2P58A

Structure of the yersinia pestis type iii secretion system needle protein yscf in complex with its chaperones ysce/yscg
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
54
structure length
54
Chain Sequence
b'NVETVRSITMQLEMALTKLKKDMMRGGDAKQYQVWQRESKALESAIAIIHYVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative type III secretion protein YscE
publication title Structural characterization of the Yersinia pestis type III secretion system needle protein YscF in complex with its heterodimeric chaperone YscE/YscG.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transport protein/chaperone
total genus 17
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2007-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2p58A00
5EFWB 1X0TA 4MN4C 1BDDA 1LP1B 2JWDA 4GODA 2WMMA 5K5GB 5DJTB 2B87A 4HB1A 1ZXGA 3FXDA 1BDCA 2KUBA 2KZIA 1EDKA 4NPFX 2B87B 3ZDMA 4ZMDA 2ZAEB 2Q1KA 4NPEA 1JM0A 1U7JA 1DEEG 4GOFA 4WWIA 2KS1B 4ASWA 1LT1A 4GOEA 3MHVA 1H0TA 3QWOC 4NPDA 4ZNCA 1JMBA 5CBOA 2LXCB 2SPZA 2P58A 1OVRA 2KZJA 2HR3A 2B89A 4JBZA 2R44A 2M0BA 3RGUA 5CBNA 2M5AA 5DJUB 3S1KA 5C39A 2KI7B 3FXEA 2RKLA 1EC5A 2B88A 2QRXA 1NVOA 1OVUA 2LR2A 4IOIH 3PH0A 4EYYQ 2QVAA 1LP1A 1S3JA 2M5AB 2LXBA 2K3RA 1H0TB 1MFTA 1EDLA 1SS1A 1FC2C 4K35A 1U7MA 1ZW0A 4ASVA 4BXLA 3MZWB 2KIKA 4HKZH 1EDJA 4KJMA 4CPGA 2UWJE 4K3AA 1Y47A 2OTKE 4HJGH 1OVVA 1EDIA 2I8DA 1Q2NA
chains in the Genus database with same CATH superfamily
3KQGA 3OA7A 1VQOP 1PZQA 3IN6A 1NU1J 1BE3J 2V7QH 4H13B 3SFDC 2YIUB 1M1KQ 1CZQA 1RF1A 1MZ9A 4GODA 1GK6A 3A0HH 3UIAA 3L73E 2OARA 1HF9A 4OGQD 5H2FE 3VOPA 2NRGA 4WY4D 4H13C 4PD4I 2YIUC 5KJ7C 3WU2E 3B71A 3CMEP 2A06D 2GUSA 4N78D 1Q86Q 1QVGO 3P32A 1OIPA 4GOEA 3CCVP 5CCGC 2N1TA 3AE3C 1JY2O 3H1KD 3H1LJ 1LTTC 3Q5PA 1G2CA 3L73D 5AVXB 1NYHA 1G1JA 2IZ0A 3IAOA 5KLIB 1GW4A 1R8EA 1KORA 3M0DA 2WT7A 5KLVG 1SP4A 1EC5A 3L70E 5KLIC 1IFDA 2H7HA 4N3YB 4BXLA 2FFDB 1YTZT 2KIKA 1JY2P 1YIJP 1VQKP 2UWJE 2A45H 3LW5H 1XTCC 1FBMA 4JF7A 3JCUE 4HH2A 1M90Q 2KS1A 4LGDE 3L36A 2ZT9B 2LKMA 2PGDA 3L70D 2P10A 5KLVE 3AECC 2M8RA 2IFMA 5BVZA 2W6AA 1ZXGA 4WB4A 1Y9BA 3VTPC 2JDIH 1SQXE 3H1KJ 4H44D 2JJLA 1NJIQ 4GDOA 1NTZG 1KC8Q 4ASWA 4WVZA 4L75A 1JTHA 5KLVD 2HR3A 1K8AQ 4I7ZC 1K05A 1SQXD 3FWLA 1FZFA 3AE1C 3BRVB 2RKLA 1NVOA 1OW8A 1WMKA 2V7QJ 2Y0EA 3M9BA 3RL0D 1EQ7A 3B5NB 1NTZE 1H88A 1RY3A 2FXPA 1PGOA 4R4MA 4HKZH 2WSFH 1EDJA 1L4AA 2ZYAA 1VQMP 1L0LK 3P8CD 1FDOA 3OW2O 2W8ZA 3O8ZA 3B5NC 1FZCA 1VF5D 1URQA 1BCCE 1PGQA 3L74E 1BDDA 4IL6H 1HUCA 1QL1A 3C9IA 2HFED 1IZNB 2WMMA 3D6YA 3O6QB 1NTZD 4XE5B 4HB1A 1KQFB 1N7SB 2KUBA 4C7RA 3TGUG 2PAJA 1X9VA 2XNDH 3I5CA 1DEEG 3I56P 1GL2B 2Z5IA 4XFJA 1FE6A 4DOJA 3T97B 3A0BH 1NH4A 3SFEC 2CPBA 5KAIH 1L0LG 1FU1A 2YKPA 3EFFK 4IL6E 5TISH 5AW7B 4OH8B 3BATA 4W7ZA 2KSEA 2LR2A 2KB7P 4IOIH 5KJ7A 1GDTA 3B8EB 3M91A 3IFMA 2QG4A 1YQ3C 2ZFCA 3V6IA 4KT0J 3KDPB 5CCGA 2IYOA 2YO2A 2ZYGA 1M8OB 2H43A 5KAIE 3TGUD 3RL0g 5B66H 2JO1A 1PGPA 3L75E 5TISE 2ZJSE 3MTUE 4ZKUA 2QJPB 2QE7H 1HJBA 5KKZB 1NTME 1JCCA 1L0LD 2L5GB 1YBKA 2A45I 3BCCG 3SWYA 1A02J 3CD6P 4NPDA 2O3JA 3V2PA 2MKVA 2KOGA 2FFDA 5APSA 2Y9ZA 2HODB 1ZMEC 5KKZC 2MJZA 1IK7A 1JY2N 1QX8A 1KV4A 1M56D 1TU3F 1R5LA 2CK3H 5AVZB 3RK2D 2YXQB 2AEFA 2E75D 1GU4A 1NU1G 3Q2YA 2LXBA 3WUTA 1FC2C 3KPEA 1BGYJ 2FY8A 1QLED 3MZWB 3TGUJ 1SQQK 4ZKPA 5AVRB 3H1IE 3VMXA 4L74A 2PP6A 3VYIA 2D2CD 1J1DB 5AVUB 1YITP 3D71A 3G4SP 2YMKA 2JWAA 3AE8C 2Q5UA 3WUVA 3EQ2A 3H1LG 3D6ZA 1NU1E 1BE3E 2Z4EA 1L0LJ 1J1DC 2P1JA 3U59A 5CJ0A 1ZOYC 1NAFA 2RH0A 2KZIA 1EZVG 1NTKK 2OYHB 4GIFA 4R4LA 4NPFX 1JO5A 2Q1KA 1KN7A 1AVYA 2J58A 1JM0A 1X8YA 2WQYC 1L0NK 1LGHB 3S4RA 3B5NA 2OYHC 3HTKB 4EOTA 3SWKA 1J1EB 1SQQG 3H1JG 1NU1D 1BE3D 3H1LE 1W2EA 2FYNB 3GHGB 1NOHA 4H0LB 1J1EC 2Z5HA 3TNUB 4YPCA 4EYYQ 1M1JB 1KTMA 1MFTA 1EDLA 1GU5A 2FYNC 3GHGC 1U7MA 1JOCA 1SFCB 4H0LC 1USDA 2N1TD 2BCCG 3JC22 5APUA 3CCRP 3BVHA 2WSEH 3E1RA 5BU5A 1NTKG 1K73Q 1YJWP 4JYCA 3H1LD 3IF4A 1OMIA 2NPSB 3BCCJ 3CCJP 1SFCC 3CPWO 1L0NG 1EZVD 3LIDA 1JEKA 3T97A 3BRTB 3VP9A 1AA0A 4QMAA 1KQGB 2NPSC 3M0AA 2DW3A 2FYUK 3FXDA 5APQA 2A06E 3RK3B 4L76A 3CL3D 1KB9I 4C7NB 1SQQD 3H1JD 3H1KE 1LT1A 1NGMB 1OZHA 3RK3C 1LTAC 3CXHH 1SVFA 2J59M 3W67A 3SSUA 2P67A 1YYCA 1S9KD 3A7OA 1X22A 1J2JB 3FWNA 2K37A 4KHXA 1K9MQ 1FS0E 3K5BA 2BCCD 1HJ0A 1VQ9P 3AEFC 2E76D 1NTKD 1DD4A 1JMMA 2M5AB 2M3EA 3L71G 1H0TB 1VDFA 4XA4A 2FYUG 4JQ0D 2WPQA 2C9NY 3A0HE 3A2AA 4KJMA 1GZLA 1SQPK 2OYOA 1QL2A 2OTKE 1L2PA 3CXHE 1OVVA 5AVQB 1AQ5A 2R5BA 1N2DC 3AEEC 3Q3DA 2I1JA 2IPPA 1QGKB 2OYIB 5CCHC 3PRJA 1SQQJ 4PV1D 3H1JJ 3A5TA 4D6TG 2HODA 2QEXP 2B87A 1N86A 2OYIC 1P84H 2FFDC 1GTWA 3BASA 5E79H 1L4AD 3CXHD 3CX5H 1GW3A 3GMAA 3N4XA 1KILB 1URQD 2BCCJ 2E43A 2Q7CA 3U1CA 1HBWA 3R2PA 1NTKJ 2WSEJ 1JB0J 2ZT9C 1OVRA 1SQPG 1KILC 3L71D 1KQSO 2E5YA 1LT9B 2W6JH 1L0NJ 4PJ0H 1KYOI 2C0WA 2GUVA 2QRXA 1JUNA 1P84E 2P7JA 1LT9C 3TSIA 3P8CE 4K35A 2IBZG 3AE6C 4N6JA 1T2KD 2K88A 2OYHA 4U3FG 5APXA 4D6TD 1PP9J 1FJKA 1SQPE 2I8DA 2OTLP 3H25A 4IFMA 2ITAA 1X0TA 3HTKA 4PJ0E 4H13D 2FBWC 5AW8B 1P84D 5KJ7D 2XV5A 1XTGB 1YHQP 1LTJB 3CX5D 1YJ9P 1FZAA 3B4SA 2XKMA 3GHGA 3OJAB 5CCGD 3TNUA 2HYNA 3L71J 2BEQD 1SQPD 4YTPC 1LTJC 2YO3A 3HE5B 1NAYA 5KTBA 3R4YA 1M1JA 4OWFA 1W5CE 2H88C 2FYUJ 2OQQA 3ABVC 1VQLP 1SFCA 1BGYG 2Q6QA 1DX7A 1FDMA 2N9YB 3AEGC 4I6MC 2IBZD 2NPSA 1N7SC 1VPCA 5GTIH 5CMZA 2Q9IA 3P8MC 5CCHD 5GTHH 3PH0A 4U3FD 4D6TJ 1FOSF 1FZBA 2K3RA 1SS1A 1OW7A 3CCEP 2AEJA 1GL2C 2Y9YA 3HD7B 3D70A 4CPGA 1BGYE 3TGUE 2E74B 4C7NA 5AVVB 2IZ1A 1NWQA 4HYTB 3HD7C 3G9RA 3G71P 2FXOA 4YXWH 3GG2A 2IDBA 2E74C 4OVNF 3NTNA 1SQPJ 2PFXA 5AW5B 3A0BE 3QH9A 4C46A 2GM4A 5GTHE 2Y0DA 1NKZB 1L0LE 3MD0A 4TT3H 2ZAEB 1BGYD 1BSHA 1LNQA 4GOFA 2WSCH 3CLQA 5TJHA 2O01H 1H0TA 5B5EH 5APTA 1FZGA 2W6BA 5APWA 4PD4H 3M9HA 3HRNA 4U3FJ 1S1CX 1S2EA 1OX3A 5CCHA 1SQBK 2QJPC 1S72P 3VP8A 2OYIA 2QVAA 1DEBA 3GW6A 2K1AA 3AE7C 2V4HA 3B5ND 5B66E 4AYCA 1GK4A 3M9QA 1WT6A 4HJGH 1VQ8P 2L91A 1RE4C 3AEBC 3NXSA 1NO4A 1UIXA 1KILA 2AEMA 1MKMA 3BCCE 1LP1B 2H8PD 4OGQB 2WITA 4WY4B 5K5GB 1EDKA 1SLQA 3EFGA 1LT9A 1SQBG 4UB6H 1N7SD 1M7LA 4OGQC 4WY4C 1U7JA 4WBAA 4U7JA 4PD4D 1GD2E 1Q7YQ 3C8VA 2W90A 3VMZA 2J5UA 1GL2D 3BCCD 5CBOA 4W7YA 1ZLLA 2BASA 2OTJP 1RHZB 4JPZB 4Z1MH 1IFPA 2POHA 3F5HA 2Q3EA 2ZXXA 5DJUB 2KI7B 3FXEA 3IR9A 1OVUA 3CCLP 1N8RQ 4UB6E 2B9BA 2HLOA 1QEXA 2KLVA 1LTJA 3CWBG 3TK1A 5KAFH 3H1HG 1EZVE 2QSIA 1RE3C 3NFQA 2WZ7A 3H6PA 3AEDC 3A3YB 2HG5D 1QVFO 2WSCJ 5EFWB 3HE5A 1SQBD 3O6QA 2O01J 1N7SA 5AVTB 2ZYDA 2RMZA 1VQ6P 4H44B 1PPJG 3KHUA 5AW9B 1FZEA 1SQQE 3H1JE 1M1JC 3V2RA 3VMYA 1GL2A 1T6AA 3CWBE 5BU8B 4H44C 4WWIA 5KAFE 1EXIA 1OWAA 1RQUA 3G6EP 5H2FH 1S9KE 1N7LA 1LWUB 1WRGA 2H89C 3HD7A 3WU2H 1HH0A 3JSVC 2BCCE 3PLNA 1DIPA 2SPZA 4A7PA 3MIWA 4M3LA 3RBZA 1KMIZ 3C1LA 4L73A 1VL2A 1VQNP 2M3BA 1NTKE 4EI2A 3H32B 1K04A 1PP9G 1LWUC 4RJTA 1OXZA 2WPVB 3CWBD 5C39A 3RL0B 5AVSB 1L0NE 3MUDC 5M1BA 3AEAC 1MUUA 3PHLA 4AUWA 1LTBC 1S3JA 2JP3A 5KLVK 1AV1A 2W27A 3V2NA 4DCKA 1SQBJ 2Q3IA 3RL0C 2K9JB 1SQXK 1VF5B 1ZV8A 1IFIA 2QA4P 3N7NA 1PPJD 4BRYB 3L70G 5AW3B 2NZ2A 4MN4C 1VF5C 1PP9E 1L0ND 2FKWB 1T8ZA 1Q81Q 1FJPA 3HUSB 3CC2P 3KYQA 1EXJA 1BDCA 3JCUH 4UB8H 3USSA 2KSJA 3W68A 1D7MA 1NKNA 4AQRD 3HUSC 4JYBA 1JNMA 3AE4C 1W2BO 3PJSK 1KFNA 1RE4A 1GMJA 1NTZK 2CPSA 3CC7P 1JMBA 3L71E 1PP9D 3CWBJ 2XNXA 1CW5A 3H1HJ 3FGAD 3V5BA 2FYUE 2QJYB 1HWTC 1SQXG 1JY3N 1IK9A 1DD3A 3KXDA 5CBNA 1H89A 1ZR4A 1ZP0C 2A45G 1FDIA 4H0LD 2QJYC 4IFFA 4UB8E 1LP1A 1RH5B 2KXPB 4WY4A 2R5DA 3NMDA 4D6TE 1AVOA 1G1IA 4K3AA 1SFCD 1YJNP 1EZVI 2YMYA 1Y47A 2FYUD 3RK3E 1U57A 1HTLC 4LC1A 2WPSA 3L73J 2NPSD 3L4FA 3L72G 1E5WA 5E79E 1A02F 3CX5E 1N73B 1S5LX 2R3SA 4I7ZB 3V4QA 3S9OA 5DJTB 4IFDK 1YTZI 3Q5SA 1N73C 2O1JA 1BCCG 2WTYA 2RN0A 3RK3D 3L74G 3GF3A 3MP7B 3LIEA 2OGUA 2P2UA 4TLFA 1RE3A 1VQPP 1SQVK 2BEZF 3EWKA 3L72E 2KNCB 2IBZE 3CI9A 3FX0A 2HPCB 2P58A 1CI6B 4B86A 4RO0A 1ZR2A 3HE4B 2JKVA 4JBZA 3RK2B 3RBXA 3PTZA 3CCMP 2E75B 4U3FE 3L70J 4LLHA 3VN0A 1X79B 2R32A 1FAVA 1RF0C 3RK2C 2E75C 1PGJA 2IYPA 4ASVA 2C9LY 3L72D 2Y0CA 2D2CB 3KZIH 4O9BA 1RQVA 3AE9C 1EDIA 1NTMK 1AJYA 5KLVJ 2IX7C 4EDFA 4RESB 3L37A 5APYA 1SQVG 1KILE 2G3AA 1BCCD 2D2CC 3L74D 4DT0A 1LWUA 2WPRA 3GF7A 1SQXJ 3GLMA 3E1IA 3CXHI 1BSNA 3MUDA 2AXTH 1E79H 1KZUB 3CCSP 1OW6A 3H32A 4Y28J 3LW5J 1JCDA 1IFJA 3G3ZA 3WUUA 2XZRA 5CJ4A 1CSBA 3VMAA 2ZVOB 3KZIE 3MHVA 2ZT9D 3L75G 5GTIE 1RF1B 3TDKA 3TF5A 1KILD 1S4XA 2I1KA 1SQVE 3V2QA 4DZOA 4EIJA 2FYZA 2K9JA 4YXDC 1KB9H 5AW4B 2B89A 2M0BA 1RF1C 1LJ2A 3L72J 4BRYA 3PP5A 1IJDB 1NTMG 2M5AA 2G8YA 1JY3O 2K9YA 1NTZJ 1KD1Q 2AXTE 3U1AA 2WSSH 5AVWB 2N1TB 1NU1K 1USEA 4GT1A 3HUSA 1ZW0A 1G2CB 2O1KA 2E42A 1BCCJ 1SQVD 3CCQP 3L74J 2ZVNB 1UIIA 2N1TC 1FOSE 4RKUJ 2XU6A 3SWFA 1R5SA 5L8RJ 2WT7B 2E5TA 1P84I 2XDJA 1KB9E 5APVA 1OFCX 3CX5I 1H8AA 2IFNA 3OAKA 1JY3P 1IC2A 1LTGC 3AE2C 3M0DC 2W83C 3H1IG 5B5EE 2YNYA 3L75D 3E7KA 2WSFJ 4PD4E 2B87B 3ZDMA 4ZMDA 1PV3A 2QM7A 2KS1B 2C0XA 2WVRA 1DH3A 2AXCA 1KB9D 2YKQA 3CCUP 1PL5A 4ZNCA 1NTMD 1BE3G 2IBZI 1VQ5P 3Q5RA 2QM8A 1YQ4C 2KZJA 4W80A 3L35A 2FXMA 2YXRB 2R44A 5CHXA 5AW0B 2E76B 5AW1B 3RGUA 2QIWA 3CC4P 1SQVJ 3S1KA 2N9BA 1IFMA 2B88A 3MGNA 1AFOA 1N73A 1LTSC 1T3UA 1S5LH 2E76C 1JTHB 2GA1A 3II6A 1KFMA 4GKGA 1VQ4P 2KK7A 1Z56A 2WWWA 1KYOH 3HD7D 1SQBE 4I2LC 3H1ID 1KQLA 1M57D 1Q2NA 3L75J 2E74D 1Y8AA 4PV1B 4I1LA 1VQ7P 4BWNA 1YI2P 2JWDA 1ZRTE 1HGVA 2KNCA 1PFIA 3CMAP 2HPCA 1CI6A 1ZN5A 4PV1C 3HE4A 1LTIC 2KYVA 4Y99B 1L4AB 1RF0A 1Q90D 1NTMJ 2KLUA 2ZXEB 1HVVA 1S5LE 3M06A 1FZCB 4NPEA 1URQB 1PIXA 3F89A 2R3CA 4Y99C 1L4AC 1KYOE 3QWOC 4IL6X 1NHLA 3TYYA 1MV8A 1FZCC 1ZRTD 3V4WA 1URQC 2JEEA 3Q1MA 2LXCB 2A06G 2JR8A 1MFZA 4DJGA 3H1HE 1HGZA 3H1KG 5AW6B 3ITKA 2VRSA 1T3JA 2O01N 3L73G 3I55P 2YKOA 3H1IJ 2QJKB 1AQTA 1KYOD 5AVYB 3AE5C 1PPJE 1Q82Q 5AW2B 3H1HD 4N78E 2QJKC 3WMM0 3P7KA 1IO4A 1IFNA 2KP8A 2PRRA 1T2KC
chains in the Genus database with same CATH topology
5EFWB 1X0TA 4MN4C 1BDDA 1LP1B 2JWDA 4GODA 2WMMA 5K5GB 5DJTB 2B87A 4HB1A 1ZXGA 3FXDA 1BDCA 2KUBA 2KZIA 1EDKA 4NPFX 2B87B 3ZDMA 4ZMDA 2ZAEB 2Q1KA 4NPEA 1JM0A 1U7JA 1DEEG 4GOFA 4WWIA 2KS1B 4ASWA 1LT1A 4GOEA 3MHVA 1H0TA 3QWOC 4NPDA 4ZNCA 1JMBA 5CBOA 2LXCB 2SPZA 2P58A 1OVRA 2KZJA 2HR3A 2B89A 4JBZA 2R44A 2M0BA 3RGUA 5CBNA 2M5AA 5DJUB 3S1KA 5C39A 2KI7B 3FXEA 2RKLA 1EC5A 2B88A 2QRXA 1NVOA 1OVUA 2LR2A 4IOIH 3PH0A 4EYYQ 2QVAA 1LP1A 1S3JA 2M5AB 2LXBA 2K3RA 1H0TB 1MFTA 1EDLA 1SS1A 1FC2C 4K35A 1U7MA 1ZW0A 4ASVA 4BXLA 3MZWB 2KIKA 4HKZH 1EDJA 4KJMA 4CPGA 2UWJE 4K3AA 1Y47A 2OTKE 4HJGH 1OVVA 1EDIA 2I8DA 1Q2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EFW B;  1X0T A;  4MN4 C;  1BDD A;  1LP1 B;  2JWD A;  4GOD A;  2WMM A;  5K5G B;  5DJT B;  2B87 A;  4HB1 A;  1ZXG A;  3FXD A;  1BDC A;  2KUB A;  2KZI A;  1EDK A;  4NPF X;  2B87 B;  3ZDM A;  4ZMD A;  2ZAE B;  2Q1K A;  4NPE A;  1JM0 A;  1U7J A;  1DEE G;  4GOF A;  4WWI A;  2KS1 B;  4ASW A;  1LT1 A;  4GOE A;  3MHV A;  1H0T A;  3QWO C;  4NPD A;  4ZNC A;  1JMB A;  5CBO A;  2LXC B;  2SPZ A;  2P58 A;  1OVR A;  2KZJ A;  2HR3 A;  2B89 A;  4JBZ A;  2R44 A;  2M0B A;  3RGU A;  5CBN A;  2M5A A;  5DJU B;  3S1K A;  5C39 A;  2KI7 B;  3FXE A;  2RKL A;  1EC5 A;  2B88 A;  2QRX A;  1NVO A;  1OVU A;  2LR2 A;  4IOI H;  3PH0 A;  4EYY Q;  2QVA A;  1LP1 A;  1S3J A;  2M5A B;  2LXB A;  2K3R A;  1H0T B;  1MFT A;  1EDL A;  1SS1 A;  1FC2 C;  4K35 A;  1U7M A;  1ZW0 A;  4ASV A;  4BXL A;  3MZW B;  2KIK A;  4HKZ H;  1EDJ A;  4KJM A;  4CPG A;  2UWJ E;  4K3A A;  1Y47 A;  2OTK E;  4HJG H;  1OVV A;  1EDI A;  2I8D A;  1Q2N A; 
#chains in the Genus database with same CATH topology
 3KQG A;  3OA7 A;  1VQO P;  1PZQ A;  3IN6 A;  1NU1 J;  1BE3 J;  2V7Q H;  4H13 B;  3SFD C;  2YIU B;  1M1K Q;  1CZQ A;  1RF1 A;  1MZ9 A;  4GOD A;  1GK6 A;  3A0H H;  3UIA A;  3L73 E;  2OAR A;  1HF9 A;  4OGQ D;  5H2F E;  3VOP A;  2NRG A;  4WY4 D;  4H13 C;  4PD4 I;  2YIU C;  5KJ7 C;  3WU2 E;  3B71 A;  3CME P;  2A06 D;  2GUS A;  4N78 D;  1Q86 Q;  1QVG O;  3P32 A;  1OIP A;  4GOE A;  3CCV P;  5CCG C;  2N1T A;  3AE3 C;  1JY2 O;  3H1K D;  3H1L J;  1LTT C;  3Q5P A;  1G2C A;  3L73 D;  5AVX B;  1NYH A;  1G1J A;  2IZ0 A;  3IAO A;  5KLI B;  1GW4 A;  1R8E A;  1KOR A;  3M0D A;  2WT7 A;  5KLV G;  1SP4 A;  1EC5 A;  3L70 E;  5KLI C;  1IFD A;  2H7H A;  4N3Y B;  4BXL A;  2FFD B;  1YTZ T;  2KIK A;  1JY2 P;  1YIJ P;  1VQK P;  2UWJ E;  2A45 H;  3LW5 H;  1XTC C;  1FBM A;  4JF7 A;  3JCU E;  4HH2 A;  1M90 Q;  2KS1 A;  4LGD E;  3L36 A;  2ZT9 B;  2LKM A;  2PGD A;  3L70 D;  2P10 A;  5KLV E;  3AEC C;  2M8R A;  2IFM A;  5BVZ A;  2W6A A;  1ZXG A;  4WB4 A;  1Y9B A;  3VTP C;  2JDI H;  1SQX E;  3H1K J;  4H44 D;  2JJL A;  1NJI Q;  4GDO A;  1NTZ G;  1KC8 Q;  4ASW A;  4WVZ A;  4L75 A;  1JTH A;  5KLV D;  2HR3 A;  1K8A Q;  4I7Z C;  1K05 A;  1SQX D;  3FWL A;  1FZF A;  3AE1 C;  3BRV B;  2RKL A;  1NVO A;  1OW8 A;  1WMK A;  2V7Q J;  2Y0E A;  3M9B A;  3RL0 D;  1EQ7 A;  3B5N B;  1NTZ E;  1H88 A;  1RY3 A;  2FXP A;  1PGO A;  4R4M A;  4HKZ H;  2WSF H;  1EDJ A;  1L4A A;  2ZYA A;  1VQM P;  1L0L K;  3P8C D;  1FDO A;  3OW2 O;  2W8Z A;  3O8Z A;  3B5N C;  1FZC A;  1VF5 D;  1URQ A;  1BCC E;  1PGQ A;  3L74 E;  1BDD A;  4IL6 H;  1HUC A;  1QL1 A;  3C9I A;  2HFE D;  1IZN B;  2WMM A;  3D6Y A;  3O6Q B;  1NTZ D;  4XE5 B;  4HB1 A;  1KQF B;  1N7S B;  2KUB A;  4C7R A;  3TGU G;  2PAJ A;  1X9V A;  2XND H;  3I5C A;  1DEE G;  3I56 P;  1GL2 B;  2Z5I A;  4XFJ A;  1FE6 A;  4DOJ A;  3T97 B;  3A0B H;  1NH4 A;  3SFE C;  2CPB A;  5KAI H;  1L0L G;  1FU1 A;  2YKP A;  3EFF K;  4IL6 E;  5TIS H;  5AW7 B;  4OH8 B;  3BAT A;  4W7Z A;  2KSE A;  2LR2 A;  2KB7 P;  4IOI H;  5KJ7 A;  1GDT A;  3B8E B;  3M91 A;  3IFM A;  2QG4 A;  1YQ3 C;  2ZFC A;  3V6I A;  4KT0 J;  3KDP B;  5CCG A;  2IYO A;  2YO2 A;  2ZYG A;  1M8O B;  2H43 A;  5KAI E;  3TGU D;  3RL0 g;  5B66 H;  2JO1 A;  1PGP A;  3L75 E;  5TIS E;  2ZJS E;  3MTU E;  4ZKU A;  2QJP B;  2QE7 H;  1HJB A;  5KKZ B;  1NTM E;  1JCC A;  1L0L D;  2L5G B;  1YBK A;  2A45 I;  3BCC G;  3SWY A;  1A02 J;  3CD6 P;  4NPD A;  2O3J A;  3V2P A;  2MKV A;  2KOG A;  2FFD A;  5APS A;  2Y9Z A;  2HOD B;  1ZME C;  5KKZ C;  2MJZ A;  1IK7 A;  1JY2 N;  1QX8 A;  1KV4 A;  1M56 D;  1TU3 F;  1R5L A;  2CK3 H;  5AVZ B;  3RK2 D;  2YXQ B;  2AEF A;  2E75 D;  1GU4 A;  1NU1 G;  3Q2Y A;  2LXB A;  3WUT A;  1FC2 C;  3KPE A;  1BGY J;  2FY8 A;  1QLE D;  3MZW B;  3TGU J;  1SQQ K;  4ZKP A;  5AVR B;  3H1I E;  3VMX A;  4L74 A;  2PP6 A;  3VYI A;  2D2C D;  1J1D B;  5AVU B;  1YIT P;  3D71 A;  3G4S P;  2YMK A;  2JWA A;  3AE8 C;  2Q5U A;  3WUV A;  3EQ2 A;  3H1L G;  3D6Z A;  1NU1 E;  1BE3 E;  2Z4E A;  1L0L J;  1J1D C;  2P1J A;  3U59 A;  5CJ0 A;  1ZOY C;  1NAF A;  2RH0 A;  2KZI A;  1EZV G;  1NTK K;  2OYH B;  4GIF A;  4R4L A;  4NPF X;  1JO5 A;  2Q1K A;  1KN7 A;  1AVY A;  2J58 A;  1JM0 A;  1X8Y A;  2WQY C;  1L0N K;  1LGH B;  3S4R A;  3B5N A;  2OYH C;  3HTK B;  4EOT A;  3SWK A;  1J1E B;  1SQQ G;  3H1J G;  1NU1 D;  1BE3 D;  3H1L E;  1W2E A;  2FYN B;  3GHG B;  1NOH A;  4H0L B;  1J1E C;  2Z5H A;  3TNU B;  4YPC A;  4EYY Q;  1M1J B;  1KTM A;  1MFT A;  1EDL A;  1GU5 A;  2FYN C;  3GHG C;  1U7M A;  1JOC A;  1SFC B;  4H0L C;  1USD A;  2N1T D;  2BCC G;  3JC2 2;  5APU A;  3CCR P;  3BVH A;  2WSE H;  3E1R A;  5BU5 A;  1NTK G;  1K73 Q;  1YJW P;  4JYC A;  3H1L D;  3IF4 A;  1OMI A;  2NPS B;  3BCC J;  3CCJ P;  1SFC C;  3CPW O;  1L0N G;  1EZV D;  3LID A;  1JEK A;  3T97 A;  3BRT B;  3VP9 A;  1AA0 A;  4QMA A;  1KQG B;  2NPS C;  3M0A A;  2DW3 A;  2FYU K;  3FXD A;  5APQ A;  2A06 E;  3RK3 B;  4L76 A;  3CL3 D;  1KB9 I;  4C7N B;  1SQQ D;  3H1J D;  3H1K E;  1LT1 A;  1NGM B;  1OZH A;  3RK3 C;  1LTA C;  3CXH H;  1SVF A;  2J59 M;  3W67 A;  3SSU A;  2P67 A;  1YYC A;  1S9K D;  3A7O A;  1X22 A;  1J2J B;  3FWN A;  2K37 A;  4KHX A;  1K9M Q;  1FS0 E;  3K5B A;  2BCC D;  1HJ0 A;  1VQ9 P;  3AEF C;  2E76 D;  1NTK D;  1DD4 A;  1JMM A;  2M5A B;  2M3E A;  3L71 G;  1H0T B;  1VDF A;  4XA4 A;  2FYU G;  4JQ0 D;  2WPQ A;  2C9N Y;  3A0H E;  3A2A A;  4KJM A;  1GZL A;  1SQP K;  2OYO A;  1QL2 A;  2OTK E;  1L2P A;  3CXH E;  1OVV A;  5AVQ B;  1AQ5 A;  2R5B A;  1N2D C;  3AEE C;  3Q3D A;  2I1J A;  2IPP A;  1QGK B;  2OYI B;  5CCH C;  3PRJ A;  1SQQ J;  4PV1 D;  3H1J J;  3A5T A;  4D6T G;  2HOD A;  2QEX P;  2B87 A;  1N86 A;  2OYI C;  1P84 H;  2FFD C;  1GTW A;  3BAS A;  5E79 H;  1L4A D;  3CXH D;  3CX5 H;  1GW3 A;  3GMA A;  3N4X A;  1KIL B;  1URQ D;  2BCC J;  2E43 A;  2Q7C A;  3U1C A;  1HBW A;  3R2P A;  1NTK J;  2WSE J;  1JB0 J;  2ZT9 C;  1OVR A;  1SQP G;  1KIL C;  3L71 D;  1KQS O;  2E5Y A;  1LT9 B;  2W6J H;  1L0N J;  4PJ0 H;  1KYO I;  2C0W A;  2GUV A;  2QRX A;  1JUN A;  1P84 E;  2P7J A;  1LT9 C;  3TSI A;  3P8C E;  4K35 A;  2IBZ G;  3AE6 C;  4N6J A;  1T2K D;  2K88 A;  2OYH A;  4U3F G;  5APX A;  4D6T D;  1PP9 J;  1FJK A;  1SQP E;  2I8D A;  2OTL P;  3H25 A;  4IFM A;  2ITA A;  1X0T A;  3HTK A;  4PJ0 E;  4H13 D;  2FBW C;  5AW8 B;  1P84 D;  5KJ7 D;  2XV5 A;  1XTG B;  1YHQ P;  1LTJ B;  3CX5 D;  1YJ9 P;  1FZA A;  3B4S A;  2XKM A;  3GHG A;  3OJA B;  5CCG D;  3TNU A;  2HYN A;  3L71 J;  2BEQ D;  1SQP D;  4YTP C;  1LTJ C;  2YO3 A;  3HE5 B;  1NAY A;  5KTB A;  3R4Y A;  1M1J A;  4OWF A;  1W5C E;  2H88 C;  2FYU J;  2OQQ A;  3ABV C;  1VQL P;  1SFC A;  1BGY G;  2Q6Q A;  1DX7 A;  1FDM A;  2N9Y B;  3AEG C;  4I6M C;  2IBZ D;  2NPS A;  1N7S C;  1VPC A;  5GTI H;  5CMZ A;  2Q9I A;  3P8M C;  5CCH D;  5GTH H;  3PH0 A;  4U3F D;  4D6T J;  1FOS F;  1FZB A;  2K3R A;  1SS1 A;  1OW7 A;  3CCE P;  2AEJ A;  1GL2 C;  2Y9Y A;  3HD7 B;  3D70 A;  4CPG A;  1BGY E;  3TGU E;  2E74 B;  4C7N A;  5AVV B;  2IZ1 A;  1NWQ A;  4HYT B;  3HD7 C;  3G9R A;  3G71 P;  2FXO A;  4YXW H;  3GG2 A;  2IDB A;  2E74 C;  4OVN F;  3NTN A;  1SQP J;  2PFX A;  5AW5 B;  3A0B E;  3QH9 A;  4C46 A;  2GM4 A;  5GTH E;  2Y0D A;  1NKZ B;  1L0L E;  3MD0 A;  4TT3 H;  2ZAE B;  1BGY D;  1BSH A;  1LNQ A;  4GOF A;  2WSC H;  3CLQ A;  5TJH A;  2O01 H;  1H0T A;  5B5E H;  5APT A;  1FZG A;  2W6B A;  5APW A;  4PD4 H;  3M9H A;  3HRN A;  4U3F J;  1S1C X;  1S2E A;  1OX3 A;  5CCH A;  1SQB K;  2QJP C;  1S72 P;  3VP8 A;  2OYI A;  2QVA A;  1DEB A;  3GW6 A;  2K1A A;  3AE7 C;  2V4H A;  3B5N D;  5B66 E;  4AYC A;  1GK4 A;  3M9Q A;  1WT6 A;  4HJG H;  1VQ8 P;  2L91 A;  1RE4 C;  3AEB C;  3NXS A;  1NO4 A;  1UIX A;  1KIL A;  2AEM A;  1MKM A;  3BCC E;  1LP1 B;  2H8P D;  4OGQ B;  2WIT A;  4WY4 B;  5K5G B;  1EDK A;  1SLQ A;  3EFG A;  1LT9 A;  1SQB G;  4UB6 H;  1N7S D;  1M7L A;  4OGQ C;  4WY4 C;  1U7J A;  4WBA A;  4U7J A;  4PD4 D;  1GD2 E;  1Q7Y Q;  3C8V A;  2W90 A;  3VMZ A;  2J5U A;  1GL2 D;  3BCC D;  5CBO A;  4W7Y A;  1ZLL A;  2BAS A;  2OTJ P;  1RHZ B;  4JPZ B;  4Z1M H;  1IFP A;  2POH A;  3F5H A;  2Q3E A;  2ZXX A;  5DJU B;  2KI7 B;  3FXE A;  3IR9 A;  1OVU A;  3CCL P;  1N8R Q;  4UB6 E;  2B9B A;  2HLO A;  1QEX A;  2KLV A;  1LTJ A;  3CWB G;  3TK1 A;  5KAF H;  3H1H G;  1EZV E;  2QSI A;  1RE3 C;  3NFQ A;  2WZ7 A;  3H6P A;  3AED C;  3A3Y B;  2HG5 D;  1QVF O;  2WSC J;  5EFW B;  3HE5 A;  1SQB D;  3O6Q A;  2O01 J;  1N7S A;  5AVT B;  2ZYD A;  2RMZ A;  1VQ6 P;  4H44 B;  1PPJ G;  3KHU A;  5AW9 B;  1FZE A;  1SQQ E;  3H1J E;  1M1J C;  3V2R A;  3VMY A;  1GL2 A;  1T6A A;  3CWB E;  5BU8 B;  4H44 C;  4WWI A;  5KAF E;  1EXI A;  1OWA A;  1RQU A;  3G6E P;  5H2F H;  1S9K E;  1N7L A;  1LWU B;  1WRG A;  2H89 C;  3HD7 A;  3WU2 H;  1HH0 A;  3JSV C;  2BCC E;  3PLN A;  1DIP A;  2SPZ A;  4A7P A;  3MIW A;  4M3L A;  3RBZ A;  1KMI Z;  3C1L A;  4L73 A;  1VL2 A;  1VQN P;  2M3B A;  1NTK E;  4EI2 A;  3H32 B;  1K04 A;  1PP9 G;  1LWU C;  4RJT A;  1OXZ A;  2WPV B;  3CWB D;  5C39 A;  3RL0 B;  5AVS B;  1L0N E;  3MUD C;  5M1B A;  3AEA C;  1MUU A;  3PHL A;  4AUW A;  1LTB C;  1S3J A;  2JP3 A;  5KLV K;  1AV1 A;  2W27 A;  3V2N A;  4DCK A;  1SQB J;  2Q3I A;  3RL0 C;  2K9J B;  1SQX K;  1VF5 B;  1ZV8 A;  1IFI A;  2QA4 P;  3N7N A;  1PPJ D;  4BRY B;  3L70 G;  5AW3 B;  2NZ2 A;  4MN4 C;  1VF5 C;  1PP9 E;  1L0N D;  2FKW B;  1T8Z A;  1Q81 Q;  1FJP A;  3HUS B;  3CC2 P;  3KYQ A;  1EXJ A;  1BDC A;  3JCU H;  4UB8 H;  3USS A;  2KSJ A;  3W68 A;  1D7M A;  1NKN A;  4AQR D;  3HUS C;  4JYB A;  1JNM A;  3AE4 C;  1W2B O;  3PJS K;  1KFN A;  1RE4 A;  1GMJ A;  1NTZ K;  2CPS A;  3CC7 P;  1JMB A;  3L71 E;  1PP9 D;  3CWB J;  2XNX A;  1CW5 A;  3H1H J;  3FGA D;  3V5B A;  2FYU E;  2QJY B;  1HWT C;  1SQX G;  1JY3 N;  1IK9 A;  1DD3 A;  3KXD A;  5CBN A;  1H89 A;  1ZR4 A;  1ZP0 C;  2A45 G;  1FDI A;  4H0L D;  2QJY C;  4IFF A;  4UB8 E;  1LP1 A;  1RH5 B;  2KXP B;  4WY4 A;  2R5D A;  3NMD A;  4D6T E;  1AVO A;  1G1I A;  4K3A A;  1SFC D;  1YJN P;  1EZV I;  2YMY A;  1Y47 A;  2FYU D;  3RK3 E;  1U57 A;  1HTL C;  4LC1 A;  2WPS A;  3L73 J;  2NPS D;  3L4F A;  3L72 G;  1E5W A;  5E79 E;  1A02 F;  3CX5 E;  1N73 B;  1S5L X;  2R3S A;  4I7Z B;  3V4Q A;  3S9O A;  5DJT B;  4IFD K;  1YTZ I;  3Q5S A;  1N73 C;  2O1J A;  1BCC G;  2WTY A;  2RN0 A;  3RK3 D;  3L74 G;  3GF3 A;  3MP7 B;  3LIE A;  2OGU A;  2P2U A;  4TLF A;  1RE3 A;  1VQP P;  1SQV K;  2BEZ F;  3EWK A;  3L72 E;  2KNC B;  2IBZ E;  3CI9 A;  3FX0 A;  2HPC B;  2P58 A;  1CI6 B;  4B86 A;  4RO0 A;  1ZR2 A;  3HE4 B;  2JKV A;  4JBZ A;  3RK2 B;  3RBX A;  3PTZ A;  3CCM P;  2E75 B;  4U3F E;  3L70 J;  4LLH A;  3VN0 A;  1X79 B;  2R32 A;  1FAV A;  1RF0 C;  3RK2 C;  2E75 C;  1PGJ A;  2IYP A;  4ASV A;  2C9L Y;  3L72 D;  2Y0C A;  2D2C B;  3KZI H;  4O9B A;  1RQV A;  3AE9 C;  1EDI A;  1NTM K;  1AJY A;  5KLV J;  2IX7 C;  4EDF A;  4RES B;  3L37 A;  5APY A;  1SQV G;  1KIL E;  2G3A A;  1BCC D;  2D2C C;  3L74 D;  4DT0 A;  1LWU A;  2WPR A;  3GF7 A;  1SQX J;  3GLM A;  3E1I A;  3CXH I;  1BSN A;  3MUD A;  2AXT H;  1E79 H;  1KZU B;  3CCS P;  1OW6 A;  3H32 A;  4Y28 J;  3LW5 J;  1JCD A;  1IFJ A;  3G3Z A;  3WUU A;  2XZR A;  5CJ4 A;  1CSB A;  3VMA A;  2ZVO B;  3KZI E;  3MHV A;  2ZT9 D;  3L75 G;  5GTI E;  1RF1 B;  3TDK A;  3TF5 A;  1KIL D;  1S4X A;  2I1K A;  1SQV E;  3V2Q A;  4DZO A;  4EIJ A;  2FYZ A;  2K9J A;  4YXD C;  1KB9 H;  5AW4 B;  2B89 A;  2M0B A;  1RF1 C;  1LJ2 A;  3L72 J;  4BRY A;  3PP5 A;  1IJD B;  1NTM G;  2M5A A;  2G8Y A;  1JY3 O;  2K9Y A;  1NTZ J;  1KD1 Q;  2AXT E;  3U1A A;  2WSS H;  5AVW B;  2N1T B;  1NU1 K;  1USE A;  4GT1 A;  3HUS A;  1ZW0 A;  1G2C B;  2O1K A;  2E42 A;  1BCC J;  1SQV D;  3CCQ P;  3L74 J;  2ZVN B;  1UII A;  2N1T C;  1FOS E;  4RKU J;  2XU6 A;  3SWF A;  1R5S A;  5L8R J;  2WT7 B;  2E5T A;  1P84 I;  2XDJ A;  1KB9 E;  5APV A;  1OFC X;  3CX5 I;  1H8A A;  2IFN A;  3OAK A;  1JY3 P;  1IC2 A;  1LTG C;  3AE2 C;  3M0D C;  2W83 C;  3H1I G;  5B5E E;  2YNY A;  3L75 D;  3E7K A;  2WSF J;  4PD4 E;  2B87 B;  3ZDM A;  4ZMD A;  1PV3 A;  2QM7 A;  2KS1 B;  2C0X A;  2WVR A;  1DH3 A;  2AXC A;  1KB9 D;  2YKQ A;  3CCU P;  1PL5 A;  4ZNC A;  1NTM D;  1BE3 G;  2IBZ I;  1VQ5 P;  3Q5R A;  2QM8 A;  1YQ4 C;  2KZJ A;  4W80 A;  3L35 A;  2FXM A;  2YXR B;  2R44 A;  5CHX A;  5AW0 B;  2E76 B;  5AW1 B;  3RGU A;  2QIW A;  3CC4 P;  1SQV J;  3S1K A;  2N9B A;  1IFM A;  2B88 A;  3MGN A;  1AFO A;  1N73 A;  1LTS C;  1T3U A;  1S5L H;  2E76 C;  1JTH B;  2GA1 A;  3II6 A;  1KFM A;  4GKG A;  1VQ4 P;  2KK7 A;  1Z56 A;  2WWW A;  1KYO H;  3HD7 D;  1SQB E;  4I2L C;  3H1I D;  1KQL A;  1M57 D;  1Q2N A;  3L75 J;  2E74 D;  1Y8A A;  4PV1 B;  4I1L A;  1VQ7 P;  4BWN A;  1YI2 P;  2JWD A;  1ZRT E;  1HGV A;  2KNC A;  1PFI A;  3CMA P;  2HPC A;  1CI6 A;  1ZN5 A;  4PV1 C;  3HE4 A;  1LTI C;  2KYV A;  4Y99 B;  1L4A B;  1RF0 A;  1Q90 D;  1NTM J;  2KLU A;  2ZXE B;  1HVV A;  1S5L E;  3M06 A;  1FZC B;  4NPE A;  1URQ B;  1PIX A;  3F89 A;  2R3C A;  4Y99 C;  1L4A C;  1KYO E;  3QWO C;  4IL6 X;  1NHL A;  3TYY A;  1MV8 A;  1FZC C;  1ZRT D;  3V4W A;  1URQ C;  2JEE A;  3Q1M A;  2LXC B;  2A06 G;  2JR8 A;  1MFZ A;  4DJG A;  3H1H E;  1HGZ A;  3H1K G;  5AW6 B;  3ITK A;  2VRS A;  1T3J A;  2O01 N;  3L73 G;  3I55 P;  2YKO A;  3H1I J;  2QJK B;  1AQT A;  1KYO D;  5AVY B;  3AE5 C;  1PPJ E;  1Q82 Q;  5AW2 B;  3H1H D;  4N78 E;  2QJK C;  3WMM 0;  3P7K A;  1IO4 A;  1IFN A;  2KP8 A;  2PRR A;  1T2K C; 
#chains in the Genus database with same CATH homology
 5EFW B;  1X0T A;  4MN4 C;  1BDD A;  1LP1 B;  2JWD A;  4GOD A;  2WMM A;  5K5G B;  5DJT B;  2B87 A;  4HB1 A;  1ZXG A;  3FXD A;  1BDC A;  2KUB A;  2KZI A;  1EDK A;  4NPF X;  2B87 B;  3ZDM A;  4ZMD A;  2ZAE B;  2Q1K A;  4NPE A;  1JM0 A;  1U7J A;  1DEE G;  4GOF A;  4WWI A;  2KS1 B;  4ASW A;  1LT1 A;  4GOE A;  3MHV A;  1H0T A;  3QWO C;  4NPD A;  4ZNC A;  1JMB A;  5CBO A;  2LXC B;  2SPZ A;  2P58 A;  1OVR A;  2KZJ A;  2HR3 A;  2B89 A;  4JBZ A;  2R44 A;  2M0B A;  3RGU A;  5CBN A;  2M5A A;  5DJU B;  3S1K A;  5C39 A;  2KI7 B;  3FXE A;  2RKL A;  1EC5 A;  2B88 A;  2QRX A;  1NVO A;  1OVU A;  2LR2 A;  4IOI H;  3PH0 A;  4EYY Q;  2QVA A;  1LP1 A;  1S3J A;  2M5A B;  2LXB A;  2K3R A;  1H0T B;  1MFT A;  1EDL A;  1SS1 A;  1FC2 C;  4K35 A;  1U7M A;  1ZW0 A;  4ASV A;  4BXL A;  3MZW B;  2KIK A;  4HKZ H;  1EDJ A;  4KJM A;  4CPG A;  2UWJ E;  4K3A A;  1Y47 A;  2OTK E;  4HJG H;  1OVV A;  1EDI A;  2I8D A;  1Q2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...