CA4A 5IFJA 4FLSA 4H0LB 3CHRA 3GQFA 3O9WD 3KGUA 1OW8A 4FLHA 1MIMH 4ZUUA 3CTTA 1KENL 1VZGA 1ZJAA 3IDMA 3TZVD 2C4FU 2P5ED 3GSWB 3E6HB 2MCMA 2G9HB 3X1FA 3MTXA 3CHSA 4U6HB 4Y88A 1JK9B 3BT0A 2CR0A 3KS0J 3WFCH 1CBVL 3G7TA 1A2YB 1YJDL 3BASA 2E5EA 1WCQA 2E47A 2H1PL 2MEJB 3GMRA 3WE6A 4BM7A 4X83A 4KJYA 1PSKH 3NIGB 3CCQP 2CK2A 3SPCA 2OQJA 3PP4L 1GPOH 1KB9K 3DVNA 2CDGB 3QUKA 4PUBL 4W9HC 3PV7A 4F7EB 1U8OB 1SOXA 2FECL 2YPLB 1CDGA 3I6SA 4XVUD 1OHZA 4FG0A 4HCIA 4NPDA 4UTBL 4YXKH 1QFWM 3SZ6A 3KW7A 5BUPA 1CG9A 1D5BA 4YBQC 2D7PA 2IPKB 5EU3A 4URKA 2V7QH 3RTQA 4HQQH 1JYVA 5DMYA 3L74D 3IPBA 2ADIA 4LSTH 1SQQG 2FVNA 3VXPA 3RK2D 4GT1A 2F8IA 3D2TA 4N1CA 4Z0XB 4F9PC 4NJAH 4N85A 5I1JH 4A04A 2IGFH 1NMBH 2DAVA 2RCSH 5AD0B 3C60D 5JXAL 1AZBA 4BINA 4QTFA 3NIGE 1QTSA 2DQFB 3SSGA 2XIIA 4C57C 3N42B 5HVFB 3UPRA 3QG6B 4WWKB 3O41A 3B2PA 3VFGH 5HTSA 3LIZL 1BYPA 4LVEA 1DJGA 4WFFD 4JG0H 5K39A 1Y47A 4NGHH 1HYSD 3FC8A 3OG6B 2DF3A 2WTRB 3L6FA 2CNZA 4ODUB 5MERB 4HH9A 1FDMA 4HLZG 4Q97A 3AXLB 3UC0L 3DX2A 1T7WA 5CSZA 3CFMA 3W9EA 1NCJA 2J4WL 3MLSL 5IHLB 4L8CB 3C75A 3F62A 3EHBC 3LEVL 4PTUB 1U8QB 3MX0A 1KGUA 1P9MC 5HI5D 4POZD 4P3WA 2YMOA 4FXKC 1U91A 2EDNA 1Z0MA 1I8IA 4RKUJ 1TYRA 3IDGB 3IF4A 4M5YH 1UKQA 4U6VH 4LMQI 3S48A 3TNMB 1UB5B 3P8MC 2X89A 5L6YL 3V4WA 2AFNA 2CBMA 4M93C 4PS7A 3GXNA 5L9DL 1M1SA 3E80A 2XXGA 4A2FA 4HHAA 4QRRB 4AKQA 4PG2C 1UFGA 1AY1L 4BA0A 3C6EA 2KLVA 1PV3A 5J1TC 1UKSA 2H4EA 2WXGA 1P5UB 5SWSE 1JYXA 4J3OD 1CYXA 4K5MA 1JERA 4WW2C 5AYTA 5JHLL 3NMEA 4I0PC 4MA3A 1GL4B 1VQNP 1RAMA 2NT0A 4XN8A 3RU8L 1YJNP 4I85A 1JB0J 4Y19E 2VAAB 5JQ6H 4FFZA 1BAWA 5L0QC 1KG0B 1AIFB 3KJ6H 5E6IA 5HHQB 1XGUA 1T04A 2DRUA 4WUUA 3QH3A 3F00A 1MCBA 5IKCB 4JFFD 4OD2A 2FNWA 3RVXD 4M5ZL 1Z56A 4O2CB 4H44B 2HKAA 1BDYA 1SP4A 2CALA 4KROC 3BWZA 1A4CA 2A83A 1URZA 4IGBC 3B7YA 4ZK8A 3PJNA 1NCOA 4GKZA 5F7HA 1ACZA 2WP3O 3KPNA 4P2OD 2YA0A 4PIBA 1L0NJ 3G6DH 5GGRA 4C4BA 4ZKPA 1GRWA 4WUKH 3VMYA 1N7SA 4G6FB 5D4HA 3WFHA 2WBJA 4QHUB 3VFTB 2F1EA 3IFLL 3AVEA 3FN0H 2E7DA 2BNQD 1S4IA 1SBBA 2HKHL 3OPZL 4O51B 4L9LC 1AFOA 1X9UA 2JLPA 2EDRA 4FQQB 5CLXA 2CGYA 2QGBA 5DWUH 3V0GA 2ZOLA 2Q7CA 3VFVB 15C8H 4AENB 1DVSA 1OB1B 3DGDA 5KJRH 5F93C 1QSEB 2HODB 4JO3H 3NPSC 5CCHC 1PZAA 4MNGA 2AEPL 1VCBC 4MMXA 4NRXA 1G1KA 3R4DA 1CPUA 4Y5VA 3CQPA 3UZEA 1UG9A 1MWOA 5D1XC 1D5XB 4E9XA 2CBTA 4I48A 4P9MH 3O6QA 4YWGH 2CAKA 4O2EA 4KNQA 2F8OA 3VCLB 3GXFA 4FQHB 3H1JD 3HNVH 3US0A 4X0NA 3V5HA 3OPUA 1G1IA 4HQQL 4LQFH 4N5ED 4QRPB 3I6KA 4ODVL 1KYOH 3KDMA 3WTTA 1RPUA 3BRVB 1WBZA 2E7HA 1M7IB 3VDBA 1AV1A 2TRHA 2VDPH 3NJIA 4GOSA 4IMLB 1ZDSA 5G4MA 1Z9PA 4JPWL 2A5UA 4A37A 1JHTB 3D25A 2V6HA 1PX3A 3RJDA 3ESMA 5IY5B 3NFSL 3LDBC 2VSDA 4TRPH 4B96A 4NUPA 1QMUA 5GGVL 3NACH 2APSA 1WC7B 4R90L 1MRFH 2DLIA 4MX7B 3EFOB 2ITDA 4L4TE 2I26N 3Q5YA 1QI5A 1AD9B 2ED6A 1KB5B 1LK2B 3TIDA 3O2VL 5IGXH 2Q2LA 3KPQA 4H8VA 5DQ9A 1TO5A 5AVYB 3CQQA 1A02F 3RAJH 4DP8X 4ZMNA 4ODTH 5JW4R 1FFPA 2BJMH 3O4LA 4LGRB 3VXOA 3HI5L 3SDDC 1KIUA 5IBUG 4HD9A 2QQLH 4YIQA 3MJ9A 3S35X 1PU0A 3HZYA 1KWKA 2AQQA 3TZVB 3D39E 2MCG1 3PQYA 5ABDE 3SKUD 1RLBA 4FFZL 1KILD 1C8QA 2EYSA 3AABA 3QDGE 1A6UL 3MRIB 5F1NB 5HPMA 1A7NL 3T6VA 4XNMB 1LE5B 4UTAH 4Z0BH 3BCDA 1I7ZB 1GK6A 2VLRE 5IUCA 2CUAA 1D9KB 1SNRA 1USZA 4HIXL 1XGQB 2BS9A 4ISVA 1NO4A 2X05A 4Z7WE 3TNUA 4QT5B 1YMME 1YDPB 4QHNB 1F86A 3KMDA 4U7KA 1KQLA 1FH5H 1VFAB 3FRPB 1RURH 2IAMD 2YNYA 1J1DC 5ITFA 1G9NH 3RNQB 2C9SA 2KZKA 2WTYA 3QNXA 1H3XA 4GSDH 2PXYD 2OZ4L 1HS6A 3CFCL 2CH8A 5MI0B 3WY4A 4XNXL 5KSAB 2O01H 3E8UL 4NUGL 3ITKA 5IVXA 4OLXL 3ZHKA 35C8L 3GHEH 3DYMA 3VG9B 5EBWA 1FG9C 1TVBA 5E79E 3VFSA 4NC1E 3U7YL 2XTJD 3P9LA 5B7EA 2JKRM 2Y72A 3WEAA 3IEAA 1DQQB 2QPUA 5BO0D 2LLGA 4W1TA 4ODUA 5F9DC 5IR1B 1KLFB 2QQQA 2EDMA 1TTUA 2XV6B 4A66A 2D7QA 4OVNF 1F42A 2WXRA 3UOAB 4DZBA 4GLRH 1XH0A 3LX9A 5E6ID 4DF9A 1FS0E 1OAZL 3H9SA 3T2NH 3I74A 4Z0XA 5F0MB 4M02A 1KJ2L 2PR4H 1CXKA 2GC4C 4DQOL 2HG0A 2H0FA 4YH6A 2WZPA 5I17B 2XKSA 2E7CA 1AVAA 1ZHKB 4KRPB 4QRUB 4ODVH 1KCWA 1X5IA 4HOXA 3CVCA 4KMLB 4WV1A 1Z1WA 2OMYA 3AS1A 3TCXA 1U8PB 1BVZA 1XO8A 2DIJA 2VT0A 3A2AA 2R4SL 3SE9L 2YUWA 1XB3A 2L8AA 1SQQE 2VR9A 1SJMA 1LT9C 4I18B 1DJIA 2OW6A 4XMLH 4XPTL 1GIGH 2H3XC 1FZCC 4K8RH 3O6ML 3T04D 3V6BR 1G4MA 4L4VA 1CFNA 1HKLH 1ND0B 4YAQB 3IDIA 4X7DC 1EK3A 4R4FL 3M1OA 5FOBA 2D03H 2JH2A 3GDBA 3WIIH 2WBXA 4X6DE 2HRPL 5B8CC 2DQJH 2EH8H 1RK7A 1QO3A 3DARA 3FNKA 2HUEA 3OKOA 5JO5A 3W9DB 1KC8Q 1ZT4A 3TO4C 3GIVA 3APCA 3O11A 4PD4D 2B1AL 3IM1A 3UPRB 5CWSB 3WKQA 2DQGH 3D6GA 3GKWL 1RZIA 4F37K 2HJFA 5C0DB 4GT0A 5E8OB 5SWSA 1MRDL 2FGWL 3FQ2A 3I9IA 1CFBA 1YY8B 4N2LA 5KTBA 1SDDA 2TSBA 2QQLL 3DURA 2YIUB 2B87A 3LZRA 1OAYH 1G9ML 4Y19A 4MN4C 5CIPA 2L7JA 1I8KA 4CSPA 5I15L 2OTUB 2C5DC 4NNYA 2LQRA 4PGCA 3ABZA 3D39B 4HXBL 5KSBF 4JY5L 3B8EB 2ATAA 1SZNA 4XXCA 3WBDA 2J72A 43C9A 3M86A 2F7IA 4J1UB 1R3IL 5DA4A 3NACL 2K9JB 3NA9H 1FBIH 2B3IA 2GBAA 1JI2A 5D96C 1NTZD 2VN6A 3TYFB 4EI5B 1C12B 4GG8A 2JCCF 1HE7A 4GMSH 3HVNA 4AQOA 3LZLA 2EIJB 4R26L 4KTDH 1IAIH 1QYGL 3SODB 4WTZG 4PP2B 5BCAA 5AVWB 4IMKC 1T66C 3DHUA 1FZKB 1Y7VA 1XB8A 3U7YH 3WV0A 3WELA 2GJZA 1MZ9A 3BVNA 4KXDA 1AS6A 3CWBG 2Y6SC 3EYUH 4UQ3A 1GGIL 1EBAA 1HT6A 4JHBA 4D9RE 4PD4E 4ASWA 1L6PA 4Y2DC 4IS6B 2HYMA 1KC5H 5AVRB 2NR6D 4NNXB 1I1FA 4PV1D 1Z9NA 5KKZB 2W6AA 4KDWA 4RGOL 5C3IA 1IKNC 2YMTA 2JELL 2CMRH 3TJPA 4QOKA 2F1AA 2WINB 2CHNA 2UY7A 4G80A 3RX7A 4A2DA 1XGRB 2XZQL 3HR5B 2DYPD 4GAYA 1RJZB 1B2YA 5FO7B 4P48A 2ZP0T 4GFTB 3V2PA 4NDMB 2R2BB 2YGOA 1QRND 1N73B 1P7KB 3CDZB 5JUEL 2XV2A 3HE6C 4UT6A 5LG1A 2OR7A 5KVGH 4HKBB 1JY2N 3MRRA 3OJVC 4JLRB 3JVGA 2Z0BA 1LHZA 3BPOC 1AXSB 3BUDA 1E27B 1I1AC 4JCMA 5T1LB 2ZYSA 5H37A 1JCDA 4G9FB 4GAFB 2WGNB 3K80A 2X4SB 5HDBE 3P30L 3QFJD 2W1NA 3KZIH 1KBGL 4N90D 2J59M 5EBMB 3H4FA 2Q86B 5B39B 4N6JA 4XNMA 4TUJB 2LFEA 4PRDB 4GO9A 4M43H 4ACTA 3LN4B 3KQGA 3GO1H 4U0QB 2GK0A 2KSJA 4N8PA 3W0WA 1A7OH 3BDXA 1JN6B 4KI1A 4LPVA 1SM3H 1WS8A 3SKOB 2BCKA 3VGHA 3MIWA 1J88A 1E9QA 3O4LE 1J5IA 1CTMA 3QZPA 4JRYD 4NENB 4BSJA 2EVIA 3MRBA 5DJTB 3HE6A 2IOOA 4GKOA 2AZUA 2CBQA 2MWCA 1DQKA 1DUYA 4WWOA 3GKWH 5E8EA 1S9KD 3KPQB 4HUMB 1EPFA 3PWPE 4WKZB 2NW2A 5GGUA 4AEEA 1A66A 3TA3A 4GFXA 3QDGA 4AEHH 2R23A 3O6LH 3FQUB 2PCXA 3MLRL 4EOWL 1YPZB 3LAFA 2YKKA 2EDYA 3GSOA 4XBPA 3SE9H 4WNQB 4N4YB 5D71H 4G1EA 2P10A 4CJ0A 4W9CC 5BW7A 3MUDC 1YEJH 4FQ2H 4X4YB 1YMMA 2WO3B 4MJIB 4GKZB 5PAZA 3T2LA 1K8DA 2F8VA 3VNZA 2W90A 3QSKB 1UXWA 3R2PA 2AAAA 5K5GB 1OM9A 3QUMH 1PG7W 2AJSH 4EXKA 3KEHA 5IKCA 2HJLA 2BIIA 4GXVL 2H8PA 1U2CA 2QV4A 2ZWZA 4OH2A 1UXSB 2BSRB 4GLRI 2NY2B 2VERA 3FQTB 1NGPH 1KFAL 3MBEA 1IAIM 3EZ8A 5E70A 3INOA 3D0LA 3G08B 5F9AC 2PCYA 3R4YA 1DJSA 4MD4B 4FMVA 5LGJA 3QZNA 1YEDA 2V4LA 4F58H 4DTGH 5IMLB 1KB9J 3L4YA 1M1XB 4PJEB 3M0DA 1T7VA 5IB5A 1IGML 1UWXK 1CI6B 3EJYC 3LPWA 1CMOA 4PB0L 3AS3A 4ZXBA 4YUEH 2BOCA 1CICC 3F12A 3IRZA 3H9SE 4TSBL 2XHNA 4GODA 3MBEC 2XN9A 2L7QA 2WWMD 5AWNL 5C7ZA 3AROA 2ATKB 1ZEAH 2X1XR 3QYMA 2EXYD 2E9BA 2VDKB 1MWAB 3CDGB 4H25A 3R18A 2WJ7A 3O8XA 4I0PB 3RFZA 3OQ3B 1XTLA 1ZA3A 3BT2H 5FUZH 1WP6A 1KD1Q 3WKYA 5BV7L 3B7TA 4K7PL 1IAOB 4ICXA 1JO5A 4JFWA 1MVFA 1BEXA 1TT6A 3TU6A 1Q0EA 5KW9L 1WGOA 1SDAB 2P52A 2QVIA 1YAIA 1IC5H 3LXAA 1S6NA 1BQHG 4P3CH 2R83A 1OP3H 3TN0D 4M9OA 3AQYA 3FFDB 5D8JH 1F6FB 5HYSA 4BBWA 4XHQA 4XE0A 1HJ0A 2VAAA 4X9IA 2J1XA 1G94A 1YY9C 2CXGA 3HS0C 3AY4A 5SWZE 1EERB 3QWRA 1X7QB 3G5VB 3FTZA 1P7QB 1UATA 3L45A 3SCMC 2XWBB 1YEIL 2DTSA 3ETTA 5J1AA 1TEFA 1VZIA 5I19L 2BMKA 1TJGL 3O8XC 5IHUL 2FKWB 1N6VA 2BERA 5CN1A 5E9DE 5C3LD 1MI5E 5IEHA 3OA7A 5B38A 2O3JA 2PO6B 1URQC 4FHJA 2C8NA 5C9JB 5F8QC 1ZLWK 1T22A 3U1AA 2KHAA 3MRLA 3P77A 1MY5A 4WHTA 3DX8A 1SQVD 1QVFO 3DJSA 1SFCB 3UO8B 4QUOA 3TO2B 4DCKA 2BVQB 5EC1B 5L2JA 4XVSL 2PR4L 1FGVH 1NGZA 3S3PA 3CL3D 3NZSA 4P4KD 4B9ZA 1FZEA 4X6CF 4Z3HA 2X12A 2NQCA 3MV9E 1U93A 1XIWD 1T3UA 4HSCX 1RIVL 3UEQA 2KMWA 5JW5A 5KBNC 3VU1A 1QI4A 2NSXA 1SUJA 1AZCA 4RGNE 4JPVH 1F3RB 3FTWA 3MFFB 4M62H 4L3CB 1R4XA 1U8JA 4LLMA 3HE4A 5F7BA 5CEZH 1RV6X 5JA9A 3VW3H 3UBXA 4CC1A 1E5CA 1OM3L 2DBJA 3KPRE 4MYWB 5HY9B 1OEZW 4JFVA 2X4TB 3MLYH 2DWYA 1Q94A 2Z35A 3ZTJH 1AGFA 3RTQB 3HHSA 3ZXAC 1J8HD 1IM3A 5TGBA 1B0WA 2IDFA 3S37X 2BP0B 3LH2L 1EFQA 5GZOD 4JM2C 2ZXEB 1NVOA 3VO0A 2X4OB 1ZAGA 3PAUA 2DWEA 2CPUA 3CCHB 2BY3A 2NY7H 2WLZA 2BFVL 3MMEA 1OWRM 5LWYL 3CCEP 1YNTB 2AQRA 5CCGC 4YPJA 4GMTH 3EHBD 3S36L 2QFPA 3WL9B 2A2QT 3KGRA 3P7KA 3SPGA 4MYPA 2VR3A 3QIUA 4UT6H 3M9BA 2NY1B 3UYRL 1GC1L 2G4GA 4OCXL 3E38A 3LCYA 1B2WL 5E4AA 3TF7C 1SXZA 4YX2L 2G5RA 4U1JB 5F7EH 2HKFH 1IKOP 1AJ7L 1RZ8A 3TFKD 3H53A 4MDRA 5A2LH 5BV7H 1RK0A 1N6UA 3MGTB 2K7PA 5C6PB 1LEIB 2ZKMX 4NQCA 3LRGA 5FGBC 1LYQA 5ISZE 1ZHBB 2CIKA 4HS3B 4HUWB 1RZJL 3GJFK 4DGYH 4HOZA 5L0QB 1OXZA 3LYRA 1ET7A 3IXAA 2MHAB 4KOCA 4G8FA 2VDLH 1JF1A 2E75C 1H6UA 1TJXA 3BZDA 5E2VL 2QJDA 2CJ3A 1V3KA 1PAMA 1ZK9A 4R0LB 3SE8H 3IFOB 4L9DA 3GHBL 4HHWA 4E9VA 2N9YB 5C0NC 1PMYA 3W0WE 2R0KL 4OU3A 2J6EH 3UGEA 3F7VB 2QHRH 1V3LA 1YNLH 2NY5C 1N2RA 2HRGA 4UB8H 2RAMA 2EE0A 4NKDB 3VXUD 4GJTB 4L05A 3S88H 5HYJA 1GGIH 2O6CA 4PCTA 2EIZB 4DZ8A 4HXAH 1MCSA 5CLTA 3I02A 2YBRB 3DA0A 2RKLA 1P7QD 3CSTA 3DVFA 5HVGB 2NY3C 4DO6A 4G5ZL 1R34A 3PWPA 4HISA 5CXPA 3STZA 3WXVL 4NT6B 5IMMB 5J57B 1XZ0B 2NX5A 2J8OA 4X8GA 2X4QB 2PXYA 4FNPA 4G72B 4WFHE 1P6FA 2GK0B 3MYZA 4XB8A 3U46A 4W9JC 1GL2A 5T1KB 4EN3D 4ZFOB 3ZU8A 4AC2A 1FNAA 6PAZA 1QWHA 2XFGB 4LSPH 4HZ1A 1YNKL 1ZHNB 3PDGA 1QL1A 3CSPA 3S9DB 2WCSA 3LIUA 4ZUSA 2AJUH 2X4SA 3D4CA 4MJ4A 3H1ZA 4OZFB 2H1LM 5EUOB 5I1KH 5C2BL 3ZBMA 4FQXB 1R3KA 2K8QA 3HNTL 3U4EB 3EDKA 1DVYA 1FDOA 5DJ8A 4GG6F 4AZ8B 4AUWA 1CGVA 3CHOA 4M7LH 1UZ6E 3ILPA 2BWIA 5ELIA 2YXMA 4DZ8B 1UM4L 2Y3AA 3PQYD 1IAKB 3VDCA 1P7KA 4QNPF 1HWGB 3V4LA 1T1XA 4XBGA 3RVXC 1BIIB 2DLGA 1NFDF 1OW7A 3OLIA 2VLJB 4EXPX 2R8SL 4KXZH 4OI8A 1JD7A 5SX4I 5KZCD 5DJ6A 1OB0A 1X6NA 3JWDL 5CUSH 4NHUB 5J6HB 3LKOB 1JNHB 4NN6B 1UZ6F 1I7TA 1BFVH 1TO4A 4IL6X 3GSUA 3SGKA 3LPGA 1EVTC 1OP3K 3BUTA 1AI1L 1BCIA 3CX5E 1AHWB 1XAKA 2JI2A 1JGUL 1SQVJ 1L6ZA 3DSFH 1AGEA 3JTSB 3AU0A 5LN4A 1QVGO 1BVKA 2ICEA 3BCFA 4M1CD 5KAQF 3BVNB 2ZAHA 4F9PA 3HZVB 2IEPA 4YGVB 3SDDB 3PHLA 2QTEA 3U1PA 3VUAA 1AJ7H 4F1ZA 5C0GB 5ICUA 4LBAA 1MFTA 4I77L 5AQ0A 4LMQE 3HFFA 5DVLA 2BVOA 3BIBX 1LP9E 4LCWB 3S5YA 4XCNB 4L2YA 4LSQH 1HUCA 2WC7A 5C09B 4LAJH 4FQ1L 4KO7A 5F7NC 4KVNH 2P5EE 3GJFB 5KYXB 3ULVC 3TT1H 4KAQH 2BVQA 5F7DA 4UCFA 4X0KB 2X10A 3MXVH 1OE1A 4WEBH 1HDMA 2WXJA 1RZJH 3GMAA 3NFPB 1KCUH 2QPSA 1PKQA 2JWDA 2YO3A 1N19A 1NU1K 1DN2A 4E42A 1GHFH 1KGCE 1GW6A 2VZVA 1OK8A 5F9JB 3LIEA 3CXHH 5AW9B 1Y07A 3F04A 2ICCA 4NN7C 3SDYH 4AYID 1NGQH 2R59A 1LO2H 2XUWA 5HGAB 2VE6A 3ZL4H 1UWYA 5DUMH 5KSAC 2C9XA 1UWGL 1PPJE 1YUKB 1A8ZA 2X9ZA 3NSFA 1MI5A 2ZWKA 1F41A 1ETJA 2C1PA 3IRCA 4TQEL 3LNGA 5HHMD 3TCTA 5SWSB 1A3LH 1KJMB 4AUUA 5DR5H 4O58L 4OD1H 3BWUC 4W9LC 2JR8A 1E4WL 5FYLH 1DHKA 5DYOA 4U3FJ 4BRYB 1R5LA 3J2PA 5BRZE 4LLYB 3R7QA 2ZXAA 4UTBA 3QS3A 5D2LA 5FHBL 4OF0A 5KS9E 1U93B 4ANWA 5DD6A 3C08L 4HK3J 4L3EE 3MV9A 4B60A 1NIBA 3NIGF 4WFGE 1G6RB 2YRPA 3S4SB 3BSZA 1T1WB 2EDBA 1TEYA 3MYJA 4NCDA 4QRRD 1ZA3B 3TSIA 3DROA 4AQEB 3TGUE 1BA9A 2ZIDA 2OCCB 3RB5A 1XSKA 4J3TA 3DYOA 2QADC 3CVHH 4M7LT 4FTVD 3RY6A 1YEKL 3KYKH 1E43A 1ZPLA 1GW4A 2VLRD 2ZONA 3RX5A 4E2OA 5F7MC 4WRLA 1NCDL 1JF6A 4LBEA 2CJTA 3U9UA 3Q3GA 5I1JL 3QO0A 1G0DA 4LSUH 1SEBB 1PDKB 2BMKB 5IT2L 1KXVA 3B2VH 2E56A 4BDVA 3CHXA 1CU4H 3FQNA 5F2FA 1JOIA 1UH3A 2I9TB 4HWBL 3BQUA 3CH1B 5HJDA 1LEKB 3KXDA 1ZIAA 4IRZL 2H0JA 5A16A 2QPEB 4FI6A 2MNJB 1BFVL 3A0BE 1JY3N 3G9VA 1EZVY 2VDPB 2D31A 2B1AH 2Q1EA 2H8PB 1UD2A 1IJNA 1QFWI 2E59A 2F0CA 2AJ3B 4LOEA 5I71B 2VERN 4BE6A 5DJAB 4J3OG 4NQSA 4PWGA 4JPIA 2F61A 5AAWA 1D5MA 2GJ6A 5FGBA 2WOBA 3FTXA 1KB9H 4UBDD 1MJJB 1TVHB 2IADA 1DVUA 1QZNA 3LKQB 1ZY9A 3ISYA 4M3HA 2BCCJ 3MRKA 3EIFA 3FH8A 3VFSB 5HDRA 4CGTA 4WFFE 2FR4B 3BOVA 4LCUB 2NRDA 4Y2DB 4MXWL 4I13B 4PW4A 2IGFL 1NMBL 2RCSL 3CDGA 4H25B 1UADC 1H15B 1XV8A 2GUOB 4DZOA 3DLQR 4LSQL 3EDDA 1J5OL 4MB3A 1OAYL 2FL5A 1UH4A 2FGZA 4HXBH 1F1GA 3QNXB 4LP8A 5ISZA 5C9KA 1FVEA 3F12B 4X4ME 4H5SB 1KQGB 5DRWB 3BQUC 3HEIB 3NXSA 2ARJA 1G5GA 2CIIA 4A6YL 1UENA 1M2VA 4KMQA 2YKPA 1FYTB 4I3SH 4GO8A 3D85B 4OZFH 2FJSA 2J5UA 3EOBB 2W8CA 5DQJB 4KDTA 1TJIH 1MHCB 1U8HB 3WN5A 1AKJD 3MLSH 4XWGH 1AQKH 5IBLD 3PF2A 4RNRA 4A7UA 1BQLL 5LXGH 2JWYA 1CGYA 3W2DH 1KBVA 2IMNA 2OCFD 4OZFA 1LNUA 2XQYA 1EDIA 2AK1H 4K3GA 4ZMLA 1ECYA 2HT3C 4WO4C 1YECH 2RA1A 1SQQD 4R8WL 5EFWB 2FECI 5I5MA 3DMMD 4NN5C 4NS0A 4BZ1L 3C60B 4PRBA 3TOPA 3WNKA 2H0EA 3V4UL 1A1NB 3PP3H 4J3OC 5EBMA 3CFJA 4LDLB 4YR6B 4OR1A 3NIFF 1AMYA 3GTTA 2DQTH 4Z7UE 5C0IA 2O1JA 1L7IH 3MHZA 3GSVB 1JRHI 3OJMB 1E27A 3GSOB 1E4XL 4BEIA 3F7KA 3IWUA 5DHVB 3SOBH 3SYAA 2D7OA 3FXEA 4TVPD 3MO1A 4CW1A 1HXYA 2DLFL 3GSXA 4RMQA 4OKDA 1BF5A 1FLRL 1D2PA 2HVJB 4LK4A 4NO5B 2N9BA 4N2KA 4MMZC 1G7MA 5DZNA 2VDLL 4N2GA 1OOWA 4XB7A 4EZMA 5EWIH 2F5AL 3VGGA 2WKLA 2FYVA 1M4KA 3PL6B 4U1SB 4GAGH 5C6WH 3RTQD 4TL5A 2PPCA 2YD2A 4LSUL 1SLVA 1EDQA 4AGOA 3PHSA 4LRNL 4EKJA 3GO1L 3O8XD 2WIIB 2FATL 4G9DB 4P8QA 5CGBA 4B97A 3TBSA 4H44C 3A4EA 5BS0A 2OSLA 3FT4B 1GZLA 2LTQC 2QSTA 3HIZA 3EO0A 1YEHL 3H32B 5C0EB 1E5ZA 1KQFB 3WTUA 4R90H 3II3A 3KPRB 1VRSA 1JUFB 2OTWA 4LL9A 4PJ8B 4OV5B 2WZAA 3TM6A 4ELME 5DJ2B 5KSAD 1SOSA 4YQXH 3X14B 1DBJL 3AGWA 2HFGH 2ALWA 2W92A 2QJPB 4JQVA 1QLED 5SX5H 5FX3A 1MQKL 1YNTA 2CLVB 1JZEA 1SYVA 1TQWA 3CVIL 4WI6A 3OB8A 2IANB 3QDAA 3CFNA 3K74B 3RI5K 4U1IA 2ZG3A 1MFDH 5D2NC 1G7QB 4PJIA 2YPLD 3JWNG 5T5NF 4JQIA 3WEMA 5JW3H 2J2ZB 1EHKB 1TDQA 3BKCL 2DMKA 2P5EA 2CUHA 2M0BA 1G0YR 1ZOYC 1FAIH 1U41A 2H41A 3HNTH 2ITCB 2DBLL 5I74C 3V4PL 3EQ2A 5DJDB 2VQ1B 2X4TA 2HA1A 2YEZA 4GAAA 4HK3N 4L4VD 3TBWB 2P24B 1KIQA 2Z0UA 3QVAA 3HMXA 2VJ0A 4LFHG 4QF1A 2OZ4A 3P2DA 3KLHD 1IC2A 3LXCA 4LRIC 5GGSY 2WLNA 4BUQA 2J12B 5E00B 4QAMB 4BZ1A 4PJFF 1TU2B 2UXGA 2GI7A 1DD3A 4WWKD 1YTZT 4FG2A 2IPUG 3IJYB 1RXLA 5FYJL 3U30C 3H9YA 3L75J 4TV3A 3QUZA 4OQTH 4FDWA 5E08L 3RA7H 4UB0H 3MLWL 4ZOEA 1QQDA 4KK6D 5CCHD 4QRSA 4R8WH 4L4VB 1Q9WB 5CMZA 1QLEH 3HMWH 4PR5A 5LQBL 5GS0H 1AXTH 2X2UA 4XP6H 5CZXC 5BRZA 4K7FA 4NN6C 2G9KA 4YUEL 4UYPA 4KZDL 2YXWA 5D2LE 3OR6B 2AW2A 5KS9A 4O9HL 4TTDD 4L3EA 2DQTL 3CFBA 4DP7X 1PGJA 1GD2E 3L9YA 1KF9B 2Z34A 3B7UX 1JTOA 1EGJA 4F2MA 1MNUH 1XD0A 4IQHA 3HI1B 2ESVA 4QCIB 4IFDK 2OXGB 2WCGA 5IFHH 5I23A 4J8RA 1KIRB 2XCMC 5E1QA 4XVOA 4KGJA 2FFDA 1AR1B 2OYOA 4PBWD 4NZTL 3LZFH 3MBED 2HLFC 4ONFH 4X9GA 4DKAA 1G9NC 2DQFA 5H94B 1RZIB 2CJSA 4P9HH 3GJFH 2ADFH 1G7LB 1KCUL 3A47A 4UQAA 4DZBB 2E74C 1K8AQ 2N0KA 1SLWA 2J5WA 3LQAL 2P7TB 4GQ9H 1RLWA 2VQ1A 2YEZB 4OZFG 3ABGA 1N6QH 2MKVA 2YD0A 4LCIH 3K6SB 2OMWB 4M29A 4YSDA 1FN4A 1ETA1 2X44D 4NZJA 2AZAA 2AV7B 2XXFA 2ITFA 1NCBL 3EHBB 3ILEA 3NFNA 3AE5C 3CIQA 1CFNB 3O6MH 1LWUA 3BEWA 2FATH 2Z93B 4MLSA 4L3EB 3JV4A 3IFLH 1QLRA 3IKKA 4K2UL 3VVVA 4GP5B 1E8ZA 3MKGA 5AW2B 2I1KA 4JPKL 5DZ9A 3RNQA 2Y5EA 3T4YB 4X99A 1DVTA 5EH1A 5IIEB 1QW9A 1KGJA 1CL7H 5HHVH 3RVWD 4DESA 5IHZB 2DJ4A 3BZFB 1RJLA 1BBJB 3KE0A 2NUPB 1YYCA 1IBBA 3WEXA 4MLIA 4AM0A 1D9KA 1U8KA 1M90Q 3SO3B 3JSVC 5IW3A 3OZKA 2O01J 2WY3B 3RTLA 4WI4A 2DWDA 4M61A 5BNXD 4G7RB 4X4MA 1ZS8A 3A0HH 3TBTA 1JK8A 3HHRB 3D18B 4HJIA 5DU7A 4LIQE 4U1MB 2WANA 1JUNA 2CO7A 2J6WA 3ZE1E 1I1RA 1RQUA 1WTGT 2WUBL 3O3AB 4U0RB 4ZX3A 3ML9A 2Y7NA 4J8QA 4UQ2A 4W9ZA 5IR1A 4DEPB 4JFSA 3GUFA 4MB4A 2DBLH 3VXMD 2IPUK 2APTA 1EANA 3QK0A 2AK4E 2HH0L 3HCVA 1YEGL 2EEAA 4AMXA 4KHXL 5M95B 5DFWH 4ES9A 1G7MB 5K5YA 3F85A 1RH8A 4UIKL 1TVBB 2VQUA 3R8QA 2TRYA 1CYWA 2XWTB 2VXVH 2VDRH 4HA1A 1IC4H 3FB6B 4JDVB 4YEEA 4J5VA 3V5DB 2HPCB 4P23B 3TWCL 2IDUA 1HQRA 4OZ4A 4XCCL 1F11A 3MNWA 5B7MA 4R7XA 5AYUH 4N8VA 1PZ5B 1SDYA 2B0SL 5DHVA 2FH8A 3QNZA 3ILQC 4LVOC 4DCQB 1ZV9A 3VWKA 3ARWA 1Y18A 1F02I 2JVUA 3NAAH 2F58H 4QHNA 1JHTA 2PMZA 3D25B