2R5DA

Structure of the gp41 n-trimer in complex with the hiv entry inhibitor pie7
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/inhibitor
molecule keywords gp41 N-peptide
publication title Potent D-peptide inhibitors of HIV-1 entry
pubmed doi rcsb
total genus 20
structure length 45
sequence length 45
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2r5dA00
2WPSA 2IPPA 1SLQA 2YO3A 4XE5B 3M9BA 5AW0B 1X8YA 3UIAA 4HYTB 3VYIA 2BASA 4JYBA 5APTA 2XU6A 4C7NB 1DH3A 2W6AA 1H88A 5APVA 2N9BA 3HE5A 2P7JA 2Q5UA 3VTPC 5APWA 3HTKA 2Z5IA 4AYCA 1S9KD 1YYCA 3M9HA 2XV5A 2Q3IA 1HWTC 5AVYB 5CMZA 2YNYA 3A7OA 5APUA 2JJLA 2P2UA 3I5CA 3V4QA 3A3YB 3L36A 2WTYA 3TYYA 1CZQA 3MGNA 1T2KD 4C7NA 1FOSF 5AVTB 4KHXA 3M06A 3V4WA 3NMDA 4EOTA 5AW3B 5APYA 2XZRA 3B8EB 3L37A 3HE4B 2H7HA 5APSA 4I2LC 1JUNA 3IR9A 5AW4B 1MFZA 3NFQA 3T97A 5AW5B 3KQGA 4LC1A 2C9LY 2WT7B 1FOSE 5AW6B 3VMZA 3M91A 2QM8A 3TNUB 1CI6A 1GTWA 2WWWA 5AW8B 2ZXEB 1A02F 3A2AA 5AVWB 2WPRA 3P8MC 1CI6B 3P32A 1GU4A 3MD0A 1A02J 3HE4A 3OAKA 1KQLA 4GT1A 3V5BA 1GK4A 1G2CB 3LIEA 4GKGA 4C46A 1NWQA 1IO4A 1CSBA 2KP8A 3O8ZA 1JNMA 3M0AA 2WT7A 5AVQB 5AW9B 1HJBA 5APXA 2Z5HA 1H8AA 2R32A 3TNUA 1S9KE 1H89A 2VRSA 2W27A 4AQRD 5AW2B 1GD2E 2QM7A 3M0DA 2P67A 1GU5A 1HBWA 2R5BA 5AVVB 2ZFCA 5AW7B 2R5DA 5AVSB 3P7KA 4DZOA 3SWFA 4M3LA 4RESB 2R3CA 3NXSA 4JYCA 3LIDA 2WPQA 5AVRB 5AVXB 2C9NY 1HUCA 1MUUA 1NAFA 1MV8A 5AVZB 3TK1A 3VMXA 3HE5B 1GK6A 3KDPB 4AUWA 4I6MC 2E42A 5AW1B 3L35A 5AVUB 1FAVA 2E43A 1GZLA 1J2JB 3VMYA 1SP4A 2Q7CA 3NTNA 4B86A 3VN0A 1OXZA 1OWAA 3A5TA 2YO2A 1T2KC 5APQA
chains in the Genus database with same CATH superfamily
5KLVD 3WUUA 4WVZA 1SQXJ 4UB6E 3A0HE 5APTA 3SWKA 1GL2D 2FYZA 2WSEH 2KI7B 1G1JA 2R3SA 2OYIB 3V2NA 1DEBA 2M5AA 2QSIA 2E75D 3FX0A 1PPJE 4IFFA 1FJKA 2O01N 3H6PA 1SQXK 3CWBD 2N1TD 5APYA 3H1JE 2W83C 4YTPC 1Q81Q 1EXJA 2C9LY 1RH5B 1URQC 4MN4C 2OTJP 1LTJA 4L74A 1NTMJ 2WWWA 1NTKJ 2RMZA 4ASWA 1EZVG 1M1JA 2PFXA 1VQ7P 1KILD 1IFIA 1KTMA 1FS0E 1LTJC 1JMMA 3EFFK 1SQPJ 2B88A 3CX5H 3M0DA 1NTMK 1NTKK 2P10A 2A06D 5K5GB 1SQQK 1SQVJ 2XNXA 4KJMA 4GIFA 1VQPP 3GW6A 1EQ7A 5AW1B 3GMAA 1SQPK 2JWAA 5E79E 1H0TB 1FZFA 3N7NA 1URQD 2KSEA 1M7LA 1SFCA 2YO3A 1LT1A 1YJ9P 1K9MQ 2QG4A 1AVOA 3SSUA 4N3YB 4L76A 1VL2A 2HFED 4JF7A 5CCHC 1L0LK 1M57D 2QJYC 3G71P 3HD7B 2L91A 1OIPA 3MZWB 1NTME 1NTKE 3M06A 2W6BA 1KD1Q 3B8EB 1SQQE 2ZT9D 4L75A 5APSA 1JUNA 1L0ND 5AW5B 1ZN5A 3RK2B 2YMKA 3KPEA 1ZP0C 1LTGC 3OJAB 3CCSP 2ZXEB 2JWDA 3A0BE 3P8MC 3H1HG 1BCCE 3L75J 3CL3D 1G2CA 1ZW0A 5B66H 3GF3A 2JO1A 2WSSH 3IFMA 2FKWB 1SQBG 5AW9B 4ZKPA 2YKOA 2WPVB 3HUSA 3L70J 3AEBC 1Y8AA 1ZR2A 1L0LE 3AEGC 2R5BA 1KYOE 3TGUJ 1ZRTD 2K37A 2E75B 2YKQA 1X0TA 4R4LA 3L71J 3CX5D 3CCMP 2N1TB 3LW5J 1J2JB 3NTNA 1PP9J 2OYHB 1EDIA 2CPBA 2IBZE 3H32B 2BASA 5BU8B 4L73A 1AV1A 3GHGA 4AYCA 1OZHA 2YXRB 2AEMA 3VP9A 1KILB 1LT9A 1L4AD 3AE8C 2GUSA 3BRVB 5KAIH 3SFDC 2FYUG 4OGQC 1RF1C 1IK7A 2IDBA 3H1LG 3QWOC 3KHUA 3HE4B 5KKZC 3T97A 1MFZA 3RL0C 3H1KJ 4LC1A 2IFMA 3M91A 3TNUB 4K35A 1W5CE 3W68A 2DW3A 2QVAA 4U3FE 2BEZF 3L70E 1BE3G 2KNCB 1N2DC 2PP6A 1URQB 3B71A 3TGUE 2V7QJ 2KYVA 4BXLA 2I1KA 2W8ZA 5CCGC 2Q3EA 1HVVA 3CLQA 1AJYA 3JCUE 2ZFCA 1QVFO 3QH9A 4DZOA 3CCRP 3NXSA 4JYCA 3P8CE 3WU2E 1MV8A 2Q9IA 2IYOA 3BASA 5GTIH 2V7QH 3A5TA 2AEJA 1KORA 3WUTA 3GLMA 3H1IJ 5BU5A 2OYIA 1KYOI 4ZNCA 1BGYG 3FGAD 4JQ0D 4UB8E 5AVYB 1N7SD 2YNYA 1KB9H 1OVVA 3H1KE 3PP5A 5CCGD 3AE5C 2K9JB 3CCJP 2GM4A 4QMAA 1NOHA 3S1KA 1FC2C 3CCLP 2QJKB 1EZVD 2IBZI 1RE3C 3IR9A 1NO4A 3JSVC 1FOSE 1PPJG 3RBZA 2FXMA 1Q2NA 1N73C 3OAKA 4RKUJ 5DJUB 2WSCH 2WSFH 3VOPA 1KFNA 3H1JG 2WMMA 3M0AA 2WT7A 5B5EH 2OQQA 5TJHA 3L74G 3AE1C 4OH8B 5KAFE 5KLVJ 1HJ0A 1PGOA 2KXPB 1L4AB 2ITAA 5AW7B 3AE3C 3BVHA 5AVZB 3HE5B 1GMJA 1H0TA 4IFDK 2GA1A 4NPEA 1YBKA 2Q7CA 2JKVA 3CCUP 3CWBJ 4WY4D 2A45I 2B9BA 2OARA 3RGUA 2Q6QA 1IFMA 1WT6A 2OTLP 2Q3IA 3HD7A 1W2BO 3V4QA 3F89A 1T2KD 3CXHE 1FBMA 2P58A 3H1HD 1KB9D 1LTTC 4OGQB 1RF1B 1FDOA 2I1JA 4HJGH 3PLNA 2ZXXA 1K05A 1NTMG 1NTKG 4D6TD 1LWUC 1SQQG 1OW6A 5AVQB 1KZUB 4TT3H 1H89A 2G8YA 4N78E 2P67A 2E5YA 2FFDA 2LKMA 2NPSA 1GL2C 2JDIH 1LNQA 1BCCG 4U7JA 1IFPA 3CWBE 3WMM0 4YPCA 2E75C 3B5NC 3AE6C 3PRJA 3MUDA 1QEXA 3AE4C 3A0HH 2N1TC 5EFWB 1L0LG 2GUVA 2WSEJ 4C7NB 2OYHC 4H44D 1AQ5A 2PAJA 3V2PA 3HTKA 1PGJA 2FYUD 1AVYA 1RQUA 3Q5RA 3H1LD 5APUA 3USSA 2POHA 4IL6E 1KILC 1S5LH 1EC5A 1PZQA 4H0LC 3Q5PA 3L72G 2IBZG 1T6AA 3AEFC 2A06E 1BE3D 3SWYA 3B5ND 5AW8B 2KNCA 1YJNP 1P84E 5H2FE 1URQA 1WMKA 4BWNA 4NPDA 1IO4A 2KP8A 1JM0A 1KFMA 3CXHI 1H8AA 2IZ0A 1VQNP 4WY4B 1N73B 2BCCE 3U59A 4OWFA 1ZMEC 3P7KA 4U3FG 4H0LD 3CCQP 1D7MA 4HKZH 2NRGA 3TGUG 2IX7C 3ITKA 2LXCB 2YKPA 3O6QB 3D6ZA 1MZ9A 1BGYD 2HODB 2ZT9C 1DH3A 2N9BA 2Q5UA 1SQXE 3TDKA 1QL1A 1OMIA 5CJ4A 1YTZT 1YHQP 5CMZA 3A7OA 2P2UA 2K9JA 1U7MA 1PFIA 4ZMDA 4DT0A 4GDOA 3G6EP 5CCHA 4KT0J 3AEEC 3D70A 1SQVK 2QRXA 1S1CX 1PPJD 4BRYB 2YIUB 2WVRA 3CX5E 2QJKC 3H1JD 3EFGA 4W7ZA 3H1KG 1ZOYC 4GODA 1NYHA 1S3JA 3L74D 2JR8A 1PV3A 1USDA 1YQ4C 5M1BA 2R32A 1FZEA 4CPGA 1L4AA 1SQPE 2WITA 1LWUB 1KYOH 1OVRA 2AXTH 1FZAA 3LIDA 5C39A 2J5UA 1P84I 1SQVE 4AUWA 2PRRA 1L4AC 2E42A 2IFNA 4PD4E 1PGPA 2K3RA 1QVGO 3CC4P 1GL2B 1ZV8A 3CC2P 1OWAA 1VDFA 4H13C 2YO2A 1DEEG 3CI9A 3PJSK 2Y0DA 1IFNA 3B5NB 3W67A 2Z5IA 1SFCD 1J1DC 4DJGA 1XTCC 2CPSA 5DJTB 2WTYA 2KS1A 2HG5D 1NKZB 3RK3C 2O1JA 5B66E 1YI2P 1EDJA 1HGZA 2KK7A 1RF1A 2Q1KA 2XDJA 2KOGA 1DD3A 3II6A 4H0LB 3TSIA 4GOEA 1GTWA 1SQQD 4IOIH 4H13D 3L73G 1VQ6P 5CBNA 3V5BA 3FWNA 1GK4A 1T3JA 4GKGA 2RKLA 4Y99B 1JY3N 3L75E 1NTZD 2IZ1A 1RHZB 1HJBA 2OGUA 4PJ0H 3Q1MA 1BCCD 3AE7C 1VQOP 1VQLP 1JCDA 2SPZA 2QIWA 3ZDMA 1BDDA 3BCCJ 5CCGA 2HR3A 4I1LA 2R3CA 3CX5I 1K8AQ 3RK3D 1GW4A 1NAFA 1JY3O 1N8RQ 2W90A 4GOFA 4I7ZB 1LJ2A 1L0LD 1N7SC 4A7PA 1JO5A 1BSHA 1KYOD 3CCEP 5KAIE 3L71E 1OXZA 2Y0EA 3G3ZA 2WPSA 3CPWO 4IFMA 1PP9E 4EYYQ 1JY3P 3CMAP 1KMIZ 3Q2YA 1JOCA 3E1RA 1S9KD 3H1HJ 3M9QA 3M9HA 3WUVA 4UB8H 3L72D 5KLIB 2OTKE 2ZT9B 4PD4I 1T3UA 1KC8Q 3L37A 4D6TJ 2KLVA 2FXOA 4I2LC 2QA4P 5AW4B 1U7JA 1NU1G 3FXEA 5KJ7C 3CMEP 1KV4A 1RE3A 3R4YA 4PV1C 2WSCJ 2WSFJ 3PHLA 3EWKA 3BCCE 1PGQA 2KZIA 2L5GB 3G4SP 1N73A 1Q90D 2ZVOB 4U3FD 2O1KA 1FDMA 2B87B 1FZGA 2LXBA 5KAFH 1FZCC 1SFCB 3TGUD 2E76C 1NGMB 4WY4C 2WPQA 2RN0A 1MUUA 1GK6A 2HPCB 2FYUJ 1UIIA 1VQ5P 4DOJA 2E43A 3IAOA 3VMYA 3H1LJ 1VQMP 3VN0A 3P8CD 1T2KC 5KJ7D 2HODA 1HH0A 2BCCG 1X22A 1X8YA 4PV1D 2HLOA 2M3BA 4ZKUA 4HH2A 1R5LA 3H1IE 4H13B 1BE3J 2M8RA 4WWIA 2FYUK 4D6TE 1VF5C 1DIPA 3MGNA 3CXHH 5KLVK 5AVTB 3PH0A 3AE9C 1J1DB 2E76D 2KUBA 4BRYA 2NZ2A 2C0XA 3H1KD 1SQXG 1N7LA 3RK3B 1VPCA 1M90Q 3HUSB 2JEEA 1RF0C 1JY2O 3C1LA 2RH0A 2YIUC 3ABVC 1JMBA 4YXWH 4LLHA 1BDCA 2QEXP 1LP1B 1LWUA 3KZIE 1VF5D 3H1LE 3Q3DA 4ASVA 1SQBD 4RO0A 1BGYJ 2PGDA 1IC2A 4RESB 5AVRB 4H44C 5KLVE 2KB7P 4HB1A 3GHGB 3AECC 3K5BA 2O01J 2Y0CA 1GL2A 4JPZB 2WZ7A 5TISE 5GTHH 1SP4A 1S2EA 2QJPB 2KIKA 3B4SA 1K73Q 2E5TA 3M9BA 3B5NA 3UIAA 3VYIA 1SQPG 3V6IA 4Z1MH 2W6AA 1N7SB 3VTPC 1IK9A 5APWA 4IL6X 2N1TA 3GG2A 2E74D 3BATA 1HTLC 1SQVG 2OYHA 4IL6H 2O01H 1QL2A 3H1JJ 3H32A 4C7RA 2J59M 3MTUE 4UB6H 5AW3B 4TLFA 3L74J 1JCCA 3MP7B 2UWJE 1S72P 1RE4C 1GDTA 1KILA 1KILE 2H43A 1E79H 3L73D 1L0NJ 2BEQD 4Y28J 4OVNF 1SVFA 1LTBC 3CXHD 1L2PA 1A02F 5AVWB 2O3JA 3I55P 3CD6P 3P32A 1NVOA 3V2RA 3MD0A 3HE4A 1KQLA 1QX8A 3AEAC 1VQKP 1BGYE 3OW2O 1NKNA 3EQ2A 4PV1B 2FYNC 3TNUA 1L0NK 4W80A 1GD2E 4Y99C 2R5DA 1YQ3C 2YXQB 3F5HA 2I8DA 3TK1A 4I6MC 4N78D 1M8OB 3MHVA 1FZCB 3L75G 3D6YA 1OVUA 2E76B 1DX7A 2NPSD 3H25A 1HGVA 3JC22 1S5LE 4I7ZC 2IPPA 5CJ0A 1S4XA 1XTGB 3L70G 2C0WA 1IJDB 3L4FA 2FY8A 3L74E 1SS1A 5E79H 2R44A 3I5CA 1M56D 3A3YB 1L0NE 2KZJA 1SQQJ 2D2CC 3L71G 1FOSF 1Q82Q 1FZBA 2A45G 5KLIC 1NU1D 4JBZA 1FE6A 1VF5B 1PP9G 1Q86Q 3C8VA 2H7HA 1NTZJ 1M1JC 3KQGA 5L8RJ 2WT7B 2K1AA 4WB4A 1BCCJ 3V2QA 2WPRA 1LTIC 1USEA 2YMYA 1YTZI 4GT1A 3IN6A 4C46A 1EDKA 3M0DC 1ZRTE 1R5SA 4EI2A 1NTZK 1X9VA 2B87A 1L0LJ 1JTHB 1P84D 1KN7A 4AQRD 5AW2B 1MFTA 1GU5A 3A0BH 3MIWA 2OYOA 1QGKB 2E74B 2K88A 3U1CA 2D2CD 1X79B 2C9NY 1KQGB 2KSJA 1N86A 2HPCA 1J1EC 1SFCC 3BCCG 1JB0J 2BCCD 2ZYAA 4PD4H 3Q5SA 3L72J 1IFJA 1ZLLA 4H44B 1M1KQ 2CK3H 4JYBA 2B89A 5APVA 3HE5A 1MKMA 4W7YA 4EDFA 1Z56A 3N4XA 1NTZE 3FXDA 5BVZA 1CZQA 1SQXD 1GW3A 1VQ8P 2M0BA 3RK3E 3C9IA 4XA4A 1ZXGA 3H1IG 4U3FJ 5AW6B 2QM8A 5CCHD 4D6TG 1OW7A 1CI6B 1GU4A 2AXTE 2FFDB 1A02J 2ZVNB 3VMAA 1JEKA 2NPSB 3I56P 3HUSC 4EIJA 1NWQA 1JNMA 1IFDA 2HYNA 1LP1A 1W2EA 3CC7P 1S9KE 2VRSA 2W27A 1NTMD 1NTKD 2N9YB 3L72E 1TU3F 1QLED 1HBWA 5AVSB 2FYNB 2W6JH 3TF5A 3HTKB 1SQPD 3LW5H 2A45H 3GHGC 5AW0B 1SLQA 4XE5B 3JCUH 1N7SA 1LT9C 1SQVD 4PD4D 2QJPC 3WU2H 2P7JA 1FJPA 3FWLA 5KLVG 1YYCA 3PTZA 2V4HA 1HWTC 1EZVE 4K3AA 2M5AB 3L36A 3TYYA 4C7NA 4XFJA 3NMDA 2XZRA 3AEDC 1E5WA 2IYPA 2D2CB 3CWBG 1EDLA 4PJ0E 3D71A 3VMZA 1CW5A 2IBZD 3A2AA 2H89C 1LTJB 1SQBJ 1IZNB 1M1JB 5KJ7A 4OGQD 1NH4A 2Y9ZA 3U1AA 1AQTA 2QE7H 2Z5HA 3RL0D 1DD4A 4R4MA 1HF9A 3E1IA 2LR2A 5CBOA 1VQ9P 3L75D 1SQBK 1OW8A 2M3EA 1FZCA 3VMXA 2P1JA 3HRNA 1YJWP 4WY4A 2A06G 5AVUB 1KQSO 3AE2C 3KXDA 3L70D 2K9YA 1RQVA 5GTIE 4LGDE 1FU1A 2FBWC 1J1EB 2OYIC 2XU6A 2QJYB 1Y47A 3L71D 2XV5A 3L73J 3OA7A 2H88C 3H1HE 3O6QA 1PP9D 1KB9E 1AFOA 2ZYDA 3R2PA 5KTBA 3GF7A 2ZJSE 4EOTA 3V4WA 1U57A 1BSNA 1SQBE 2MKVA 3NFQA 1K04A 1LTAC 4NPFX 1JY2N 1T8ZA 1L0NG 1UIXA 1EZVI 1G2CB 1OX3A 2Z4EA 1RF0A 2WQYC 3RBXA 3O8ZA 1JTHA 5B5EE 3BRTB 3KZIH 4RJTA 3CCVP 3BCCD 2H8PD 5AVVB 5AVXB 4DCKA 1HUCA 4YXDC 3KDPB 3S9OA 2E74C 2J58A 5TISH 1FAVA 1AA0A 1WRGA 1JY2P 2FYUE 3L73E 5APQA 1PIXA 1NHLA 2KS1B 4HYTB 3VP8A 1NAYA 2ZAEB 1NU1J 1H88A 3HD7C 2MJZA 1KQFB 1Q7YQ 2G3AA 1LT9B 2KLUA 3KYQA 2JJLA 2Y9YA 1BE3E 3IF4A 5KKZB 4WBAA 3RL0B 3RK2C 3H1ID 4KHXA 1YITP 4N6JA 1PL5A 1NU1K 2AEFA 3SFEC 1LGHB 1FDIA 3T97B 2ZYGA 1RE4A 1CI6A 1NTZG 2XKMA 2JP3A 1KB9I 3LIEA 1CSBA 3HD7D 2BCCJ 1G1IA 2FFDC 5APXA 2AXCA 1NJIQ 4O9BA 2NPSC 1Y9BA 5GTHE 2QM7A 2XNDH 1P84H 5H2FH 3RL0g 1EXIA 1RY3A 1OFCX 5CHXA 3SWFA 4M3LA 3S4RA 3RK2D 3G9RA 1VQ4P 3MUDC 2FXPA 3E7KA 1NU1E 1S5LX 1R8EA 3L35A 1ZR4A 1GZLA 1YIJP 4B86A 1LTSC
chains in the Genus database with same CATH topology
3G3ZA 2WPSA 4IFMA 4JYBA 5APTA 1JY3P 5APVA 4WY4D 2A45I 1GL2D 3HE5A 2OARA 4W7YA 1JOCA 2FYZA 2WSEH 1S9KD 1Z56A 1IFMA 1WT6A 3M9QA 1G1JA 3M9HA 2OYIB 3N4XA 2Q3IA 3V2NA 1DEBA 3HD7A 5BVZA 4IFFA 3V4QA 1CZQA 1FJKA 1T2KD 3H6PA 1SQXK 1T3UA 2N1TD 5APYA 1FBMA 1GW3A 3L37A 2KLVA 4I2LC 5AW4B 1LTTC 3C9IA 4XA4A 2C9LY 1URQC 5AW6B 1RF1B 1LTJA 5KJ7C 2QM8A 5CCHD 2WWWA 1RE3A 2I1JA 1M1JA 1CI6B 1KILD 1GU4A 1IFIA 2FFDB 1A02J 2NPSB 3HUSC 1LWUC 4EIJA 1NWQA 1LTJC 1JMMA 2L5GB 1JNMA 1IFDA 2HYNA 5AVQB 1KZUB 1N73A 1W2EA 2O1KA 1S9KE 1FDMA 1H89A 2VRSA 1FZGA 2W27A 4N78E 3M0DA 2P67A 1NTMK 1NTKK 1FZCC 1SFCB 2FFDA 1HBWA 1SQQK 2XNXA 2LKMA 5AVSB 2NPSA 4WY4C 1GL2C 2WPQA 4GIFA 1MUUA 1GK6A 3WMM0 2HPCB 1EQ7A 3HTKB 5AW1B 4DOJA 2E43A 3B5NC 3VMYA 1SQPK 3MUDA 1FZFA 3N7NA 1URQD 1M7LA 1SFCA 3VN0A 3LW5H 3GHGC 2A45H 3P8CD 1T2KC 5KJ7D 2HODA 1HH0A 1SLQA 2YO3A 4XE5B 5AW0B 1X8YA 1N7SA 2N1TC 1LT9C 2GUVA 2HLOA 4C7NB 2M3BA 2OYHC 2P7JA 1FJPA 1AQ5A 2PAJA 4ZKUA 3V2PA 3HTKA 4HH2A 4N3YB 2M8RA 1YYCA 2FYUK 2HFED 4JF7A 5CCHC 1L0LK 1HWTC 5APUA 2POHA 3HD7B 3L36A 3TYYA 1KILC 3MGNA 4C7NA 5KLVK 5AVTB 3M06A 2W6BA 3NMDA 1J1DB 2XZRA 3B8EB 2C0XA 5APSA 1JUNA 1E5WA 3SWYA 5AW5B 1ZN5A 3RK2B 1N7LA 3KPEA 3RK3B 3VMZA 1CW5A 1VPCA 3B5ND 1LTGC 3OJAB 5AW8B 3HUSB 2ZXEB 3A2AA 2JEEA 1LTJB 1RF0C 1JY2O 3P8MC 1URQA 3CL3D 1G2CA 1M1JB 5KJ7A 1NH4A 3IFMA 1IO4A 2FKWB 2KP8A 4LLHA 3U1AA 1KFMA 5AW9B 2Z5HA 3RL0D 1H8AA 4ZKPA 4WY4B 2YKOA 3E1IA 3HUSA 1N73B 1LWUA 3U59A 1ZR2A 2R5BA 1SQBK 3P7KA 1IC2A 2YKQA 4RESB 5AVRB 2KB7P 1FZCA 3VMXA 3GHGB 2P1JA 3HRNA 4WY4A 2IX7C 5AVUB 1GL2A 2N1TB 1J2JB 2WZ7A 1SP4A 3NTNA 2YKPA 4LGDE 2OYHB 1FU1A 2CPBA 1J1EB 2OYIC 3M9BA 3B5NA 3UIAA 1MZ9A 3H32B 3VYIA 2BASA 2HODB 2XU6A 5BU8B 1DH3A 2W6AA 1N7SB 2N9BA 3GHGA 2Q5UA 3VTPC 1IK9A 1QL1A 5APWA 4AYCA 3VP9A 2N1TA 1KILB 1LT9A 5CJ4A 1L4AD 3BATA 1HTLC 2XV5A 2OYHA 1YTZT 2GUSA 3OA7A 3A7OA 5CMZA 2P2UA 3BRVB 1AFOA 2O01H 1QL2A 1PFIA 3R2PA 5KTBA 3H32A 4C7RA 2J59M 3MTUE 5CCHA 1RF1C 4EOTA 3V4WA 5AW3B 1SQVK 1JCCA 3HE4B 1RE4C 1GDTA 1KILA 2H43A 3T97A 1MFZA 3NFQA 3RL0C 4LC1A 2IFMA 1LTAC 3M91A 3TNUB 1SVFA 1LTBC 1A02F 3EFGA 5AVWB 4W7ZA 1JY2N 1T8ZA 3P32A 3V2RA 1N2DC 3MD0A 3HE4A 2PP6A 1KQLA 1URQB 1G2CB 2Z4EA 1RF0A 1NKNA 3O8ZA 1JTHA 3EQ2A 2KYVA 2I1KA 2R32A 3TNUA 1L0NK 5CCGC 1FZEA 3BRTB 4W80A 1GD2E 4Y99C 1L4AA 1HVVA 3CLQA 2WITA 1LWUB 2H8PD 5AVVB 2ZFCA 1FZAA 2R5DA 4DZOA 3NXSA 4JYCA 3P8CE 3LIDA 5AVXB 1HUCA 1MV8A 3TK1A 3KDPB 4AUWA 4I6MC 1L4AC 4N78D 2J58A 2E42A 2IFNA 2Q9IA 1FZCB 1FAVA 1WRGA 1DX7A 3BASA 1JY2P 1GL2B 1ZV8A 2NPSD 3A5TA 1OWAA 1VDFA 2YO2A 1HGVA 5APQA 3CI9A 2IPPA 1NHLA 5CJ0A 4HYTB 3VP8A 1IFNA 1XTGB 1H88A 3B5NB 5BU5A 3HD7C 2MJZA 2C0WA 2OYIA 2Z5IA 1IJDB 3L4FA 1SFCD 1J1DC 1LT9B 1XTCC 5AVYB 1N7SD 2CPSA 2YNYA 3KYQA 2JJLA 3I5CA 3PP5A 3A3YB 5CCGD 2WTYA 4WBAA 2GM4A 2HG5D 1NKZB 3RK2C 3RL0B 1FOSF 3RK3C 1NOHA 1FZBA 2A45G 2O1JA 4KHXA 4N6JA 1NU1K 1HGZA 2H7HA 1RE3C 3IR9A 1NO4A 1M1JC 1LGHB 1RF1A 2XDJA 3KQGA 2KOGA 2WT7B 1FOSE 3II6A 3TSIA 4WB4A 1RE4A 3V2QA 1CI6A 1GTWA 2WPRA 1LTIC 2YMYA 2XKMA 2FXMA 1YTZI 1N73C 3OAKA 4GT1A 3V5BA 2WSCH 2WSFH 1GK4A 1T3JA 3VOPA 3LIEA 4GKGA 4Y99B 1JY3N 1KFNA 1CSBA 3M0DC 4C46A 3HD7D 1G1IA 3M0AA 2WT7A 1NTZK 1X9VA 2FFDC 1HJBA 5APXA 1JTHB 4O9BA 2NPSC 4AQRD 5AW2B 2QM7A 1JCDA 1GU5A 3MIWA 4OH8B 1L4AB 5AW7B 3U1CA 1RY3A 1X79B 5CHXA 5CCGA 4M3LA 3SWFA 4I1LA 2R3CA 3BVHA 2C9NY 3RK2D 3RK3D 2KSJA 1N86A 2HPCA 1GW4A 1NAFA 1J1EC 1JY3O 5AVZB 3HE5B 1SFCC 4IFDK 3L35A 1ZR4A 1GZLA 1N7SC 1JO5A 1IFJA 1ZLLA 2Q7CA 4B86A 1OXZA 1LTSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPS A;  2IPP A;  1SLQ A;  2YO3 A;  4XE5 B;  3M9B A;  5AW0 B;  1X8Y A;  3UIA A;  4HYT B;  3VYI A;  2BAS A;  4JYB A;  5APT A;  2XU6 A;  4C7N B;  1DH3 A;  2W6A A;  1H88 A;  5APV A;  2N9B A;  3HE5 A;  2P7J A;  2Q5U A;  3VTP C;  5APW A;  3HTK A;  2Z5I A;  4AYC A;  1S9K D;  1YYC A;  3M9H A;  2XV5 A;  2Q3I A;  1HWT C;  5AVY B;  5CMZ A;  2YNY A;  3A7O A;  5APU A;  2JJL A;  2P2U A;  3I5C A;  3V4Q A;  3A3Y B;  3L36 A;  2WTY A;  3TYY A;  1CZQ A;  3MGN A;  1T2K D;  4C7N A;  1FOS F;  5AVT B;  4KHX A;  3M06 A;  3V4W A;  3NMD A;  4EOT A;  5AW3 B;  5APY A;  2XZR A;  3B8E B;  3L37 A;  3HE4 B;  2H7H A;  5APS A;  4I2L C;  1JUN A;  3IR9 A;  5AW4 B;  1MFZ A;  3NFQ A;  3T97 A;  5AW5 B;  3KQG A;  4LC1 A;  2C9L Y;  2WT7 B;  1FOS E;  5AW6 B;  3VMZ A;  3M91 A;  2QM8 A;  3TNU B;  1CI6 A;  1GTW A;  2WWW A;  5AW8 B;  2ZXE B;  1A02 F;  3A2A A;  5AVW B;  2WPR A;  3P8M C;  1CI6 B;  3P32 A;  1GU4 A;  3MD0 A;  1A02 J;  3HE4 A;  3OAK A;  1KQL A;  4GT1 A;  3V5B A;  1GK4 A;  1G2C B;  3LIE A;  4GKG A;  4C46 A;  1NWQ A;  1IO4 A;  1CSB A;  2KP8 A;  3O8Z A;  1JNM A;  3M0A A;  2WT7 A;  5AVQ B;  5AW9 B;  1HJB A;  5APX A;  2Z5H A;  1H8A A;  2R32 A;  3TNU A;  1S9K E;  1H89 A;  2VRS A;  2W27 A;  4AQR D;  5AW2 B;  1GD2 E;  2QM7 A;  3M0D A;  2P67 A;  1GU5 A;  1HBW A;  2R5B A;  5AVV B;  2ZFC A;  5AW7 B;  2R5D A;  5AVS B;  3P7K A;  4DZO A;  3SWF A;  4M3L A;  4RES B;  2R3C A;  3NXS A;  4JYC A;  3LID A;  2WPQ A;  5AVR B;  5AVX B;  2C9N Y;  1HUC A;  1MUU A;  1NAF A;  1MV8 A;  5AVZ B;  3TK1 A;  3VMX A;  3HE5 B;  1GK6 A;  3KDP B;  4AUW A;  4I6M C;  2E42 A;  5AW1 B;  3L35 A;  5AVU B;  1FAV A;  2E43 A;  1GZL A;  1J2J B;  3VMY A;  1SP4 A;  2Q7C A;  3NTN A;  4B86 A;  3VN0 A;  1OXZ A;  1OWA A;  3A5T A;  2YO2 A;  1T2K C;  5APQ A; 
#chains in the Genus database with same CATH topology
 5KLV D;  3WUU A;  4WVZ A;  1SQX J;  4UB6 E;  3A0H E;  5APT A;  3SWK A;  1GL2 D;  2FYZ A;  2WSE H;  2KI7 B;  1G1J A;  2R3S A;  2OYI B;  3V2N A;  1DEB A;  2M5A A;  2QSI A;  2E75 D;  3FX0 A;  1PPJ E;  4IFF A;  1FJK A;  2O01 N;  3H6P A;  1SQX K;  3CWB D;  2N1T D;  5APY A;  3H1J E;  2W83 C;  4YTP C;  1Q81 Q;  1EXJ A;  2C9L Y;  1RH5 B;  1URQ C;  4MN4 C;  2OTJ P;  1LTJ A;  4L74 A;  1NTM J;  2WWW A;  1NTK J;  2RMZ A;  4ASW A;  1EZV G;  1M1J A;  2PFX A;  1VQ7 P;  1KIL D;  1IFI A;  1KTM A;  1FS0 E;  1LTJ C;  1JMM A;  3EFF K;  1SQP J;  2B88 A;  3CX5 H;  3M0D A;  1NTM K;  1NTK K;  2P10 A;  2A06 D;  5K5G B;  1SQQ K;  1SQV J;  2XNX A;  4KJM A;  4GIF A;  1VQP P;  3GW6 A;  1EQ7 A;  5AW1 B;  3GMA A;  1SQP K;  2JWA A;  5E79 E;  1H0T B;  1FZF A;  3N7N A;  1URQ D;  2KSE A;  1M7L A;  1SFC A;  2YO3 A;  1LT1 A;  1YJ9 P;  1K9M Q;  2QG4 A;  1AVO A;  3SSU A;  4N3Y B;  4L76 A;  1VL2 A;  2HFE D;  4JF7 A;  5CCH C;  1L0L K;  1M57 D;  2QJY C;  3G71 P;  3HD7 B;  2L91 A;  1OIP A;  3MZW B;  1NTM E;  1NTK E;  3M06 A;  2W6B A;  1KD1 Q;  3B8E B;  1SQQ E;  2ZT9 D;  4L75 A;  5APS A;  1JUN A;  1L0N D;  5AW5 B;  1ZN5 A;  3RK2 B;  2YMK A;  3KPE A;  1ZP0 C;  1LTG C;  3OJA B;  3CCS P;  2ZXE B;  2JWD A;  3A0B E;  3P8M C;  3H1H G;  1BCC E;  3L75 J;  3CL3 D;  1G2C A;  1ZW0 A;  5B66 H;  3GF3 A;  2JO1 A;  2WSS H;  3IFM A;  2FKW B;  1SQB G;  5AW9 B;  4ZKP A;  2YKO A;  2WPV B;  3HUS A;  3L70 J;  3AEB C;  1Y8A A;  1ZR2 A;  1L0L E;  3AEG C;  2R5B A;  1KYO E;  3TGU J;  1ZRT D;  2K37 A;  2E75 B;  2YKQ A;  1X0T A;  4R4L A;  3L71 J;  3CX5 D;  3CCM P;  2N1T B;  3LW5 J;  1J2J B;  3NTN A;  1PP9 J;  2OYH B;  1EDI A;  2CPB A;  2IBZ E;  3H32 B;  2BAS A;  5BU8 B;  4L73 A;  1AV1 A;  3GHG A;  4AYC A;  1OZH A;  2YXR B;  2AEM A;  3VP9 A;  1KIL B;  1LT9 A;  1L4A D;  3AE8 C;  2GUS A;  3BRV B;  5KAI H;  3SFD C;  2FYU G;  4OGQ C;  1RF1 C;  1IK7 A;  2IDB A;  3H1L G;  3QWO C;  3KHU A;  3HE4 B;  5KKZ C;  3T97 A;  1MFZ A;  3RL0 C;  3H1K J;  4LC1 A;  2IFM A;  3M91 A;  3TNU B;  4K35 A;  1W5C E;  3W68 A;  2DW3 A;  2QVA A;  4U3F E;  2BEZ F;  3L70 E;  1BE3 G;  2KNC B;  1N2D C;  2PP6 A;  1URQ B;  3B71 A;  3TGU E;  2V7Q J;  2KYV A;  4BXL A;  2I1K A;  2W8Z A;  5CCG C;  2Q3E A;  1HVV A;  3CLQ A;  1AJY A;  3JCU E;  2ZFC A;  1QVF O;  3QH9 A;  4DZO A;  3CCR P;  3NXS A;  4JYC A;  3P8C E;  3WU2 E;  1MV8 A;  2Q9I A;  2IYO A;  3BAS A;  5GTI H;  2V7Q H;  3A5T A;  2AEJ A;  1KOR A;  3WUT A;  3GLM A;  3H1I J;  5BU5 A;  2OYI A;  1KYO I;  4ZNC A;  1BGY G;  3FGA D;  4JQ0 D;  4UB8 E;  5AVY B;  1N7S D;  2YNY A;  1KB9 H;  1OVV A;  3H1K E;  3PP5 A;  5CCG D;  3AE5 C;  2K9J B;  3CCJ P;  2GM4 A;  4QMA A;  1NOH A;  3S1K A;  1FC2 C;  3CCL P;  2QJK B;  1EZV D;  2IBZ I;  1RE3 C;  3IR9 A;  1NO4 A;  3JSV C;  1FOS E;  1PPJ G;  3RBZ A;  2FXM A;  1Q2N A;  1N73 C;  3OAK A;  4RKU J;  5DJU B;  2WSC H;  2WSF H;  3VOP A;  1KFN A;  3H1J G;  2WMM A;  3M0A A;  2WT7 A;  5B5E H;  2OQQ A;  5TJH A;  3L74 G;  3AE1 C;  4OH8 B;  5KAF E;  5KLV J;  1HJ0 A;  1PGO A;  2KXP B;  1L4A B;  2ITA A;  5AW7 B;  3AE3 C;  3BVH A;  5AVZ B;  3HE5 B;  1GMJ A;  1H0T A;  4IFD K;  2GA1 A;  4NPE A;  1YBK A;  2Q7C A;  2JKV A;  3CCU P;  3CWB J;  4WY4 D;  2A45 I;  2B9B A;  2OAR A;  3RGU A;  2Q6Q A;  1IFM A;  1WT6 A;  2OTL P;  2Q3I A;  3HD7 A;  1W2B O;  3V4Q A;  3F89 A;  1T2K D;  3CXH E;  1FBM A;  2P58 A;  3H1H D;  1KB9 D;  1LTT C;  4OGQ B;  1RF1 B;  1FDO A;  2I1J A;  4HJG H;  3PLN A;  2ZXX A;  1K05 A;  1NTM G;  1NTK G;  4D6T D;  1LWU C;  1SQQ G;  1OW6 A;  5AVQ B;  1KZU B;  4TT3 H;  1H89 A;  2G8Y A;  4N78 E;  2P67 A;  2E5Y A;  2FFD A;  2LKM A;  2NPS A;  1GL2 C;  2JDI H;  1LNQ A;  1BCC G;  4U7J A;  1IFP A;  3CWB E;  3WMM 0;  4YPC A;  2E75 C;  3B5N C;  3AE6 C;  3PRJ A;  3MUD A;  1QEX A;  3AE4 C;  3A0H H;  2N1T C;  5EFW B;  1L0L G;  2GUV A;  2WSE J;  4C7N B;  2OYH C;  4H44 D;  1AQ5 A;  2PAJ A;  3V2P A;  3HTK A;  1PGJ A;  2FYU D;  1AVY A;  1RQU A;  3Q5R A;  3H1L D;  5APU A;  3USS A;  2POH A;  4IL6 E;  1KIL C;  1S5L H;  1EC5 A;  1PZQ A;  4H0L C;  3Q5P A;  3L72 G;  2IBZ G;  1T6A A;  3AEF C;  2A06 E;  1BE3 D;  3SWY A;  3B5N D;  5AW8 B;  2KNC A;  1YJN P;  1P84 E;  5H2F E;  1URQ A;  1WMK A;  4BWN A;  4NPD A;  1IO4 A;  2KP8 A;  1JM0 A;  1KFM A;  3CXH I;  1H8A A;  2IZ0 A;  1VQN P;  4WY4 B;  1N73 B;  2BCC E;  3U59 A;  4OWF A;  1ZME C;  3P7K A;  4U3F G;  4H0L D;  3CCQ P;  1D7M A;  4HKZ H;  2NRG A;  3TGU G;  2IX7 C;  3ITK A;  2LXC B;  2YKP A;  3O6Q B;  3D6Z A;  1MZ9 A;  1BGY D;  2HOD B;  2ZT9 C;  1DH3 A;  2N9B A;  2Q5U A;  1SQX E;  3TDK A;  1QL1 A;  1OMI A;  5CJ4 A;  1YTZ T;  1YHQ P;  5CMZ A;  3A7O A;  2P2U A;  2K9J A;  1U7M A;  1PFI A;  4ZMD A;  4DT0 A;  4GDO A;  3G6E P;  5CCH A;  4KT0 J;  3AEE C;  3D70 A;  1SQV K;  2QRX A;  1S1C X;  1PPJ D;  4BRY B;  2YIU B;  2WVR A;  3CX5 E;  2QJK C;  3H1J D;  3EFG A;  4W7Z A;  3H1K G;  1ZOY C;  4GOD A;  1NYH A;  1S3J A;  3L74 D;  2JR8 A;  1PV3 A;  1USD A;  1YQ4 C;  5M1B A;  2R32 A;  1FZE A;  4CPG A;  1L4A A;  1SQP E;  2WIT A;  1LWU B;  1KYO H;  1OVR A;  2AXT H;  1FZA A;  3LID A;  5C39 A;  2J5U A;  1P84 I;  1SQV E;  4AUW A;  2PRR A;  1L4A C;  2E42 A;  2IFN A;  4PD4 E;  1PGP A;  2K3R A;  1QVG O;  3CC4 P;  1GL2 B;  1ZV8 A;  3CC2 P;  1OWA A;  1VDF A;  4H13 C;  2YO2 A;  1DEE G;  3CI9 A;  3PJS K;  2Y0D A;  1IFN A;  3B5N B;  3W67 A;  2Z5I A;  1SFC D;  1J1D C;  4DJG A;  1XTC C;  2CPS A;  5DJT B;  2WTY A;  2KS1 A;  2HG5 D;  1NKZ B;  3RK3 C;  2O1J A;  5B66 E;  1YI2 P;  1EDJ A;  1HGZ A;  2KK7 A;  1RF1 A;  2Q1K A;  2XDJ A;  2KOG A;  1DD3 A;  3II6 A;  4H0L B;  3TSI A;  4GOE A;  1GTW A;  1SQQ D;  4IOI H;  4H13 D;  3L73 G;  1VQ6 P;  5CBN A;  3V5B A;  3FWN A;  1GK4 A;  1T3J A;  4GKG A;  2RKL A;  4Y99 B;  1JY3 N;  3L75 E;  1NTZ D;  2IZ1 A;  1RHZ B;  1HJB A;  2OGU A;  4PJ0 H;  3Q1M A;  1BCC D;  3AE7 C;  1VQO P;  1VQL P;  1JCD A;  2SPZ A;  2QIW A;  3ZDM A;  1BDD A;  3BCC J;  5CCG A;  2HR3 A;  4I1L A;  2R3C A;  3CX5 I;  1K8A Q;  3RK3 D;  1GW4 A;  1NAF A;  1JY3 O;  1N8R Q;  2W90 A;  4GOF A;  4I7Z B;  1LJ2 A;  1L0L D;  1N7S C;  4A7P A;  1JO5 A;  1BSH A;  1KYO D;  3CCE P;  5KAI E;  3L71 E;  1OXZ A;  2Y0E A;  3G3Z A;  2WPS A;  3CPW O;  4IFM A;  1PP9 E;  4EYY Q;  1JY3 P;  3CMA P;  1KMI Z;  3Q2Y A;  1JOC A;  3E1R A;  1S9K D;  3H1H J;  3M9Q A;  3M9H A;  3WUV A;  4UB8 H;  3L72 D;  5KLI B;  2OTK E;  2ZT9 B;  4PD4 I;  1T3U A;  1KC8 Q;  3L37 A;  4D6T J;  2KLV A;  2FXO A;  4I2L C;  2QA4 P;  5AW4 B;  1U7J A;  1NU1 G;  3FXE A;  5KJ7 C;  3CME P;  1KV4 A;  1RE3 A;  3R4Y A;  4PV1 C;  2WSC J;  2WSF J;  3PHL A;  3EWK A;  3BCC E;  1PGQ A;  2KZI A;  2L5G B;  3G4S P;  1N73 A;  1Q90 D;  2ZVO B;  4U3F D;  2O1K A;  1FDM A;  2B87 B;  1FZG A;  2LXB A;  5KAF H;  1FZC C;  1SFC B;  3TGU D;  2E76 C;  1NGM B;  4WY4 C;  2WPQ A;  2RN0 A;  1MUU A;  1GK6 A;  2HPC B;  2FYU J;  1UII A;  1VQ5 P;  4DOJ A;  2E43 A;  3IAO A;  3VMY A;  3H1L J;  1VQM P;  3VN0 A;  3P8C D;  1T2K C;  5KJ7 D;  2HOD A;  1HH0 A;  2BCC G;  1X22 A;  1X8Y A;  4PV1 D;  2HLO A;  2M3B A;  4ZKU A;  4HH2 A;  1R5L A;  3H1I E;  4H13 B;  1BE3 J;  2M8R A;  4WWI A;  2FYU K;  4D6T E;  1VF5 C;  1DIP A;  3MGN A;  3CXH H;  5KLV K;  5AVT B;  3PH0 A;  3AE9 C;  1J1D B;  2E76 D;  2KUB A;  4BRY A;  2NZ2 A;  2C0X A;  3H1K D;  1SQX G;  1N7L A;  3RK3 B;  1VPC A;  1M90 Q;  3HUS B;  2JEE A;  1RF0 C;  1JY2 O;  3C1L A;  2RH0 A;  2YIU C;  3ABV C;  1JMB A;  4YXW H;  4LLH A;  1BDC A;  2QEX P;  1LP1 B;  1LWU A;  3KZI E;  1VF5 D;  3H1L E;  3Q3D A;  4ASV A;  1SQB D;  4RO0 A;  1BGY J;  2PGD A;  1IC2 A;  4RES B;  5AVR B;  4H44 C;  5KLV E;  2KB7 P;  4HB1 A;  3GHG B;  3AEC C;  3K5B A;  2O01 J;  2Y0C A;  1GL2 A;  4JPZ B;  2WZ7 A;  5TIS E;  5GTH H;  1SP4 A;  1S2E A;  2QJP B;  2KIK A;  3B4S A;  1K73 Q;  2E5T A;  3M9B A;  3B5N A;  3UIA A;  3VYI A;  1SQP G;  3V6I A;  4Z1M H;  2W6A A;  1N7S B;  3VTP C;  1IK9 A;  5APW A;  4IL6 X;  2N1T A;  3GG2 A;  2E74 D;  3BAT A;  1HTL C;  1SQV G;  2OYH A;  4IL6 H;  2O01 H;  1QL2 A;  3H1J J;  3H32 A;  4C7R A;  2J59 M;  3MTU E;  4UB6 H;  5AW3 B;  4TLF A;  3L74 J;  1JCC A;  3MP7 B;  2UWJ E;  1S72 P;  1RE4 C;  1GDT A;  1KIL A;  1KIL E;  2H43 A;  1E79 H;  3L73 D;  1L0N J;  2BEQ D;  4Y28 J;  4OVN F;  1SVF A;  1LTB C;  3CXH D;  1L2P A;  1A02 F;  5AVW B;  2O3J A;  3I55 P;  3CD6 P;  3P32 A;  1NVO A;  3V2R A;  3MD0 A;  3HE4 A;  1KQL A;  1QX8 A;  3AEA C;  1VQK P;  1BGY E;  3OW2 O;  1NKN A;  3EQ2 A;  4PV1 B;  2FYN C;  3TNU A;  1L0N K;  4W80 A;  1GD2 E;  4Y99 C;  2R5D A;  1YQ3 C;  2YXQ B;  3F5H A;  2I8D A;  3TK1 A;  4I6M C;  4N78 D;  1M8O B;  3MHV A;  1FZC B;  3L75 G;  3D6Y A;  1OVU A;  2E76 B;  1DX7 A;  2NPS D;  3H25 A;  1HGV A;  3JC2 2;  1S5L E;  4I7Z C;  2IPP A;  5CJ0 A;  1S4X A;  1XTG B;  3L70 G;  2C0W A;  1IJD B;  3L4F A;  2FY8 A;  3L74 E;  1SS1 A;  5E79 H;  2R44 A;  3I5C A;  1M56 D;  3A3Y B;  1L0N E;  2KZJ A;  1SQQ J;  2D2C C;  3L71 G;  1FOS F;  1Q82 Q;  1FZB A;  2A45 G;  5KLI C;  1NU1 D;  4JBZ A;  1FE6 A;  1VF5 B;  1PP9 G;  1Q86 Q;  3C8V A;  2H7H A;  1NTZ J;  1M1J C;  3KQG A;  5L8R J;  2WT7 B;  2K1A A;  4WB4 A;  1BCC J;  3V2Q A;  2WPR A;  1LTI C;  1USE A;  2YMY A;  1YTZ I;  4GT1 A;  3IN6 A;  4C46 A;  1EDK A;  3M0D C;  1ZRT E;  1R5S A;  4EI2 A;  1NTZ K;  1X9V A;  2B87 A;  1L0L J;  1JTH B;  1P84 D;  1KN7 A;  4AQR D;  5AW2 B;  1MFT A;  1GU5 A;  3A0B H;  3MIW A;  2OYO A;  1QGK B;  2E74 B;  2K88 A;  3U1C A;  2D2C D;  1X79 B;  2C9N Y;  1KQG B;  2KSJ A;  1N86 A;  2HPC A;  1J1E C;  1SFC C;  3BCC G;  1JB0 J;  2BCC D;  2ZYA A;  4PD4 H;  3Q5S A;  3L72 J;  1IFJ A;  1ZLL A;  4H44 B;  1M1K Q;  2CK3 H;  4JYB A;  2B89 A;  5APV A;  3HE5 A;  1MKM A;  4W7Y A;  4EDF A;  1Z56 A;  3N4X A;  1NTZ E;  3FXD A;  5BVZ A;  1CZQ A;  1SQX D;  1GW3 A;  1VQ8 P;  2M0B A;  3RK3 E;  3C9I A;  4XA4 A;  1ZXG A;  3H1I G;  4U3F J;  5AW6 B;  2QM8 A;  5CCH D;  4D6T G;  1OW7 A;  1CI6 B;  1GU4 A;  2AXT E;  2FFD B;  1A02 J;  2ZVN B;  3VMA A;  1JEK A;  2NPS B;  3I56 P;  3HUS C;  4EIJ A;  1NWQ A;  1JNM A;  1IFD A;  2HYN A;  1LP1 A;  1W2E A;  3CC7 P;  1S9K E;  2VRS A;  2W27 A;  1NTM D;  1NTK D;  2N9Y B;  3L72 E;  1TU3 F;  1QLE D;  1HBW A;  5AVS B;  2FYN B;  2W6J H;  3TF5 A;  3HTK B;  1SQP D;  3LW5 H;  2A45 H;  3GHG C;  5AW0 B;  1SLQ A;  4XE5 B;  3JCU H;  1N7S A;  1LT9 C;  1SQV D;  4PD4 D;  2QJP C;  3WU2 H;  2P7J A;  1FJP A;  3FWL A;  5KLV G;  1YYC A;  3PTZ A;  2V4H A;  1HWT C;  1EZV E;  4K3A A;  2M5A B;  3L36 A;  3TYY A;  4C7N A;  4XFJ A;  3NMD A;  2XZR A;  3AED C;  1E5W A;  2IYP A;  2D2C B;  3CWB G;  1EDL A;  4PJ0 E;  3D71 A;  3VMZ A;  1CW5 A;  2IBZ D;  3A2A A;  2H89 C;  1LTJ B;  1SQB J;  1IZN B;  1M1J B;  5KJ7 A;  4OGQ D;  1NH4 A;  2Y9Z A;  3U1A A;  1AQT A;  2QE7 H;  2Z5H A;  3RL0 D;  1DD4 A;  4R4M A;  1HF9 A;  3E1I A;  2LR2 A;  5CBO A;  1VQ9 P;  3L75 D;  1SQB K;  1OW8 A;  2M3E A;  1FZC A;  3VMX A;  2P1J A;  3HRN A;  1YJW P;  4WY4 A;  2A06 G;  5AVU B;  1KQS O;  3AE2 C;  3KXD A;  3L70 D;  2K9Y A;  1RQV A;  5GTI E;  4LGD E;  1FU1 A;  2FBW C;  1J1E B;  2OYI C;  2XU6 A;  2QJY B;  1Y47 A;  3L71 D;  2XV5 A;  3L73 J;  3OA7 A;  2H88 C;  3H1H E;  3O6Q A;  1PP9 D;  1KB9 E;  1AFO A;  2ZYD A;  3R2P A;  5KTB A;  3GF7 A;  2ZJS E;  4EOT A;  3V4W A;  1U57 A;  1BSN A;  1SQB E;  2MKV A;  3NFQ A;  1K04 A;  1LTA C;  4NPF X;  1JY2 N;  1T8Z A;  1L0N G;  1UIX A;  1EZV I;  1G2C B;  1OX3 A;  2Z4E A;  1RF0 A;  2WQY C;  3RBX A;  3O8Z A;  1JTH A;  5B5E E;  3BRT B;  3KZI H;  4RJT A;  3CCV P;  3BCC D;  2H8P D;  5AVV B;  5AVX B;  4DCK A;  1HUC A;  4YXD C;  3KDP B;  3S9O A;  2E74 C;  2J58 A;  5TIS H;  1FAV A;  1AA0 A;  1WRG A;  1JY2 P;  2FYU E;  3L73 E;  5APQ A;  1PIX A;  1NHL A;  2KS1 B;  4HYT B;  3VP8 A;  1NAY A;  2ZAE B;  1NU1 J;  1H88 A;  3HD7 C;  2MJZ A;  1KQF B;  1Q7Y Q;  2G3A A;  1LT9 B;  2KLU A;  3KYQ A;  2JJL A;  2Y9Y A;  1BE3 E;  3IF4 A;  5KKZ B;  4WBA A;  3RL0 B;  3RK2 C;  3H1I D;  4KHX A;  1YIT P;  4N6J A;  1PL5 A;  1NU1 K;  2AEF A;  3SFE C;  1LGH B;  1FDI A;  3T97 B;  2ZYG A;  1RE4 A;  1CI6 A;  1NTZ G;  2XKM A;  2JP3 A;  1KB9 I;  3LIE A;  1CSB A;  3HD7 D;  2BCC J;  1G1I A;  2FFD C;  5APX A;  2AXC A;  1NJI Q;  4O9B A;  2NPS C;  1Y9B A;  5GTH E;  2QM7 A;  2XND H;  1P84 H;  5H2F H;  3RL0 g;  1EXI A;  1RY3 A;  1OFC X;  5CHX A;  3SWF A;  4M3L A;  3S4R A;  3RK2 D;  3G9R A;  1VQ4 P;  3MUD C;  2FXP A;  3E7K A;  1NU1 E;  1S5L X;  1R8E A;  3L35 A;  1ZR4 A;  1GZL A;  1YIJ P;  4B86 A;  1LTS C; 
#chains in the Genus database with same CATH homology
 3G3Z A;  2WPS A;  4IFM A;  4JYB A;  5APT A;  1JY3 P;  5APV A;  4WY4 D;  2A45 I;  1GL2 D;  3HE5 A;  2OAR A;  4W7Y A;  1JOC A;  2FYZ A;  2WSE H;  1S9K D;  1Z56 A;  1IFM A;  1WT6 A;  3M9Q A;  1G1J A;  3M9H A;  2OYI B;  3N4X A;  2Q3I A;  3V2N A;  1DEB A;  3HD7 A;  5BVZ A;  4IFF A;  3V4Q A;  1CZQ A;  1FJK A;  1T2K D;  3H6P A;  1SQX K;  1T3U A;  2N1T D;  5APY A;  1FBM A;  1GW3 A;  3L37 A;  2KLV A;  4I2L C;  5AW4 B;  1LTT C;  3C9I A;  4XA4 A;  2C9L Y;  1URQ C;  5AW6 B;  1RF1 B;  1LTJ A;  5KJ7 C;  2QM8 A;  5CCH D;  2WWW A;  1RE3 A;  2I1J A;  1M1J A;  1CI6 B;  1KIL D;  1GU4 A;  1IFI A;  2FFD B;  1A02 J;  2NPS B;  3HUS C;  1LWU C;  4EIJ A;  1NWQ A;  1LTJ C;  1JMM A;  2L5G B;  1JNM A;  1IFD A;  2HYN A;  5AVQ B;  1KZU B;  1N73 A;  1W2E A;  2O1K A;  1S9K E;  1FDM A;  1H89 A;  2VRS A;  1FZG A;  2W27 A;  4N78 E;  3M0D A;  2P67 A;  1NTM K;  1NTK K;  1FZC C;  1SFC B;  2FFD A;  1HBW A;  1SQQ K;  2XNX A;  2LKM A;  5AVS B;  2NPS A;  4WY4 C;  1GL2 C;  2WPQ A;  4GIF A;  1MUU A;  1GK6 A;  3WMM 0;  2HPC B;  1EQ7 A;  3HTK B;  5AW1 B;  4DOJ A;  2E43 A;  3B5N C;  3VMY A;  1SQP K;  3MUD A;  1FZF A;  3N7N A;  1URQ D;  1M7L A;  1SFC A;  3VN0 A;  3LW5 H;  3GHG C;  2A45 H;  3P8C D;  1T2K C;  5KJ7 D;  2HOD A;  1HH0 A;  1SLQ A;  2YO3 A;  4XE5 B;  5AW0 B;  1X8Y A;  1N7S A;  2N1T C;  1LT9 C;  2GUV A;  2HLO A;  4C7N B;  2M3B A;  2OYH C;  2P7J A;  1FJP A;  1AQ5 A;  2PAJ A;  4ZKU A;  3V2P A;  3HTK A;  4HH2 A;  4N3Y B;  2M8R A;  1YYC A;  2FYU K;  2HFE D;  4JF7 A;  5CCH C;  1L0L K;  1HWT C;  5APU A;  2POH A;  3HD7 B;  3L36 A;  3TYY A;  1KIL C;  3MGN A;  4C7N A;  5KLV K;  5AVT B;  3M06 A;  2W6B A;  3NMD A;  1J1D B;  2XZR A;  3B8E B;  2C0X A;  5APS A;  1JUN A;  1E5W A;  3SWY A;  5AW5 B;  1ZN5 A;  3RK2 B;  1N7L A;  3KPE A;  3RK3 B;  3VMZ A;  1CW5 A;  1VPC A;  3B5N D;  1LTG C;  3OJA B;  5AW8 B;  3HUS B;  2ZXE B;  3A2A A;  2JEE A;  1LTJ B;  1RF0 C;  1JY2 O;  3P8M C;  1URQ A;  3CL3 D;  1G2C A;  1M1J B;  5KJ7 A;  1NH4 A;  3IFM A;  1IO4 A;  2FKW B;  2KP8 A;  4LLH A;  3U1A A;  1KFM A;  5AW9 B;  2Z5H A;  3RL0 D;  1H8A A;  4ZKP A;  4WY4 B;  2YKO A;  3E1I A;  3HUS A;  1N73 B;  1LWU A;  3U59 A;  1ZR2 A;  2R5B A;  1SQB K;  3P7K A;  1IC2 A;  2YKQ A;  4RES B;  5AVR B;  2KB7 P;  1FZC A;  3VMX A;  3GHG B;  2P1J A;  3HRN A;  4WY4 A;  2IX7 C;  5AVU B;  1GL2 A;  2N1T B;  1J2J B;  2WZ7 A;  1SP4 A;  3NTN A;  2YKP A;  4LGD E;  2OYH B;  1FU1 A;  2CPB A;  1J1E B;  2OYI C;  3M9B A;  3B5N A;  3UIA A;  1MZ9 A;  3H32 B;  3VYI A;  2BAS A;  2HOD B;  2XU6 A;  5BU8 B;  1DH3 A;  2W6A A;  1N7S B;  2N9B A;  3GHG A;  2Q5U A;  3VTP C;  1IK9 A;  1QL1 A;  5APW A;  4AYC A;  3VP9 A;  2N1T A;  1KIL B;  1LT9 A;  5CJ4 A;  1L4A D;  3BAT A;  1HTL C;  2XV5 A;  2OYH A;  1YTZ T;  2GUS A;  3OA7 A;  3A7O A;  5CMZ A;  2P2U A;  3BRV B;  1AFO A;  2O01 H;  1QL2 A;  1PFI A;  3R2P A;  5KTB A;  3H32 A;  4C7R A;  2J59 M;  3MTU E;  5CCH A;  1RF1 C;  4EOT A;  3V4W A;  5AW3 B;  1SQV K;  1JCC A;  3HE4 B;  1RE4 C;  1GDT A;  1KIL A;  2H43 A;  3T97 A;  1MFZ A;  3NFQ A;  3RL0 C;  4LC1 A;  2IFM A;  1LTA C;  3M91 A;  3TNU B;  1SVF A;  1LTB C;  1A02 F;  3EFG A;  5AVW B;  4W7Z A;  1JY2 N;  1T8Z A;  3P32 A;  3V2R A;  1N2D C;  3MD0 A;  3HE4 A;  2PP6 A;  1KQL A;  1URQ B;  1G2C B;  2Z4E A;  1RF0 A;  1NKN A;  3O8Z A;  1JTH A;  3EQ2 A;  2KYV A;  2I1K A;  2R32 A;  3TNU A;  1L0N K;  5CCG C;  1FZE A;  3BRT B;  4W80 A;  1GD2 E;  4Y99 C;  1L4A A;  1HVV A;  3CLQ A;  2WIT A;  1LWU B;  2H8P D;  5AVV B;  2ZFC A;  1FZA A;  2R5D A;  4DZO A;  3NXS A;  4JYC A;  3P8C E;  3LID A;  5AVX B;  1HUC A;  1MV8 A;  3TK1 A;  3KDP B;  4AUW A;  4I6M C;  1L4A C;  4N78 D;  2J58 A;  2E42 A;  2IFN A;  2Q9I A;  1FZC B;  1FAV A;  1WRG A;  1DX7 A;  3BAS A;  1JY2 P;  1GL2 B;  1ZV8 A;  2NPS D;  3A5T A;  1OWA A;  1VDF A;  2YO2 A;  1HGV A;  5APQ A;  3CI9 A;  2IPP A;  1NHL A;  5CJ0 A;  4HYT B;  3VP8 A;  1IFN A;  1XTG B;  1H88 A;  3B5N B;  5BU5 A;  3HD7 C;  2MJZ A;  2C0W A;  2OYI A;  2Z5I A;  1IJD B;  3L4F A;  1SFC D;  1J1D C;  1LT9 B;  1XTC C;  5AVY B;  1N7S D;  2CPS A;  2YNY A;  3KYQ A;  2JJL A;  3I5C A;  3PP5 A;  3A3Y B;  5CCG D;  2WTY A;  4WBA A;  2GM4 A;  2HG5 D;  1NKZ B;  3RK2 C;  3RL0 B;  1FOS F;  3RK3 C;  1NOH A;  1FZB A;  2A45 G;  2O1J A;  4KHX A;  4N6J A;  1NU1 K;  1HGZ A;  2H7H A;  1RE3 C;  3IR9 A;  1NO4 A;  1M1J C;  1LGH B;  1RF1 A;  2XDJ A;  3KQG A;  2KOG A;  2WT7 B;  1FOS E;  3II6 A;  3TSI A;  4WB4 A;  1RE4 A;  3V2Q A;  1CI6 A;  1GTW A;  2WPR A;  1LTI C;  2YMY A;  2XKM A;  2FXM A;  1YTZ I;  1N73 C;  3OAK A;  4GT1 A;  3V5B A;  2WSC H;  2WSF H;  1GK4 A;  1T3J A;  3VOP A;  3LIE A;  4GKG A;  4Y99 B;  1JY3 N;  1KFN A;  1CSB A;  3M0D C;  4C46 A;  3HD7 D;  1G1I A;  3M0A A;  2WT7 A;  1NTZ K;  1X9V A;  2FFD C;  1HJB A;  5APX A;  1JTH B;  4O9B A;  2NPS C;  4AQR D;  5AW2 B;  2QM7 A;  1JCD A;  1GU5 A;  3MIW A;  4OH8 B;  1L4A B;  5AW7 B;  3U1C A;  1RY3 A;  1X79 B;  5CHX A;  5CCG A;  4M3L A;  3SWF A;  4I1L A;  2R3C A;  3BVH A;  2C9N Y;  3RK2 D;  3RK3 D;  2KSJ A;  1N86 A;  2HPC A;  1GW4 A;  1NAF A;  1J1E C;  1JY3 O;  5AVZ B;  3HE5 B;  1SFC C;  4IFD K;  3L35 A;  1ZR4 A;  1GZL A;  1N7S C;  1JO5 A;  1IFJ A;  1ZLL A;  2Q7C A;  4B86 A;  1OXZ A;  1LTS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...