2P58A

Structure of the yersinia pestis type iii secretion system needle protein yscf in complex with its chaperones ysce/yscg
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
54
structure length
54
Chain Sequence
NVETVRSITMQLEMALTKLKKDMMRGGDAKQYQVWQRESKALESAIAIIHYVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/chaperone
molecule keywords Putative type III secretion protein YscE
publication title Structural characterization of the Yersinia pestis type III secretion system needle protein YscF in complex with its heterodimeric chaperone YscE/YscG.
pubmed doi rcsb
source organism Yersinia pestis
total genus 17
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2007-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2p58A00
1EDJA 2R44A 3FXEA 4JBZA 3RGUA 1EDLA 1DEEG 1S3JA 1H0TB 5CBNA 2SPZA 3ZDMA 4K3AA 2M0BA 4NPFX 4ASVA 3MHVA 5CBOA 1OVRA 4GODA 1EDKA 3PH0A 2JWDA 2LXCB 4HJGH 2HR3A 2KIKA 4WWIA 4K35A 2LXBA 1SS1A 3S1KA 5K5GB 1LT1A 4ASWA 1LP1B 5DJTB 4HKZH 5DJUB 5EFWB 2OTKE 2QVAA 1ZW0A 4MN4C 2UWJE 2ZAEB 4ZNCA 1EC5A 2LR2A 2I8DA 2M5AA 5C39A 2RKLA 1JMBA 2B87A 1U7JA 1BDCA 1BDDA 2B88A 1OVUA 4NPEA 1JM0A 4GOFA 1NVOA 4GOEA 2KZIA 2KS1B 1Y47A 2P58A 3MZWB 1H0TA 4CPGA 2Q1KA 2B87B 4EYYQ 2B89A 3QWOC 2K3RA 1FC2C 1OVVA 2KI7B 1U7MA 2KUBA 2WMMA 1EDIA 4BXLA 2M5AB 4IOIH 2KZJA 4NPDA 3FXDA 1LP1A 4ZMDA 1X0TA 1MFTA 1Q2NA 1ZXGA 4KJMA 2QRXA 4HB1A
chains in the Genus database with same CATH superfamily
2RN0A 2VRSA 1FJPA 3H1JJ 1DEEG 5BU8B 3ZDMA 2E43A 3Q1MA 2P10A 1LTJC 2AXTE 1QL1A 3P8CE 1VL2A 5KJ7D 2MJZA 3LW5H 1Q86Q 1J1DC 3A7OA 3V2RA 2QEXP 3W67A 4M3LA 2D2CD 3TSIA 1N7LA 1FZAA 2Z4EA 4GDOA 3CWBJ 3B5NB 4GOFA 3AEEC 2GUSA 4D6TJ 3F89A 3L75G 4GKGA 3S9OA 2KNCA 1AFOA 2BEZF 3V4QA 3VP8A 1HBWA 3BCCE 3CCJP 1OW8A 3JCUH 1EQ7A 1VQ5P 3GHGB 4LGDE 2ZXXA 2K9JB 1G2CB 5CJ0A 1NTKD 5AVYB 3TK1A 2C0WA 1LT9A 2E76B 4IL6X 3TF5A 1N7SD 5CCHD 1GD2E 3Q5SA 3RK3C 4C7RA 4B86A 1K9MQ 2AEMA 2KS1A 1VF5C 1KYOI 5H2FH 3CCUP 1SFCC 1FDMA 2E5YA 2YO2A 1YIJP 2V7QH 3RK2C 3H1KD 3L72E 5M1BA 1L0LK 1L0NJ 1KILC 1URQA 4WWIA 3TGUE 1W5CE 1SQVE 1HJBA 2IYOA 5AW6B 1IK7A 1S4XA 1T3UA 2O3JA 4LLHA 2B88A 2P7JA 3NMDA 1Q81Q 2V4HA 1SVFA 1S9KE 3V2NA 1LTAC 1NH4A 1H0TA 1JEKA 2B87B 1VQLP 1N8RQ 5AW7B 3L70J 1HH0A 3IN6A 1L4AC 1SQXD 2Y0EA 3P32A 2KI7B 4HYTB 1N7SB 1K05A 1FZCB 4YTPC 5GTIE 3OJAB 1YTZI 3VMZA 2R3CA 3AEBC 1NAFA 2QG4A 2BCCJ 2M5AB 2CK3H 3L36A 1YHQP 3H1JD 2RH0A 1SQBE 1BDCA 4PV1D 1T3JA 4BWNA 3FXEA 3Q5RA 3N7NA 3I56P 1J1EB 1SFCA 4ZKUA 3CCMP 2PP6A 2H88C 3V4WA 1AQ5A 3CCVP 1MZ9A 2HG5D 1GL2B 1NTME 1KILA 4ASVA 1SQQD 4KT0J 3NXSA 1EDKA 2W6JH 2XV5A 3CD6P 3E7KA 3H1IJ 1KQLA 2BEQD 1PP9D 1HWTC 3CWBD 3CCRP 5KTBA 1AVOA 2XZRA 4IL6E 3MUDC 2W83C 1U57A 4PD4H 1R8EA 1Q7YQ 1KFNA 2J5UA 2GA1A 1ZN5A 3K5BA 3KPEA 1URQD 1SQVK 2QM8A 1L0LJ 3HE5A 2C0XA 3CX5H 1ZP0C 3HTKA 2Z5IA 4U3FG 3W68A 1U7MA 2KNCB 1SQPJ 2IFMA 2HODA 1FOSE 1GW3A 2AEFA 2QJYC 2FBWC 5AVSB 2E74C 5CCGC 4Y28J 4N78D 1OW6A 5GTHH 4EI2A 1EDJA 1SQXG 2QJPB 1KQFB 1LGHB 2G3AA 1GTWA 5AVUB 1R5SA 2FXOA 1D7MA 3TNUB 3H1JG 1Q82Q 2IYPA 2WWWA 2NZ2A 1Z56A 2E75B 1SQBK 1KB9H 1PPJG 3HUSB 3HD7A 3M9HA 3S1KA 1LT1A 1LP1B 2R5BA 2BASA 4HKZH 5AW9B 4DZOA 1JY3P 1SFCD 1TU3F 2Q3EA 1AV1A 3BCCJ 3RK2D 1URQB 1N2DC 1ZR4A 1DIPA 2O01H 1ZRTD 2KXPB 3VYIA 1KILD 3L70D 2IBZE 1PL5A 1Y47A 3E1IA 1M7LA 2WSCH 3JCUE 3CWBG 2Q7CA 1OXZA 1CZQA 1FAVA 4D6TG 5L8RJ 1RF1C 4DT0A 2YKQA 1K73Q 3L74E 2BCCD 5AW4B 5CJ4A 4XFJA 5AW2B 5CCGA 5KLVE 3WMM0 4C7NA 1VQ7P 3H1HE 1FBMA 4L74A 2A45H 2W8ZA 1VQPP 2Z5HA 2R3SA 3A3YB 5H2FE 1E79H 3L72J 1OW7A 4H13B 2JKVA 4AYCA 1GU5A 1LTBC 2H43A 4H44C 1RQUA 4LC1A 2IPPA 4I6MC 1YQ4C 4NPFX 2W6AA 1VQ4P 3O6QA 1UIIA 2XNDH 2N1TA 1NTKJ 1RF0C 2ZJSE 2KYVA 1FU1A 1AJYA 4MN4C 1L0NG 2LR2A 3PP5A 3H1LE 2WT7B 1BGYE 1EZVE 3HE4B 2AEJA 3MTUE 3SFDC 1JO5A 1L0LD 1RF1A 2A06G 3AE1C 2QIWA 3F5HA 1OWAA 5TISH 1SQBJ 2KOGA 3HD7D 4R4MA 2HLOA 2ZXEB 4JQ0D 2ZT9D 4RO0A 3CLQA 1WMKA 2FYUG 5B66H 3L70G 3CPWO 2FFDC 3P8CD 1JUNA 1NJIQ 2QE7H 5KKZC 4L73A 2BCCG 2HODB 4IFFA 2K9YA 2OGUA 1LNQA 2KSEA 4OVNF 1S3JA 3L37A 5APWA 3H25A 1N73B 1DH3A 5AVQB 3I55P 1T6AA 2E74D 2WZ7A 1LWUB 5CCGD 4H0LB 3PLNA 3BRVB 1VQKP 3L73J 1Q90D 1RF0A 3RL0C 1JY2N 1HGZA 5BU5A 3BCCD 3CMAP 2W6BA 1Y9BA 2JO1A 2YIUC 4PD4E 3A5TA 1M1JB 2ZVNB 3EFGA 5AW1B 1KQSO 1EC5A 3FGAD 3H1IG 1JMBA 1H89A 2ZYAA 3CXHH 2RMZA 2OYIC 1KZUB 3M0DA 1CI6B 2ZT9B 4OGQD 1SQQJ 4N3YB 2POHA 2N1TD 1NOHA 1HTLC 3JSVC 1X79B 2FFDA 2K3RA 1PV3A 1PP9J 3D70A 5B5EE 1FDIA 5GTHE 5APQA 3L71G 1L0LG 3KYQA 3L72D 3LW5J 1ZOYC 1JY3N 1SQPG 1MFTA 1SQVD 1P84I 3EQ2A 1NTZK 1MV8A 4JPZB 4WY4C 3R4YA 1KB9E 1NU1E 1VQOP 1FZFA 2WVRA 2OQQA 3H32A 2KB7P 2OTLP 3IFMA 2JWDA 3CC7P 1JB0J 4H44D 1LTJA 4EDFA 3VOPA 1ZW0A 4OGQB 1RE3C 4H13C 2N1TB 2OYIA 1NO4A 2NPSC 1U7JA 1BDDA 2HPCA 2D2CB 4BRYA 3E1RA 3B4SA 1SQBD 3M9QA 1KYOD 3VMXA 3PTZA 2P58A 4Y99C 2Q1KA 3KZIH 2ZYDA 4ZKPA 2OYHC 1G1JA 1X9VA 3M9BA 5KLIB 3G71P 1H8AA 1P84E 3CI9A 1PIXA 1LTGC 2V7QJ 2J58A 1EDIA 2LKMA 2Q5UA 1JCCA 4ZMDA 2FKWB 4YPCA 1R5LA 4KJMA 4GIFA 3CCQP 3Q2YA 3C9IA 4WY4A 1BE3J 3T97B 3L73D 1JCDA 1OX3A 4K3AA 2A45G 2XNXA 3QH9A 1BGYJ 5APUA 3GF3A 1CSBA 4N6JA 2FYNC 1M8OB 1HJ0A 3MIWA 2NPSA 1OZHA 2OTKE 1NTKG 2M3BA 1MUUA 4U7JA 3RL0D 1NTZJ 1NU1K 1KORA 1BCCJ 2KP8A 2B9BA 1MKMA 5TISE 2M3EA 1NKZB 4GOEA 1GMJA 2OYHA 1NAYA 3TDKA 3MZWB 4U3FE 5KAFH 3AE5C 5B66E 3SWKA 3AE8C 3QWOC 5AW0B 1GU4A 4YXDC 4XE5B 1XTGB 1OVVA 1VQ9P 3G3ZA 1ZLLA 3H1KG 1IJDB 1QVFO 1L4AA 1SQXE 2O1KA 2I1JA 3GLMA 2IBZI 3V2PA 2QJKB 3SWFA 1IZNB 4JBZA 1VQNP 1T2KC 3D6YA 1KMIZ 1XTCC 4AQRD 4PV1B 2AXTH 2YO3A 4L76A 2WSEJ 3AEDC 1MFZA 1PPJE 4W7ZA 3CCEP 3B5NC 3MHVA 1JNMA 1OVRA 1SP4A 5APSA 4Z1MH 2ZFCA 1GK4A 3M0AA 2HR3A 3L74D 2ITAA 3AE7C 3L73G 1SS1A 1LT9B 1PZQA 4WY4D 2N9BA 3BRTB 3CXHE 3AE2C 1WT6A 3GHGC 4R4LA 2O1JA 3GF7A 1YQ3C 1RQVA 3KQGA 1HUCA 3CWBE 2PGDA 2XDJA 4NPEA 1S5LH 1DD4A 1LTJB 3RK3D 3U1AA 2KS1B 4D6TE 3CCLP 2E76C 2HYNA 1YBKA 2Q6QA 2PRRA 1YYCA 2WPQA 1S72P 2R5DA 4IFMA 1VF5D 4CPGA 1J1DB 2H7HA 3MUDA 3EFFK 1WRGA 1IK9A 4TT3H 2YNYA 2NPSD 1H88A 4KHXA 2QA4P 1SQQG 3FX0A 1NTMK 2I1KA 1W2BO 3V6IA 1OIPA 2P2UA 3V2QA 2P67A 1LTIC 2WSSH 3A2AA 1PP9G 1EZVI 1NU1J 2IZ1A 3NFQA 2D2CC 1BE3D 3OAKA 1W2EA 4JYCA 2IFNA 1PGQA 4GT1A 2JWAA 3MP7B 3Q5PA 2L5GB 5AW8B 5AVTB 3LIDA 3SSUA 1BGYD 2W27A 3II6A 2FY8A 1H0TB 4IFDK 3B5NA 1AA0A 3KXDA 4W80A 3A0BH 3GMAA 1FZEA 5KLIC 1S2EA 2R32A 5CBOA 1L4AD 1PGPA 2YMYA 4GODA 4WVZA 1YI2P 1EXIA 1L0NE 1RY3A 3TGUJ 2LXBA 1NTZD 3GHGA 1SQVJ 1BCCD 3IF4A 3CC2P 3RK3B 2K9JA 1G2CA 3AE6C 3KHUA 4DJGA 1N7SC 1FZCC 1DX7A 1FJKA 2A06E 1SFCB 3KZIE 1BSNA 2Y0CA 3BASA 3RK2B 1JMMA 3R2PA 1KILB 1M1KQ 2FYUE 2FXMA 1J1EC 3WU2H 2WSFJ 1ZMEC 3BATA 1GL2C 2OARA 4PD4I 1S5LX 1KYOH 2BCCE 3FXDA 1QL2A 2GUVA 3CX5I 4DOJA 1K04A 1L4AB 1EDLA 1X8YA 3UIAA 2JEEA 1RE4C 3A0HH 3HE5B 1EXJA 5CMZA 1PFIA 3HTKB 1BE3G 1NTMJ 2ZYGA 1T2KD 1YJWP 2C9LY 2JR8A 3H1IE 2NRGA 3U59A 4DCKA 5DJUB 1G1IA 1HVVA 4EOTA 4JYBA 5KLVK 3U1CA 2M5AA 3B5ND 1YJNP 5CHXA 3H6PA 5E79H 5KAFE 5APVA 1JTHA 1NKNA 1KB9I 3AE9C 2M8RA 2WQYC 1L0NK 1NTZG 2YKPA 1BCCG 2Y0DA 3EWKA 1IFNA 2QJPC 5KAIH 1GL2A 3L71E 1L0LE 3L75E 5AVZB 1NU1D 1LT9C 1OFCX 3HD7B 1FOSF 2IX7C 4UB8H 1SQPE 3WUVA 2E76D 3CX5E 1RHZB 1FS0E 3CCSP 4QMAA 1E5WA 2E75C 3HUSC 2QRXA 1RE4A 2E42A 2FYUK 2KLVA 3RGUA 2N9YB 2SPZA 3TYYA 1FDOA 2Y9YA 2KSJA 1URQC 2A45I 3TGUD 2K88A 4YXWH 2QJYB 1PGOA 2E74B 3RBXA 1IFJA 1GW4A 4C7NB 2WPRA 3PHLA 1CW5A 3ABVC 1KN7A 4WBAA 1KV4A 1QVGO 1KFMA 1S5LE 1FE6A 1P84D 2QVAA 2UWJE 2I8DA 1AQTA 1ZV8A 2J59M 2WPVB 1S9KD 3AE4C 1OVUA 1USDA 1A02F 1QGKB 1A02J 1HGVA 2O01N 1IC2A 3O6QB 4OWFA 4WB4A 1IFPA 3L74J 3TNUA 1FC2C 3JC22 3ITKA 4I1LA 1HF9A 1YJ9P 4UB6H 1GK6A 5KLVJ 1LJ2A 3BCCG 3H1HJ 3HUSA 4IOIH 3RL0g 1JOCA 1LP1A 3L35A 1IFDA 1J2JB 3A0BE 1NU1G 1RF1B 1GL2D 1NTMD 1VQMP 1IFIA 1SQPK 2Q3IA 3BVHA 1IO4A 3B71A 2M0BA 1RH5B 2Y9ZA 4U3FD 2L91A 2YMKA 4RKUJ 4L75A 1NTKE 4HJGH 4EIJA 4PJ0H 3OW2O 2JP3A 2P1JA 5DJTB 3L72G 2ZAEB 2FYUJ 3H1LJ 4I7ZB 4H44B 3TGUG 1SQVG 1ZR2A 4W7YA 2YXQB 3P7KA 3WU2E 1VPCA 1RE3A 4AUWA 4RESB 1YITP 3H1KE 3D6ZA 1KYOE 4HH2A 1JTHB 2C9NY 3Q3DA 3WUTA 1X22A 2QM7A 1PPJD 3FWNA 1N86A 1N73C 3C8VA 3AEGC 3CXHI 1LWUC 4H0LC 1QEXA 1NYHA 3LIEA 3IAOA 3G6EP 2JJLA 3S4RA 3M91A 1QLED 3G9RA 3A0HE 3CXHD 5AW5B 2WT7A 2R44A 2Q9IA 3HE4A 3MGNA 1M1JC 2CPSA 1SQBG 2FFDB 3USSA 4D6TD 2E75D 3HD7C 3L73E 2ZT9C 3CMEP 3MD0A 5KKZB 3VTPC 1NTMG 2WSEH 3H1JE 2WITA 3VN0A 5E79E 3L4FA 1T8ZA 2IBZD 3RBZA 3L71J 2IDBA 3I5CA 1JY2P 5C39A 3L75J 2H89C 2K1AA 2XU6A 2ZVOB 5KAIE 1Y8AA 1NVOA 3RL0B 2KZIA 2YKOA 2AXCA 2PFXA 4JF7A 2K37A 1NTKK 5AVWB 1SQQE 2YXRB 1JY2O 3VMAA 3SFEC 3CL3D 4UB8E 3H32B 5B5EH 1N73A 5KLVD 2YIUB 1LWUA 3H1HD 1AVYA 1DD3A 1PP9E 1YTZT 3WUUA 1OMIA 4TLFA 4BXLA 1L0ND 2G8YA 2KZJA 4NPDA 2OYIB 5AVRB 2HPCB 2GM4A 1M1JA 4H13D 4BRYB 4HB1A 1L2PA 5KJ7C 1USEA 3N4XA 2A06D 1KQGB 4OGQC 1M90Q 5TJHA 1S1CX 2N1TC 3B8EB 3AEFC 1CI6A 3VP9A 3CC4P 1KC8Q 2IZ0A 4O9BA 3D71A 1VQ6P 3AE3C 3GW6A 1VQ8P 5APTA 2FYUD 2PAJA 3H1LD 2LXCB 1EZVD 1JY3O 2KIKA 4K35A 1FZGA 2XKMA 4N78E 5AVXB 5K5GB 2O01J 3AEAC 3P8MC 1SLQA 2WSCJ 3NTNA 4WY4B 1SQXK 2RKLA 5AW3B 3FWLA 1FZBA 1BSHA 2WTYA 3PJSK 1LTSC 1K8AQ 2OTJP 1DEBA 3SWYA 1PGJA 4UB6E 1P84H 2IBZG 1VDFA 1KD1Q 3RK3E 5CCHC 1VF5B 2MKVA 2NPSB 2KUBA 2DW3A 4I7ZC 3L74G 3OA7A 2QSIA 2WSFH 4XA4A 3H1ID 5KJ7A 1SQQK 4Y99B 1ZRTE 5GTIH 1NGMB 3KDPB 1KILE 1ZXGA 3L70E 5KLVG 1NHLA 3G4SP 3H1HG 2HFED 2OYHB 1UIXA 2CPBA 3HRNA 5BVZA 1BE3E 2KLUA 1M57D 3V5BA 5APXA 5CBNA 4H0LD 2FYZA 1NWQA 4C46A 4PJ0E 3AECC 4A7PA 4PD4D 1GDTA 4RJTA 3PH0A 3L71D 1IFMA 3L75D 4ASWA 5EFWB 1SQPD 3H1KJ 1LTTC 3M0DC 4ZNCA 5AVVB 3CX5D 5APYA 2B87A 1NTZE 3IR9A 1GZLA 1BCCE 3M06A 1JM0A 4I2LC 2OYOA 2W90A 3H1LG 4OH8B 1BGYG 2JDIH 1EZVG 2FYNB 3C1LA 1N7SA 1FZCA 5CCHA 2KK7A 1KTMA 3PRJA 3T97A 4U3FJ 4IL6H 4EYYQ 2B89A 3O8ZA 2QJKC 3GG2A 2H8PD 4PV1C 2E5TA 2WMMA 1QX8A 3VMYA 1SQXJ 2FXPA 1X0TA 2WPSA 1Q2NA 1M56D 1KB9D
chains in the Genus database with same CATH topology
1EDJA 2R44A 3FXEA 4JBZA 3RGUA 1EDLA 1DEEG 1S3JA 1H0TB 5CBNA 2SPZA 3ZDMA 4K3AA 2M0BA 4NPFX 4ASVA 3MHVA 5CBOA 1OVRA 4GODA 1EDKA 3PH0A 2JWDA 2LXCB 4HJGH 2HR3A 2KIKA 4WWIA 4K35A 2LXBA 1SS1A 3S1KA 5K5GB 1LT1A 4ASWA 1LP1B 5DJTB 4HKZH 5DJUB 5EFWB 2OTKE 2QVAA 1ZW0A 4MN4C 2UWJE 2ZAEB 4ZNCA 1EC5A 2LR2A 2I8DA 2M5AA 5C39A 2RKLA 1JMBA 2B87A 1U7JA 1BDCA 1BDDA 2B88A 1OVUA 4NPEA 1JM0A 4GOFA 1NVOA 4GOEA 2KZIA 2KS1B 1Y47A 2P58A 3MZWB 1H0TA 4CPGA 2Q1KA 2B87B 4EYYQ 2B89A 3QWOC 2K3RA 1FC2C 1OVVA 2KI7B 1U7MA 2KUBA 2WMMA 1EDIA 4BXLA 2M5AB 4IOIH 2KZJA 4NPDA 3FXDA 1LP1A 4ZMDA 1X0TA 1MFTA 1Q2NA 1ZXGA 4KJMA 2QRXA 4HB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDJ A;  2R44 A;  3FXE A;  4JBZ A;  3RGU A;  1EDL A;  1DEE G;  1S3J A;  1H0T B;  5CBN A;  2SPZ A;  3ZDM A;  4K3A A;  2M0B A;  4NPF X;  4ASV A;  3MHV A;  5CBO A;  1OVR A;  4GOD A;  1EDK A;  3PH0 A;  2JWD A;  2LXC B;  4HJG H;  2HR3 A;  2KIK A;  4WWI A;  4K35 A;  2LXB A;  1SS1 A;  3S1K A;  5K5G B;  1LT1 A;  4ASW A;  1LP1 B;  5DJT B;  4HKZ H;  5DJU B;  5EFW B;  2OTK E;  2QVA A;  1ZW0 A;  4MN4 C;  2UWJ E;  2ZAE B;  4ZNC A;  1EC5 A;  2LR2 A;  2I8D A;  2M5A A;  5C39 A;  2RKL A;  1JMB A;  2B87 A;  1U7J A;  1BDC A;  1BDD A;  2B88 A;  1OVU A;  4NPE A;  1JM0 A;  4GOF A;  1NVO A;  4GOE A;  2KZI A;  2KS1 B;  1Y47 A;  2P58 A;  3MZW B;  1H0T A;  4CPG A;  2Q1K A;  2B87 B;  4EYY Q;  2B89 A;  3QWO C;  2K3R A;  1FC2 C;  1OVV A;  2KI7 B;  1U7M A;  2KUB A;  2WMM A;  1EDI A;  4BXL A;  2M5A B;  4IOI H;  2KZJ A;  4NPD A;  3FXD A;  1LP1 A;  4ZMD A;  1X0T A;  1MFT A;  1Q2N A;  1ZXG A;  4KJM A;  2QRX A;  4HB1 A; 
#chains in the Genus database with same CATH topology
 2RN0 A;  2VRS A;  1FJP A;  3H1J J;  1DEE G;  5BU8 B;  3ZDM A;  2E43 A;  3Q1M A;  2P10 A;  1LTJ C;  2AXT E;  1QL1 A;  3P8C E;  1VL2 A;  5KJ7 D;  2MJZ A;  3LW5 H;  1Q86 Q;  1J1D C;  3A7O A;  3V2R A;  2QEX P;  3W67 A;  4M3L A;  2D2C D;  3TSI A;  1N7L A;  1FZA A;  2Z4E A;  4GDO A;  3CWB J;  3B5N B;  4GOF A;  3AEE C;  2GUS A;  4D6T J;  3F89 A;  3L75 G;  4GKG A;  3S9O A;  2KNC A;  1AFO A;  2BEZ F;  3V4Q A;  3VP8 A;  1HBW A;  3BCC E;  3CCJ P;  1OW8 A;  3JCU H;  1EQ7 A;  1VQ5 P;  3GHG B;  4LGD E;  2ZXX A;  2K9J B;  1G2C B;  5CJ0 A;  1NTK D;  5AVY B;  3TK1 A;  2C0W A;  1LT9 A;  2E76 B;  4IL6 X;  3TF5 A;  1N7S D;  5CCH D;  1GD2 E;  3Q5S A;  3RK3 C;  4C7R A;  4B86 A;  1K9M Q;  2AEM A;  2KS1 A;  1VF5 C;  1KYO I;  5H2F H;  3CCU P;  1SFC C;  1FDM A;  2E5Y A;  2YO2 A;  1YIJ P;  2V7Q H;  3RK2 C;  3H1K D;  3L72 E;  5M1B A;  1L0L K;  1L0N J;  1KIL C;  1URQ A;  4WWI A;  3TGU E;  1W5C E;  1SQV E;  1HJB A;  2IYO A;  5AW6 B;  1IK7 A;  1S4X A;  1T3U A;  2O3J A;  4LLH A;  2B88 A;  2P7J A;  3NMD A;  1Q81 Q;  2V4H A;  1SVF A;  1S9K E;  3V2N A;  1LTA C;  1NH4 A;  1H0T A;  1JEK A;  2B87 B;  1VQL P;  1N8R Q;  5AW7 B;  3L70 J;  1HH0 A;  3IN6 A;  1L4A C;  1SQX D;  2Y0E A;  3P32 A;  2KI7 B;  4HYT B;  1N7S B;  1K05 A;  1FZC B;  4YTP C;  5GTI E;  3OJA B;  1YTZ I;  3VMZ A;  2R3C A;  3AEB C;  1NAF A;  2QG4 A;  2BCC J;  2M5A B;  2CK3 H;  3L36 A;  1YHQ P;  3H1J D;  2RH0 A;  1SQB E;  1BDC A;  4PV1 D;  1T3J A;  4BWN A;  3FXE A;  3Q5R A;  3N7N A;  3I56 P;  1J1E B;  1SFC A;  4ZKU A;  3CCM P;  2PP6 A;  2H88 C;  3V4W A;  1AQ5 A;  3CCV P;  1MZ9 A;  2HG5 D;  1GL2 B;  1NTM E;  1KIL A;  4ASV A;  1SQQ D;  4KT0 J;  3NXS A;  1EDK A;  2W6J H;  2XV5 A;  3CD6 P;  3E7K A;  3H1I J;  1KQL A;  2BEQ D;  1PP9 D;  1HWT C;  3CWB D;  3CCR P;  5KTB A;  1AVO A;  2XZR A;  4IL6 E;  3MUD C;  2W83 C;  1U57 A;  4PD4 H;  1R8E A;  1Q7Y Q;  1KFN A;  2J5U A;  2GA1 A;  1ZN5 A;  3K5B A;  3KPE A;  1URQ D;  1SQV K;  2QM8 A;  1L0L J;  3HE5 A;  2C0X A;  3CX5 H;  1ZP0 C;  3HTK A;  2Z5I A;  4U3F G;  3W68 A;  1U7M A;  2KNC B;  1SQP J;  2IFM A;  2HOD A;  1FOS E;  1GW3 A;  2AEF A;  2QJY C;  2FBW C;  5AVS B;  2E74 C;  5CCG C;  4Y28 J;  4N78 D;  1OW6 A;  5GTH H;  4EI2 A;  1EDJ A;  1SQX G;  2QJP B;  1KQF B;  1LGH B;  2G3A A;  1GTW A;  5AVU B;  1R5S A;  2FXO A;  1D7M A;  3TNU B;  3H1J G;  1Q82 Q;  2IYP A;  2WWW A;  2NZ2 A;  1Z56 A;  2E75 B;  1SQB K;  1KB9 H;  1PPJ G;  3HUS B;  3HD7 A;  3M9H A;  3S1K A;  1LT1 A;  1LP1 B;  2R5B A;  2BAS A;  4HKZ H;  5AW9 B;  4DZO A;  1JY3 P;  1SFC D;  1TU3 F;  2Q3E A;  1AV1 A;  3BCC J;  3RK2 D;  1URQ B;  1N2D C;  1ZR4 A;  1DIP A;  2O01 H;  1ZRT D;  2KXP B;  3VYI A;  1KIL D;  3L70 D;  2IBZ E;  1PL5 A;  1Y47 A;  3E1I A;  1M7L A;  2WSC H;  3JCU E;  3CWB G;  2Q7C A;  1OXZ A;  1CZQ A;  1FAV A;  4D6T G;  5L8R J;  1RF1 C;  4DT0 A;  2YKQ A;  1K73 Q;  3L74 E;  2BCC D;  5AW4 B;  5CJ4 A;  4XFJ A;  5AW2 B;  5CCG A;  5KLV E;  3WMM 0;  4C7N A;  1VQ7 P;  3H1H E;  1FBM A;  4L74 A;  2A45 H;  2W8Z A;  1VQP P;  2Z5H A;  2R3S A;  3A3Y B;  5H2F E;  1E79 H;  3L72 J;  1OW7 A;  4H13 B;  2JKV A;  4AYC A;  1GU5 A;  1LTB C;  2H43 A;  4H44 C;  1RQU A;  4LC1 A;  2IPP A;  4I6M C;  1YQ4 C;  4NPF X;  2W6A A;  1VQ4 P;  3O6Q A;  1UII A;  2XND H;  2N1T A;  1NTK J;  1RF0 C;  2ZJS E;  2KYV A;  1FU1 A;  1AJY A;  4MN4 C;  1L0N G;  2LR2 A;  3PP5 A;  3H1L E;  2WT7 B;  1BGY E;  1EZV E;  3HE4 B;  2AEJ A;  3MTU E;  3SFD C;  1JO5 A;  1L0L D;  1RF1 A;  2A06 G;  3AE1 C;  2QIW A;  3F5H A;  1OWA A;  5TIS H;  1SQB J;  2KOG A;  3HD7 D;  4R4M A;  2HLO A;  2ZXE B;  4JQ0 D;  2ZT9 D;  4RO0 A;  3CLQ A;  1WMK A;  2FYU G;  5B66 H;  3L70 G;  3CPW O;  2FFD C;  3P8C D;  1JUN A;  1NJI Q;  2QE7 H;  5KKZ C;  4L73 A;  2BCC G;  2HOD B;  4IFF A;  2K9Y A;  2OGU A;  1LNQ A;  2KSE A;  4OVN F;  1S3J A;  3L37 A;  5APW A;  3H25 A;  1N73 B;  1DH3 A;  5AVQ B;  3I55 P;  1T6A A;  2E74 D;  2WZ7 A;  1LWU B;  5CCG D;  4H0L B;  3PLN A;  3BRV B;  1VQK P;  3L73 J;  1Q90 D;  1RF0 A;  3RL0 C;  1JY2 N;  1HGZ A;  5BU5 A;  3BCC D;  3CMA P;  2W6B A;  1Y9B A;  2JO1 A;  2YIU C;  4PD4 E;  3A5T A;  1M1J B;  2ZVN B;  3EFG A;  5AW1 B;  1KQS O;  1EC5 A;  3FGA D;  3H1I G;  1JMB A;  1H89 A;  2ZYA A;  3CXH H;  2RMZ A;  2OYI C;  1KZU B;  3M0D A;  1CI6 B;  2ZT9 B;  4OGQ D;  1SQQ J;  4N3Y B;  2POH A;  2N1T D;  1NOH A;  1HTL C;  3JSV C;  1X79 B;  2FFD A;  2K3R A;  1PV3 A;  1PP9 J;  3D70 A;  5B5E E;  1FDI A;  5GTH E;  5APQ A;  3L71 G;  1L0L G;  3KYQ A;  3L72 D;  3LW5 J;  1ZOY C;  1JY3 N;  1SQP G;  1MFT A;  1SQV D;  1P84 I;  3EQ2 A;  1NTZ K;  1MV8 A;  4JPZ B;  4WY4 C;  3R4Y A;  1KB9 E;  1NU1 E;  1VQO P;  1FZF A;  2WVR A;  2OQQ A;  3H32 A;  2KB7 P;  2OTL P;  3IFM A;  2JWD A;  3CC7 P;  1JB0 J;  4H44 D;  1LTJ A;  4EDF A;  3VOP A;  1ZW0 A;  4OGQ B;  1RE3 C;  4H13 C;  2N1T B;  2OYI A;  1NO4 A;  2NPS C;  1U7J A;  1BDD A;  2HPC A;  2D2C B;  4BRY A;  3E1R A;  3B4S A;  1SQB D;  3M9Q A;  1KYO D;  3VMX A;  3PTZ A;  2P58 A;  4Y99 C;  2Q1K A;  3KZI H;  2ZYD A;  4ZKP A;  2OYH C;  1G1J A;  1X9V A;  3M9B A;  5KLI B;  3G71 P;  1H8A A;  1P84 E;  3CI9 A;  1PIX A;  1LTG C;  2V7Q J;  2J58 A;  1EDI A;  2LKM A;  2Q5U A;  1JCC A;  4ZMD A;  2FKW B;  4YPC A;  1R5L A;  4KJM A;  4GIF A;  3CCQ P;  3Q2Y A;  3C9I A;  4WY4 A;  1BE3 J;  3T97 B;  3L73 D;  1JCD A;  1OX3 A;  4K3A A;  2A45 G;  2XNX A;  3QH9 A;  1BGY J;  5APU A;  3GF3 A;  1CSB A;  4N6J A;  2FYN C;  1M8O B;  1HJ0 A;  3MIW A;  2NPS A;  1OZH A;  2OTK E;  1NTK G;  2M3B A;  1MUU A;  4U7J A;  3RL0 D;  1NTZ J;  1NU1 K;  1KOR A;  1BCC J;  2KP8 A;  2B9B A;  1MKM A;  5TIS E;  2M3E A;  1NKZ B;  4GOE A;  1GMJ A;  2OYH A;  1NAY A;  3TDK A;  3MZW B;  4U3F E;  5KAF H;  3AE5 C;  5B66 E;  3SWK A;  3AE8 C;  3QWO C;  5AW0 B;  1GU4 A;  4YXD C;  4XE5 B;  1XTG B;  1OVV A;  1VQ9 P;  3G3Z A;  1ZLL A;  3H1K G;  1IJD B;  1QVF O;  1L4A A;  1SQX E;  2O1K A;  2I1J A;  3GLM A;  2IBZ I;  3V2P A;  2QJK B;  3SWF A;  1IZN B;  4JBZ A;  1VQN P;  1T2K C;  3D6Y A;  1KMI Z;  1XTC C;  4AQR D;  4PV1 B;  2AXT H;  2YO3 A;  4L76 A;  2WSE J;  3AED C;  1MFZ A;  1PPJ E;  4W7Z A;  3CCE P;  3B5N C;  3MHV A;  1JNM A;  1OVR A;  1SP4 A;  5APS A;  4Z1M H;  2ZFC A;  1GK4 A;  3M0A A;  2HR3 A;  3L74 D;  2ITA A;  3AE7 C;  3L73 G;  1SS1 A;  1LT9 B;  1PZQ A;  4WY4 D;  2N9B A;  3BRT B;  3CXH E;  3AE2 C;  1WT6 A;  3GHG C;  4R4L A;  2O1J A;  3GF7 A;  1YQ3 C;  1RQV A;  3KQG A;  1HUC A;  3CWB E;  2PGD A;  2XDJ A;  4NPE A;  1S5L H;  1DD4 A;  1LTJ B;  3RK3 D;  3U1A A;  2KS1 B;  4D6T E;  3CCL P;  2E76 C;  2HYN A;  1YBK A;  2Q6Q A;  2PRR A;  1YYC A;  2WPQ A;  1S72 P;  2R5D A;  4IFM A;  1VF5 D;  4CPG A;  1J1D B;  2H7H A;  3MUD A;  3EFF K;  1WRG A;  1IK9 A;  4TT3 H;  2YNY A;  2NPS D;  1H88 A;  4KHX A;  2QA4 P;  1SQQ G;  3FX0 A;  1NTM K;  2I1K A;  1W2B O;  3V6I A;  1OIP A;  2P2U A;  3V2Q A;  2P67 A;  1LTI C;  2WSS H;  3A2A A;  1PP9 G;  1EZV I;  1NU1 J;  2IZ1 A;  3NFQ A;  2D2C C;  1BE3 D;  3OAK A;  1W2E A;  4JYC A;  2IFN A;  1PGQ A;  4GT1 A;  2JWA A;  3MP7 B;  3Q5P A;  2L5G B;  5AW8 B;  5AVT B;  3LID A;  3SSU A;  1BGY D;  2W27 A;  3II6 A;  2FY8 A;  1H0T B;  4IFD K;  3B5N A;  1AA0 A;  3KXD A;  4W80 A;  3A0B H;  3GMA A;  1FZE A;  5KLI C;  1S2E A;  2R32 A;  5CBO A;  1L4A D;  1PGP A;  2YMY A;  4GOD A;  4WVZ A;  1YI2 P;  1EXI A;  1L0N E;  1RY3 A;  3TGU J;  2LXB A;  1NTZ D;  3GHG A;  1SQV J;  1BCC D;  3IF4 A;  3CC2 P;  3RK3 B;  2K9J A;  1G2C A;  3AE6 C;  3KHU A;  4DJG A;  1N7S C;  1FZC C;  1DX7 A;  1FJK A;  2A06 E;  1SFC B;  3KZI E;  1BSN A;  2Y0C A;  3BAS A;  3RK2 B;  1JMM A;  3R2P A;  1KIL B;  1M1K Q;  2FYU E;  2FXM A;  1J1E C;  3WU2 H;  2WSF J;  1ZME C;  3BAT A;  1GL2 C;  2OAR A;  4PD4 I;  1S5L X;  1KYO H;  2BCC E;  3FXD A;  1QL2 A;  2GUV A;  3CX5 I;  4DOJ A;  1K04 A;  1L4A B;  1EDL A;  1X8Y A;  3UIA A;  2JEE A;  1RE4 C;  3A0H H;  3HE5 B;  1EXJ A;  5CMZ A;  1PFI A;  3HTK B;  1BE3 G;  1NTM J;  2ZYG A;  1T2K D;  1YJW P;  2C9L Y;  2JR8 A;  3H1I E;  2NRG A;  3U59 A;  4DCK A;  5DJU B;  1G1I A;  1HVV A;  4EOT A;  4JYB A;  5KLV K;  3U1C A;  2M5A A;  3B5N D;  1YJN P;  5CHX A;  3H6P A;  5E79 H;  5KAF E;  5APV A;  1JTH A;  1NKN A;  1KB9 I;  3AE9 C;  2M8R A;  2WQY C;  1L0N K;  1NTZ G;  2YKP A;  1BCC G;  2Y0D A;  3EWK A;  1IFN A;  2QJP C;  5KAI H;  1GL2 A;  3L71 E;  1L0L E;  3L75 E;  5AVZ B;  1NU1 D;  1LT9 C;  1OFC X;  3HD7 B;  1FOS F;  2IX7 C;  4UB8 H;  1SQP E;  3WUV A;  2E76 D;  3CX5 E;  1RHZ B;  1FS0 E;  3CCS P;  4QMA A;  1E5W A;  2E75 C;  3HUS C;  2QRX A;  1RE4 A;  2E42 A;  2FYU K;  2KLV A;  3RGU A;  2N9Y B;  2SPZ A;  3TYY A;  1FDO A;  2Y9Y A;  2KSJ A;  1URQ C;  2A45 I;  3TGU D;  2K88 A;  4YXW H;  2QJY B;  1PGO A;  2E74 B;  3RBX A;  1IFJ A;  1GW4 A;  4C7N B;  2WPR A;  3PHL A;  1CW5 A;  3ABV C;  1KN7 A;  4WBA A;  1KV4 A;  1QVG O;  1KFM A;  1S5L E;  1FE6 A;  1P84 D;  2QVA A;  2UWJ E;  2I8D A;  1AQT A;  1ZV8 A;  2J59 M;  2WPV B;  1S9K D;  3AE4 C;  1OVU A;  1USD A;  1A02 F;  1QGK B;  1A02 J;  1HGV A;  2O01 N;  1IC2 A;  3O6Q B;  4OWF A;  4WB4 A;  1IFP A;  3L74 J;  3TNU A;  1FC2 C;  3JC2 2;  3ITK A;  4I1L A;  1HF9 A;  1YJ9 P;  4UB6 H;  1GK6 A;  5KLV J;  1LJ2 A;  3BCC G;  3H1H J;  3HUS A;  4IOI H;  3RL0 g;  1JOC A;  1LP1 A;  3L35 A;  1IFD A;  1J2J B;  3A0B E;  1NU1 G;  1RF1 B;  1GL2 D;  1NTM D;  1VQM P;  1IFI A;  1SQP K;  2Q3I A;  3BVH A;  1IO4 A;  3B71 A;  2M0B A;  1RH5 B;  2Y9Z A;  4U3F D;  2L91 A;  2YMK A;  4RKU J;  4L75 A;  1NTK E;  4HJG H;  4EIJ A;  4PJ0 H;  3OW2 O;  2JP3 A;  2P1J A;  5DJT B;  3L72 G;  2ZAE B;  2FYU J;  3H1L J;  4I7Z B;  4H44 B;  3TGU G;  1SQV G;  1ZR2 A;  4W7Y A;  2YXQ B;  3P7K A;  3WU2 E;  1VPC A;  1RE3 A;  4AUW A;  4RES B;  1YIT P;  3H1K E;  3D6Z A;  1KYO E;  4HH2 A;  1JTH B;  2C9N Y;  3Q3D A;  3WUT A;  1X22 A;  2QM7 A;  1PPJ D;  3FWN A;  1N86 A;  1N73 C;  3C8V A;  3AEG C;  3CXH I;  1LWU C;  4H0L C;  1QEX A;  1NYH A;  3LIE A;  3IAO A;  3G6E P;  2JJL A;  3S4R A;  3M91 A;  1QLE D;  3G9R A;  3A0H E;  3CXH D;  5AW5 B;  2WT7 A;  2R44 A;  2Q9I A;  3HE4 A;  3MGN A;  1M1J C;  2CPS A;  1SQB G;  2FFD B;  3USS A;  4D6T D;  2E75 D;  3HD7 C;  3L73 E;  2ZT9 C;  3CME P;  3MD0 A;  5KKZ B;  3VTP C;  1NTM G;  2WSE H;  3H1J E;  2WIT A;  3VN0 A;  5E79 E;  3L4F A;  1T8Z A;  2IBZ D;  3RBZ A;  3L71 J;  2IDB A;  3I5C A;  1JY2 P;  5C39 A;  3L75 J;  2H89 C;  2K1A A;  2XU6 A;  2ZVO B;  5KAI E;  1Y8A A;  1NVO A;  3RL0 B;  2KZI A;  2YKO A;  2AXC A;  2PFX A;  4JF7 A;  2K37 A;  1NTK K;  5AVW B;  1SQQ E;  2YXR B;  1JY2 O;  3VMA A;  3SFE C;  3CL3 D;  4UB8 E;  3H32 B;  5B5E H;  1N73 A;  5KLV D;  2YIU B;  1LWU A;  3H1H D;  1AVY A;  1DD3 A;  1PP9 E;  1YTZ T;  3WUU A;  1OMI A;  4TLF A;  4BXL A;  1L0N D;  2G8Y A;  2KZJ A;  4NPD A;  2OYI B;  5AVR B;  2HPC B;  2GM4 A;  1M1J A;  4H13 D;  4BRY B;  4HB1 A;  1L2P A;  5KJ7 C;  1USE A;  3N4X A;  2A06 D;  1KQG B;  4OGQ C;  1M90 Q;  5TJH A;  1S1C X;  2N1T C;  3B8E B;  3AEF C;  1CI6 A;  3VP9 A;  3CC4 P;  1KC8 Q;  2IZ0 A;  4O9B A;  3D71 A;  1VQ6 P;  3AE3 C;  3GW6 A;  1VQ8 P;  5APT A;  2FYU D;  2PAJ A;  3H1L D;  2LXC B;  1EZV D;  1JY3 O;  2KIK A;  4K35 A;  1FZG A;  2XKM A;  4N78 E;  5AVX B;  5K5G B;  2O01 J;  3AEA C;  3P8M C;  1SLQ A;  2WSC J;  3NTN A;  4WY4 B;  1SQX K;  2RKL A;  5AW3 B;  3FWL A;  1FZB A;  1BSH A;  2WTY A;  3PJS K;  1LTS C;  1K8A Q;  2OTJ P;  1DEB A;  3SWY A;  1PGJ A;  4UB6 E;  1P84 H;  2IBZ G;  1VDF A;  1KD1 Q;  3RK3 E;  5CCH C;  1VF5 B;  2MKV A;  2NPS B;  2KUB A;  2DW3 A;  4I7Z C;  3L74 G;  3OA7 A;  2QSI A;  2WSF H;  4XA4 A;  3H1I D;  5KJ7 A;  1SQQ K;  4Y99 B;  1ZRT E;  5GTI H;  1NGM B;  3KDP B;  1KIL E;  1ZXG A;  3L70 E;  5KLV G;  1NHL A;  3G4S P;  3H1H G;  2HFE D;  2OYH B;  1UIX A;  2CPB A;  3HRN A;  5BVZ A;  1BE3 E;  2KLU A;  1M57 D;  3V5B A;  5APX A;  5CBN A;  4H0L D;  2FYZ A;  1NWQ A;  4C46 A;  4PJ0 E;  3AEC C;  4A7P A;  4PD4 D;  1GDT A;  4RJT A;  3PH0 A;  3L71 D;  1IFM A;  3L75 D;  4ASW A;  5EFW B;  1SQP D;  3H1K J;  1LTT C;  3M0D C;  4ZNC A;  5AVV B;  3CX5 D;  5APY A;  2B87 A;  1NTZ E;  3IR9 A;  1GZL A;  1BCC E;  3M06 A;  1JM0 A;  4I2L C;  2OYO A;  2W90 A;  3H1L G;  4OH8 B;  1BGY G;  2JDI H;  1EZV G;  2FYN B;  3C1L A;  1N7S A;  1FZC A;  5CCH A;  2KK7 A;  1KTM A;  3PRJ A;  3T97 A;  4U3F J;  4IL6 H;  4EYY Q;  2B89 A;  3O8Z A;  2QJK C;  3GG2 A;  2H8P D;  4PV1 C;  2E5T A;  2WMM A;  1QX8 A;  3VMY A;  1SQX J;  2FXP A;  1X0T A;  2WPS A;  1Q2N A;  1M56 D;  1KB9 D; 
#chains in the Genus database with same CATH homology
 1EDJ A;  2R44 A;  3FXE A;  4JBZ A;  3RGU A;  1EDL A;  1DEE G;  1S3J A;  1H0T B;  5CBN A;  2SPZ A;  3ZDM A;  4K3A A;  2M0B A;  4NPF X;  4ASV A;  3MHV A;  5CBO A;  1OVR A;  4GOD A;  1EDK A;  3PH0 A;  2JWD A;  2LXC B;  4HJG H;  2HR3 A;  2KIK A;  4WWI A;  4K35 A;  2LXB A;  1SS1 A;  3S1K A;  5K5G B;  1LT1 A;  4ASW A;  1LP1 B;  5DJT B;  4HKZ H;  5DJU B;  5EFW B;  2OTK E;  2QVA A;  1ZW0 A;  4MN4 C;  2UWJ E;  2ZAE B;  4ZNC A;  1EC5 A;  2LR2 A;  2I8D A;  2M5A A;  5C39 A;  2RKL A;  1JMB A;  2B87 A;  1U7J A;  1BDC A;  1BDD A;  2B88 A;  1OVU A;  4NPE A;  1JM0 A;  4GOF A;  1NVO A;  4GOE A;  2KZI A;  2KS1 B;  1Y47 A;  2P58 A;  3MZW B;  1H0T A;  4CPG A;  2Q1K A;  2B87 B;  4EYY Q;  2B89 A;  3QWO C;  2K3R A;  1FC2 C;  1OVV A;  2KI7 B;  1U7M A;  2KUB A;  2WMM A;  1EDI A;  4BXL A;  2M5A B;  4IOI H;  2KZJ A;  4NPD A;  3FXD A;  1LP1 A;  4ZMD A;  1X0T A;  1MFT A;  1Q2N A;  1ZXG A;  4KJM A;  2QRX A;  4HB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...