2P58A

Structure of the yersinia pestis type iii secretion system needle protein yscf in complex with its chaperones ysce/yscg
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
54
structure length
54
Chain Sequence
NVETVRSITMQLEMALTKLKKDMMRGGDAKQYQVWQRESKALESAIAIIHYVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative type III secretion protein YscE
publication title Structural characterization of the Yersinia pestis type III secretion system needle protein YscF in complex with its heterodimeric chaperone YscE/YscG.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transport protein/chaperone
total genus 17
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2007-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2p58A00
1BDDA 2JWDA 2M5AA 1JMBA 2M5AB 1EDJA 3MZWB 1EC5A 1OVRA 4JBZA 2P58A 1Y47A 1NVOA 4NPEA 4IOIH 4ZMDA 2KIKA 3FXEA 2LXBA 1DEEG 2WMMA 4GOEA 4ZNCA 1SS1A 2B89A 2SPZA 1EDKA 3QWOC 2I8DA 4GODA 2RKLA 2ZAEB 4ASWA 3ZDMA 4CPGA 1FC2C 5CBOA 4K3AA 2HR3A 1OVUA 4ASVA 2KI7B 1U7MA 2KZIA 4HKZH 4BXLA 1BDCA 2QRXA 5C39A 1X0TA 1MFTA 1EDLA 2KUBA 4HJGH 1H0TA 2B87A 4NPFX 1Q2NA 2LXCB 2OTKE 2M0BA 5CBNA 2QVAA 4K35A 1LP1A 3S1KA 3MHVA 4NPDA 1LP1B 1JM0A 3FXDA 4MN4C 1U7JA 1S3JA 4WWIA 3RGUA 2KS1B 2K3RA 5EFWB 1OVVA 4HB1A 2LR2A 5DJUB 2UWJE 1ZXGA 2Q1KA 1EDIA 2R44A 4EYYQ 3PH0A 1H0TB 5K5GB 2B88A 4GOFA 2B87B 5DJTB 2KZJA 1ZW0A 1LT1A 4KJMA
chains in the Genus database with same CATH superfamily
1SQXG 3CCUP 5KLVK 4JBZA 3EWKA 1SQXD 2YMKA 2QJKC 2QM8A 1JO5A 3LW5J 1GD2E 2M3BA 1H89A 3L75E 3AE6C 2IFNA 1LT9C 3B5ND 2RKLA 2XKMA 2OYOA 2QJKB 3L73J 3AE1C 3Q5SA 2AXTH 5AVXB 1PGOA 3L73G 1YJ9P 2KYVA 1ZMEC 3QH9A 3P8CE 3EFFK 5KLVJ 1NAFA 3L73D 4HKZH 3W68A 5CCHD 1KYOI 2K37A 1A02F 1NHLA 2KSEA 1YTZT 1LT9B 3SWKA 4C7NA 1HGVA 1EXJA 4M3LA 1RE4C 1JNMA 3AE3C 3MUDA 1KILD 1ZLLA 2ZVNB 3A0HE 3VN0A 5APUA 3HD7A 1NWQA 3AE2C 2O3JA 3RBZA 3RL0g 1L0NG 3SSUA 3G6EP 1BGYE 3B71A 2JDIH 1FU1A 1L0ND 5GTIE 3H1JE 3L75J 4PD4E 1GL2D 3A5TA 4OGQD 5CCHA 2NPSD 3TDKA 3CWBE 1BDDA 3FWLA 2E43A 1KYOE 3VTPC 5APXA 4BWNA 1GW3A 4N6JA 4PJ0E 1WRGA 4R4MA 5B66H 3I56P 1KFMA 1FJKA 3CXHH 1ZR4A 1GDTA 2ITAA 3D71A 1N73A 2Y0EA 3VP8A 2HODB 3W67A 2G3AA 3AE4C 1IFPA 1M8OB 2O01N 2WSCH 1NTKK 3PRJA 3N4XA 1IFMA 1T2KD 1FJPA 1RQUA 1BGYJ 2WPRA 2MJZA 1JY3N 3HUSA 2BEZF 1ZRTE 4CPGA 1BGYG 4K3AA 2KSJA 2FY8A 1NKNA 4YPCA 2PGDA 3H1JJ 1BGYD 2P2UA 2IBZI 2KUBA 2P67A 1H0TA 4DJGA 3CWBJ 1QLED 2FXOA 3CX5E 3TNUA 3HRNA 1M1KQ 2FFDC 4PD4D 2WVRA 4RO0A 3RGUA 1IJDB 1FDMA 3RL0C 3A0BE 3CI9A 1X22A 2UWJE 1EDIA 3AEGC 3M9BA 4H0LC 3KQGA 5DJTB 3L71E 4C46A 1S9KE 2FFDB 4KJMA 3AE7C 2BCCE 4I2LC 2JJLA 1ZP0C 1JY3P 3MZWB 2NRGA 2KXPB 3BATA 1AVYA 1NVOA 2FKWB 2J58A 3IAOA 4IOIH 1ZN5A 1ZRTD 2WT7A 4H0LB 3Q3DA 1OFCX 2QIWA 3CCQP 2WSSH 1RH5B 1FZAA 3IN6A 2M8RA 1N7SC 1HJ0A 1L0LK 1K04A 1EDKA 3CX5D 1VQOP 5AW5B 5AW6B 3AEBC 1MFZA 4I7ZC 2Q7CA 3VOPA 1G1JA 1KORA 3S4RA 3OAKA 3L71J 2QRXA 1CI6B 4JQ0D 3L71G 4WY4A 2AXTE 4RJTA 1QL2A 3M0DA 3GMAA 3KDPB 2BCCJ 3G4SP 1S9KD 4R4LA 2BCCG 3O6QA 1LTTC 3LW5H 4I7ZB 1IZNB 5TISH 3G3ZA 3H1LE 2I1KA 2BCCD 3EFGA 3BVHA 2YMYA 1URQC 1NJIQ 1FZCC 1VQ5P 3PH0A 3CXHI 2W6AA 1LTJA 1HUCA 3H25A 2OQQA 2RMZA 2JWDA 4O9BA 2M5AA 4ZKPA 1IC2A 2E75D 2QA4P 1URQB 3WU2E 4NPEA 3RL0D 1QVGO 1FZCB 3MP7B 3FX0A 1DIPA 1IFDA 4GOEA 1PFIA 2B89A 1RY3A 2A06E 3RK3E 1RF1C 3H1LJ 3VP9A 3H1LG 3V2QA 3V2NA 2N1TC 3H1LD 2GM4A 2MKVA 5BU8B 1GZLA 1EDLA 3Q5RA 3V4QA 1N7SD 1Q2NA 1H8AA 1RF1B 1PZQA 1X79B 1FE6A 4JYBA 3WUUA 5CMZA 4MN4C 2N1TB 5KJ7A 2KS1A 1KTMA 2ZFCA 3G9RA 1RE3A 1JCCA 2B88A 1VF5C 4W7YA 1S4XA 2R5BA 2PAJA 3IR9A 2N9YB 1KN7A 3CPWO 3U1CA 2A06G 1YTZI 2K9JA 4PD4H 1RF0A 2Q3EA 3RK3D 4L75A 2WSCJ 5AW8B 5AVYB 1VQ9P 1VF5B 4AUWA 2YKQA 4H13C 2FYUE 3Q5PA 1SQPE 2BEQD 1SQBK 4U3FE 3BRVB 1NTZE 4KHXA 3CLQA 2J5UA 1N7LA 2QE7H 3D6ZA 3M91A 5CJ0A 3V5BA 2D2CB 3VMYA 2NZ2A 1NO4A 3JCUH 2QJYB 3MUDC 5CBOA 4PV1C 4H13B 3GHGA 3HD7C 4IFMA 3AE9C 1YYCA 1JEKA 1R5LA 1IO4A 2WPQA 1AJYA 1JMMA 2H43A 3CX5H 2YXRB 1JB0J 1S3JA 4PV1B 3HD7B 4OWFA 1KQGB 2C9LY 1NKZB 2FYUJ 2LR2A 1SQXK 1LTSC 2WITA 1SQPJ 5DJUB 4U3FJ 2FYUG 3I55P 1NTZJ 1SQPG 1FZGA 4U3FG 5TISE 1NTZG 4QMAA 3FWNA 1SFCD 3HE4B 4D6TE 3TYYA 2FYUD 1SQPD 2WWWA 3PJSK 1NTZD 4JYCA 1JTHB 5E79H 3F5HA 2W90A 1EC5A 1H88A 1DX7A 1AV1A 2KLUA 1UIIA 5AVZB 3P7KA 4U7JA 1XTGB 2WPSA 5CHXA 4L73A 4KT0J 1KILE 3RK2D 2ZVOB 3GG2A 1N73B 1SQVE 3B8EB 2IPPA 1LTBC 1MV8A 1WMKA 1VL2A 2ZAEB 1L0NE 5AVTB 1QEXA 1Q7YQ 5AW1B 3P8MC 1M90Q 2YKPA 2KK7A 2Q6QA 1OW8A 1LJ2A 1D7MA 5TJHA 4D6TJ 1MFTA 4DT0A 1P84H 2Y9YA 1L0NK 3NFQA 4D6TG 2B87A 3TF5A 1JUNA 2KLVA 3TSIA 2HYNA 4D6TD 3O8ZA 3OJAB 3NTNA 4PD4I 2ZT9D 3F89A 1G1IA 1N8RQ 1OVVA 3V4WA 1SQVJ 2ZXXA 3K5BA 1JOCA 1SQVG 2N9BA 1RQVA 1MKMA 3AEAC 2C0WA 1HBWA 2FXPA 1LT1A 1AVOA 4XA4A 1L0NJ 1SQVD 4EI2A 2IZ0A 3B5NA 1X8YA 1L4AC 5L8RJ 2HG5D 3VYIA 2Z4EA 3E7KA 2WT7B 3WU2H 3CC4P 1BCCE 2YIUC 1VPCA 3II6A 1YITP 1JY2N 5BVZA 1L4AB 3H6PA 5CCGD 1KILA 4WY4C 1YQ3C 2WPVB 3CX5I 4AYCA 1OVUA 5KTBA 4YXDC 5APYA 3CCVP 3CMAP 2YIUB 1BDCA 3JCUE 1M7LA 4WY4B 1GL2A 2NPSA 1EZVE 2FYNB 1DD3A 1KQFB 1LTJC 3S9OA 1KMIZ 3CCLP 2KNCB 2ZXEB 3SWYA 4H44C 5EFWB 3TGUE 3C8VA 3L74E 1BCCJ 2R3CA 4EYYQ 1KV4A 1BCCG 1PP9G 1FZEA 1ZW0A 1LTJB 2WSEH 1JY2P 1HGZA 2E76B 1BCCD 3CCJP 1PP9D 4LGDE 3BASA 3MD0A 4OVNF 2AXCA 1KC8Q 2M5AB 4H44B 1S5LH 3RBXA 1Q86Q 1ZOYC 1PGJA 1MUUA 3SFDC 1YJNP 1PGPA 5E79E 2JP3A 1T3JA 1P84I 1EZVG 1M1JA 1VQMP 3OW2O 1L4AD 2JKVA 2BASA 1FAVA 1ZR2A 1EZVD 3TGUJ 3TGUG 3L74J 2ZJSE 1MZ9A 3T97A 1TU3F 5KJ7C 3L74G 2KZIA 3IFMA 3TGUD 1IK7A 2H7HA 3L74D 1RE4A 1RE3C 2M0BA 2I1JA 1BSNA 3A2AA 1ZV8A 1GK4A 1NTME 3ITKA 1P84E 4BRYA 4JPZB 2KS1B 1VDFA 4XFJA 3CCRP 1FDIA 1LWUA 4HB1A 1NU1E 1WT6A 1DEBA 2L5GB 1K73Q 2CPSA 1GMJA 2H89C 3V6IA 5KKZC 2E74C 2C0XA 2WMMA 2XNXA 1FOSE 4W80A 1SS1A 3GHGC 3HTKA 2AEFA 1OIPA 3IF4A 5KKZB 2SPZA 1NTMJ 2E74B 1NTMG 3GF7A 2JO1A 1NTMD 1NU1J 4H0LD 1P84D 4RKUJ 4ASVA 2A45G 1NGMB 1NU1G 3GHGB 1LGHB 2FYZA 2C9NY 1NU1D 1KB9H 3MIWA 2FFDA 4HH2A 2POHA 1KQSO 1NAYA 4WBAA 3USSA 4WWIA 2WZ7A 3AEFC 2K3RA 3FGAD 1PGQA 1T3UA 1GW4A 1J1DC 2H8PD 1SQQD 4IFDK 5AVRB 5K5GB 1AFOA 1KQLA 4IL6H 3WUVA 2LKMA 4JF7A 1AQTA 4B86A 5AVUB 2W8ZA 3A3YB 3TK1A 4HYTB 3UIAA 4W7ZA 1S5LX 2P58A 2OYIA 1J1DB 2W6BA 3CCMP 2LXBA 4GKGA 1S5LE 2PP6A 2P10A 3KXDA 1N7SA 5AVWB 1FS0E 5APSA 1X9VA 1Q82Q 1HJBA 2D2CC 1FDOA 1URQD 3ZDMA 3U1AA 2QJYC 1FC2C 4UB6E 2W6JH 5AW7B 1YQ4C 1G2CA 1W2EA 4DCKA 1VQ8P 2AEJA 2FYUK 2IZ1A 2HPCA 1SQPK 4EDFA 1U7JA 1NTZK 2WSEJ 4GDOA 1USEA 4TT3H 2J59M 1K05A 1NYHA 1Z56A 3B5NC 2ZYDA 1VQKP 3CD6P 4GT1A 1ZXGA 2Q1KA 2R44A 4C7NB 1HVVA 2RN0A 5CCHC 1T8ZA 2N1TD 2V4HA 3Q1MA 1JMBA 3B5NB 2OYHA 3JC22 1YI2P 1Y47A 2KIKA 4XE5B 1OWAA 1GK6A 1N73C 1PV3A 1M56D 5M1BA 2Q5UA 1HTLC 2IYPA 1R5SA 1KILB 1GL2C 2NPSC 1GTWA 5APVA 3V2PA 3HUSC 2N1TA 2HR3A 1VF5D 2IFMA 3VMZA 2G8YA 1SFCA 2OTKE 3M0AA 2D2CD 1GL2B 2NPSB 2Y9ZA 3HE5A 3HUSB 4AQRD 1L2PA 2Y0CA 1Q81Q 1KD1Q 1SQVK 1KZUB 1KB9E 5KLIC 2V7QH 1FBMA 4H13D 3AEDC 1T2KC 5AVVB 2YNYA 1XTCC 3JSVC 1H0TB 2KOGA 4IL6X 2A45H 3TNUB 1YIJP 1S72P 4RESB 5APQA 1QL1A 4L74A 5KLIB 1FOSF 4PV1D 3BRTB 3HD7D 3GW6A 3LIDA 1M1JC 4IL6E 1EQ7A 1LNQA 3AECC 3VMAA 5APWA 1FZBA 1QGKB 1VQ4P 1NOHA 3H32A 5KLVG 2XV5A 4TLFA 3C1LA 4IFFA 1M1JB 4GIFA 3R4YA 5KLVD 2K9YA 1PPJE 2VRSA 1PIXA 2PFXA 2YXQB 1EZVI 3H1KE 3L35A 4UB8H 3E1RA 1KB9D 2OTJP 3T97B 1PP9E 1HH0A 1LWUC 1JY2O 2IYOA 3M9QA 1S1CX 1QX8A 3M0DC 2K1AA 3HE4A 3VMXA 2FYNC 2JWAA 3L75G 1LP1A 4NPDA 3L72E 1JM0A 1JTHA 3FXDA 2XDJA 2ZYAA 3L75D 3L70E 2IDBA 4BRYB 3PP5A 1LWUB 1W5CE 3WUTA 1NTKE 1FZFA 2H88C 5B5EH 4GOFA 1VQ6P 2KB7P 1KFNA 1JY3O 3P8CD 2E76C 5AW2B 3O6QB 5CCGA 1HF9A 1BE3E 3A7OA 1PPJG 3H1KJ 4A7PA 4ZKUA 4Y28J 3H1KG 1PPJD 2R5DA 1PP9J 5H2FE 4YXWH 3H1KD 2KP8A 4L76A 1NH4A 1Y9BA 3L4FA 3H1JG 1AQ5A 3HTKB 3L72J 3QWOC 3CCEP 2I8DA 3H1JD 3L72G 3CWBG 3L70J 3M9HA 4YTPC 2QJPC 3CC7P 3L70G 1LTGC 3KYQA 3L72D 4Y99C 3CWBD 3C9IA 1NTKJ 4EIJA 2KI7B 1KYOD 3L70D 1NTKG 2E75C 4UB6H 3V2RA 5C39A 1IK9A 1LT9A 4EOTA 2L91A 1NTKD 2OGUA 3NXSA 5KAFE 1BE3J 2A45I 1BE3G 2QJPB 3KZIH 3OA7A 2XZRA 4Y99B 2Q9IA 2IBZE 1BE3D 3LIEA 2E75B 2O01H 2W27A 3RL0B 3CC2P 2HLOA 1L0LE 2WSFH 2OYIC 4WY4D 1LTAC 1OXZA 2YO3A 2FBWC 2IX7C 1L4AA 1OZHA 1SP4A 5BU5A 4Z1MH 1CSBA 2O1JA 1RF0C 1OVRA 3KHUA 2OYIB 3G71P 2E42A 1DEEG 3PHLA 1NTMK 3H1HE 1E79H 5APTA 2HODA 4ZNCA 2E76D 3P32A 3Q2YA 3CL3D 3AE8C 1N7SB 3EQ2A 2Y0DA 2K9JB 1NU1K 2Q3IA 1CW5A 1VQLP 4H44D 5CJ4A 2IBZG 4ASWA 1SQQE 5GTHH 3L71D 3SFEC 2B9BA 1YHQP 2IBZD 1L0LJ 2QM7A 1VQ7P 2KNCA 3L36A 1L0LG 3RK3C 4C7RA 1G2CB 5KAIH 2V7QJ 1U57A 3GF3A 4HJGH 1L0LD 1SQQK 4NPFX 5AW3B 3BCCE 2O1KA 2QVAA 4UB8E 1IFNA 3MHVA 1M57D 1S2EA 4I6MC 2HPCB 3H1IE 3KPEA 3RK3B 2CPBA 3N7NA 2CK3H 2DW3A 2YKOA 3H1HJ 2GUSA 2OYHC 3H1HG 3D70A 3MGNA 2HFED 3H1HD 1OX3A 3ABVC 1N2DC 1SLQA 2QSIA 1YBKA 1HWTC 1PL5A 3AEEC 1SQQJ 3M06A 1T6AA 5AVQB 1SQQG 2PRRA 2WTYA 5B5EE 1EDJA 4DZOA 5KJ7D 5B66E 1N86A 2OYHB 3CXHE 1R8EA 4ZMDA 3SWFA 3FXEA 2QEXP 5AW0B 1Y8AA 2E5TA 1QVFO 2P7JA 2OTLP 2W83C 3BCCJ 2WQYC 3BCCG 1DD4A 1IFJA 5AVSB 1A02J 5AW4B 1K8AQ 4GODA 3MTUE 1OMIA 3H1IJ 1SFCC 1J1EC 3BCCD 2Z5HA 3H1IG 2XU6A 4OH8B 2K88A 3CMEP 1BSHA 3H1ID 3CCSP 1U7MA 1CI6A 3I5CA 4BXLA 3A0HH 2P1JA 1X0TA 4N78E 5CBNA 1JCDA 3RK2C 1SFCB 2E74D 1J1EB 1USDA 2JR8A 3S1KA 5GTIH 2R32A 3HE5B 4WB4A 1SQBE 2RH0A 1VQPP 2A06D 2Z5IA 3CXHD 3KZIE 1SVFA 1KYOH 3B4SA 1VQNP 3D6YA 3RK2B 3WMM0 2B87B 4PJ0H 2KZJA 4WVZA 3GLMA 1RHZB 1J2JB 2M3EA 1Q90D 3E1IA 1URQA 4I1LA 2AEMA 2OARA 1FZCA 1YJWP 1EXIA 2GUVA 2GA1A 4DOJA 2ZT9C 1AA0A 1IFIA 5H2FH 1OW6A 4N78D 3PTZA 3H32B 2R3SA 3R2PA 2YO2A 3L37A 1OW7A 1KILC 1SQXE 2QG4A 2XNDH 1SQBJ 4N3YB 1GU5A 1SQBG 3NMDA 2ZT9B 2FXMA 1K9MQ 1SQBD 1CZQA 3PLNA 5AW9B 3U59A 5GTHE 1KB9I 2O01J 1RF1A 2LXCB 2WSFJ 4OGQC 1E5WA 3A0BH 4K35A 1W2BO 2JEEA 1LP1B 5KAIE 5KAFH 4U3FD 5CCGC 1GU4A 3L73E 3AE5C 2E5YA 4LC1A 1LTIC 4LLHA 5KLVE 1DH3A 1UIXA 4OGQB 2ZYGA 1SQXJ
chains in the Genus database with same CATH topology
1BDDA 2JWDA 2M5AA 1JMBA 2M5AB 1EDJA 3MZWB 1EC5A 1OVRA 4JBZA 2P58A 1Y47A 1NVOA 4NPEA 4IOIH 4ZMDA 2KIKA 3FXEA 2LXBA 1DEEG 2WMMA 4GOEA 4ZNCA 1SS1A 2B89A 2SPZA 1EDKA 3QWOC 2I8DA 4GODA 2RKLA 2ZAEB 4ASWA 3ZDMA 4CPGA 1FC2C 5CBOA 4K3AA 2HR3A 1OVUA 4ASVA 2KI7B 1U7MA 2KZIA 4HKZH 4BXLA 1BDCA 2QRXA 5C39A 1X0TA 1MFTA 1EDLA 2KUBA 4HJGH 1H0TA 2B87A 4NPFX 1Q2NA 2LXCB 2OTKE 2M0BA 5CBNA 2QVAA 4K35A 1LP1A 3S1KA 3MHVA 4NPDA 1LP1B 1JM0A 3FXDA 4MN4C 1U7JA 1S3JA 4WWIA 3RGUA 2KS1B 2K3RA 5EFWB 1OVVA 4HB1A 2LR2A 5DJUB 2UWJE 1ZXGA 2Q1KA 1EDIA 2R44A 4EYYQ 3PH0A 1H0TB 5K5GB 2B88A 4GOFA 2B87B 5DJTB 2KZJA 1ZW0A 1LT1A 4KJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDD A;  2JWD A;  2M5A A;  1JMB A;  2M5A B;  1EDJ A;  3MZW B;  1EC5 A;  1OVR A;  4JBZ A;  2P58 A;  1Y47 A;  1NVO A;  4NPE A;  4IOI H;  4ZMD A;  2KIK A;  3FXE A;  2LXB A;  1DEE G;  2WMM A;  4GOE A;  4ZNC A;  1SS1 A;  2B89 A;  2SPZ A;  1EDK A;  3QWO C;  2I8D A;  4GOD A;  2RKL A;  2ZAE B;  4ASW A;  3ZDM A;  4CPG A;  1FC2 C;  5CBO A;  4K3A A;  2HR3 A;  1OVU A;  4ASV A;  2KI7 B;  1U7M A;  2KZI A;  4HKZ H;  4BXL A;  1BDC A;  2QRX A;  5C39 A;  1X0T A;  1MFT A;  1EDL A;  2KUB A;  4HJG H;  1H0T A;  2B87 A;  4NPF X;  1Q2N A;  2LXC B;  2OTK E;  2M0B A;  5CBN A;  2QVA A;  4K35 A;  1LP1 A;  3S1K A;  3MHV A;  4NPD A;  1LP1 B;  1JM0 A;  3FXD A;  4MN4 C;  1U7J A;  1S3J A;  4WWI A;  3RGU A;  2KS1 B;  2K3R A;  5EFW B;  1OVV A;  4HB1 A;  2LR2 A;  5DJU B;  2UWJ E;  1ZXG A;  2Q1K A;  1EDI A;  2R44 A;  4EYY Q;  3PH0 A;  1H0T B;  5K5G B;  2B88 A;  4GOF A;  2B87 B;  5DJT B;  2KZJ A;  1ZW0 A;  1LT1 A;  4KJM A; 
#chains in the Genus database with same CATH topology
 1SQX G;  3CCU P;  5KLV K;  4JBZ A;  3EWK A;  1SQX D;  2YMK A;  2QJK C;  2QM8 A;  1JO5 A;  3LW5 J;  1GD2 E;  2M3B A;  1H89 A;  3L75 E;  3AE6 C;  2IFN A;  1LT9 C;  3B5N D;  2RKL A;  2XKM A;  2OYO A;  2QJK B;  3L73 J;  3AE1 C;  3Q5S A;  2AXT H;  5AVX B;  1PGO A;  3L73 G;  1YJ9 P;  2KYV A;  1ZME C;  3QH9 A;  3P8C E;  3EFF K;  5KLV J;  1NAF A;  3L73 D;  4HKZ H;  3W68 A;  5CCH D;  1KYO I;  2K37 A;  1A02 F;  1NHL A;  2KSE A;  1YTZ T;  1LT9 B;  3SWK A;  4C7N A;  1HGV A;  1EXJ A;  4M3L A;  1RE4 C;  1JNM A;  3AE3 C;  3MUD A;  1KIL D;  1ZLL A;  2ZVN B;  3A0H E;  3VN0 A;  5APU A;  3HD7 A;  1NWQ A;  3AE2 C;  2O3J A;  3RBZ A;  3RL0 g;  1L0N G;  3SSU A;  3G6E P;  1BGY E;  3B71 A;  2JDI H;  1FU1 A;  1L0N D;  5GTI E;  3H1J E;  3L75 J;  4PD4 E;  1GL2 D;  3A5T A;  4OGQ D;  5CCH A;  2NPS D;  3TDK A;  3CWB E;  1BDD A;  3FWL A;  2E43 A;  1KYO E;  3VTP C;  5APX A;  4BWN A;  1GW3 A;  4N6J A;  4PJ0 E;  1WRG A;  4R4M A;  5B66 H;  3I56 P;  1KFM A;  1FJK A;  3CXH H;  1ZR4 A;  1GDT A;  2ITA A;  3D71 A;  1N73 A;  2Y0E A;  3VP8 A;  2HOD B;  3W67 A;  2G3A A;  3AE4 C;  1IFP A;  1M8O B;  2O01 N;  2WSC H;  1NTK K;  3PRJ A;  3N4X A;  1IFM A;  1T2K D;  1FJP A;  1RQU A;  1BGY J;  2WPR A;  2MJZ A;  1JY3 N;  3HUS A;  2BEZ F;  1ZRT E;  4CPG A;  1BGY G;  4K3A A;  2KSJ A;  2FY8 A;  1NKN A;  4YPC A;  2PGD A;  3H1J J;  1BGY D;  2P2U A;  2IBZ I;  2KUB A;  2P67 A;  1H0T A;  4DJG A;  3CWB J;  1QLE D;  2FXO A;  3CX5 E;  3TNU A;  3HRN A;  1M1K Q;  2FFD C;  4PD4 D;  2WVR A;  4RO0 A;  3RGU A;  1IJD B;  1FDM A;  3RL0 C;  3A0B E;  3CI9 A;  1X22 A;  2UWJ E;  1EDI A;  3AEG C;  3M9B A;  4H0L C;  3KQG A;  5DJT B;  3L71 E;  4C46 A;  1S9K E;  2FFD B;  4KJM A;  3AE7 C;  2BCC E;  4I2L C;  2JJL A;  1ZP0 C;  1JY3 P;  3MZW B;  2NRG A;  2KXP B;  3BAT A;  1AVY A;  1NVO A;  2FKW B;  2J58 A;  3IAO A;  4IOI H;  1ZN5 A;  1ZRT D;  2WT7 A;  4H0L B;  3Q3D A;  1OFC X;  2QIW A;  3CCQ P;  2WSS H;  1RH5 B;  1FZA A;  3IN6 A;  2M8R A;  1N7S C;  1HJ0 A;  1L0L K;  1K04 A;  1EDK A;  3CX5 D;  1VQO P;  5AW5 B;  5AW6 B;  3AEB C;  1MFZ A;  4I7Z C;  2Q7C A;  3VOP A;  1G1J A;  1KOR A;  3S4R A;  3OAK A;  3L71 J;  2QRX A;  1CI6 B;  4JQ0 D;  3L71 G;  4WY4 A;  2AXT E;  4RJT A;  1QL2 A;  3M0D A;  3GMA A;  3KDP B;  2BCC J;  3G4S P;  1S9K D;  4R4L A;  2BCC G;  3O6Q A;  1LTT C;  3LW5 H;  4I7Z B;  1IZN B;  5TIS H;  3G3Z A;  3H1L E;  2I1K A;  2BCC D;  3EFG A;  3BVH A;  2YMY A;  1URQ C;  1NJI Q;  1FZC C;  1VQ5 P;  3PH0 A;  3CXH I;  2W6A A;  1LTJ A;  1HUC A;  3H25 A;  2OQQ A;  2RMZ A;  2JWD A;  4O9B A;  2M5A A;  4ZKP A;  1IC2 A;  2E75 D;  2QA4 P;  1URQ B;  3WU2 E;  4NPE A;  3RL0 D;  1QVG O;  1FZC B;  3MP7 B;  3FX0 A;  1DIP A;  1IFD A;  4GOE A;  1PFI A;  2B89 A;  1RY3 A;  2A06 E;  3RK3 E;  1RF1 C;  3H1L J;  3VP9 A;  3H1L G;  3V2Q A;  3V2N A;  2N1T C;  3H1L D;  2GM4 A;  2MKV A;  5BU8 B;  1GZL A;  1EDL A;  3Q5R A;  3V4Q A;  1N7S D;  1Q2N A;  1H8A A;  1RF1 B;  1PZQ A;  1X79 B;  1FE6 A;  4JYB A;  3WUU A;  5CMZ A;  4MN4 C;  2N1T B;  5KJ7 A;  2KS1 A;  1KTM A;  2ZFC A;  3G9R A;  1RE3 A;  1JCC A;  2B88 A;  1VF5 C;  4W7Y A;  1S4X A;  2R5B A;  2PAJ A;  3IR9 A;  2N9Y B;  1KN7 A;  3CPW O;  3U1C A;  2A06 G;  1YTZ I;  2K9J A;  4PD4 H;  1RF0 A;  2Q3E A;  3RK3 D;  4L75 A;  2WSC J;  5AW8 B;  5AVY B;  1VQ9 P;  1VF5 B;  4AUW A;  2YKQ A;  4H13 C;  2FYU E;  3Q5P A;  1SQP E;  2BEQ D;  1SQB K;  4U3F E;  3BRV B;  1NTZ E;  4KHX A;  3CLQ A;  2J5U A;  1N7L A;  2QE7 H;  3D6Z A;  3M91 A;  5CJ0 A;  3V5B A;  2D2C B;  3VMY A;  2NZ2 A;  1NO4 A;  3JCU H;  2QJY B;  3MUD C;  5CBO A;  4PV1 C;  4H13 B;  3GHG A;  3HD7 C;  4IFM A;  3AE9 C;  1YYC A;  1JEK A;  1R5L A;  1IO4 A;  2WPQ A;  1AJY A;  1JMM A;  2H43 A;  3CX5 H;  2YXR B;  1JB0 J;  1S3J A;  4PV1 B;  3HD7 B;  4OWF A;  1KQG B;  2C9L Y;  1NKZ B;  2FYU J;  2LR2 A;  1SQX K;  1LTS C;  2WIT A;  1SQP J;  5DJU B;  4U3F J;  2FYU G;  3I55 P;  1NTZ J;  1SQP G;  1FZG A;  4U3F G;  5TIS E;  1NTZ G;  4QMA A;  3FWN A;  1SFC D;  3HE4 B;  4D6T E;  3TYY A;  2FYU D;  1SQP D;  2WWW A;  3PJS K;  1NTZ D;  4JYC A;  1JTH B;  5E79 H;  3F5H A;  2W90 A;  1EC5 A;  1H88 A;  1DX7 A;  1AV1 A;  2KLU A;  1UII A;  5AVZ B;  3P7K A;  4U7J A;  1XTG B;  2WPS A;  5CHX A;  4L73 A;  4KT0 J;  1KIL E;  3RK2 D;  2ZVO B;  3GG2 A;  1N73 B;  1SQV E;  3B8E B;  2IPP A;  1LTB C;  1MV8 A;  1WMK A;  1VL2 A;  2ZAE B;  1L0N E;  5AVT B;  1QEX A;  1Q7Y Q;  5AW1 B;  3P8M C;  1M90 Q;  2YKP A;  2KK7 A;  2Q6Q A;  1OW8 A;  1LJ2 A;  1D7M A;  5TJH A;  4D6T J;  1MFT A;  4DT0 A;  1P84 H;  2Y9Y A;  1L0N K;  3NFQ A;  4D6T G;  2B87 A;  3TF5 A;  1JUN A;  2KLV A;  3TSI A;  2HYN A;  4D6T D;  3O8Z A;  3OJA B;  3NTN A;  4PD4 I;  2ZT9 D;  3F89 A;  1G1I A;  1N8R Q;  1OVV A;  3V4W A;  1SQV J;  2ZXX A;  3K5B A;  1JOC A;  1SQV G;  2N9B A;  1RQV A;  1MKM A;  3AEA C;  2C0W A;  1HBW A;  2FXP A;  1LT1 A;  1AVO A;  4XA4 A;  1L0N J;  1SQV D;  4EI2 A;  2IZ0 A;  3B5N A;  1X8Y A;  1L4A C;  5L8R J;  2HG5 D;  3VYI A;  2Z4E A;  3E7K A;  2WT7 B;  3WU2 H;  3CC4 P;  1BCC E;  2YIU C;  1VPC A;  3II6 A;  1YIT P;  1JY2 N;  5BVZ A;  1L4A B;  3H6P A;  5CCG D;  1KIL A;  4WY4 C;  1YQ3 C;  2WPV B;  3CX5 I;  4AYC A;  1OVU A;  5KTB A;  4YXD C;  5APY A;  3CCV P;  3CMA P;  2YIU B;  1BDC A;  3JCU E;  1M7L A;  4WY4 B;  1GL2 A;  2NPS A;  1EZV E;  2FYN B;  1DD3 A;  1KQF B;  1LTJ C;  3S9O A;  1KMI Z;  3CCL P;  2KNC B;  2ZXE B;  3SWY A;  4H44 C;  5EFW B;  3TGU E;  3C8V A;  3L74 E;  1BCC J;  2R3C A;  4EYY Q;  1KV4 A;  1BCC G;  1PP9 G;  1FZE A;  1ZW0 A;  1LTJ B;  2WSE H;  1JY2 P;  1HGZ A;  2E76 B;  1BCC D;  3CCJ P;  1PP9 D;  4LGD E;  3BAS A;  3MD0 A;  4OVN F;  2AXC A;  1KC8 Q;  2M5A B;  4H44 B;  1S5L H;  3RBX A;  1Q86 Q;  1ZOY C;  1PGJ A;  1MUU A;  3SFD C;  1YJN P;  1PGP A;  5E79 E;  2JP3 A;  1T3J A;  1P84 I;  1EZV G;  1M1J A;  1VQM P;  3OW2 O;  1L4A D;  2JKV A;  2BAS A;  1FAV A;  1ZR2 A;  1EZV D;  3TGU J;  3TGU G;  3L74 J;  2ZJS E;  1MZ9 A;  3T97 A;  1TU3 F;  5KJ7 C;  3L74 G;  2KZI A;  3IFM A;  3TGU D;  1IK7 A;  2H7H A;  3L74 D;  1RE4 A;  1RE3 C;  2M0B A;  2I1J A;  1BSN A;  3A2A A;  1ZV8 A;  1GK4 A;  1NTM E;  3ITK A;  1P84 E;  4BRY A;  4JPZ B;  2KS1 B;  1VDF A;  4XFJ A;  3CCR P;  1FDI A;  1LWU A;  4HB1 A;  1NU1 E;  1WT6 A;  1DEB A;  2L5G B;  1K73 Q;  2CPS A;  1GMJ A;  2H89 C;  3V6I A;  5KKZ C;  2E74 C;  2C0X A;  2WMM A;  2XNX A;  1FOS E;  4W80 A;  1SS1 A;  3GHG C;  3HTK A;  2AEF A;  1OIP A;  3IF4 A;  5KKZ B;  2SPZ A;  1NTM J;  2E74 B;  1NTM G;  3GF7 A;  2JO1 A;  1NTM D;  1NU1 J;  4H0L D;  1P84 D;  4RKU J;  4ASV A;  2A45 G;  1NGM B;  1NU1 G;  3GHG B;  1LGH B;  2FYZ A;  2C9N Y;  1NU1 D;  1KB9 H;  3MIW A;  2FFD A;  4HH2 A;  2POH A;  1KQS O;  1NAY A;  4WBA A;  3USS A;  4WWI A;  2WZ7 A;  3AEF C;  2K3R A;  3FGA D;  1PGQ A;  1T3U A;  1GW4 A;  1J1D C;  2H8P D;  1SQQ D;  4IFD K;  5AVR B;  5K5G B;  1AFO A;  1KQL A;  4IL6 H;  3WUV A;  2LKM A;  4JF7 A;  1AQT A;  4B86 A;  5AVU B;  2W8Z A;  3A3Y B;  3TK1 A;  4HYT B;  3UIA A;  4W7Z A;  1S5L X;  2P58 A;  2OYI A;  1J1D B;  2W6B A;  3CCM P;  2LXB A;  4GKG A;  1S5L E;  2PP6 A;  2P10 A;  3KXD A;  1N7S A;  5AVW B;  1FS0 E;  5APS A;  1X9V A;  1Q82 Q;  1HJB A;  2D2C C;  1FDO A;  1URQ D;  3ZDM A;  3U1A A;  2QJY C;  1FC2 C;  4UB6 E;  2W6J H;  5AW7 B;  1YQ4 C;  1G2C A;  1W2E A;  4DCK A;  1VQ8 P;  2AEJ A;  2FYU K;  2IZ1 A;  2HPC A;  1SQP K;  4EDF A;  1U7J A;  1NTZ K;  2WSE J;  4GDO A;  1USE A;  4TT3 H;  2J59 M;  1K05 A;  1NYH A;  1Z56 A;  3B5N C;  2ZYD A;  1VQK P;  3CD6 P;  4GT1 A;  1ZXG A;  2Q1K A;  2R44 A;  4C7N B;  1HVV A;  2RN0 A;  5CCH C;  1T8Z A;  2N1T D;  2V4H A;  3Q1M A;  1JMB A;  3B5N B;  2OYH A;  3JC2 2;  1YI2 P;  1Y47 A;  2KIK A;  4XE5 B;  1OWA A;  1GK6 A;  1N73 C;  1PV3 A;  1M56 D;  5M1B A;  2Q5U A;  1HTL C;  2IYP A;  1R5S A;  1KIL B;  1GL2 C;  2NPS C;  1GTW A;  5APV A;  3V2P A;  3HUS C;  2N1T A;  2HR3 A;  1VF5 D;  2IFM A;  3VMZ A;  2G8Y A;  1SFC A;  2OTK E;  3M0A A;  2D2C D;  1GL2 B;  2NPS B;  2Y9Z A;  3HE5 A;  3HUS B;  4AQR D;  1L2P A;  2Y0C A;  1Q81 Q;  1KD1 Q;  1SQV K;  1KZU B;  1KB9 E;  5KLI C;  2V7Q H;  1FBM A;  4H13 D;  3AED C;  1T2K C;  5AVV B;  2YNY A;  1XTC C;  3JSV C;  1H0T B;  2KOG A;  4IL6 X;  2A45 H;  3TNU B;  1YIJ P;  1S72 P;  4RES B;  5APQ A;  1QL1 A;  4L74 A;  5KLI B;  1FOS F;  4PV1 D;  3BRT B;  3HD7 D;  3GW6 A;  3LID A;  1M1J C;  4IL6 E;  1EQ7 A;  1LNQ A;  3AEC C;  3VMA A;  5APW A;  1FZB A;  1QGK B;  1VQ4 P;  1NOH A;  3H32 A;  5KLV G;  2XV5 A;  4TLF A;  3C1L A;  4IFF A;  1M1J B;  4GIF A;  3R4Y A;  5KLV D;  2K9Y A;  1PPJ E;  2VRS A;  1PIX A;  2PFX A;  2YXQ B;  1EZV I;  3H1K E;  3L35 A;  4UB8 H;  3E1R A;  1KB9 D;  2OTJ P;  3T97 B;  1PP9 E;  1HH0 A;  1LWU C;  1JY2 O;  2IYO A;  3M9Q A;  1S1C X;  1QX8 A;  3M0D C;  2K1A A;  3HE4 A;  3VMX A;  2FYN C;  2JWA A;  3L75 G;  1LP1 A;  4NPD A;  3L72 E;  1JM0 A;  1JTH A;  3FXD A;  2XDJ A;  2ZYA A;  3L75 D;  3L70 E;  2IDB A;  4BRY B;  3PP5 A;  1LWU B;  1W5C E;  3WUT A;  1NTK E;  1FZF A;  2H88 C;  5B5E H;  4GOF A;  1VQ6 P;  2KB7 P;  1KFN A;  1JY3 O;  3P8C D;  2E76 C;  5AW2 B;  3O6Q B;  5CCG A;  1HF9 A;  1BE3 E;  3A7O A;  1PPJ G;  3H1K J;  4A7P A;  4ZKU A;  4Y28 J;  3H1K G;  1PPJ D;  2R5D A;  1PP9 J;  5H2F E;  4YXW H;  3H1K D;  2KP8 A;  4L76 A;  1NH4 A;  1Y9B A;  3L4F A;  3H1J G;  1AQ5 A;  3HTK B;  3L72 J;  3QWO C;  3CCE P;  2I8D A;  3H1J D;  3L72 G;  3CWB G;  3L70 J;  3M9H A;  4YTP C;  2QJP C;  3CC7 P;  3L70 G;  1LTG C;  3KYQ A;  3L72 D;  4Y99 C;  3CWB D;  3C9I A;  1NTK J;  4EIJ A;  2KI7 B;  1KYO D;  3L70 D;  1NTK G;  2E75 C;  4UB6 H;  3V2R A;  5C39 A;  1IK9 A;  1LT9 A;  4EOT A;  2L91 A;  1NTK D;  2OGU A;  3NXS A;  5KAF E;  1BE3 J;  2A45 I;  1BE3 G;  2QJP B;  3KZI H;  3OA7 A;  2XZR A;  4Y99 B;  2Q9I A;  2IBZ E;  1BE3 D;  3LIE A;  2E75 B;  2O01 H;  2W27 A;  3RL0 B;  3CC2 P;  2HLO A;  1L0L E;  2WSF H;  2OYI C;  4WY4 D;  1LTA C;  1OXZ A;  2YO3 A;  2FBW C;  2IX7 C;  1L4A A;  1OZH A;  1SP4 A;  5BU5 A;  4Z1M H;  1CSB A;  2O1J A;  1RF0 C;  1OVR A;  3KHU A;  2OYI B;  3G71 P;  2E42 A;  1DEE G;  3PHL A;  1NTM K;  3H1H E;  1E79 H;  5APT A;  2HOD A;  4ZNC A;  2E76 D;  3P32 A;  3Q2Y A;  3CL3 D;  3AE8 C;  1N7S B;  3EQ2 A;  2Y0D A;  2K9J B;  1NU1 K;  2Q3I A;  1CW5 A;  1VQL P;  4H44 D;  5CJ4 A;  2IBZ G;  4ASW A;  1SQQ E;  5GTH H;  3L71 D;  3SFE C;  2B9B A;  1YHQ P;  2IBZ D;  1L0L J;  2QM7 A;  1VQ7 P;  2KNC A;  3L36 A;  1L0L G;  3RK3 C;  4C7R A;  1G2C B;  5KAI H;  2V7Q J;  1U57 A;  3GF3 A;  4HJG H;  1L0L D;  1SQQ K;  4NPF X;  5AW3 B;  3BCC E;  2O1K A;  2QVA A;  4UB8 E;  1IFN A;  3MHV A;  1M57 D;  1S2E A;  4I6M C;  2HPC B;  3H1I E;  3KPE A;  3RK3 B;  2CPB A;  3N7N A;  2CK3 H;  2DW3 A;  2YKO A;  3H1H J;  2GUS A;  2OYH C;  3H1H G;  3D70 A;  3MGN A;  2HFE D;  3H1H D;  1OX3 A;  3ABV C;  1N2D C;  1SLQ A;  2QSI A;  1YBK A;  1HWT C;  1PL5 A;  3AEE C;  1SQQ J;  3M06 A;  1T6A A;  5AVQ B;  1SQQ G;  2PRR A;  2WTY A;  5B5E E;  1EDJ A;  4DZO A;  5KJ7 D;  5B66 E;  1N86 A;  2OYH B;  3CXH E;  1R8E A;  4ZMD A;  3SWF A;  3FXE A;  2QEX P;  5AW0 B;  1Y8A A;  2E5T A;  1QVF O;  2P7J A;  2OTL P;  2W83 C;  3BCC J;  2WQY C;  3BCC G;  1DD4 A;  1IFJ A;  5AVS B;  1A02 J;  5AW4 B;  1K8A Q;  4GOD A;  3MTU E;  1OMI A;  3H1I J;  1SFC C;  1J1E C;  3BCC D;  2Z5H A;  3H1I G;  2XU6 A;  4OH8 B;  2K88 A;  3CME P;  1BSH A;  3H1I D;  3CCS P;  1U7M A;  1CI6 A;  3I5C A;  4BXL A;  3A0H H;  2P1J A;  1X0T A;  4N78 E;  5CBN A;  1JCD A;  3RK2 C;  1SFC B;  2E74 D;  1J1E B;  1USD A;  2JR8 A;  3S1K A;  5GTI H;  2R32 A;  3HE5 B;  4WB4 A;  1SQB E;  2RH0 A;  1VQP P;  2A06 D;  2Z5I A;  3CXH D;  3KZI E;  1SVF A;  1KYO H;  3B4S A;  1VQN P;  3D6Y A;  3RK2 B;  3WMM 0;  2B87 B;  4PJ0 H;  2KZJ A;  4WVZ A;  3GLM A;  1RHZ B;  1J2J B;  2M3E A;  1Q90 D;  3E1I A;  1URQ A;  4I1L A;  2AEM A;  2OAR A;  1FZC A;  1YJW P;  1EXI A;  2GUV A;  2GA1 A;  4DOJ A;  2ZT9 C;  1AA0 A;  1IFI A;  5H2F H;  1OW6 A;  4N78 D;  3PTZ A;  3H32 B;  2R3S A;  3R2P A;  2YO2 A;  3L37 A;  1OW7 A;  1KIL C;  1SQX E;  2QG4 A;  2XND H;  1SQB J;  4N3Y B;  1GU5 A;  1SQB G;  3NMD A;  2ZT9 B;  2FXM A;  1K9M Q;  1SQB D;  1CZQ A;  3PLN A;  5AW9 B;  3U59 A;  5GTH E;  1KB9 I;  2O01 J;  1RF1 A;  2LXC B;  2WSF J;  4OGQ C;  1E5W A;  3A0B H;  4K35 A;  1W2B O;  2JEE A;  1LP1 B;  5KAI E;  5KAF H;  4U3F D;  5CCG C;  1GU4 A;  3L73 E;  3AE5 C;  2E5Y A;  4LC1 A;  1LTI C;  4LLH A;  5KLV E;  1DH3 A;  1UIX A;  4OGQ B;  2ZYG A;  1SQX J; 
#chains in the Genus database with same CATH homology
 1BDD A;  2JWD A;  2M5A A;  1JMB A;  2M5A B;  1EDJ A;  3MZW B;  1EC5 A;  1OVR A;  4JBZ A;  2P58 A;  1Y47 A;  1NVO A;  4NPE A;  4IOI H;  4ZMD A;  2KIK A;  3FXE A;  2LXB A;  1DEE G;  2WMM A;  4GOE A;  4ZNC A;  1SS1 A;  2B89 A;  2SPZ A;  1EDK A;  3QWO C;  2I8D A;  4GOD A;  2RKL A;  2ZAE B;  4ASW A;  3ZDM A;  4CPG A;  1FC2 C;  5CBO A;  4K3A A;  2HR3 A;  1OVU A;  4ASV A;  2KI7 B;  1U7M A;  2KZI A;  4HKZ H;  4BXL A;  1BDC A;  2QRX A;  5C39 A;  1X0T A;  1MFT A;  1EDL A;  2KUB A;  4HJG H;  1H0T A;  2B87 A;  4NPF X;  1Q2N A;  2LXC B;  2OTK E;  2M0B A;  5CBN A;  2QVA A;  4K35 A;  1LP1 A;  3S1K A;  3MHV A;  4NPD A;  1LP1 B;  1JM0 A;  3FXD A;  4MN4 C;  1U7J A;  1S3J A;  4WWI A;  3RGU A;  2KS1 B;  2K3R A;  5EFW B;  1OVV A;  4HB1 A;  2LR2 A;  5DJU B;  2UWJ E;  1ZXG A;  2Q1K A;  1EDI A;  2R44 A;  4EYY Q;  3PH0 A;  1H0T B;  5K5G B;  2B88 A;  4GOF A;  2B87 B;  5DJT B;  2KZJ A;  1ZW0 A;  1LT1 A;  4KJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...