2R5DA

Structure of the gp41 n-trimer in complex with the hiv entry inhibitor pie7
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
b'RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gp41 N-peptide
publication title Potent D-peptide inhibitors of HIV-1 entry
pubmed doi rcsb
molecule tags Viral protein/inhibitor
total genus 20
structure length 45
sequence length 45
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2r5dA00
3VMXA 1A02F 2N9BA 3P7KA 3NFQA 1CSBA 1NAFA 3L36A 5AW1B 3LIEA 1MV8A 3KDPB 5AVXB 3HTKA 3OAKA 2WPRA 5AVTB 3V5BA 3VMYA 4C7NB 1KQLA 2XZRA 3NMDA 4LC1A 5AW0B 3T97A 5APVA 3A3YB 2ZXEB 2BASA 3NTNA 4KHXA 5AW6B 4M3LA 3HE5B 3B8EB 5AW9B 3SWFA 2R32A 3MD0A 4JYCA 5APTA 4C7NA 4EOTA 2YO3A 3O8ZA 2ZFCA 3A7OA 4HYTB 1JUNA 2IPPA 5AVRB 1OXZA 3M91A 4AYCA 2W6AA 3P8MC 4C46A 1JNMA 5AW3B 3I5CA 1H89A 1FAVA 1HUCA 2C9NY 3NXSA 3HE5A 3M9BA 5APSA 5AVVB 1CI6A 5AVQB 3L37A 2W27A 1H8AA 2P7JA 2Q3IA 1T2KC 1HJBA 1HBWA 3HE4B 3VMZA 1GU4A 5AW4B 2P2UA 1X8YA 2Z5IA 2WT7B 1SLQA 5AW5B 2P67A 1GTWA 1IO4A 3UIAA 1GZLA 1GD2E 1YYCA 3KQGA 5AVZB 3M0DA 3P32A 1H88A 2E43A 4GKGA 3HE4A 1MUUA 2WPSA 5AW2B 2YNYA 2R5BA 2WT7A 2C9LY 1T2KD 1GK6A 4GT1A 3TNUB 1SP4A 5AVSB 1GU5A 3V4QA 3LIDA 5CMZA 5APUA 4XE5B 1GK4A 1FOSF 2E42A 1G2CB 3M0AA 4B86A 1FOSE 1HWTC 2YO2A 2WPQA 5AW8B 3A2AA 4RESB 3TNUA 4DZOA 1NWQA 2JJLA 4I6MC 2XV5A 2Q7CA 2H7HA 5APWA 3TK1A 3M9HA 2Z5HA 3A5TA 3TYYA 1CZQA 5AW7B 1MFZA 1A02J 1DH3A 3VN0A 2WWWA 3VYIA 2KP8A 5APXA 2Q5UA 3V4WA 4JYBA 2QM8A 1S9KE 2XU6A 4AUWA 2QM7A 3IR9A 2WTYA 3M06A 2R5DA 1J2JB 2R3CA 4I2LC 2VRSA 1S9KD 5AVUB 3L35A 4AQRD 5APYA 1CI6B 5AVYB 1OWAA 3MGNA 3VTPC 5AVWB 5APQA
chains in the Genus database with same CATH superfamily
4UB6E 1BSHA 2HG5D 2C0XA 2K37A 3G71P 3H1IE 2AXTH 4XFJA 4K35A 3B4SA 1FDOA 1P84I 4W7ZA 1N8RQ 4DT0A 3HE5B 3O8ZA 1X9VA 2J59M 4HYTB 2W6AA 1IZNB 1DIPA 3KZIE 1BE3D 1E79H 1FZGA 2WSFH 2SPZA 1VQ4P 2ZT9D 2L5GB 2XDJA 5M1BA 5KLVJ 1N7SA 5AVZB 3G3ZA 1PZQA 1IFDA 4GKGA 3FGAD 1JY2O 3N4XA 2K9JB 1GK6A 1S5LX 3P8CD 3V4QA 3FXDA 3CCEP 1BE3G 1FOSF 1KN7A 5B66E 1N7LA 3EFGA 1SQBE 3VP8A 1RF0C 2QG4A 1SQQJ 1NTKD 2KSJA 1SQVG 4WWIA 1JCCA 3D6ZA 3RK3D 1NJIQ 1VQOP 1T6AA 4AUWA 3M0DC 1FU1A 1Q82Q 4H0LB 2Y0DA 1NU1D 3M9QA 4GIFA 2KYVA 2CPBA 5CCGC 1NTKG 3L75D 3SWKA 1NAFA 1AV1A 5CJ0A 2OTKE 3USSA 1MV8A 2GUVA 2Q1KA 1NOHA 1VF5D 1EXJA 4C7NB 2QJKB 3T97A 2HFED 1MZ9A 3A3YB 2IZ1A 4KHXA 4N6JA 5KLVK 1KYOI 5APTA 1NU1G 1PP9E 2J5UA 1ZN5A 4C46A 1EZVE 1EDIA 1GW4A 1H89A 2JDIH 2B87B 5CCHD 3HD7B 1IFNA 3MUDA 1HJBA 1NO4A 3VMZA 5AW4B 1JOCA 4H0LC 1SQQK 5CCHC 3KQGA 3CWBD 3OA7A 3P8CE 2IBZD 4ZMDA 4HB1A 4N78D 4RJTA 1T2KD 1LP1B 3TNUB 4GOEA 1KQGB 3LIDA 2YMYA 3CC2P 2QJKC 1U7JA 3C9IA 3M0AA 1HWTC 3HRNA 1VQMP 3GF7A 1JO5A 2KNCA 4WB4A 3B5NA 3RK3E 1FJPA 3L72D 3HD7D 2IBZG 3CMAP 2KP8A 2A45H 5C39A 4U3FJ 2YKQA 1L0LJ 2W90A 3HD7C 2O1KA 1JY3O 3L75E 2FYUK 1RF1B 2NRGA 5AVWB 1VQPP 3VMXA 5KJ7C 3L73E 1BCCJ 1G1IA 1GMJA 1DEEG 1FC2C 4WY4D 1URQA 1KB9I 3S4RA 3HTKA 3N7NA 3VMYA 1P84H 1GL2A 3RL0C 3SSUA 4JQ0D 3GLMA 2E5YA 2OYIB 4IL6X 3P8MC 1M7LA 3I5CA 1LWUB 4HKZH 3CWBE 1SLQA 3CX5I 3CL3D 2JEEA 1GD2E 4N78E 1NVOA 3CCMP 5CJ4A 3AE4C 1MUUA 2BEZF 3KHUA 3G9RA 1L0LK 2ZVNB 1OVUA 4PD4I 4JPZB 3CCQP 2WPQA 3L72E 4K3AA 2N1TB 1BDDA 1IJDB 4IFDK 4H44B 1RY3A 3BCCJ 2OYIC 3RBXA 4EIJA 5KLVD 1LWUC 3B71A 3AE9C 2KLVA 4YXWH 3WUTA 2WSFJ 3VTPC 2K1AA 1RE3C 3Q5RA 3TDKA 5L8RJ 5TISE 1SQQD 3KDPB 3VMAA 5AVTB 4RO0A 1QL1A 4LC1A 5APVA 1XTGB 1KYOH 3SWFA 4EOTA 3GF3A 1BE3J 1KILB 2N1TC 5GTIH 1LTIC 2JKVA 1DEBA 4HJGH 3H32B 4H44C 4AYCA 3KPEA 3M9BA 2WPVB 2JWAA 1SQVJ 3L37A 2E5TA 3E1RA 3PTZA 3MTUE 4PJ0E 2PRRA 1IO4A 4Y28J 4OVNF 4OGQB 3MUDC 1PIXA 1KFMA 5AW2B 1S5LH 3KYQA 1LT9A 2FYUD 1YIJP 1NTKJ 1KZUB 1G2CB 3L70D 1FOSE 5KLIB 4WVZA 3PJSK 2Q7CA 4I6MC 3S9OA 3CLQA 2FFDA 5KLVE 1H0TB 1AJYA 1KILC 2CK3H 1QVGO 4W80A 3A0HE 3V4WA 2FYUG 1BSNA 3L70G 1OMIA 1Q7YQ 4EYYQ 3MGNA 1MFTA 1SQQE 5KAFH 1OVVA 3HUSA 2N9BA 1RQUA 3NFQA 4OGQC 1KB9H 2WSCH 3IN6A 5CHXA 1JTHB 4ZNCA 1SQVK 2Q6QA 2FXPA 2Y0EA 1J1EB 2ZXEB 1ZOYC 4U3FD 1VQ9P 1L0LD 3B8EB 5CBNA 3OW2O 4JYCA 3JCUE 1EZVI 2YIUB 3A7OA 1SVFA 1PGPA 2IPPA 3EFFK 3SWYA 1SFCD 2KIKA 4DCKA 1R5SA 2W27A 2P7JA 1BCCD 2LXCB 2B9BA 3CX5H 3HE4B 4WBAA 2GM4A 2P2UA 1X8YA 4EI2A 1KFNA 3EWKA 1L0LG 1H88A 2WSSH 2WPSA 2IYPA 1SQPK 2YKOA 1PGJA 2FYZA 2HODA 3GMAA 1S4XA 1GK4A 2O01H 4PD4H 1YJ9P 3F5HA 1VL2A 2ITAA 1J1EC 1JMMA 1QVFO 2XV5A 2H7HA 2WSEH 1DD3A 1CZQA 5AW7B 2KUBA 4Y99B 2KS1B 4JYBA 2WMMA 1OW8A 4PV1B 1MKMA 4UB6H 1AVOA 2JP3A 3H1HG 4OWFA 4YXDC 2O01N 4LGDE 1CSBA 1FDIA 1N2DC 4BWNA 4UB8E 2V7QH 4KT0J 4U3FE 3BCCD 1KORA 3H1JJ 2BASA 2IFNA 4W7YA 3CC7P 3GHGB 1KC8Q 1ZRTD 3KZIH 1ZR4A 1BGYD 2CPSA 1BCCE 2Y9ZA 1M1JB 3SFDC 1Q86Q 4Y99C 5AVQB 1JB0J 3CCLP 1VQLP 3BRVB 4PV1C 3BCCG 5AW5B 1GZLA 4WY4A 4I1LA 2FKWB 3OJAB 2C9LY 2WT7A 3H25A 1BGYG 1KQSO 5B66H 3CCRP 1RHZB 1FZCB 4IL6E 1VQ8P 1OIPA 1JY3P 4DJGA 1R5LA 4B86A 1AQTA 1NKZB 2OYHB 2QIWA 3AE6C 1SQVD 4OH8B 3GHGC 1VQKP 2IDBA 3RBZA 2I1JA 3V2PA 1N73B 2XNXA 1OVRA 4HH2A 2M3EA 2IFMA 1M1JC 4NPDA 2OQQA 3V2QA 3I56P 1XTCC 1KMIZ 1NH4A 5APQA 1NTZG 3VP9A 3IF4A 2OTLP 1T3UA 4TLFA 3F89A 3AE8C 2A06D 2FYNB 5AW0B 1FZCC 2JO1A 3H1KD 3V2RA 5CCGD 1EC5A 5E79E 1SQPD 2W8ZA 1QEXA 3PHLA 4L73A 2OYHC 1U57A 1JUNA 2OTJP 3M91A 4ZKUA 1YQ3C 2C9NY 1N73C 1HTLC 4TT3H 1LJ2A 1J1DC 2A06G 2H8PD 1VQ7P 2R3SA 2K88A 3H1KG 2IX7C 2RMZA 3L71D 2BCCD 1JEKA 4LLHA 1FZAA 1GDTA 1SQPG 2FYUJ 2E43A 2M3BA 1BE3E 1E5WA 3L70J 1VPCA 2M0BA 3E1IA 2R44A 4H0LD 5BU5A 4Z1MH 1SQVE 1M57D 4GDOA 2FYNC 2J58A 2NPSB 2IYOA 3II6A 4DOJA 3L71G 2BCCG 3TSIA 1RQVA 1PFIA 3A5TA 3WU2E 2JWDA 2HPCB 3PRJA 1L4AB 5B5EE 2AXCA 3VYIA 1LTJA 2Q5UA 3RL0g 1W2EA 1NTKE 3AEFC 3GG2A 3RL0B 3RGUA 2A45G 3CMEP 3LIEA 2RKLA 1NTMG 1WT6A 1UIIA 1NU1E 5KJ7D 4YPCA 5AW6B 3AEEC 2NPSC 1L4AD 5DJUB 1D7MA 2WSEJ 4BRYA 1L4AC 1M1KQ 1T3JA 1N7SB 3RL0D 2UWJE 3R2PA 1HBWA 3FX0A 1ZW0A 3VOPA 3H1LG 3ABVC 1YYCA 2GUSA 2QRXA 1LTTC 3BVHA 2E76B 3H1JD 5KKZB 1FJKA 3Q1MA 3EQ2A 3H1HJ 5KAIE 2YO2A 3CXHD 2IBZE 3A0BE 1PGQA 5BU8B 4N3YB 1KQFB 3H1JG 1N7SC 3IAOA 2R3CA 1S9KD 2E76D 3E7KA 1PV3A 5TISH 3ZDMA 3T97B 2V4HA 2E76C 5KKZC 4EDFA 3L36A 1KYOD 2WPRA 3FXEA 4D6TG 1FDMA 4NPEA 2QEXP 3L74G 1L0NG 1BGYJ 3NTNA 1HH0A 3KXDA 2C0WA 4I7ZB 5AW9B 1K05A 1LT1A 3AE1C 3WUUA 2AEJA 1JNMA 3PLNA 4PJ0H 2E75B 1H8AA 2N1TD 3U1AA 3FWNA 1TU3F 4H44D 2M5AA 2B89A 1T8ZA 3IFMA 4GT1A 1GU5A 3G4SP 5CMZA 2KNCB 3CXHE 3B5NB 1NTZJ 3I55P 1ZXGA 1PP9J 4RESB 3MZWB 2JJLA 4I7ZC 3K5BA 3A0HH 4L75A 1Q81Q 1PPJG 1W2BO 2WWWA 2LXBA 2QM8A 4JF7A 1S9KE 2MJZA 2E75C 1KILD 1URQB 3HTKB 1HVVA 5DJTB 2OARA 3H1KJ 5BVZA 1GL2B 3TGUD 2RN0A 5AVXB 4BXLA 4KJMA 1SQPJ 3B5NC 2FXMA 3JCUH 4GOFA 1SS1A 4OGQD 1AQ5A 1Q2NA 2NZ2A 2QVAA 2ZFCA 1RF0A 3L71J 3HE5A 2BCCJ 3NXSA 1AVYA 3TGUG 1NTZK 1URQD 1M8OB 4ASVA 1QX8A 2LKMA 3MHVA 1GTWA 4NPFX 1URQC 4GODA 3L73J 3M0DA 3GW6A 5H2FE 3FWLA 3D70A 1HF9A 1YBKA 1NGMB 1OFCX 2AEMA 2FBWC 1GL2C 5CCGA 2YXRB 2PP6A 3QWOC 2K9JA 3D6YA 3AEBC 3M9HA 1NTMJ 2FYUE 3Q5SA 1SQXG 3L70E 2PAJA 1KILE 1Q90D 2I1KA 2QM7A 1QLED 1S3JA 1KTMA 4A7PA 3H1HD 2W6BA 4IOIH 4H13B 2POHA 4UB8H 5CCHA 3SFEC 3AE2C 5CBOA 3H1LJ 3W67A 5GTHE 1QGKB 1KQLA 3NMDA 3H1IG 3CCVP 2R32A 4C7NA 2LR2A 1YJNP 1WMKA 1QL2A 3C8VA 2KXPB 5APSA 2ZYGA 2QA4P 1S1CX 1L0LE 1DX7A 3QH9A 2B87A 1LT9B 1LNQA 3HD7A 1NTMK 2KZJA 3P32A 1WRGA 4H13C 2YNYA 4IL6H 2OYOA 1EDLA 4PV1D 2H89C 3H6PA 2E74B 1X0TA 4XE5B 2FFDB 2IBZI 3BRTB 1LP1A 2Y0CA 3TNUA 2FY8A 4D6TJ 2ZT9B 2Z5HA 1SQBG 3L74J 1L0NJ 3LW5H 3ITKA 2XU6A 3HUSB 3H1HE 2WTYA 2ZYDA 4RKUJ 1YITP 4I2LC 2VRSA 2YXQB 3PP5A 3MP7B 5APYA 2G8YA 5AVYB 1OWAA 1Y9BA 4O9BA 1LT9C 1NTZD 3VN0A 2E74D 1PP9D 2WITA 3BASA 2QJPB 4QMAA 1PL5A 2IZ0A 5E79H 1RF1A 1J1DB 1KD1Q 1EZVD 3RK3B 2E74C 1EQ7A 2FFDC 2AXTE 2YKPA 2KLUA 3TF5A 2KI7B 1Y47A 2ZT9C 1ZMEC 1OZHA 1IK9A 1PP9G 2KZIA 1S72P 3BCCE 5AVVB 1CI6A 2Z4EA 2N9YB 1EDKA 3Q3DA 2OYIA 1EZVG 2HYNA 1VF5B 3HUSC 1HJ0A 3CI9A 1ZRTE 1LWUA 4XA4A 1FZFA 3CD6P 1BGYE 2K3RA 2HODB 1K8AQ 1L0NK 3CCJP 3CXHI 2HR3A 1SP4A 5AVSB 2QJPC 1YI2P 2Q9IA 1RE3A 1HGZA 3O6QA 3RK3C 3WMM0 3RK2B 3V6IA 3WU2H 4DZOA 2H43A 5B5EH 3AEGC 2JR8A 2QJYB 5APXA 3L73D 4R4MA 3S1KA 2N1TA 2WSCJ 4YTPC 3IR9A 1KV4A 1L2PA 1NTZE 1IFMA 1VF5C 2KB7P 3L35A 3TGUJ 4IFFA 3P7KA 1JMBA 3L75G 1IFIA 5AW1B 2XKMA 2W83C 1NKNA 1NTMD 3V5BA 2XZRA 3L73G 3RK2D 2WQYC 3RK2C 1JY2N 2YO3A 2KK7A 1OX3A 3BATA 2A06E 1P84D 2P1JA 2QJYC 1FAVA 1HUCA 3H1KE 2NPSD 4WY4B 1KILA 1SQPE 1T2KC 3H32A 2WT7B 2O01J 3H1LD 3UIAA 1SQXJ 2Y9YA 1FBMA 2XNDH 1K73Q 1S2EA 2KSEA 3CWBG 2Q3EA 5KAIH 2M8RA 3D71A 4JBZA 2HLOA 5APUA 3L71E 1K04A 2BCCE 2RH0A 3AEAC 3A0BH 5AW8B 1RE4A 2P10A 1K9MQ 1FZEA 1X79B 2L91A 2K9YA 1G2CA 3L72G 1A02J 3H1IJ 1OW6A 1W5CE 1H0TA 4WY4C 1HGVA 1J2JB 2V7QJ 2O3JA 4AQRD 1CI6B 1IK7A 5TJHA 2AEFA 1SFCA 1A02F 1NTME 1Z56A 3AECC 4ZKPA 1N7SD 1ZR2A 1NHLA 3L4FA 4D6TD 1USEA 3L74D 1L0ND 3R4YA 1JCDA 2I8DA 1FS0E 1SQXK 1JTHA 4M3LA 1R8EA 1P84E 3MD0A 4CPGA 1RF1C 1ZP0C 3O6QB 1OXZA 5AW3B 3LW5J 2OGUA 3H1LE 4IFMA 2PFXA 1SQBJ 4MN4C 3C1LA 1AFOA 2Z5IA 2ZXXA 3JSVC 2P67A 2H88C 1G1JA 3Q2YA 3HE4A 3CXHH 2R5BA 4L74A 1JY3N 2E42A 2ZYAA 4L76A 1LTJB 2PGDA 1DD4A 3H1JE 1NWQA 3TK1A 1PGOA 1VDFA 5APWA 1VQ5P 1EXIA 3U1CA 1PPJD 3MIWA 2WVRA 1MFZA 2KOGA 1X22A 2WZ7A 5KLVG 1EDJA 2B88A 5KTBA 1LTGC 2BEQD 3M06A 2R5DA 3AEDC 1NAYA 2KS1A 1VQNP 1M56D 1IFJA 4D6TE 1AA0A 1IFPA 3L74E 1L0NE 2W6JH 2E75D 1ZV8A 1CW5A 1SQQG 3V2NA 1SQBK 1YJWP 1FE6A 1BDCA 1N86A 1FZBA 2O1JA 1LTAC 4BRYB 1NYHA 1KB9D 1LTJC 4U7JA 1U7MA 1LGHB 3CPWO 5AVRB 1KYOE 3B5ND 5GTIE 3GHGA 2QSIA 4C7RA 1GU4A 1OW7A 5H2FH 1GW3A 1M1JA 1LTSC 3WUVA 2GA1A 3CX5D 1NU1J 1SFCB 3PH0A 3AE3C 3JC22 1S5LE 3L75J 1PPJE 3A2AA 1FZCA 1GL2D 1USDA 1M90Q 3TYYA 3CCUP 4PD4D 2QE7H 3CCSP 1YQ4C 1SQXD 2OYHA 1RE4C 1YTZT 3CC4P 1LTBC 1N73A 5KLIC 2G3AA 1IC2A 1JY2P 5GTHH 4R4LA 5KAFE 1NTKK 3OAKA 3CWBJ 1KB9E 1SFCC 3H1ID 3U59A 4U3FG 3TGUE 2ZJSE 2DW3A 1NU1K 1JM0A 2M5AB 1UIXA 2Q3IA 5K5GB 1BCCG 3AE5C 3G6EP 3L72J 2D2CB 3CX5E 2YIUC 2MKVA 1Y8AA 2ZAEB 1RH5B 2YMKA 1YHQP 4ASWA 5EFWB 1YTZI 3Q5PA 4H13D 4PD4E 1SQXE 1SQBD 1ZLLA 2NPSA 1DH3A 3W68A 2A45I 5KJ7A 2D2CD 2HPCA 1L4AA 2P58A 3AE7C 5AVUB 2FXOA 2ZVOB 2D2CC 1VQ6P
chains in the Genus database with same CATH topology
2N9BA 3P7KA 3NFQA 1IFIA 2WSCH 2HG5D 3L36A 5AW1B 2C0XA 1JTHB 5CHXA 1SQVK 2XKMA 1NKNA 2WPRA 3V5BA 2XZRA 3RK2D 1FDMA 1J1EB 2ZXEB 4W7ZA 3NTNA 1HH0A 2C0WA 3HE5B 3RK2C 3B8EB 5AW9B 4JYCA 1JY2N 2YO3A 3O8ZA 3A7OA 1X9VA 2J59M 3BATA 4HYTB 1SVFA 2IPPA 2P1JA 3SWYA 2W6AA 1SFCD 1JNMA 1FAVA 1HUCA 2NPSD 4WY4B 1KILA 2W27A 1H8AA 2P7JA 1T2KC 1FZGA 2WSFH 2GM4A 3HE4B 4WBAA 2P2UA 1X8YA 2N1TD 3H32A 2WT7B 3U1AA 1KFNA 2L5GB 2XDJA 3UIAA 1N7SA 1T8ZA 5AVZB 1FBMA 3G3ZA 1H88A 1IFDA 4GKGA 1JY2O 3N4XA 2WPSA 3IFMA 1GK6A 1SQPK 2M8RA 4GT1A 2YKOA 3P8CD 2FYZA 3V4QA 2HODA 1GU5A 2HLOA 5APUA 5CMZA 1GK4A 3B5NB 1FOSF 2O01H 1N7LA 3EFGA 3VP8A 1RF0C 1J1EC 1JMMA 5AW8B 4RESB 1RE4A 2JJLA 2XV5A 2KSJA 2H7HA 1FZEA 1X79B 2WSEH 1G2CA 1CZQA 5AW7B 1JCCA 1A02J 2WWWA 4Y99B 3RK3D 4JYBA 2QM8A 4JF7A 1S9KE 4AUWA 2MJZA 3M0DC 1FU1A 4WY4C 1HGVA 1J2JB 1KILD 1URQB 4AQRD 3M9QA 3HTKB 1CI6B 4GIFA 2KYVA 1HVVA 2CPBA 5CCGC 1SFCA 1A02F 4LGDE 1Z56A 1CSBA 1NAFA 4ZKPA 1N7SD 2OARA 1ZR2A 5CJ0A 1NHLA 5BVZA 1GL2B 1MV8A 3L4FA 5AVXB 1N2DC 2GUVA 1NOHA 4C7NB 3B5NC 2FXMA 3T97A 2HFED 1MZ9A 3A3YB 1JCDA 2BASA 2IFNA 4KHXA 1SQXK 4N6JA 1JTHA 4W7YA 4M3LA 5KLVK 1AQ5A 3GHGB 3MD0A 5APTA 1ZR4A 1RF1C 2ZFCA 1RF0A 1OXZA 2CPSA 1ZN5A 4C46A 5AW3B 1GW4A 1H89A 1M1JB 3NXSA 3HE5A 5CCHD 4Y99C 3HD7B 5AVQB 1IFNA 1NTZK 1URQD 3MUDA 4IFMA 1HJBA 1NO4A 3VMZA 1AFOA 3BRVB 5AW4B 2Z5IA 2LKMA 1JOCA 1SQQK 5AW5B 2P67A 5CCHC 1GTWA 1GZLA 1URQC 3KQGA 3M0DA 4WY4A 4I1LA 3OA7A 1G1JA 2FKWB 3P8CE 3HE4A 3OJAB 2R5BA 2WT7A 2C9LY 4N78D 1T2KD 3TNUB 1GL2C 5CCGA 1JY3N 3LIDA 2PP6A 1FZCB 2YMYA 1JY3P 2E42A 3C9IA 3M0AA 4B86A 1NKZB 1HWTC 3HRNA 1LTJB 2OYHB 1NWQA 4OH8B 4WB4A 1VDFA 3GHGC 5APWA 3TK1A 3B5NA 3M9HA 1JO5A 3U1CA 1FJPA 3HD7D 3MIWA 1MFZA 2I1JA 2KOGA 3V2PA 1N73B 2XNXA 2KP8A 4HH2A 2A45H 2WZ7A 2IFMA 1M1JC 2PAJA 2YKQA 5KTBA 1LTGC 3HD7C 2I1KA 2QM7A 2O1KA 3V2QA 1JY3O 3M06A 2R5DA 2FYUK 1XTCC 2W6BA 1RF1B 1NH4A 1IFJA 5AVWB 5APQA 3VMXA 2POHA 5KJ7C 3VP9A 1G1IA 5CCHA 4WY4D 1ZV8A 1URQA 1CW5A 1T3UA 3HTKA 3V2NA 3N7NA 3VMYA 1KQLA 1SQBK 3NMDA 5AW0B 1FZCC 3V2RA 5CCGD 1N86A 1FZBA 1GL2A 2O1JA 3RL0C 1LTAC 1LTJC 2R32A 4C7NA 2OYHC 1LGHB 1JUNA 2OYIB 5AVRB 3M91A 4ZKUA 1QL2A 3P8MC 1M7LA 3B5ND 3I5CA 1LWUB 2C9NY 1N73C 3GHGA 5APSA 1HTLC 1J1DC 2H8PD 4C7RA 1GU4A 1DX7A 1SLQA 2IX7C 1GW3A 3CL3D 1M1JA 2JEEA 1LT9B 4LLHA 1FZAA 1GD2E 1GDTA 3HD7A 1NTMK 4N78E 5CJ4A 3P32A 2E43A 2M3BA 1MUUA 1WRGA 1LTSC 2YNYA 1E5WA 1VPCA 3E1IA 1L0LK 3H6PA 1SFCB 4XE5B 5BU5A 2FFDB 3BRTB 2J58A 2NPSB 2WPQA 3II6A 3TNUA 3A2AA 4DOJA 3TSIA 2N1TB 1FZCA 1PFIA 2Z5HA 1GL2D 1IJDB 3A5TA 3TYYA 4IFDK 1RY3A 2HPCB 2OYIC 3LW5H 1L4AB 3VYIA 1LTJA 4EIJA 2OYHA 2Q5UA 1LWUC 1RE4C 2XU6A 2KLVA 1YTZT 3HUSB 1W2EA 2WTYA 4I2LC 1LTBC 3RL0B 2VRSA 1N73A 3PP5A 5APYA 1IC2A 5AVYB 1OWAA 4O9BA 3VTPC 1LT9C 1JY2P 2A45G 3VN0A 1RE3C 2WITA 3BASA 3LIEA 3KDPB 1NTKK 3OAKA 5AVTB 1RF1A 1J1DB 1QL1A 4LC1A 1WT6A 3RK3B 1SFCC 1EQ7A 5APVA 2FFDC 1XTGB 5KJ7D 5AW6B 3U59A 2NPSC 2YKPA 3SWFA 4EOTA 1L4AD 1KILB 2N1TC 1LTIC 1DEBA 3H32B 4AYCA 3KPEA 1NU1K 1IK9A 1L4AC 3M9BA 5AVVB 1CI6A 1T3JA 1N7SB 3RL0D 2Z4EA 3L37A 2Q3IA 3R2PA 2OYIA 3MTUE 2HYNA 3HUSC 1HBWA 3CI9A 1LWUA 4XA4A 1FZFA 1IO4A 3VOPA 2HODB 1YYCA 2GUSA 1L0NK 1LTTC 3BVHA 1KFMA 5AW2B 1FJKA 3KYQA 1SP4A 1LT9A 5AVSB 2Q9IA 3EQ2A 1RE3A 1KZUB 1HGZA 1G2CB 1YTZI 3RK3C 1FOSE 2YO2A 3RK2B 3WMM0 4DZOA 2H43A 2Q7CA 4I6MC 3CLQA 5BU8B 2FFDA 4N3YB 1ZLLA 1KILC 4W80A 2NPSA 1DH3A 5APXA 3V4WA 2A45I 2N1TA 5KJ7A 1N7SC 3IR9A 2HPCA 2R3CA 1L4AA 1IFMA 5AVUB 1S9KD 2KB7P 3L35A 3MGNA 4IFFA 3HUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMX A;  1A02 F;  2N9B A;  3P7K A;  3NFQ A;  1CSB A;  1NAF A;  3L36 A;  5AW1 B;  3LIE A;  1MV8 A;  3KDP B;  5AVX B;  3HTK A;  3OAK A;  2WPR A;  5AVT B;  3V5B A;  3VMY A;  4C7N B;  1KQL A;  2XZR A;  3NMD A;  4LC1 A;  5AW0 B;  3T97 A;  5APV A;  3A3Y B;  2ZXE B;  2BAS A;  3NTN A;  4KHX A;  5AW6 B;  4M3L A;  3HE5 B;  3B8E B;  5AW9 B;  3SWF A;  2R32 A;  3MD0 A;  4JYC A;  5APT A;  4C7N A;  4EOT A;  2YO3 A;  3O8Z A;  2ZFC A;  3A7O A;  4HYT B;  1JUN A;  2IPP A;  5AVR B;  1OXZ A;  3M91 A;  4AYC A;  2W6A A;  3P8M C;  4C46 A;  1JNM A;  5AW3 B;  3I5C A;  1H89 A;  1FAV A;  1HUC A;  2C9N Y;  3NXS A;  3HE5 A;  3M9B A;  5APS A;  5AVV B;  1CI6 A;  5AVQ B;  3L37 A;  2W27 A;  1H8A A;  2P7J A;  2Q3I A;  1T2K C;  1HJB A;  1HBW A;  3HE4 B;  3VMZ A;  1GU4 A;  5AW4 B;  2P2U A;  1X8Y A;  2Z5I A;  2WT7 B;  1SLQ A;  5AW5 B;  2P67 A;  1GTW A;  1IO4 A;  3UIA A;  1GZL A;  1GD2 E;  1YYC A;  3KQG A;  5AVZ B;  3M0D A;  3P32 A;  1H88 A;  2E43 A;  4GKG A;  3HE4 A;  1MUU A;  2WPS A;  5AW2 B;  2YNY A;  2R5B A;  2WT7 A;  2C9L Y;  1T2K D;  1GK6 A;  4GT1 A;  3TNU B;  1SP4 A;  5AVS B;  1GU5 A;  3V4Q A;  3LID A;  5CMZ A;  5APU A;  4XE5 B;  1GK4 A;  1FOS F;  2E42 A;  1G2C B;  3M0A A;  4B86 A;  1FOS E;  1HWT C;  2YO2 A;  2WPQ A;  5AW8 B;  3A2A A;  4RES B;  3TNU A;  4DZO A;  1NWQ A;  2JJL A;  4I6M C;  2XV5 A;  2Q7C A;  2H7H A;  5APW A;  3TK1 A;  3M9H A;  2Z5H A;  3A5T A;  3TYY A;  1CZQ A;  5AW7 B;  1MFZ A;  1A02 J;  1DH3 A;  3VN0 A;  2WWW A;  3VYI A;  2KP8 A;  5APX A;  2Q5U A;  3V4W A;  4JYB A;  2QM8 A;  1S9K E;  2XU6 A;  4AUW A;  2QM7 A;  3IR9 A;  2WTY A;  3M06 A;  2R5D A;  1J2J B;  2R3C A;  4I2L C;  2VRS A;  1S9K D;  5AVU B;  3L35 A;  4AQR D;  5APY A;  1CI6 B;  5AVY B;  1OWA A;  3MGN A;  3VTP C;  5AVW B;  5APQ A; 
#chains in the Genus database with same CATH topology
 4UB6 E;  1BSH A;  2HG5 D;  2C0X A;  2K37 A;  3G71 P;  3H1I E;  2AXT H;  4XFJ A;  4K35 A;  3B4S A;  1FDO A;  1P84 I;  4W7Z A;  1N8R Q;  4DT0 A;  3HE5 B;  3O8Z A;  1X9V A;  2J59 M;  4HYT B;  2W6A A;  1IZN B;  1DIP A;  3KZI E;  1BE3 D;  1E79 H;  1FZG A;  2WSF H;  2SPZ A;  1VQ4 P;  2ZT9 D;  2L5G B;  2XDJ A;  5M1B A;  5KLV J;  1N7S A;  5AVZ B;  3G3Z A;  1PZQ A;  1IFD A;  4GKG A;  3FGA D;  1JY2 O;  3N4X A;  2K9J B;  1GK6 A;  1S5L X;  3P8C D;  3V4Q A;  3FXD A;  3CCE P;  1BE3 G;  1FOS F;  1KN7 A;  5B66 E;  1N7L A;  3EFG A;  1SQB E;  3VP8 A;  1RF0 C;  2QG4 A;  1SQQ J;  1NTK D;  2KSJ A;  1SQV G;  4WWI A;  1JCC A;  3D6Z A;  3RK3 D;  1NJI Q;  1VQO P;  1T6A A;  4AUW A;  3M0D C;  1FU1 A;  1Q82 Q;  4H0L B;  2Y0D A;  1NU1 D;  3M9Q A;  4GIF A;  2KYV A;  2CPB A;  5CCG C;  1NTK G;  3L75 D;  3SWK A;  1NAF A;  1AV1 A;  5CJ0 A;  2OTK E;  3USS A;  1MV8 A;  2GUV A;  2Q1K A;  1NOH A;  1VF5 D;  1EXJ A;  4C7N B;  2QJK B;  3T97 A;  2HFE D;  1MZ9 A;  3A3Y B;  2IZ1 A;  4KHX A;  4N6J A;  5KLV K;  1KYO I;  5APT A;  1NU1 G;  1PP9 E;  2J5U A;  1ZN5 A;  4C46 A;  1EZV E;  1EDI A;  1GW4 A;  1H89 A;  2JDI H;  2B87 B;  5CCH D;  3HD7 B;  1IFN A;  3MUD A;  1HJB A;  1NO4 A;  3VMZ A;  5AW4 B;  1JOC A;  4H0L C;  1SQQ K;  5CCH C;  3KQG A;  3CWB D;  3OA7 A;  3P8C E;  2IBZ D;  4ZMD A;  4HB1 A;  4N78 D;  4RJT A;  1T2K D;  1LP1 B;  3TNU B;  4GOE A;  1KQG B;  3LID A;  2YMY A;  3CC2 P;  2QJK C;  1U7J A;  3C9I A;  3M0A A;  1HWT C;  3HRN A;  1VQM P;  3GF7 A;  1JO5 A;  2KNC A;  4WB4 A;  3B5N A;  3RK3 E;  1FJP A;  3L72 D;  3HD7 D;  2IBZ G;  3CMA P;  2KP8 A;  2A45 H;  5C39 A;  4U3F J;  2YKQ A;  1L0L J;  2W90 A;  3HD7 C;  2O1K A;  1JY3 O;  3L75 E;  2FYU K;  1RF1 B;  2NRG A;  5AVW B;  1VQP P;  3VMX A;  5KJ7 C;  3L73 E;  1BCC J;  1G1I A;  1GMJ A;  1DEE G;  1FC2 C;  4WY4 D;  1URQ A;  1KB9 I;  3S4R A;  3HTK A;  3N7N A;  3VMY A;  1P84 H;  1GL2 A;  3RL0 C;  3SSU A;  4JQ0 D;  3GLM A;  2E5Y A;  2OYI B;  4IL6 X;  3P8M C;  1M7L A;  3I5C A;  1LWU B;  4HKZ H;  3CWB E;  1SLQ A;  3CX5 I;  3CL3 D;  2JEE A;  1GD2 E;  4N78 E;  1NVO A;  3CCM P;  5CJ4 A;  3AE4 C;  1MUU A;  2BEZ F;  3KHU A;  3G9R A;  1L0L K;  2ZVN B;  1OVU A;  4PD4 I;  4JPZ B;  3CCQ P;  2WPQ A;  3L72 E;  4K3A A;  2N1T B;  1BDD A;  1IJD B;  4IFD K;  4H44 B;  1RY3 A;  3BCC J;  2OYI C;  3RBX A;  4EIJ A;  5KLV D;  1LWU C;  3B71 A;  3AE9 C;  2KLV A;  4YXW H;  3WUT A;  2WSF J;  3VTP C;  2K1A A;  1RE3 C;  3Q5R A;  3TDK A;  5L8R J;  5TIS E;  1SQQ D;  3KDP B;  3VMA A;  5AVT B;  4RO0 A;  1QL1 A;  4LC1 A;  5APV A;  1XTG B;  1KYO H;  3SWF A;  4EOT A;  3GF3 A;  1BE3 J;  1KIL B;  2N1T C;  5GTI H;  1LTI C;  2JKV A;  1DEB A;  4HJG H;  3H32 B;  4H44 C;  4AYC A;  3KPE A;  3M9B A;  2WPV B;  2JWA A;  1SQV J;  3L37 A;  2E5T A;  3E1R A;  3PTZ A;  3MTU E;  4PJ0 E;  2PRR A;  1IO4 A;  4Y28 J;  4OVN F;  4OGQ B;  3MUD C;  1PIX A;  1KFM A;  5AW2 B;  1S5L H;  3KYQ A;  1LT9 A;  2FYU D;  1YIJ P;  1NTK J;  1KZU B;  1G2C B;  3L70 D;  1FOS E;  5KLI B;  4WVZ A;  3PJS K;  2Q7C A;  4I6M C;  3S9O A;  3CLQ A;  2FFD A;  5KLV E;  1H0T B;  1AJY A;  1KIL C;  2CK3 H;  1QVG O;  4W80 A;  3A0H E;  3V4W A;  2FYU G;  1BSN A;  3L70 G;  1OMI A;  1Q7Y Q;  4EYY Q;  3MGN A;  1MFT A;  1SQQ E;  5KAF H;  1OVV A;  3HUS A;  2N9B A;  1RQU A;  3NFQ A;  4OGQ C;  1KB9 H;  2WSC H;  3IN6 A;  5CHX A;  1JTH B;  4ZNC A;  1SQV K;  2Q6Q A;  2FXP A;  2Y0E A;  1J1E B;  2ZXE B;  1ZOY C;  4U3F D;  1VQ9 P;  1L0L D;  3B8E B;  5CBN A;  3OW2 O;  4JYC A;  3JCU E;  1EZV I;  2YIU B;  3A7O A;  1SVF A;  1PGP A;  2IPP A;  3EFF K;  3SWY A;  1SFC D;  2KIK A;  4DCK A;  1R5S A;  2W27 A;  2P7J A;  1BCC D;  2LXC B;  2B9B A;  3CX5 H;  3HE4 B;  4WBA A;  2GM4 A;  2P2U A;  1X8Y A;  4EI2 A;  1KFN A;  3EWK A;  1L0L G;  1H88 A;  2WSS H;  2WPS A;  2IYP A;  1SQP K;  2YKO A;  1PGJ A;  2FYZ A;  2HOD A;  3GMA A;  1S4X A;  1GK4 A;  2O01 H;  4PD4 H;  1YJ9 P;  3F5H A;  1VL2 A;  2ITA A;  1J1E C;  1JMM A;  1QVF O;  2XV5 A;  2H7H A;  2WSE H;  1DD3 A;  1CZQ A;  5AW7 B;  2KUB A;  4Y99 B;  2KS1 B;  4JYB A;  2WMM A;  1OW8 A;  4PV1 B;  1MKM A;  4UB6 H;  1AVO A;  2JP3 A;  3H1H G;  4OWF A;  4YXD C;  2O01 N;  4LGD E;  1CSB A;  1FDI A;  1N2D C;  4BWN A;  4UB8 E;  2V7Q H;  4KT0 J;  4U3F E;  3BCC D;  1KOR A;  3H1J J;  2BAS A;  2IFN A;  4W7Y A;  3CC7 P;  3GHG B;  1KC8 Q;  1ZRT D;  3KZI H;  1ZR4 A;  1BGY D;  2CPS A;  1BCC E;  2Y9Z A;  1M1J B;  3SFD C;  1Q86 Q;  4Y99 C;  5AVQ B;  1JB0 J;  3CCL P;  1VQL P;  3BRV B;  4PV1 C;  3BCC G;  5AW5 B;  1GZL A;  4WY4 A;  4I1L A;  2FKW B;  3OJA B;  2C9L Y;  2WT7 A;  3H25 A;  1BGY G;  1KQS O;  5B66 H;  3CCR P;  1RHZ B;  1FZC B;  4IL6 E;  1VQ8 P;  1OIP A;  1JY3 P;  4DJG A;  1R5L A;  4B86 A;  1AQT A;  1NKZ B;  2OYH B;  2QIW A;  3AE6 C;  1SQV D;  4OH8 B;  3GHG C;  1VQK P;  2IDB A;  3RBZ A;  2I1J A;  3V2P A;  1N73 B;  2XNX A;  1OVR A;  4HH2 A;  2M3E A;  2IFM A;  1M1J C;  4NPD A;  2OQQ A;  3V2Q A;  3I56 P;  1XTC C;  1KMI Z;  1NH4 A;  5APQ A;  1NTZ G;  3VP9 A;  3IF4 A;  2OTL P;  1T3U A;  4TLF A;  3F89 A;  3AE8 C;  2A06 D;  2FYN B;  5AW0 B;  1FZC C;  2JO1 A;  3H1K D;  3V2R A;  5CCG D;  1EC5 A;  5E79 E;  1SQP D;  2W8Z A;  1QEX A;  3PHL A;  4L73 A;  2OYH C;  1U57 A;  1JUN A;  2OTJ P;  3M91 A;  4ZKU A;  1YQ3 C;  2C9N Y;  1N73 C;  1HTL C;  4TT3 H;  1LJ2 A;  1J1D C;  2A06 G;  2H8P D;  1VQ7 P;  2R3S A;  2K88 A;  3H1K G;  2IX7 C;  2RMZ A;  3L71 D;  2BCC D;  1JEK A;  4LLH A;  1FZA A;  1GDT A;  1SQP G;  2FYU J;  2E43 A;  2M3B A;  1BE3 E;  1E5W A;  3L70 J;  1VPC A;  2M0B A;  3E1I A;  2R44 A;  4H0L D;  5BU5 A;  4Z1M H;  1SQV E;  1M57 D;  4GDO A;  2FYN C;  2J58 A;  2NPS B;  2IYO A;  3II6 A;  4DOJ A;  3L71 G;  2BCC G;  3TSI A;  1RQV A;  1PFI A;  3A5T A;  3WU2 E;  2JWD A;  2HPC B;  3PRJ A;  1L4A B;  5B5E E;  2AXC A;  3VYI A;  1LTJ A;  2Q5U A;  3RL0 g;  1W2E A;  1NTK E;  3AEF C;  3GG2 A;  3RL0 B;  3RGU A;  2A45 G;  3CME P;  3LIE A;  2RKL A;  1NTM G;  1WT6 A;  1UII A;  1NU1 E;  5KJ7 D;  4YPC A;  5AW6 B;  3AEE C;  2NPS C;  1L4A D;  5DJU B;  1D7M A;  2WSE J;  4BRY A;  1L4A C;  1M1K Q;  1T3J A;  1N7S B;  3RL0 D;  2UWJ E;  3R2P A;  1HBW A;  3FX0 A;  1ZW0 A;  3VOP A;  3H1L G;  3ABV C;  1YYC A;  2GUS A;  2QRX A;  1LTT C;  3BVH A;  2E76 B;  3H1J D;  5KKZ B;  1FJK A;  3Q1M A;  3EQ2 A;  3H1H J;  5KAI E;  2YO2 A;  3CXH D;  2IBZ E;  3A0B E;  1PGQ A;  5BU8 B;  4N3Y B;  1KQF B;  3H1J G;  1N7S C;  3IAO A;  2R3C A;  1S9K D;  2E76 D;  3E7K A;  1PV3 A;  5TIS H;  3ZDM A;  3T97 B;  2V4H A;  2E76 C;  5KKZ C;  4EDF A;  3L36 A;  1KYO D;  2WPR A;  3FXE A;  4D6T G;  1FDM A;  4NPE A;  2QEX P;  3L74 G;  1L0N G;  1BGY J;  3NTN A;  1HH0 A;  3KXD A;  2C0W A;  4I7Z B;  5AW9 B;  1K05 A;  1LT1 A;  3AE1 C;  3WUU A;  2AEJ A;  1JNM A;  3PLN A;  4PJ0 H;  2E75 B;  1H8A A;  2N1T D;  3U1A A;  3FWN A;  1TU3 F;  4H44 D;  2M5A A;  2B89 A;  1T8Z A;  3IFM A;  4GT1 A;  1GU5 A;  3G4S P;  5CMZ A;  2KNC B;  3CXH E;  3B5N B;  1NTZ J;  3I55 P;  1ZXG A;  1PP9 J;  4RES B;  3MZW B;  2JJL A;  4I7Z C;  3K5B A;  3A0H H;  4L75 A;  1Q81 Q;  1PPJ G;  1W2B O;  2WWW A;  2LXB A;  2QM8 A;  4JF7 A;  1S9K E;  2MJZ A;  2E75 C;  1KIL D;  1URQ B;  3HTK B;  1HVV A;  5DJT B;  2OAR A;  3H1K J;  5BVZ A;  1GL2 B;  3TGU D;  2RN0 A;  5AVX B;  4BXL A;  4KJM A;  1SQP J;  3B5N C;  2FXM A;  3JCU H;  4GOF A;  1SS1 A;  4OGQ D;  1AQ5 A;  1Q2N A;  2NZ2 A;  2QVA A;  2ZFC A;  1RF0 A;  3L71 J;  3HE5 A;  2BCC J;  3NXS A;  1AVY A;  3TGU G;  1NTZ K;  1URQ D;  1M8O B;  4ASV A;  1QX8 A;  2LKM A;  3MHV A;  1GTW A;  4NPF X;  1URQ C;  4GOD A;  3L73 J;  3M0D A;  3GW6 A;  5H2F E;  3FWL A;  3D70 A;  1HF9 A;  1YBK A;  1NGM B;  1OFC X;  2AEM A;  2FBW C;  1GL2 C;  5CCG A;  2YXR B;  2PP6 A;  3QWO C;  2K9J A;  3D6Y A;  3AEB C;  3M9H A;  1NTM J;  2FYU E;  3Q5S A;  1SQX G;  3L70 E;  2PAJ A;  1KIL E;  1Q90 D;  2I1K A;  2QM7 A;  1QLE D;  1S3J A;  1KTM A;  4A7P A;  3H1H D;  2W6B A;  4IOI H;  4H13 B;  2POH A;  4UB8 H;  5CCH A;  3SFE C;  3AE2 C;  5CBO A;  3H1L J;  3W67 A;  5GTH E;  1QGK B;  1KQL A;  3NMD A;  3H1I G;  3CCV P;  2R32 A;  4C7N A;  2LR2 A;  1YJN P;  1WMK A;  1QL2 A;  3C8V A;  2KXP B;  5APS A;  2ZYG A;  2QA4 P;  1S1C X;  1L0L E;  1DX7 A;  3QH9 A;  2B87 A;  1LT9 B;  1LNQ A;  3HD7 A;  1NTM K;  2KZJ A;  3P32 A;  1WRG A;  4H13 C;  2YNY A;  4IL6 H;  2OYO A;  1EDL A;  4PV1 D;  2H89 C;  3H6P A;  2E74 B;  1X0T A;  4XE5 B;  2FFD B;  2IBZ I;  3BRT B;  1LP1 A;  2Y0C A;  3TNU A;  2FY8 A;  4D6T J;  2ZT9 B;  2Z5H A;  1SQB G;  3L74 J;  1L0N J;  3LW5 H;  3ITK A;  2XU6 A;  3HUS B;  3H1H E;  2WTY A;  2ZYD A;  4RKU J;  1YIT P;  4I2L C;  2VRS A;  2YXQ B;  3PP5 A;  3MP7 B;  5APY A;  2G8Y A;  5AVY B;  1OWA A;  1Y9B A;  4O9B A;  1LT9 C;  1NTZ D;  3VN0 A;  2E74 D;  1PP9 D;  2WIT A;  3BAS A;  2QJP B;  4QMA A;  1PL5 A;  2IZ0 A;  5E79 H;  1RF1 A;  1J1D B;  1KD1 Q;  1EZV D;  3RK3 B;  2E74 C;  1EQ7 A;  2FFD C;  2AXT E;  2YKP A;  2KLU A;  3TF5 A;  2KI7 B;  1Y47 A;  2ZT9 C;  1ZME C;  1OZH A;  1IK9 A;  1PP9 G;  2KZI A;  1S72 P;  3BCC E;  5AVV B;  1CI6 A;  2Z4E A;  2N9Y B;  1EDK A;  3Q3D A;  2OYI A;  1EZV G;  2HYN A;  1VF5 B;  3HUS C;  1HJ0 A;  3CI9 A;  1ZRT E;  1LWU A;  4XA4 A;  1FZF A;  3CD6 P;  1BGY E;  2K3R A;  2HOD B;  1K8A Q;  1L0N K;  3CCJ P;  3CXH I;  2HR3 A;  1SP4 A;  5AVS B;  2QJP C;  1YI2 P;  2Q9I A;  1RE3 A;  1HGZ A;  3O6Q A;  3RK3 C;  3WMM 0;  3RK2 B;  3V6I A;  3WU2 H;  4DZO A;  2H43 A;  5B5E H;  3AEG C;  2JR8 A;  2QJY B;  5APX A;  3L73 D;  4R4M A;  3S1K A;  2N1T A;  2WSC J;  4YTP C;  3IR9 A;  1KV4 A;  1L2P A;  1NTZ E;  1IFM A;  1VF5 C;  2KB7 P;  3L35 A;  3TGU J;  4IFF A;  3P7K A;  1JMB A;  3L75 G;  1IFI A;  5AW1 B;  2XKM A;  2W83 C;  1NKN A;  1NTM D;  3V5B A;  2XZR A;  3L73 G;  3RK2 D;  2WQY C;  3RK2 C;  1JY2 N;  2YO3 A;  2KK7 A;  1OX3 A;  3BAT A;  2A06 E;  1P84 D;  2P1J A;  2QJY C;  1FAV A;  1HUC A;  3H1K E;  2NPS D;  4WY4 B;  1KIL A;  1SQP E;  1T2K C;  3H32 A;  2WT7 B;  2O01 J;  3H1L D;  3UIA A;  1SQX J;  2Y9Y A;  1FBM A;  2XND H;  1K73 Q;  1S2E A;  2KSE A;  3CWB G;  2Q3E A;  5KAI H;  2M8R A;  3D71 A;  4JBZ A;  2HLO A;  5APU A;  3L71 E;  1K04 A;  2BCC E;  2RH0 A;  3AEA C;  3A0B H;  5AW8 B;  1RE4 A;  2P10 A;  1K9M Q;  1FZE A;  1X79 B;  2L91 A;  2K9Y A;  1G2C A;  3L72 G;  1A02 J;  3H1I J;  1OW6 A;  1W5C E;  1H0T A;  4WY4 C;  1HGV A;  1J2J B;  2V7Q J;  2O3J A;  4AQR D;  1CI6 B;  1IK7 A;  5TJH A;  2AEF A;  1SFC A;  1A02 F;  1NTM E;  1Z56 A;  3AEC C;  4ZKP A;  1N7S D;  1ZR2 A;  1NHL A;  3L4F A;  4D6T D;  1USE A;  3L74 D;  1L0N D;  3R4Y A;  1JCD A;  2I8D A;  1FS0 E;  1SQX K;  1JTH A;  4M3L A;  1R8E A;  1P84 E;  3MD0 A;  4CPG A;  1RF1 C;  1ZP0 C;  3O6Q B;  1OXZ A;  5AW3 B;  3LW5 J;  2OGU A;  3H1L E;  4IFM A;  2PFX A;  1SQB J;  4MN4 C;  3C1L A;  1AFO A;  2Z5I A;  2ZXX A;  3JSV C;  2P67 A;  2H88 C;  1G1J A;  3Q2Y A;  3HE4 A;  3CXH H;  2R5B A;  4L74 A;  1JY3 N;  2E42 A;  2ZYA A;  4L76 A;  1LTJ B;  2PGD A;  1DD4 A;  3H1J E;  1NWQ A;  3TK1 A;  1PGO A;  1VDF A;  5APW A;  1VQ5 P;  1EXI A;  3U1C A;  1PPJ D;  3MIW A;  2WVR A;  1MFZ A;  2KOG A;  1X22 A;  2WZ7 A;  5KLV G;  1EDJ A;  2B88 A;  5KTB A;  1LTG C;  2BEQ D;  3M06 A;  2R5D A;  3AED C;  1NAY A;  2KS1 A;  1VQN P;  1M56 D;  1IFJ A;  4D6T E;  1AA0 A;  1IFP A;  3L74 E;  1L0N E;  2W6J H;  2E75 D;  1ZV8 A;  1CW5 A;  1SQQ G;  3V2N A;  1SQB K;  1YJW P;  1FE6 A;  1BDC A;  1N86 A;  1FZB A;  2O1J A;  1LTA C;  4BRY B;  1NYH A;  1KB9 D;  1LTJ C;  4U7J A;  1U7M A;  1LGH B;  3CPW O;  5AVR B;  1KYO E;  3B5N D;  5GTI E;  3GHG A;  2QSI A;  4C7R A;  1GU4 A;  1OW7 A;  5H2F H;  1GW3 A;  1M1J A;  1LTS C;  3WUV A;  2GA1 A;  3CX5 D;  1NU1 J;  1SFC B;  3PH0 A;  3AE3 C;  3JC2 2;  1S5L E;  3L75 J;  1PPJ E;  3A2A A;  1FZC A;  1GL2 D;  1USD A;  1M90 Q;  3TYY A;  3CCU P;  4PD4 D;  2QE7 H;  3CCS P;  1YQ4 C;  1SQX D;  2OYH A;  1RE4 C;  1YTZ T;  3CC4 P;  1LTB C;  1N73 A;  5KLI C;  2G3A A;  1IC2 A;  1JY2 P;  5GTH H;  4R4L A;  5KAF E;  1NTK K;  3OAK A;  3CWB J;  1KB9 E;  1SFC C;  3H1I D;  3U59 A;  4U3F G;  3TGU E;  2ZJS E;  2DW3 A;  1NU1 K;  1JM0 A;  2M5A B;  1UIX A;  2Q3I A;  5K5G B;  1BCC G;  3AE5 C;  3G6E P;  3L72 J;  2D2C B;  3CX5 E;  2YIU C;  2MKV A;  1Y8A A;  2ZAE B;  1RH5 B;  2YMK A;  1YHQ P;  4ASW A;  5EFW B;  1YTZ I;  3Q5P A;  4H13 D;  4PD4 E;  1SQX E;  1SQB D;  1ZLL A;  2NPS A;  1DH3 A;  3W68 A;  2A45 I;  5KJ7 A;  2D2C D;  2HPC A;  1L4A A;  2P58 A;  3AE7 C;  5AVU B;  2FXO A;  2ZVO B;  2D2C C;  1VQ6 P; 
#chains in the Genus database with same CATH homology
 2N9B A;  3P7K A;  3NFQ A;  1IFI A;  2WSC H;  2HG5 D;  3L36 A;  5AW1 B;  2C0X A;  1JTH B;  5CHX A;  1SQV K;  2XKM A;  1NKN A;  2WPR A;  3V5B A;  2XZR A;  3RK2 D;  1FDM A;  1J1E B;  2ZXE B;  4W7Z A;  3NTN A;  1HH0 A;  2C0W A;  3HE5 B;  3RK2 C;  3B8E B;  5AW9 B;  4JYC A;  1JY2 N;  2YO3 A;  3O8Z A;  3A7O A;  1X9V A;  2J59 M;  3BAT A;  4HYT B;  1SVF A;  2IPP A;  2P1J A;  3SWY A;  2W6A A;  1SFC D;  1JNM A;  1FAV A;  1HUC A;  2NPS D;  4WY4 B;  1KIL A;  2W27 A;  1H8A A;  2P7J A;  1T2K C;  1FZG A;  2WSF H;  2GM4 A;  3HE4 B;  4WBA A;  2P2U A;  1X8Y A;  2N1T D;  3H32 A;  2WT7 B;  3U1A A;  1KFN A;  2L5G B;  2XDJ A;  3UIA A;  1N7S A;  1T8Z A;  5AVZ B;  1FBM A;  3G3Z A;  1H88 A;  1IFD A;  4GKG A;  1JY2 O;  3N4X A;  2WPS A;  3IFM A;  1GK6 A;  1SQP K;  2M8R A;  4GT1 A;  2YKO A;  3P8C D;  2FYZ A;  3V4Q A;  2HOD A;  1GU5 A;  2HLO A;  5APU A;  5CMZ A;  1GK4 A;  3B5N B;  1FOS F;  2O01 H;  1N7L A;  3EFG A;  3VP8 A;  1RF0 C;  1J1E C;  1JMM A;  5AW8 B;  4RES B;  1RE4 A;  2JJL A;  2XV5 A;  2KSJ A;  2H7H A;  1FZE A;  1X79 B;  2WSE H;  1G2C A;  1CZQ A;  5AW7 B;  1JCC A;  1A02 J;  2WWW A;  4Y99 B;  3RK3 D;  4JYB A;  2QM8 A;  4JF7 A;  1S9K E;  4AUW A;  2MJZ A;  3M0D C;  1FU1 A;  4WY4 C;  1HGV A;  1J2J B;  1KIL D;  1URQ B;  4AQR D;  3M9Q A;  3HTK B;  1CI6 B;  4GIF A;  2KYV A;  1HVV A;  2CPB A;  5CCG C;  1SFC A;  1A02 F;  4LGD E;  1Z56 A;  1CSB A;  1NAF A;  4ZKP A;  1N7S D;  2OAR A;  1ZR2 A;  5CJ0 A;  1NHL A;  5BVZ A;  1GL2 B;  1MV8 A;  3L4F A;  5AVX B;  1N2D C;  2GUV A;  1NOH A;  4C7N B;  3B5N C;  2FXM A;  3T97 A;  2HFE D;  1MZ9 A;  3A3Y B;  1JCD A;  2BAS A;  2IFN A;  4KHX A;  1SQX K;  4N6J A;  1JTH A;  4W7Y A;  4M3L A;  5KLV K;  1AQ5 A;  3GHG B;  3MD0 A;  5APT A;  1ZR4 A;  1RF1 C;  2ZFC A;  1RF0 A;  1OXZ A;  2CPS A;  1ZN5 A;  4C46 A;  5AW3 B;  1GW4 A;  1H89 A;  1M1J B;  3NXS A;  3HE5 A;  5CCH D;  4Y99 C;  3HD7 B;  5AVQ B;  1IFN A;  1NTZ K;  1URQ D;  3MUD A;  4IFM A;  1HJB A;  1NO4 A;  3VMZ A;  1AFO A;  3BRV B;  5AW4 B;  2Z5I A;  2LKM A;  1JOC A;  1SQQ K;  5AW5 B;  2P67 A;  5CCH C;  1GTW A;  1GZL A;  1URQ C;  3KQG A;  3M0D A;  4WY4 A;  4I1L A;  3OA7 A;  1G1J A;  2FKW B;  3P8C E;  3HE4 A;  3OJA B;  2R5B A;  2WT7 A;  2C9L Y;  4N78 D;  1T2K D;  3TNU B;  1GL2 C;  5CCG A;  1JY3 N;  3LID A;  2PP6 A;  1FZC B;  2YMY A;  1JY3 P;  2E42 A;  3C9I A;  3M0A A;  4B86 A;  1NKZ B;  1HWT C;  3HRN A;  1LTJ B;  2OYH B;  1NWQ A;  4OH8 B;  4WB4 A;  1VDF A;  3GHG C;  5APW A;  3TK1 A;  3B5N A;  3M9H A;  1JO5 A;  3U1C A;  1FJP A;  3HD7 D;  3MIW A;  1MFZ A;  2I1J A;  2KOG A;  3V2P A;  1N73 B;  2XNX A;  2KP8 A;  4HH2 A;  2A45 H;  2WZ7 A;  2IFM A;  1M1J C;  2PAJ A;  2YKQ A;  5KTB A;  1LTG C;  3HD7 C;  2I1K A;  2QM7 A;  2O1K A;  3V2Q A;  1JY3 O;  3M06 A;  2R5D A;  2FYU K;  1XTC C;  2W6B A;  1RF1 B;  1NH4 A;  1IFJ A;  5AVW B;  5APQ A;  3VMX A;  2POH A;  5KJ7 C;  3VP9 A;  1G1I A;  5CCH A;  4WY4 D;  1ZV8 A;  1URQ A;  1CW5 A;  1T3U A;  3HTK A;  3V2N A;  3N7N A;  3VMY A;  1KQL A;  1SQB K;  3NMD A;  5AW0 B;  1FZC C;  3V2R A;  5CCG D;  1N86 A;  1FZB A;  1GL2 A;  2O1J A;  3RL0 C;  1LTA C;  1LTJ C;  2R32 A;  4C7N A;  2OYH C;  1LGH B;  1JUN A;  2OYI B;  5AVR B;  3M91 A;  4ZKU A;  1QL2 A;  3P8M C;  1M7L A;  3B5N D;  3I5C A;  1LWU B;  2C9N Y;  1N73 C;  3GHG A;  5APS A;  1HTL C;  1J1D C;  2H8P D;  4C7R A;  1GU4 A;  1DX7 A;  1SLQ A;  2IX7 C;  1GW3 A;  3CL3 D;  1M1J A;  2JEE A;  1LT9 B;  4LLH A;  1FZA A;  1GD2 E;  1GDT A;  3HD7 A;  1NTM K;  4N78 E;  5CJ4 A;  3P32 A;  2E43 A;  2M3B A;  1MUU A;  1WRG A;  1LTS C;  2YNY A;  1E5W A;  1VPC A;  3E1I A;  1L0L K;  3H6P A;  1SFC B;  4XE5 B;  5BU5 A;  2FFD B;  3BRT B;  2J58 A;  2NPS B;  2WPQ A;  3II6 A;  3TNU A;  3A2A A;  4DOJ A;  3TSI A;  2N1T B;  1FZC A;  1PFI A;  2Z5H A;  1GL2 D;  1IJD B;  3A5T A;  3TYY A;  4IFD K;  1RY3 A;  2HPC B;  2OYI C;  3LW5 H;  1L4A B;  3VYI A;  1LTJ A;  4EIJ A;  2OYH A;  2Q5U A;  1LWU C;  1RE4 C;  2XU6 A;  2KLV A;  1YTZ T;  3HUS B;  1W2E A;  2WTY A;  4I2L C;  1LTB C;  3RL0 B;  2VRS A;  1N73 A;  3PP5 A;  5APY A;  1IC2 A;  5AVY B;  1OWA A;  4O9B A;  3VTP C;  1LT9 C;  1JY2 P;  2A45 G;  3VN0 A;  1RE3 C;  2WIT A;  3BAS A;  3LIE A;  3KDP B;  1NTK K;  3OAK A;  5AVT B;  1RF1 A;  1J1D B;  1QL1 A;  4LC1 A;  1WT6 A;  3RK3 B;  1SFC C;  1EQ7 A;  5APV A;  2FFD C;  1XTG B;  5KJ7 D;  5AW6 B;  3U59 A;  2NPS C;  2YKP A;  3SWF A;  4EOT A;  1L4A D;  1KIL B;  2N1T C;  1LTI C;  1DEB A;  3H32 B;  4AYC A;  3KPE A;  1NU1 K;  1IK9 A;  1L4A C;  3M9B A;  5AVV B;  1CI6 A;  1T3J A;  1N7S B;  3RL0 D;  2Z4E A;  3L37 A;  2Q3I A;  3R2P A;  2OYI A;  3MTU E;  2HYN A;  3HUS C;  1HBW A;  3CI9 A;  1LWU A;  4XA4 A;  1FZF A;  1IO4 A;  3VOP A;  2HOD B;  1YYC A;  2GUS A;  1L0N K;  1LTT C;  3BVH A;  1KFM A;  5AW2 B;  1FJK A;  3KYQ A;  1SP4 A;  1LT9 A;  5AVS B;  2Q9I A;  3EQ2 A;  1RE3 A;  1KZU B;  1HGZ A;  1G2C B;  1YTZ I;  3RK3 C;  1FOS E;  2YO2 A;  3RK2 B;  3WMM 0;  4DZO A;  2H43 A;  2Q7C A;  4I6M C;  3CLQ A;  5BU8 B;  2FFD A;  4N3Y B;  1ZLL A;  1KIL C;  4W80 A;  2NPS A;  1DH3 A;  5APX A;  3V4W A;  2A45 I;  2N1T A;  5KJ7 A;  1N7S C;  3IR9 A;  2HPC A;  2R3C A;  1L4A A;  1IFM A;  5AVU B;  1S9K D;  2KB7 P;  3L35 A;  3MGN A;  4IFF A;  3HUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...