1NOHA

The structure of bacteriophage phi29 scaffolding protein gp7 after prohead assembly
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
73
structure length
73
Chain Sequence
PLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKSHEKLAAEKDDLIVSNSKLFRQIGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAD MORPHOGENESIS PROTEIN
publication title Bacteriophage f29 scaffolding protein gp7 before and after prohead assembly
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Viral protein
total genus 30
structure length 73
sequence length 73
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11418 Scaffolding_pro Phi29 scaffolding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.400 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nohA00
1NO4A 3OA7A 3MTUE 1NOHA 4IFFA
chains in the Genus database with same CATH superfamily
1ZW0A 2KB7P 4I2LC 2HPCA 3K5BA 1PV3A 1S3JA 3BCCE 2C0XA 2WZ7A 3FGAD 2Z5IA 2WWWA 4L74A 3L75E 3AECC 2FY8A 2YKPA 1L0LD 1NTMJ 2J5UA 5CCHA 4RESB 3L73E 4EIJA 1PP9D 2K3RA 1RF1C 3V6IA 3AEDC 4UB8E 3P7KA 3M9BA 3AEGC 4PD4I 4Y28J 1KILC 1SFCC 1HWTC 1Q90D 2QEXP 5KJ7A 3CCEP 3M0DC 3UIAA 4ZMDA 1ZN5A 1LGHB 3LW5J 1KC8Q 5KTBA 2W90A 4PV1B 4XA4A 1NU1G 2MJZA 1NYHA 1SQXJ 2SPZA 4ASVA 1K04A 2G3AA 2N1TD 3D70A 4DCKA 1K73Q 3IF4A 4U7JA 2B9BA 1SQPJ 2B89A 4IL6E 1S5LH 3VP9A 3GF7A 5B5EE 1EZVD 3L74J 2BCCJ 4U3FE 2WSFJ 3H1IJ 2ZYDA 1LP1A 2OTKE 2AXTH 1IFMA 1HGVA 2QJKB 2ZVOB 1YJ9P 1BGYG 4KHXA 1L0NJ 3D6YA 4JYBA 5AW2B 1P84H 5CCGC 1SQQE 3FXDA 1DX7A 3TGUJ 4H0LC 1GU5A 2H8PD 3L35A 5KAFE 1JMBA 1OXZA 4ASWA 2IZ1A 2W8ZA 1J1DB 3CX5I 3L72D 3AE2C 1FDMA 2P67A 2Q3EA 3I5CA 3F89A 4N78E 3Q3DA 3S9OA 3H1HG 2NZ2A 2V4HA 3OA7A 2QRXA 3Q5SA 2FYUG 2B88A 1VQPP 1YI2P 4BWNA 1NU1J 2QE7H 1BCCE 1T2KC 2FYUK 4NPFX 2LKMA 2QM8A 3GMAA 3O8ZA 1G1JA 1JB0J 1LTJB 1NTZE 3A2AA 2L91A 2L5GB 2GUSA 2YIUB 3AEBC 1Q2NA 1FC2C 2KNCA 3B5NC 1JY3N 2WTYA 1L0LK 5CCHD 3I55P 1BGYJ 3KDPB 1FZCC 1VF5D 1ZRTE 1SQBE 2WSCH 3RK3E 2O1KA 4OGQC 2GUVA 3HD7A 3H1KG 1JTHB 1YJWP 1CZQA 1PPJD 1AV1A 1KTMA 1KORA 1N7SD 1FZAA 3B8EB 5KJ7D 5AVVB 5M1BA 1FDIA 1K9MQ 1A02J 1LTTC 3AE5C 3H1HJ 2ZT9D 4GIFA 4ZNCA 4WY4A 1BDDA 3RK2D 3II6A 2OYIA 1FS0E 4D6TE 3A3YB 3RBZA 1IO4A 4OVNF 2OTLP 2XZRA 3F5HA 3BVHA 1EDKA 2QJPC 1Y8AA 2KUBA 2E5YA 3N4XA 2RKLA 3AE7C 1S1CX 4KT0J 3SWFA 2M3BA 4OWFA 1NTMD 1RE4C 3TYYA 5CJ4A 1G1IA 1FZBA 3G9RA 1VQ4P 1G2CA 1MZ9A 1KYOE 5EFWB 1GL2A 2JKVA 2FFDB 2E5TA 1PIXA 1M1JB 2FYNB 3RBXA 3H1KJ 1PP9E 5GTIH 2JO1A 3G3ZA 5KLVG 1SQVG 3EWKA 2A06G 1NVOA 3U1CA 1IFPA 1SQXD 3GF3A 4H13B 3G4SP 1JOCA 1EDJA 3AE6C 1EQ7A 5KLIC 1HVVA 1IFIA 3IFMA 2O01N 1J2JB 1Y47A 1QL1A 1RQVA 1SQPD 1SS1A 4YXWH 3IN6A 3L74D 1RHZB 2BCCD 1GDTA 3H1ID 2Z4EA 2E76B 3R4YA 1KQSO 3MZWB 3TNUB 3B71A 4H44B 2NPSC 1VL2A 2M5AA 2XNXA 1XTCC 1L0ND 1Q82Q 3H1JJ 1IK7A 2A45I 4AQRD 3TGUD 1CI6B 4GODA 3QWOC 3VMAA 1EXJA 1X0TA 3M06A 2IPPA 1VQ9P 5BU5A 1SFCD 2M3EA 4W7YA 3L71E 2BEQD 1IFJA 2O1JA 1AVOA 4Z1MH 3H1LG 3EQ2A 1Z56A 3L72E 1VPCA 3L70G 2WT7A 3I56P 1AQ5A 2N1TB 1FOSE 5KLVJ 5AVUB 4PV1C 1SQVJ 3FWLA 2A45G 1NU1D 1X79B 2D2CD 4QMAA 2K9JA 2OYHA 3R2PA 3VMYA 5APYA 1JEKA 4UB8H 4DOJA 2KS1A 5B66E 3USSA 1GK4A 1NTMG 3HRNA 1NWQA 1L4AB 2WPRA 5CCGD 2N9BA 4IFFA 1YITP 1URQA 1RE4A 4H0LD 5E79E 3WUVA 3WUTA 4WB4A 1NTMK 1H8AA 3HUSA 1Q7YQ 1BGYD 2MKVA 2E74B 1N73A 1VQLP 1MV8A 4IL6H 4GKGA 4A7PA 3CCMP 1SQXG 2KSEA 5B5EH 1NTKJ 3VOPA 1M1KQ 4I1LA 1J1DC 5AW1B 2E75D 2IFNA 4HYTB 1JNMA 1YIJP 4U3FG 1PPJE 1SQXK 3H1HD 4Y99B 1T2KD 3H1LJ 2R44A 2H7HA 3EFGA 3AE9C 1E5WA 3L70J 2R3SA 1M7LA 1YYCA 3VYIA 3W67A 2WSEH 1SQQG 2XV5A 1KB9E 1SQPK 1LWUA 4EOTA 3HE4B 1H0TA 1HH0A 5DJTB 2Y0CA 3VMZA 3CWBE 3V2QA 3TGUG 3WMM0 2ZFCA 1VQNP 2IX7C 3FXEA 2HPCB 3L73J 1W5CE 3CX5D 1NAFA 1L0NK 3CCLP 1RF0C 1LTJC 3CXHE 1LT1A 1XTGB 4BXLA 5CHXA 2W6AA 1YJNP 2YIUC 4OGQD 3FWNA 1VF5B 1TU3F 2R5DA 3D6ZA 2IZ0A 5AVWB 5CJ0A 1VQ8P 1FBMA 1X22A 2CPSA 3BRTB 3PHLA 2YXQB 2Q3IA 3V2NA 3GHGA 1N7SA 2PAJA 2W6JH 2ZJSE 2JP3A 3H1KD 4C7NA 2FKWB 3CCQP 3RGUA 3GLMA 1OIPA 3N7NA 1P84I 1NTZG 4U3FJ 2IBZI 1NU1K 5AVSB 3CLQA 4CPGA 1LTIC 1QGKB 2WSSH 5AVQB 3A5TA 4RO0A 1S9KD 3S1KA 5BVZA 4JF7A 3NMDA 2BEZF 1SQBG 2YNYA 3C1LA 1SQQJ 3H32A 1LP1B 1AVYA 3JC22 5APVA 4M3LA 1URQD 2O3JA 4BRYA 4ZKPA 2WSEJ 3L74E 1NHLA 3D71A 3H1JD 1HJ0A 2KYVA 3M9HA 3RK3C 1ZLLA 1A02F 1X8YA 3AE1C 2IBZG 2RH0A 1M8OB 1RE3A 1FZGA 2NRGA 2KIKA 4RJTA 4AYCA 2AEJA 3V2RA 1LTBC 2FFDC 1BCCJ 1M1JC 2FYNC 2WPSA 3KQGA 5C39A 2WMMA 2XKMA 3P8CD 1R5LA 5AVRB 5APSA 5KLVD 1SQVD 2A06D 4H13C 3CC7P 4MN4C 3JCUE 2AEFA 2YKOA 1NTZJ 1SP4A 3RL0D 1KYOH 2NPSD 3HE5A 2QJYB 1NU1E 1LT9C 3KXDA 1SLQA 2P10A 1SQBJ 2ZAEB 3WUUA 1RF1A 2E76C 2JDIH 4H44C 4WBAA 1AFOA 2KNCB 2AXCA 3IAOA 2KOGA 4ZKUA 1KILA 1SFCA 3E7KA 5K5GB 3CCJP 2YMYA 5KKZB 3M0DA 4PD4E 3HD7B 1YHQP 2QSIA 1IFNA 1NTKD 4IFDK 2JEEA 4HB1A 4L76A 3MGNA 4L75A 1BSHA 2KZJA 1S5LX 4D6TJ 4PV1D 1JMMA 3V4QA 3H1LD 3FX0A 1JM0A 4L73A 2JWDA 3L70D 2I1KA 4WY4B 4N3YB 2OYIB 2D2CB 2N1TC 1JO5A 4EYYQ 2ZVNB 1FZEA 2B87A 1UIIA 1BE3G 3OJAB 3H1JG 2WITA 2WVRA 5AW4B 5CCGA 2FYUE 1OX3A 2CK3H 1KQFB 5BU8B 4R4MA 1KFNA 1YQ3C 3L73D 2QA4P 2WPQA 1L4AC 4YTPC 3L71G 2PRRA 3MHVA 2XNDH 1GD2E 2FBWC 4DJGA 3MIWA 1FOSF 2WQYC 1J1EC 3CX5E 3MUDC 1PP9J 1L0LE 2HODA 2FXPA 1M57D 1G2CB 3P32A 2E74C 1GL2B 5B66H 2WSCJ 2YMKA 2YKQA 2E75B 3S4RA 4LGDE 1JY2N 2P2UA 5E79H 2J58A 2KLUA 1PGJA 2Q5UA 2E43A 4YPCA 1PGOA 1GK6A 5KLVK 1SQVK 4U3FD 1VQ5P 1OW6A 4Y99C 3RL0g 1VQ6P 1JY3P 4XE5B 4TT3H 1U7JA 5GTHE 1LT9A 2OGUA 3MP7B 3BASA 3B5NA 5APTA 1KB9I 1SQQD 1BE3J 1ZOYC 1EZVE 1FU1A 2LR2A 1FZCA 5CBOA 1IK9A 2OYOA 3M0AA 1RH5B 2M5AB 3ZDMA 1ZMEC 3G71P 4GT1A 3A0BH 4HJGH 5AW7B 3OW2O 1NTKG 1QLED 1NH4A 4OGQB 2P7JA 5AVYB 3L71J 1KILD 1OVUA 4N78D 1PGPA 2VRSA 5APXA 4JYCA 2C9LY 5CCHC 2Y9ZA 2QM7A 1VF5C 1KB9H 1JCDA 2J59M 5AVXB 3L72J 4I7ZB 3AE3C 1NTKK 1LTAC 1KZUB 1Y9BA 4UB6E 2JWAA 3GW6A 1KFMA 3LIDA 1QX8A 1LJ2A 1OVRA 4OH8B 1BCCD 4LLHA 1AA0A 3C8VA 2K37A 3CWBG 3BCCG 3CXHH 2WT7B 3L75G 1WMKA 1ZXGA 3VMXA 3TF5A 1H89A 4NPDA 1MFTA 2E42A 5APQA 1CW5A 1T3JA 2K9JB 3L73G 2OYHB 1YTZT 3CCUP 1DD3A 2I8DA 1NTZD 1OWAA 3P8CE 4HH2A 2KS1B 2OARA 3MTUE 1WT6A 5H2FE 1NJIQ 2A06E 1S72P 1NKNA 4XFJA 3Q5RA 3G6EP 3PRJA 3T97A 2QJKC 1ZRTD 1SQBD 1URQB 3RK3D 3PP5A 3Q2YA 1KV4A 3Q5PA 3KZIE 3HUSB 1EXIA 2O01H 3SFEC 4GOEA 2LXBA 3LW5H 3H25A 1P84D 4GDOA 1JY2P 1N73B 4O9BA 3VP8A 2IBZD 3NXSA 1DIPA 5CBNA 3CCRP 3OAKA 1QVFO 1T3UA 4DT0A 3A0BE 4D6TD 5KLIB 3O6QA 2G8YA 1QVGO 1UIXA 2WSFH 3TDKA 4EDFA 4K35A 1HTLC 3CWBJ 3BCCJ 4YXDC 3L75J 3SWKA 2HLOA 4EI2A 2NPSA 2KXPB 2KSJA 1LWUB 1JCCA 3RL0B 4K3AA 1H0TB 3M91A 3B5ND 1SQQK 5KAIE 2QG4A 2DW3A 4H44D 2K88A 3TK1A 2QJYC 1KD1Q 3PLNA 3ITKA 1L2PA 3SFDC 2QIWA 1FJPA 3L36A 1KYOD 1HBWA 3EFFK 3NFQA 3JCUH 1NTME 2P58A 5TISE 1BCCG 1CSBA 3BRVB 3GHGB 4AUWA 3V2PA 1N7SB 2R3CA 1X9VA 2JJLA 5KKZC 3WU2E 1FDOA 1ZR2A 5L8RJ 1RY3A 2K1AA 3HD7C 2FYZA 2IYPA 3A0HE 1N8RQ 2P1JA 1USEA 1KQGB 1HJBA 2O01J 2RMZA 4C7NB 3CL3D 2Q7CA 2ZT9B 4DZOA 4B86A 3E1IA 3RK2B 3AE8C 4WWIA 3CCSP 1LNQA 1Q81Q 1SQXE 1ZP0C 1S4XA 2WPVB 4KJMA 3AEEC 1NTZK 4PD4H 4JQ0D 4WY4C 3V5BA 2OYIC 2D2CC 5AW5B 1JY3O 1SQPE 3C9IA 3H32B 1IZNB 1L4AD 1BE3D 4IL6X 2BCCE 1SQBK 2R32A 3H1IE 4BRYB 3V4WA 2KZIA 1OMIA 1L0NE 4W7ZA 3U59A 2Q1KA 1GMJA 2E74D 3L71D 1NOHA 3TGUE 1DEBA 3W68A 4PJ0H 4D6TG 2Q9IA 2KI7B 3CC4P 1EDLA 2M0BA 1KYOI 5AVTB 5AW3B 2W83C 1KILE 1ZR4A 2QVAA 1LTSC 3NTNA 1GL2C 1FZFA 1GTWA 3VTPC 2BASA 3CCVP 1NKZB 1QL2A 2E75C 3CX5H 3PJSK 2Y0EA 4HKZH 1RQUA 1R8EA 2ZYAA 1GZLA 2ZXXA 2IDBA 1YTZI 1IJDB 1AQTA 1K8AQ 4C46A 1RF0A 1LTJA 1T6AA 1KQLA 3HE5B 2IFMA 1L0LG 4W80A 1E79H 1W2EA 2XU6A 2PP6A 3E1RA 1NGMB 3BATA 1PP9G 1VDFA 5AVZB 1RF1B 4R4LA 2ZXEB 3AEFC 1EZVI 3B4SA 2POHA 1OFCX 1PL5A 1FJKA 3A7OA 5AW9B 1JTHA 1KILB 1SFCB 2YXRB 1WRGA 1S5LE 1BGYE 3CPWO 5GTHH 3P8MC 2AXTE 1IC2A 1KN7A 2CPBA 1N86A 1JY2O 4I7ZC 1PGQA 4IOIH 1P84E 1R5SA 3CI9A 1NO4A 2N9YB 2IBZE 1VQMP 1VQOP 1KB9D 4LC1A 1EZVG 3PH0A 2GM4A 1YQ4C 1PFIA 3Q1MA 4PJ0E 3H1HE 2FYUJ 1MKMA 2Y0DA 3CWBD 3BCCD 2GA1A 2W6BA 3L75D 1H88A 2H43A 3VN0A 2B87B 3SSUA 3SWYA 2OYHC 1N7LA 3CMAP 2PFXA 3CXHD 4UB6H 3AEAC 3KPEA 4H0LB 4JBZA 1D7MA 2M8RA 1L0LJ 1GU4A 3RK3B 1HUCA 2FXMA 3L72G 2HR3A 2PGDA 1URQC 3HTKA 2Y9YA 1MFZA 3CC2P 2HODB 4IFMA 2Z5HA 3HUSC 2FFDA 1OW7A 1YBKA 2C0WA 2H89C 3HTKB 1M1JA 1OVVA 5H2FH 1DD4A 1U57A 2IYOA 1N73C 1N2DC 2R5BA 2FXOA 3H1KE 2YO2A 2LXCB 4NPEA 1IFDA 3KZIH 3CD6P 3KHUA 5AW0B 4JPZB 2H88C 1LT9B 3TNUA 1S9KE 2K9YA 1T8ZA 1U7MA 3B5NB 2UWJE 1LWUC 1FZCB 3RL0C 3H6PA 1M56D 2KLVA 2ZYGA 1AJYA 1CI6A 1FAVA 3CXHI 1PPJG 1DH3A 1BSNA 2V7QH 3KYQA 1BE3E 3H1JE 1S2EA 2I1JA 1VQ7P 1KMIZ 2YO3A 2OQQA 3HD7D 1Q86Q 2HFED 2W27A 3ABVC 2XDJA 1GW3A 1HGZA 3GHGC 3L37A 5KAIH 1N7SC 5KJ7C 2KK7A 2A45H 2C9NY 2KP8A 2N1TA 5DJUB 1EC5A 2OTJP 4N6JA 3TSIA 2ZT9C 2RN0A 1BDCA 4WY4D 1EDIA 3RK2C 2QJPB 4GOFA 4TLFA 1GW4A 5KLVE 5TISH 4RKUJ 1SQVE 2JR8A 5GTIE 5AW6B 1L4AA 3WU2H 3L4FA 1HF9A 3A0HH 1PZQA 3U1AA 3T97B 1JUNA 3MUDA 4I6MC 3M9QA 4C7RA 3PTZA 1OZHA 2ITAA 1FE6A 2Q6QA 4PD4D 1J1EB 3AE4C 1USDA 1LTGC 1VQKP 1NAYA 5CMZA 1GL2D 3CMEP 1W2BO 2HYNA 3GG2A 1RE3C 3IR9A 1OW8A 2V7QJ 5AW8B 1K05A 1NTKE 4H13D 3LIEA 1MUUA 1QEXA 3O6QB 5APUA 1SQPG 2HG5D 1M90Q 5APWA 2AEMA 1ZV8A 3L74G 5TJHA 2BCCG 1DEEG 3H1IG 5KAFH 2FYUD 3H1LE 3JSVC 3HE4A 2NPSB 3L70E 1SVFA 2E76D 1L0NG 3MD0A 3QH9A 4WVZA
chains in the Genus database with same CATH topology
5AVTB 5AW4B 5CCGA 1IFJA 2KB7P 4I2LC 2HPCA 5AW3B 2O1JA 5BU8B 1ZR4A 1KFNA 1LTSC 2C0XA 2WZ7A 3EQ2A 3NTNA 1GL2C 2Z5IA 2WWWA 1Z56A 1FZFA 1VPCA 1GTWA 2WPQA 2WT7A 1L4AC 3VTPC 1AQ5A 2YKPA 5CCHA 4RESB 2BASA 2N1TB 1FOSE 1GD2E 5AVUB 1NKZB 1QL2A 4EIJA 2A45G 3MIWA 1FOSF 1X79B 1RF1C 1J1EC 2OYHA 2HODA 3R2PA 3VMYA 5APYA 3P7KA 1G2CB 1GZLA 3P32A 3M9BA 1YTZI 4DOJA 1IJDB 1GK4A 1GL2B 4C46A 1RF0A 1LTJA 1KILC 1KQLA 1SFCC 3HE5B 3HRNA 2IFMA 1HWTC 5KJ7A 1NWQA 2YKQA 1L4AB 3M0DC 3UIAA 2WPRA 1ZN5A 1LGHB 4W80A 5CCGD 2N9BA 5KTBA 1W2EA 2XU6A 4IFFA 2PP6A 3BATA 4XA4A 2MJZA 1URQA 1RE4A 4LGDE 1VDFA 1JY2N 5AVZB 1RF1B 2P2UA 2J58A 2ZXEB 2N1TD 4WB4A 2Q5UA 1NTMK 1H8AA 3HUSA 2E43A 2POHA 1GK6A 5KLVK 1SQVK 1FJKA 3A7OA 4Y99C 5AW9B 1JTHA 1KILB 1JY3P 1SFCB 4XE5B 1WRGA 1N73A 1MV8A 4GKGA 3VP9A 1LT9A 3P8MC 3VOPA 4I1LA 1J1DC 3BASA 3B5NA 1IFMA 1IC2A 5APTA 5AW1B 2CPBA 1HGVA 1FZCA 1N86A 1FU1A 1JY2O 1IK9A 2IFNA 3M0AA 4HYTB 4KHXA 1JNMA 4JYBA 5AW2B 1SQXK 5CCGC 4Y99B 3CI9A 1NO4A 1T2KD 4GT1A 1DX7A 2H7HA 3EFGA 5AW7B 2H8PD 1GU5A 3L35A 4LC1A 1OXZA 1E5WA 2GM4A 1PFIA 1NH4A 2P7JA 5AVYB 1KILD 1M7LA 4N78D 1YYCA 3VYIA 2VRSA 5APXA 2WSEH 4JYCA 2C9LY 1J1DB 5CCHC 2QM7A 2XV5A 1SQPK 1FDMA 1LWUA 2W6BA 2P67A 4EOTA 1JCDA 2J59M 5AVXB 3I5CA 1H88A 2H43A 3VN0A 3HE4B 1HH0A 3VMZA 4N78E 1NTKK 3SWYA 3V2QA 2OYHC 1LTAC 1N7LA 1KZUB 3WMM0 2ZFCA 3OA7A 2IX7C 3KPEA 1KFMA 3LIDA 2HPCB 1NAFA 4OH8B 4LLHA 1L0NK 2M8RA 1RF0C 1LTJC 1XTGB 1GU4A 2WT7B 3RK3B 5CHXA 1HUCA 2FXMA 2W6AA 2R5DA 3VMXA 1T2KC 5AVWB 1H89A 1URQC 5CJ0A 1FBMA 3HTKA 2E42A 2CPSA 3BRTB 5APQA 1CW5A 1T3JA 1MFZA 2Q3IA 2FYUK 2OYHB 3V2NA 1YTZT 2HODB 4IFMA 2Z5HA 3GHGA 3HUSC 1N7SA 1OWAA 2FFDA 2C0WA 3P8CE 3HTKB 1M1JA 2LKMA 2QM8A 4HH2A 2OARA 3MTUE 1WT6A 3O8ZA 2PAJA 1G1JA 1LTJB 1NKNA 3A2AA 1N73C 2L5GB 4C7NA 1N2DC 2R5BA 2FKWB 2GUSA 3T97A 1URQB 3RK3D 3B5NC 1JY3N 2YO2A 2WTYA 3N7NA 1L0LK 3PP5A 5CCHD 3KDPB 1FZCC 1IFDA 2WSCH 3HUSB 1NU1K 5AVSB 3CLQA 1LTIC 2O01H 5AW0B 5AVQB 2O1KA 3A5TA 3LW5H 2GUVA 3HD7A 1S9KD 1JTHB 4JF7A 3NMDA 5BVZA 1CZQA 1JY2P 1N73B 4O9BA 1LT9B 3VP8A 1N7SD 3NXSA 3TNUA 2YNYA 3H32A 1S9KE 1FZAA 1T8ZA 3B8EB 5KJ7D 3B5NB 3OAKA 1T3UA 1LWUC 5APVA 4M3LA 5AVVB 1FZCB 3RL0C 1URQD 3H6PA 1A02J 1LTTC 4ZKPA 1NHLA 4GIFA 2KLVA 2WSFH 1CI6A 1FAVA 2KYVA 3M9HA 3RK3C 4WY4A 1DH3A 1ZLLA 3RK2D 1A02F 1X8YA 3KYQA 3II6A 2OYIA 1HTLC 3A3YB 1IO4A 2HLOA 2I1JA 2NPSA 1FZGA 1RE3A 2KSJA 2YO3A 3HD7D 1LWUB 1JCCA 2XZRA 3RL0B 2HFED 3BVHA 2W27A 3M91A 3B5ND 4AYCA 1SQQK 2XDJA 1GW3A 1HGZA 3V2RA 3GHGC 3L37A 1LTBC 1N7SC 2FFDC 1M1JC 3TK1A 5KJ7C 2WPSA 3N4XA 3KQGA 2A45H 2C9NY 2KP8A 2N1TA 3SWFA 2XKMA 2M3BA 3P8CD 5AVRB 5APSA 1FJPA 1RE4C 3L36A 4N6JA 3TYYA 3TSIA 5CJ4A 1HBWA 1G1IA 1FZBA 4WY4D 3NFQA 1G2CA 2YKOA 1MZ9A 3RK2C 1CSBA 1GW4A 1SP4A 3RL0D 1GL2A 3BRVB 3GHGB 4AUWA 3V2PA 1N7SB 2FFDB 2R3CA 1X9VA 2NPSD 3HE5A 1M1JB 2JJLA 1ZR2A 5AW6B 1L4AA 1LT9C 1RY3A 3L4FA 3HD7C 2FYZA 3G3ZA 2P1JA 1SLQA 1HJBA 3U1AA 4C7NB 1RF1A 1JUNA 3CL3D 2Q7CA 3U1CA 3MUDA 4I6MC 3M9QA 4C7RA 1JOCA 4DZOA 4WBAA 1EQ7A 1AFOA 4B86A 3E1IA 1HVVA 3RK2B 1J1EB 1IFIA 3IFMA 1J2JB 2KOGA 4ZKUA 1KILA 1SFCA 1LTGC 2YMYA 1QL1A 3M0DA 3HD7B 1NTZK 1IFNA 4WY4C 3V5BA 5CMZA 2OYIC 1GDTA 5AW5B 4IFDK 2JEEA 2Z4EA 1GL2D 1JY3O 2HYNA 3C9IA 3TNUB 3MGNA 3H32B 2NPSC 1RE3C 3IR9A 2XNXA 1L4AD 1XTCC 5AW8B 1SQBK 2R32A 3LIEA 1MUUA 1JMMA 2A45I 3V4QA 4AQRD 5APUA 2HG5D 3V4WA 1CI6B 5APWA 4W7ZA 1ZV8A 3U59A 2I1KA 4WY4B 4N3YB 2OYIB 3M06A 2N1TC 2IPPA 1JO5A 1NOHA 5BU5A 1FZEA 1DEBA 1SFCD 3HE4A 2NPSB 2Q9IA 3OJAB 4W7YA 1SVFA 2WITA 3MD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NO4 A;  3OA7 A;  3MTU E;  1NOH A;  4IFF A; 
#chains in the Genus database with same CATH topology
 1ZW0 A;  2KB7 P;  4I2L C;  2HPC A;  3K5B A;  1PV3 A;  1S3J A;  3BCC E;  2C0X A;  2WZ7 A;  3FGA D;  2Z5I A;  2WWW A;  4L74 A;  3L75 E;  3AEC C;  2FY8 A;  2YKP A;  1L0L D;  1NTM J;  2J5U A;  5CCH A;  4RES B;  3L73 E;  4EIJ A;  1PP9 D;  2K3R A;  1RF1 C;  3V6I A;  3AED C;  4UB8 E;  3P7K A;  3M9B A;  3AEG C;  4PD4 I;  4Y28 J;  1KIL C;  1SFC C;  1HWT C;  1Q90 D;  2QEX P;  5KJ7 A;  3CCE P;  3M0D C;  3UIA A;  4ZMD A;  1ZN5 A;  1LGH B;  3LW5 J;  1KC8 Q;  5KTB A;  2W90 A;  4PV1 B;  4XA4 A;  1NU1 G;  2MJZ A;  1NYH A;  1SQX J;  2SPZ A;  4ASV A;  1K04 A;  2G3A A;  2N1T D;  3D70 A;  4DCK A;  1K73 Q;  3IF4 A;  4U7J A;  2B9B A;  1SQP J;  2B89 A;  4IL6 E;  1S5L H;  3VP9 A;  3GF7 A;  5B5E E;  1EZV D;  3L74 J;  2BCC J;  4U3F E;  2WSF J;  3H1I J;  2ZYD A;  1LP1 A;  2OTK E;  2AXT H;  1IFM A;  1HGV A;  2QJK B;  2ZVO B;  1YJ9 P;  1BGY G;  4KHX A;  1L0N J;  3D6Y A;  4JYB A;  5AW2 B;  1P84 H;  5CCG C;  1SQQ E;  3FXD A;  1DX7 A;  3TGU J;  4H0L C;  1GU5 A;  2H8P D;  3L35 A;  5KAF E;  1JMB A;  1OXZ A;  4ASW A;  2IZ1 A;  2W8Z A;  1J1D B;  3CX5 I;  3L72 D;  3AE2 C;  1FDM A;  2P67 A;  2Q3E A;  3I5C A;  3F89 A;  4N78 E;  3Q3D A;  3S9O A;  3H1H G;  2NZ2 A;  2V4H A;  3OA7 A;  2QRX A;  3Q5S A;  2FYU G;  2B88 A;  1VQP P;  1YI2 P;  4BWN A;  1NU1 J;  2QE7 H;  1BCC E;  1T2K C;  2FYU K;  4NPF X;  2LKM A;  2QM8 A;  3GMA A;  3O8Z A;  1G1J A;  1JB0 J;  1LTJ B;  1NTZ E;  3A2A A;  2L91 A;  2L5G B;  2GUS A;  2YIU B;  3AEB C;  1Q2N A;  1FC2 C;  2KNC A;  3B5N C;  1JY3 N;  2WTY A;  1L0L K;  5CCH D;  3I55 P;  1BGY J;  3KDP B;  1FZC C;  1VF5 D;  1ZRT E;  1SQB E;  2WSC H;  3RK3 E;  2O1K A;  4OGQ C;  2GUV A;  3HD7 A;  3H1K G;  1JTH B;  1YJW P;  1CZQ A;  1PPJ D;  1AV1 A;  1KTM A;  1KOR A;  1N7S D;  1FZA A;  3B8E B;  5KJ7 D;  5AVV B;  5M1B A;  1FDI A;  1K9M Q;  1A02 J;  1LTT C;  3AE5 C;  3H1H J;  2ZT9 D;  4GIF A;  4ZNC A;  4WY4 A;  1BDD A;  3RK2 D;  3II6 A;  2OYI A;  1FS0 E;  4D6T E;  3A3Y B;  3RBZ A;  1IO4 A;  4OVN F;  2OTL P;  2XZR A;  3F5H A;  3BVH A;  1EDK A;  2QJP C;  1Y8A A;  2KUB A;  2E5Y A;  3N4X A;  2RKL A;  3AE7 C;  1S1C X;  4KT0 J;  3SWF A;  2M3B A;  4OWF A;  1NTM D;  1RE4 C;  3TYY A;  5CJ4 A;  1G1I A;  1FZB A;  3G9R A;  1VQ4 P;  1G2C A;  1MZ9 A;  1KYO E;  5EFW B;  1GL2 A;  2JKV A;  2FFD B;  2E5T A;  1PIX A;  1M1J B;  2FYN B;  3RBX A;  3H1K J;  1PP9 E;  5GTI H;  2JO1 A;  3G3Z A;  5KLV G;  1SQV G;  3EWK A;  2A06 G;  1NVO A;  3U1C A;  1IFP A;  1SQX D;  3GF3 A;  4H13 B;  3G4S P;  1JOC A;  1EDJ A;  3AE6 C;  1EQ7 A;  5KLI C;  1HVV A;  1IFI A;  3IFM A;  2O01 N;  1J2J B;  1Y47 A;  1QL1 A;  1RQV A;  1SQP D;  1SS1 A;  4YXW H;  3IN6 A;  3L74 D;  1RHZ B;  2BCC D;  1GDT A;  3H1I D;  2Z4E A;  2E76 B;  3R4Y A;  1KQS O;  3MZW B;  3TNU B;  3B71 A;  4H44 B;  2NPS C;  1VL2 A;  2M5A A;  2XNX A;  1XTC C;  1L0N D;  1Q82 Q;  3H1J J;  1IK7 A;  2A45 I;  4AQR D;  3TGU D;  1CI6 B;  4GOD A;  3QWO C;  3VMA A;  1EXJ A;  1X0T A;  3M06 A;  2IPP A;  1VQ9 P;  5BU5 A;  1SFC D;  2M3E A;  4W7Y A;  3L71 E;  2BEQ D;  1IFJ A;  2O1J A;  1AVO A;  4Z1M H;  3H1L G;  3EQ2 A;  1Z56 A;  3L72 E;  1VPC A;  3L70 G;  2WT7 A;  3I56 P;  1AQ5 A;  2N1T B;  1FOS E;  5KLV J;  5AVU B;  4PV1 C;  1SQV J;  3FWL A;  2A45 G;  1NU1 D;  1X79 B;  2D2C D;  4QMA A;  2K9J A;  2OYH A;  3R2P A;  3VMY A;  5APY A;  1JEK A;  4UB8 H;  4DOJ A;  2KS1 A;  5B66 E;  3USS A;  1GK4 A;  1NTM G;  3HRN A;  1NWQ A;  1L4A B;  2WPR A;  5CCG D;  2N9B A;  4IFF A;  1YIT P;  1URQ A;  1RE4 A;  4H0L D;  5E79 E;  3WUV A;  3WUT A;  4WB4 A;  1NTM K;  1H8A A;  3HUS A;  1Q7Y Q;  1BGY D;  2MKV A;  2E74 B;  1N73 A;  1VQL P;  1MV8 A;  4IL6 H;  4GKG A;  4A7P A;  3CCM P;  1SQX G;  2KSE A;  5B5E H;  1NTK J;  3VOP A;  1M1K Q;  4I1L A;  1J1D C;  5AW1 B;  2E75 D;  2IFN A;  4HYT B;  1JNM A;  1YIJ P;  4U3F G;  1PPJ E;  1SQX K;  3H1H D;  4Y99 B;  1T2K D;  3H1L J;  2R44 A;  2H7H A;  3EFG A;  3AE9 C;  1E5W A;  3L70 J;  2R3S A;  1M7L A;  1YYC A;  3VYI A;  3W67 A;  2WSE H;  1SQQ G;  2XV5 A;  1KB9 E;  1SQP K;  1LWU A;  4EOT A;  3HE4 B;  1H0T A;  1HH0 A;  5DJT B;  2Y0C A;  3VMZ A;  3CWB E;  3V2Q A;  3TGU G;  3WMM 0;  2ZFC A;  1VQN P;  2IX7 C;  3FXE A;  2HPC B;  3L73 J;  1W5C E;  3CX5 D;  1NAF A;  1L0N K;  3CCL P;  1RF0 C;  1LTJ C;  3CXH E;  1LT1 A;  1XTG B;  4BXL A;  5CHX A;  2W6A A;  1YJN P;  2YIU C;  4OGQ D;  3FWN A;  1VF5 B;  1TU3 F;  2R5D A;  3D6Z A;  2IZ0 A;  5AVW B;  5CJ0 A;  1VQ8 P;  1FBM A;  1X22 A;  2CPS A;  3BRT B;  3PHL A;  2YXQ B;  2Q3I A;  3V2N A;  3GHG A;  1N7S A;  2PAJ A;  2W6J H;  2ZJS E;  2JP3 A;  3H1K D;  4C7N A;  2FKW B;  3CCQ P;  3RGU A;  3GLM A;  1OIP A;  3N7N A;  1P84 I;  1NTZ G;  4U3F J;  2IBZ I;  1NU1 K;  5AVS B;  3CLQ A;  4CPG A;  1LTI C;  1QGK B;  2WSS H;  5AVQ B;  3A5T A;  4RO0 A;  1S9K D;  3S1K A;  5BVZ A;  4JF7 A;  3NMD A;  2BEZ F;  1SQB G;  2YNY A;  3C1L A;  1SQQ J;  3H32 A;  1LP1 B;  1AVY A;  3JC2 2;  5APV A;  4M3L A;  1URQ D;  2O3J A;  4BRY A;  4ZKP A;  2WSE J;  3L74 E;  1NHL A;  3D71 A;  3H1J D;  1HJ0 A;  2KYV A;  3M9H A;  3RK3 C;  1ZLL A;  1A02 F;  1X8Y A;  3AE1 C;  2IBZ G;  2RH0 A;  1M8O B;  1RE3 A;  1FZG A;  2NRG A;  2KIK A;  4RJT A;  4AYC A;  2AEJ A;  3V2R A;  1LTB C;  2FFD C;  1BCC J;  1M1J C;  2FYN C;  2WPS A;  3KQG A;  5C39 A;  2WMM A;  2XKM A;  3P8C D;  1R5L A;  5AVR B;  5APS A;  5KLV D;  1SQV D;  2A06 D;  4H13 C;  3CC7 P;  4MN4 C;  3JCU E;  2AEF A;  2YKO A;  1NTZ J;  1SP4 A;  3RL0 D;  1KYO H;  2NPS D;  3HE5 A;  2QJY B;  1NU1 E;  1LT9 C;  3KXD A;  1SLQ A;  2P10 A;  1SQB J;  2ZAE B;  3WUU A;  1RF1 A;  2E76 C;  2JDI H;  4H44 C;  4WBA A;  1AFO A;  2KNC B;  2AXC A;  3IAO A;  2KOG A;  4ZKU A;  1KIL A;  1SFC A;  3E7K A;  5K5G B;  3CCJ P;  2YMY A;  5KKZ B;  3M0D A;  4PD4 E;  3HD7 B;  1YHQ P;  2QSI A;  1IFN A;  1NTK D;  4IFD K;  2JEE A;  4HB1 A;  4L76 A;  3MGN A;  4L75 A;  1BSH A;  2KZJ A;  1S5L X;  4D6T J;  4PV1 D;  1JMM A;  3V4Q A;  3H1L D;  3FX0 A;  1JM0 A;  4L73 A;  2JWD A;  3L70 D;  2I1K A;  4WY4 B;  4N3Y B;  2OYI B;  2D2C B;  2N1T C;  1JO5 A;  4EYY Q;  2ZVN B;  1FZE A;  2B87 A;  1UII A;  1BE3 G;  3OJA B;  3H1J G;  2WIT A;  2WVR A;  5AW4 B;  5CCG A;  2FYU E;  1OX3 A;  2CK3 H;  1KQF B;  5BU8 B;  4R4M A;  1KFN A;  1YQ3 C;  3L73 D;  2QA4 P;  2WPQ A;  1L4A C;  4YTP C;  3L71 G;  2PRR A;  3MHV A;  2XND H;  1GD2 E;  2FBW C;  4DJG A;  3MIW A;  1FOS F;  2WQY C;  1J1E C;  3CX5 E;  3MUD C;  1PP9 J;  1L0L E;  2HOD A;  2FXP A;  1M57 D;  1G2C B;  3P32 A;  2E74 C;  1GL2 B;  5B66 H;  2WSC J;  2YMK A;  2YKQ A;  2E75 B;  3S4R A;  4LGD E;  1JY2 N;  2P2U A;  5E79 H;  2J58 A;  2KLU A;  1PGJ A;  2Q5U A;  2E43 A;  4YPC A;  1PGO A;  1GK6 A;  5KLV K;  1SQV K;  4U3F D;  1VQ5 P;  1OW6 A;  4Y99 C;  3RL0 g;  1VQ6 P;  1JY3 P;  4XE5 B;  4TT3 H;  1U7J A;  5GTH E;  1LT9 A;  2OGU A;  3MP7 B;  3BAS A;  3B5N A;  5APT A;  1KB9 I;  1SQQ D;  1BE3 J;  1ZOY C;  1EZV E;  1FU1 A;  2LR2 A;  1FZC A;  5CBO A;  1IK9 A;  2OYO A;  3M0A A;  1RH5 B;  2M5A B;  3ZDM A;  1ZME C;  3G71 P;  4GT1 A;  3A0B H;  4HJG H;  5AW7 B;  3OW2 O;  1NTK G;  1QLE D;  1NH4 A;  4OGQ B;  2P7J A;  5AVY B;  3L71 J;  1KIL D;  1OVU A;  4N78 D;  1PGP A;  2VRS A;  5APX A;  4JYC A;  2C9L Y;  5CCH C;  2Y9Z A;  2QM7 A;  1VF5 C;  1KB9 H;  1JCD A;  2J59 M;  5AVX B;  3L72 J;  4I7Z B;  3AE3 C;  1NTK K;  1LTA C;  1KZU B;  1Y9B A;  4UB6 E;  2JWA A;  3GW6 A;  1KFM A;  3LID A;  1QX8 A;  1LJ2 A;  1OVR A;  4OH8 B;  1BCC D;  4LLH A;  1AA0 A;  3C8V A;  2K37 A;  3CWB G;  3BCC G;  3CXH H;  2WT7 B;  3L75 G;  1WMK A;  1ZXG A;  3VMX A;  3TF5 A;  1H89 A;  4NPD A;  1MFT A;  2E42 A;  5APQ A;  1CW5 A;  1T3J A;  2K9J B;  3L73 G;  2OYH B;  1YTZ T;  3CCU P;  1DD3 A;  2I8D A;  1NTZ D;  1OWA A;  3P8C E;  4HH2 A;  2KS1 B;  2OAR A;  3MTU E;  1WT6 A;  5H2F E;  1NJI Q;  2A06 E;  1S72 P;  1NKN A;  4XFJ A;  3Q5R A;  3G6E P;  3PRJ A;  3T97 A;  2QJK C;  1ZRT D;  1SQB D;  1URQ B;  3RK3 D;  3PP5 A;  3Q2Y A;  1KV4 A;  3Q5P A;  3KZI E;  3HUS B;  1EXI A;  2O01 H;  3SFE C;  4GOE A;  2LXB A;  3LW5 H;  3H25 A;  1P84 D;  4GDO A;  1JY2 P;  1N73 B;  4O9B A;  3VP8 A;  2IBZ D;  3NXS A;  1DIP A;  5CBN A;  3CCR P;  3OAK A;  1QVF O;  1T3U A;  4DT0 A;  3A0B E;  4D6T D;  5KLI B;  3O6Q A;  2G8Y A;  1QVG O;  1UIX A;  2WSF H;  3TDK A;  4EDF A;  4K35 A;  1HTL C;  3CWB J;  3BCC J;  4YXD C;  3L75 J;  3SWK A;  2HLO A;  4EI2 A;  2NPS A;  2KXP B;  2KSJ A;  1LWU B;  1JCC A;  3RL0 B;  4K3A A;  1H0T B;  3M91 A;  3B5N D;  1SQQ K;  5KAI E;  2QG4 A;  2DW3 A;  4H44 D;  2K88 A;  3TK1 A;  2QJY C;  1KD1 Q;  3PLN A;  3ITK A;  1L2P A;  3SFD C;  2QIW A;  1FJP A;  3L36 A;  1KYO D;  1HBW A;  3EFF K;  3NFQ A;  3JCU H;  1NTM E;  2P58 A;  5TIS E;  1BCC G;  1CSB A;  3BRV B;  3GHG B;  4AUW A;  3V2P A;  1N7S B;  2R3C A;  1X9V A;  2JJL A;  5KKZ C;  3WU2 E;  1FDO A;  1ZR2 A;  5L8R J;  1RY3 A;  2K1A A;  3HD7 C;  2FYZ A;  2IYP A;  3A0H E;  1N8R Q;  2P1J A;  1USE A;  1KQG B;  1HJB A;  2O01 J;  2RMZ A;  4C7N B;  3CL3 D;  2Q7C A;  2ZT9 B;  4DZO A;  4B86 A;  3E1I A;  3RK2 B;  3AE8 C;  4WWI A;  3CCS P;  1LNQ A;  1Q81 Q;  1SQX E;  1ZP0 C;  1S4X A;  2WPV B;  4KJM A;  3AEE C;  1NTZ K;  4PD4 H;  4JQ0 D;  4WY4 C;  3V5B A;  2OYI C;  2D2C C;  5AW5 B;  1JY3 O;  1SQP E;  3C9I A;  3H32 B;  1IZN B;  1L4A D;  1BE3 D;  4IL6 X;  2BCC E;  1SQB K;  2R32 A;  3H1I E;  4BRY B;  3V4W A;  2KZI A;  1OMI A;  1L0N E;  4W7Z A;  3U59 A;  2Q1K A;  1GMJ A;  2E74 D;  3L71 D;  1NOH A;  3TGU E;  1DEB A;  3W68 A;  4PJ0 H;  4D6T G;  2Q9I A;  2KI7 B;  3CC4 P;  1EDL A;  2M0B A;  1KYO I;  5AVT B;  5AW3 B;  2W83 C;  1KIL E;  1ZR4 A;  2QVA A;  1LTS C;  3NTN A;  1GL2 C;  1FZF A;  1GTW A;  3VTP C;  2BAS A;  3CCV P;  1NKZ B;  1QL2 A;  2E75 C;  3CX5 H;  3PJS K;  2Y0E A;  4HKZ H;  1RQU A;  1R8E A;  2ZYA A;  1GZL A;  2ZXX A;  2IDB A;  1YTZ I;  1IJD B;  1AQT A;  1K8A Q;  4C46 A;  1RF0 A;  1LTJ A;  1T6A A;  1KQL A;  3HE5 B;  2IFM A;  1L0L G;  4W80 A;  1E79 H;  1W2E A;  2XU6 A;  2PP6 A;  3E1R A;  1NGM B;  3BAT A;  1PP9 G;  1VDF A;  5AVZ B;  1RF1 B;  4R4L A;  2ZXE B;  3AEF C;  1EZV I;  3B4S A;  2POH A;  1OFC X;  1PL5 A;  1FJK A;  3A7O A;  5AW9 B;  1JTH A;  1KIL B;  1SFC B;  2YXR B;  1WRG A;  1S5L E;  1BGY E;  3CPW O;  5GTH H;  3P8M C;  2AXT E;  1IC2 A;  1KN7 A;  2CPB A;  1N86 A;  1JY2 O;  4I7Z C;  1PGQ A;  4IOI H;  1P84 E;  1R5S A;  3CI9 A;  1NO4 A;  2N9Y B;  2IBZ E;  1VQM P;  1VQO P;  1KB9 D;  4LC1 A;  1EZV G;  3PH0 A;  2GM4 A;  1YQ4 C;  1PFI A;  3Q1M A;  4PJ0 E;  3H1H E;  2FYU J;  1MKM A;  2Y0D A;  3CWB D;  3BCC D;  2GA1 A;  2W6B A;  3L75 D;  1H88 A;  2H43 A;  3VN0 A;  2B87 B;  3SSU A;  3SWY A;  2OYH C;  1N7L A;  3CMA P;  2PFX A;  3CXH D;  4UB6 H;  3AEA C;  3KPE A;  4H0L B;  4JBZ A;  1D7M A;  2M8R A;  1L0L J;  1GU4 A;  3RK3 B;  1HUC A;  2FXM A;  3L72 G;  2HR3 A;  2PGD A;  1URQ C;  3HTK A;  2Y9Y A;  1MFZ A;  3CC2 P;  2HOD B;  4IFM A;  2Z5H A;  3HUS C;  2FFD A;  1OW7 A;  1YBK A;  2C0W A;  2H89 C;  3HTK B;  1M1J A;  1OVV A;  5H2F H;  1DD4 A;  1U57 A;  2IYO A;  1N73 C;  1N2D C;  2R5B A;  2FXO A;  3H1K E;  2YO2 A;  2LXC B;  4NPE A;  1IFD A;  3KZI H;  3CD6 P;  3KHU A;  5AW0 B;  4JPZ B;  2H88 C;  1LT9 B;  3TNU A;  1S9K E;  2K9Y A;  1T8Z A;  1U7M A;  3B5N B;  2UWJ E;  1LWU C;  1FZC B;  3RL0 C;  3H6P A;  1M56 D;  2KLV A;  2ZYG A;  1AJY A;  1CI6 A;  1FAV A;  3CXH I;  1PPJ G;  1DH3 A;  1BSN A;  2V7Q H;  3KYQ A;  1BE3 E;  3H1J E;  1S2E A;  2I1J A;  1VQ7 P;  1KMI Z;  2YO3 A;  2OQQ A;  3HD7 D;  1Q86 Q;  2HFE D;  2W27 A;  3ABV C;  2XDJ A;  1GW3 A;  1HGZ A;  3GHG C;  3L37 A;  5KAI H;  1N7S C;  5KJ7 C;  2KK7 A;  2A45 H;  2C9N Y;  2KP8 A;  2N1T A;  5DJU B;  1EC5 A;  2OTJ P;  4N6J A;  3TSI A;  2ZT9 C;  2RN0 A;  1BDC A;  4WY4 D;  1EDI A;  3RK2 C;  2QJP B;  4GOF A;  4TLF A;  1GW4 A;  5KLV E;  5TIS H;  4RKU J;  1SQV E;  2JR8 A;  5GTI E;  5AW6 B;  1L4A A;  3WU2 H;  3L4F A;  1HF9 A;  3A0H H;  1PZQ A;  3U1A A;  3T97 B;  1JUN A;  3MUD A;  4I6M C;  3M9Q A;  4C7R A;  3PTZ A;  1OZH A;  2ITA A;  1FE6 A;  2Q6Q A;  4PD4 D;  1J1E B;  3AE4 C;  1USD A;  1LTG C;  1VQK P;  1NAY A;  5CMZ A;  1GL2 D;  3CME P;  1W2B O;  2HYN A;  3GG2 A;  1RE3 C;  3IR9 A;  1OW8 A;  2V7Q J;  5AW8 B;  1K05 A;  1NTK E;  4H13 D;  3LIE A;  1MUU A;  1QEX A;  3O6Q B;  5APU A;  1SQP G;  2HG5 D;  1M90 Q;  5APW A;  2AEM A;  1ZV8 A;  3L74 G;  5TJH A;  2BCC G;  1DEE G;  3H1I G;  5KAF H;  2FYU D;  3H1L E;  3JSV C;  3HE4 A;  2NPS B;  3L70 E;  1SVF A;  2E76 D;  1L0N G;  3MD0 A;  3QH9 A;  4WVZ A; 
#chains in the Genus database with same CATH homology
 5AVT B;  5AW4 B;  5CCG A;  1IFJ A;  2KB7 P;  4I2L C;  2HPC A;  5AW3 B;  2O1J A;  5BU8 B;  1ZR4 A;  1KFN A;  1LTS C;  2C0X A;  2WZ7 A;  3EQ2 A;  3NTN A;  1GL2 C;  2Z5I A;  2WWW A;  1Z56 A;  1FZF A;  1VPC A;  1GTW A;  2WPQ A;  2WT7 A;  1L4A C;  3VTP C;  1AQ5 A;  2YKP A;  5CCH A;  4RES B;  2BAS A;  2N1T B;  1FOS E;  1GD2 E;  5AVU B;  1NKZ B;  1QL2 A;  4EIJ A;  2A45 G;  3MIW A;  1FOS F;  1X79 B;  1RF1 C;  1J1E C;  2OYH A;  2HOD A;  3R2P A;  3VMY A;  5APY A;  3P7K A;  1G2C B;  1GZL A;  3P32 A;  3M9B A;  1YTZ I;  4DOJ A;  1IJD B;  1GK4 A;  1GL2 B;  4C46 A;  1RF0 A;  1LTJ A;  1KIL C;  1KQL A;  1SFC C;  3HE5 B;  3HRN A;  2IFM A;  1HWT C;  5KJ7 A;  1NWQ A;  2YKQ A;  1L4A B;  3M0D C;  3UIA A;  2WPR A;  1ZN5 A;  1LGH B;  4W80 A;  5CCG D;  2N9B A;  5KTB A;  1W2E A;  2XU6 A;  4IFF A;  2PP6 A;  3BAT A;  4XA4 A;  2MJZ A;  1URQ A;  1RE4 A;  4LGD E;  1VDF A;  1JY2 N;  5AVZ B;  1RF1 B;  2P2U A;  2J58 A;  2ZXE B;  2N1T D;  4WB4 A;  2Q5U A;  1NTM K;  1H8A A;  3HUS A;  2E43 A;  2POH A;  1GK6 A;  5KLV K;  1SQV K;  1FJK A;  3A7O A;  4Y99 C;  5AW9 B;  1JTH A;  1KIL B;  1JY3 P;  1SFC B;  4XE5 B;  1WRG A;  1N73 A;  1MV8 A;  4GKG A;  3VP9 A;  1LT9 A;  3P8M C;  3VOP A;  4I1L A;  1J1D C;  3BAS A;  3B5N A;  1IFM A;  1IC2 A;  5APT A;  5AW1 B;  2CPB A;  1HGV A;  1FZC A;  1N86 A;  1FU1 A;  1JY2 O;  1IK9 A;  2IFN A;  3M0A A;  4HYT B;  4KHX A;  1JNM A;  4JYB A;  5AW2 B;  1SQX K;  5CCG C;  4Y99 B;  3CI9 A;  1NO4 A;  1T2K D;  4GT1 A;  1DX7 A;  2H7H A;  3EFG A;  5AW7 B;  2H8P D;  1GU5 A;  3L35 A;  4LC1 A;  1OXZ A;  1E5W A;  2GM4 A;  1PFI A;  1NH4 A;  2P7J A;  5AVY B;  1KIL D;  1M7L A;  4N78 D;  1YYC A;  3VYI A;  2VRS A;  5APX A;  2WSE H;  4JYC A;  2C9L Y;  1J1D B;  5CCH C;  2QM7 A;  2XV5 A;  1SQP K;  1FDM A;  1LWU A;  2W6B A;  2P67 A;  4EOT A;  1JCD A;  2J59 M;  5AVX B;  3I5C A;  1H88 A;  2H43 A;  3VN0 A;  3HE4 B;  1HH0 A;  3VMZ A;  4N78 E;  1NTK K;  3SWY A;  3V2Q A;  2OYH C;  1LTA C;  1N7L A;  1KZU B;  3WMM 0;  2ZFC A;  3OA7 A;  2IX7 C;  3KPE A;  1KFM A;  3LID A;  2HPC B;  1NAF A;  4OH8 B;  4LLH A;  1L0N K;  2M8R A;  1RF0 C;  1LTJ C;  1XTG B;  1GU4 A;  2WT7 B;  3RK3 B;  5CHX A;  1HUC A;  2FXM A;  2W6A A;  2R5D A;  3VMX A;  1T2K C;  5AVW B;  1H89 A;  1URQ C;  5CJ0 A;  1FBM A;  3HTK A;  2E42 A;  2CPS A;  3BRT B;  5APQ A;  1CW5 A;  1T3J A;  1MFZ A;  2Q3I A;  2FYU K;  2OYH B;  3V2N A;  1YTZ T;  2HOD B;  4IFM A;  2Z5H A;  3GHG A;  3HUS C;  1N7S A;  1OWA A;  2FFD A;  2C0W A;  3P8C E;  3HTK B;  1M1J A;  2LKM A;  2QM8 A;  4HH2 A;  2OAR A;  3MTU E;  1WT6 A;  3O8Z A;  2PAJ A;  1G1J A;  1LTJ B;  1NKN A;  3A2A A;  1N73 C;  2L5G B;  4C7N A;  1N2D C;  2R5B A;  2FKW B;  2GUS A;  3T97 A;  1URQ B;  3RK3 D;  3B5N C;  1JY3 N;  2YO2 A;  2WTY A;  3N7N A;  1L0L K;  3PP5 A;  5CCH D;  3KDP B;  1FZC C;  1IFD A;  2WSC H;  3HUS B;  1NU1 K;  5AVS B;  3CLQ A;  1LTI C;  2O01 H;  5AW0 B;  5AVQ B;  2O1K A;  3A5T A;  3LW5 H;  2GUV A;  3HD7 A;  1S9K D;  1JTH B;  4JF7 A;  3NMD A;  5BVZ A;  1CZQ A;  1JY2 P;  1N73 B;  4O9B A;  1LT9 B;  3VP8 A;  1N7S D;  3NXS A;  3TNU A;  2YNY A;  3H32 A;  1S9K E;  1FZA A;  1T8Z A;  3B8E B;  5KJ7 D;  3B5N B;  3OAK A;  1T3U A;  1LWU C;  5APV A;  4M3L A;  5AVV B;  1FZC B;  3RL0 C;  1URQ D;  3H6P A;  1A02 J;  1LTT C;  4ZKP A;  1NHL A;  4GIF A;  2KLV A;  2WSF H;  1CI6 A;  1FAV A;  2KYV A;  3M9H A;  3RK3 C;  4WY4 A;  1DH3 A;  1ZLL A;  3RK2 D;  1A02 F;  1X8Y A;  3KYQ A;  3II6 A;  2OYI A;  1HTL C;  3A3Y B;  1IO4 A;  2HLO A;  2I1J A;  2NPS A;  1FZG A;  1RE3 A;  2KSJ A;  2YO3 A;  3HD7 D;  1LWU B;  1JCC A;  2XZR A;  3RL0 B;  2HFE D;  3BVH A;  2W27 A;  3M91 A;  3B5N D;  4AYC A;  1SQQ K;  2XDJ A;  1GW3 A;  1HGZ A;  3V2R A;  3GHG C;  3L37 A;  1LTB C;  1N7S C;  2FFD C;  1M1J C;  3TK1 A;  5KJ7 C;  2WPS A;  3N4X A;  3KQG A;  2A45 H;  2C9N Y;  2KP8 A;  2N1T A;  3SWF A;  2XKM A;  2M3B A;  3P8C D;  5AVR B;  5APS A;  1FJP A;  1RE4 C;  3L36 A;  4N6J A;  3TYY A;  3TSI A;  5CJ4 A;  1HBW A;  1G1I A;  1FZB A;  4WY4 D;  3NFQ A;  1G2C A;  2YKO A;  1MZ9 A;  3RK2 C;  1CSB A;  1GW4 A;  1SP4 A;  3RL0 D;  1GL2 A;  3BRV B;  3GHG B;  4AUW A;  3V2P A;  1N7S B;  2FFD B;  2R3C A;  1X9V A;  2NPS D;  3HE5 A;  1M1J B;  2JJL A;  1ZR2 A;  5AW6 B;  1L4A A;  1LT9 C;  1RY3 A;  3L4F A;  3HD7 C;  2FYZ A;  3G3Z A;  2P1J A;  1SLQ A;  1HJB A;  3U1A A;  4C7N B;  1RF1 A;  1JUN A;  3CL3 D;  2Q7C A;  3U1C A;  3MUD A;  4I6M C;  3M9Q A;  4C7R A;  1JOC A;  4DZO A;  4WBA A;  1EQ7 A;  1AFO A;  4B86 A;  3E1I A;  1HVV A;  3RK2 B;  1J1E B;  1IFI A;  3IFM A;  1J2J B;  2KOG A;  4ZKU A;  1KIL A;  1SFC A;  1LTG C;  2YMY A;  1QL1 A;  3M0D A;  3HD7 B;  1NTZ K;  1IFN A;  4WY4 C;  3V5B A;  5CMZ A;  2OYI C;  1GDT A;  5AW5 B;  4IFD K;  2JEE A;  2Z4E A;  1GL2 D;  1JY3 O;  2HYN A;  3C9I A;  3TNU B;  3MGN A;  3H32 B;  2NPS C;  1RE3 C;  3IR9 A;  2XNX A;  1L4A D;  1XTC C;  5AW8 B;  1SQB K;  2R32 A;  3LIE A;  1MUU A;  1JMM A;  2A45 I;  3V4Q A;  4AQR D;  5APU A;  2HG5 D;  3V4W A;  1CI6 B;  5APW A;  4W7Z A;  1ZV8 A;  3U59 A;  2I1K A;  4WY4 B;  4N3Y B;  2OYI B;  3M06 A;  2N1T C;  2IPP A;  1JO5 A;  1NOH A;  5BU5 A;  1FZE A;  1DEB A;  1SFC D;  3HE4 A;  2NPS B;  2Q9I A;  3OJA B;  4W7Y A;  1SVF A;  2WIT A;  3MD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...