1NOHA

The structure of bacteriophage phi29 scaffolding protein gp7 after prohead assembly
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
73
structure length
73
Chain Sequence
PLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKSHEKLAAEKDDLIVSNSKLFRQIGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacteriophage f29 scaffolding protein gp7 before and after prohead assembly
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Viral protein
molecule keywords HEAD MORPHOGENESIS PROTEIN
total genus 30
structure length 73
sequence length 73
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11418 Scaffolding_pro Phi29 scaffolding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.400 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nohA00
1NOHA 3MTUE 1NO4A 3OA7A 4IFFA
chains in the Genus database with same CATH superfamily
4WY4C 4U3FJ 1VQ7P 1HTLC 2ZYDA 3L70E 3CC2P 4C7NB 3G71P 1E79H 1GL2D 2W6JH 1J1DC 3A5TA 3H1HJ 2JWDA 3HUSB 3JCUH 1PPJG 1SQQE 4BWNA 1BGYG 3AE1C 1JEKA 3ZDMA 4TLFA 2IFMA 4PJ0H 1KQLA 1SLQA 3H32A 2IBZG 3HE4B 3OAKA 3CD6P 1NTZJ 1PL5A 2PRRA 3RK3D 4H13D 3VOPA 1BCCJ 1RE3A 3H1HD 3VMAA 1L0NE 1Q7YQ 1NKZB 2KOGA 2OARA 3H1JG 3H1ID 3L74G 2GUSA 3PLNA 2WVRA 5AW9B 3SSUA 2I1KA 1CZQA 1NOHA 2FYUE 2QSIA 2WSCJ 3SFEC 3L73D 2AXTH 1RF0A 3H6PA 1GZLA 1NTKG 1L4AC 1ZW0A 2A45I 3L74E 5K5GB 2E42A 2FYZA 3B5NC 1IFDA 3QWOC 1NTZE 3F5HA 4UB8E 3SWKA 1L0ND 3TNUB 3L70G 5AW7B 4ASWA 5KKZB 3CCEP 3KXDA 3RBZA 4UB6E 1Z56A 1A02F 5KJ7C 2W6BA 3EQ2A 4I2LC 1YIJP 1NH4A 1L0LE 5APWA 1R5LA 1NTMG 2M3BA 1TU3F 3R4YA 1K04A 4H0LC 3OW2O 4DCKA 3K5BA 1NO4A 2YMKA 1HVVA 1M1JA 1L2PA 1SVFA 2QVAA 1YJWP 1G2CB 3Q2YA 2Z4EA 4U3FG 3L35A 5AVUB 2RN0A 1EZVI 1KYOH 2A45G 1OW7A 1S9KE 3TSIA 4IFDK 2ZT9C 1FJPA 5APUA 4TT3H 1NWQA 1VQNP 2E5YA 1NTKE 2FFDC 1ZR4A 1FBMA 2H88C 2ZT9D 1NVOA 3E1IA 5CHXA 3CWBJ 2H43A 4GT1A 3W68A 1KB9E 3L4FA 2OYIA 1AA0A 1N7LA 1RHZB 1ZLLA 3H1KE 3HE5B 1OW8A 2M5AB 1K73Q 3BCCJ 4RO0A 2N9YB 4I7ZB 1K9MQ 2NZ2A 2SPZA 4KJMA 1HGVA 1U7MA 3L71G 3MGNA 3N4XA 3O8ZA 4OVNF 3TGUD 1NTMJ 4PD4E 2K3RA 2E43A 2FYUD 1IFIA 3KDPB 2C9NY 1SQVG 1N7SD 2KNCA 4GOEA 3V2QA 1L0LD 2WPQA 3L75J 4B86A 2KZIA 1AVYA 2WQYC 4HH2A 5KJ7D 3KZIH 2XNDH 1VQMP 1OX3A 2AEJA 1ZN5A 1SQVE 3RK3E 3GHGB 4H44B 1RY3A 1BCCG 3RL0C 2ZAEB 5AVRB 2OYIC 4IFMA 3TDKA 5BU5A 2KS1A 1NJIQ 3CCUP 3CLQA 1R5SA 1KILA 1AV1A 1SQPD 5CCHA 4UB8H 2K88A 5CBNA 2HR3A 1IFPA 3PH0A 2LXBA 2YNYA 1SQBD 4U3FD 1GK6A 2BEZF 2R32A 3USSA 1T2KD 1SQPJ 1Y47A 1BCCD 3NXSA 4IL6X 1URQA 4Y99B 2E75B 4YPCA 2O01H 3NTNA 1QEXA 2CK3H 4L76A 2HPCA 3M9BA 2XZRA 1LT9A 4OGQB 4GIFA 2G3AA 2B87A 2HODA 2JWAA 1GL2B 1NHLA 3CC7P 1NU1D 2UWJE 1SFCA 3HUSA 4JQ0D 5KLVE 1KYOE 1JUNA 2ZVOB 1L0LJ 1D7MA 1JCCA 1X0TA 1Q90D 5KAIH 1DD3A 1RE4A 5BU8B 3HD7A 1L4AA 4LC1A 1IFNA 3CMEP 1UIXA 2KXPB 3WMM0 4HJGH 4DZOA 4W80A 3S4RA 1PPJE 1SQQG 3G6EP 5AVZB 3AE8C 1KYOD 3KYQA 1RQVA 5KLVD 4OH8B 5CCGA 4N78E 3Q5SA 4I7ZC 3EFFK 2Y0CA 4WB4A 1CI6B 1RF1C 1KILE 3CC4P 2AXTE 1EDKA 1AQTA 4Y28J 1BE3G 2PGDA 1QGKB 1HH0A 3H1KJ 1E5WA 1S1CX 2QRXA 3BRVB 3HRNA 3IFMA 3KPEA 2KK7A 3OA7A 1YTZT 3OJAB 3C8VA 5AVVB 4EI2A 2Y9ZA 3HE5A 1LWUC 1KFMA 1OMIA 1QL1A 2YXQB 2WSEJ 4NPDA 2HLOA 1FZEA 4GOFA 4JF7A 2A06E 3BASA 3GW6A 1OVUA 2RH0A 3CCSP 1H0TB 2FYUG 3F89A 2Q5UA 1EZVG 1BE3D 3RL0D 2Q3IA 1GU4A 3GF3A 1M1JB 2RMZA 2Y0EA 3V4QA 4D6TJ 1BSHA 1G2CA 1PGJA 5B5EH 2WSEH 3AEDC 2FFDB 3M9HA 1VPCA 1XTCC 3U59A 5GTHE 4R4LA 5KAIE 1YJ9P 2YIUB 2FXOA 1R8EA 1N7SC 3A7OA 4LGDE 2WPRA 3L72E 2QJYB 2JKVA 1PGQA 2FXMA 2O01J 1VDFA 2H8PD 2XKMA 1IZNB 5TISE 1LWUB 3D6ZA 2WWWA 4JBZA 1BGYJ 3MUDA 4PD4D 4W7YA 4XA4A 1FC2C 1YTZI 3H1IJ 2O1KA 2V7QJ 4H0LB 3AE4C 4C46A 1QVGO 3G9RA 2P7JA 5L8RJ 1M8OB 2IYOA 3VN0A 3QH9A 2I1JA 3L71D 1VQOP 3CCLP 2W83C 3RGUA 4Z1MH 2O01N 3S1KA 1USDA 2J58A 2W90A 5APVA 5TISH 3V2PA 1KYOI 3L72J 1QL2A 5APYA 2HYNA 5TJHA 4YXDC 1L0LK 1L0NK 1L0LG 1MUUA 2P2UA 1FS0E 3U1AA 3WUUA 1NKNA 2BCCD 2E76D 3NFQA 2Q7CA 1VQPP 5AW5B 3TF5A 1BCCE 1RE4C 1XTGB 1ZRTE 2LR2A 2QJYC 3MIWA 3MHVA 4H0LD 2E76B 5AVTB 5AW6B 2G8YA 4A7PA 3VTPC 1N73C 4PJ0E 1S4XA 2JO1A 4H13C 5B66E 3FXDA 1YITP 3AE9C 2OGUA 3HD7B 3D71A 1SQPK 4K35A 1SQPG 2QE7H 1Q2NA 1Y8AA 3L74J 3PRJA 5CCGD 3GMAA 2QA4P 2XV5A 1EXIA 2R3CA 5AW3B 1X9VA 1GW3A 3L70D 1QLED 1ZOYC 4GKGA 4RESB 3H1KG 4L74A 2NRGA 1L4AD 2W6AA 4BRYA 5AVWB 3CXHE 3Q5RA 1FZCA 1CI6A 1GTWA 1X8YA 2KLUA 1H0TA 4L75A 2IBZD 2C0WA 1CSBA 1JY3P 1ZP0C 2FYNC 3MUDC 1KILC 1H8AA 2OTLP 1AFOA 3D70A 1DX7A 1VF5C 3CI9A 1KTMA 3T97A 1OIPA 1WMKA 4JPZB 1GK4A 1MV8A 1N2DC 3CWBG 3FGAD 1JM0A 3RK3C 1KB9D 1SQXK 1S3JA 1SQVK 4H44C 1FDMA 5CCGC 4EDFA 1VF5B 2N1TC 1LGHB 1LT9C 3E7KA 2KP8A 2KS1B 2BASA 4D6TE 4H44D 4IL6E 1WRGA 1ZRTD 1JO5A 3PP5A 3B8EB 4RKUJ 1YI2P 1S9KD 1SQQD 2OTJP 1SQQJ 2M3EA 1HF9A 2FFDA 3T97B 1NYHA 1OWAA 2V4HA 3N7NA 3H1LE 1PIXA 1USEA 2YKQA 1KILD 1JTHA 5KLVK 1PP9J 3CXHH 2I8DA 3LIEA 3CCVP 2KNCB 1M90Q 1W2EA 1LWUA 1EDJA 2OYHB 1AQ5A 1RH5B 3VMZA 1FZCB 3M9QA 2JDIH 2W8ZA 1MFTA 1NU1G 1KFNA 1GL2A 2ZXEB 2YMYA 3MD0A 4PV1C 1SQXD 1SFCB 1M56D 2ITAA 2KSEA 1T8ZA 2IX7C 4HKZH 3SWYA 5CJ4A 1LJ2A 2IFNA 2ZT9B 4PD4H 5B66H 3VMYA 2E5TA 3W67A 3AE5C 3FWNA 2YKOA 1NTKD 1PP9E 1EZVD 4WWIA 1KQFB 1LTGC 3AE6C 2V7QH 3CX5I 1KD1Q 1A02J 1JMBA 5EFWB 3MP7B 5AW1B 4W7ZA 1IK9A 2JEEA 3BATA 3C1LA 3HD7C 1Q86Q 2OYIB 4QMAA 4RJTA 4U3FE 1N86A 5KAFH 3L70J 1VQ8P 3G3ZA 1EXJA 3AE7C 3GHGC 2JR8A 4L73A 1IO4A 1J1EB 1HJ0A 1VQ6P 1GU5A 3A2AA 3L75G 3H1HE 1N73B 1NAYA 1JY3N 1FOSF 1ZMEC 2HPCB 4IFFA 1NTMK 4N6JA 3VYIA 1PP9D 1S72P 2P1JA 2QJKC 2MKVA 1SQBE 3L37A 1KB9I 2OTKE 3B5NB 3CXHD 1FAVA 3H1HG 3H1JJ 1FDOA 4HB1A 3FWLA 5AVQB 2E74C 3P8MC 3BRTB 1FDIA 3LW5H 1RQUA 1QX8A 3TK1A 1MZ9A 3KHUA 1N7SA 3IR9A 1RF1A 1NTZG 1NTKJ 1OZHA 3HD7D 4BXLA 1U7JA 2J59M 3B71A 5E79H 1PP9G 2Y9YA 3AEFC 1H88A 3V2RA 2K37A 2OYHA 1YYCA 1JY2O 4M3LA 5B5EE 2IYPA 3VP8A 1U57A 2B88A 2L91A 1EC5A 1X79B 2FXPA 1EQ7A 2K9YA 2N1TD 3B4SA 1UIIA 3H1LD 3H1JE 4XFJA 3TNUA 2XNXA 3WU2E 1LTSC 1N7SB 3CXHI 3CCJP 2N9BA 2D2CD 2R3SA 2KZJA 3HE4A 3V4WA 2WSCH 3EFGA 1GMJA 2K1AA 2JJLA 4WBAA 2Q9IA 2H89C 2B9BA 1AVOA 2C0XA 3ITKA 2LXCB 1LP1A 3O6QB 4KHXA 4WY4B 2R44A 2ZXXA 2HODB 3H1IG 3H1JD 3H1LJ 2FY8A 3L74D 1FU1A 1Y9BA 3C9IA 1N73A 4YTPC 3ABVC 3GF7A 1P84H 3IF4A 3L73E 5KKZC 1HGZA 1HUCA 3A3YB 1SS1A 1BDCA 3PJSK 2QIWA 4PV1D 1L4AB 2IZ0A 3B5NA 4N3YB 1EDLA 1JCDA 3E1RA 3O6QA 4WY4A 1IJDB 3CWBE 1SQPE 2O1JA 3Q5PA 2WTYA 1K05A 1LT1A 5KJ7A 4R4MA 2QM8A 4HYTB 1VQ9P 3HTKA 5CMZA 4K3AA 3VMXA 3FXEA 1M7LA 3CCMP 1RF1B 1FZCC 1JY3O 3RK3B 5APTA 3CPWO 1VF5D 1P84I 1IK7A 3A0BE 3M0AA 5E79E 5KTBA 3SWFA 2QEXP 1SQVD 3AE2C 2P67A 2KLVA 5BVZA 4IL6H 2C9LY 1LTAC 1AJYA 3P7KA 3MTUE 1S5LE 1SFCD 2OYOA 3S9OA 3UIAA 5KLVJ 5GTHH 3H1LG 1LTJC 5AW8B 5KLIC 1G1JA 4Y99C 4EOTA 3H1IE 2D2CC 3JSVC 4PV1B 3GHGA 3HTKB 2GM4A 1SQVJ 2R5DA 1LTJB 2K9JA 1VQ4P 3L73G 4U7JA 1KQSO 1IFJA 4DT0A 2Y0DA 2WPSA 2WPVB 5M1BA 3BVHA 1URQD 1GL2C 2XU6A 1M1KQ 3G4SP 1KN7A 2VRSA 1P84D 1SQQK 3NMDA 1NU1J 1MFZA 2BCCE 2YO2A 2WT7B 3CCQP 3WU2H 2WITA 3MZWB 4H13B 1PPJD 1T3JA 2E75C 3M06A 4AQRD 3TGUJ 2ZVNB 2JP3A 3H32B 1JMMA 2NPSA 3M91A 1LTJA 4XE5B 2E76C 2D2CB 2DW3A 3KQGA 5KLIB 1JY2N 3L71J 1LT9B 1YBKA 1NGMB 5H2FH 3RK2B 3GLMA 1FOSE 2AXCA 1PGOA 4ASVA 2YKPA 2N1TA 1PV3A 1NU1E 2BCCJ 1KORA 2IPPA 3I56P 3A0HH 2IBZE 4GODA 3RL0B 1Q81Q 1JTHB 2NPSB 2BEQD 1T2KC 1KILB 1BSNA 1RE3C 5CCHC 4EIJA 4NPFX 1DH3A 3LIDA 1M57D 4ZNCA 3BCCE 3D6YA 4JYCA 3CX5E 3P32A 2MJZA 1CW5A 3KZIE 2KB7P 4EYYQ 3V6IA 4D6TD 5KLVG 2M5AA 1BE3E 1H89A 3A0HE 3CX5D 1BGYD 1NTME 3EWKA 3II6A 1JOCA 2YIUC 3P8CE 2PAJA 5C39A 3H25A 2Q3EA 2KSJA 3L75E 5GTIE 1BGYE 1NTMD 5AW4B 1GD2E 2WZ7A 4OWFA 2B87B 4AUWA 1S5LH 1S2EA 3M0DC 3BCCD 5H2FE 4ZKPA 2KYVA 5DJTB 1EZVE 4JYBA 1ZV8A 1X22A 1LNQA 4ZKUA 1HBWA 1FZBA 1T6AA 1NTKK 2E74B 4CPGA 1BE3J 1JNMA 3AEBC 2QJPB 4IOIH 2FYUK 2OQQA 2HG5D 1SQXE 5AVSB 4N78D 2QJKB 1J2JB 1LP1B 1WT6A 2J5UA 3PTZA 2W27A 4AYCA 3U1CA 1VQ5P 2B89A 2L5GB 1K8AQ 2KUBA 1IC2A 1LTIC 2CPBA 3BCCG 2AEFA 3WUTA 1SQBG 3WUVA 4C7RA 1LTTC 4YXWH 3RK2D 1YJNP 1VQLP 1SQXG 3SFDC 1OXZA 3AEAC 4WY4D 3VP9A 1N8RQ 3A0BH 3IN6A 3M0DA 2A06G 3Q1MA 2K9JB 2RKLA 2YO3A 4I6MC 1SQXJ 2PFXA 2QJPC 3CX5H 1ZR2A 4O9BA 2ZFCA 2Z5IA 1BDDA 3CCRP 3AEGC 5APQA 1KZUB 2KIKA 2ZYAA 5CCHD 3TGUE 1L0NJ 2WSSH 5DJUB 3HUSC 1NAFA 4PD4I 1DEEG 2ZJSE 4UB6H 5AW0B 5AW2B 3L75D 1J1DB 1EDIA 1J1EC 1JB0J 2QG4A 3L72G 2WSFJ 5GTIH 1GW4A 1OVRA 2HFED 2FYUJ 2KI7B 1M1JC 3GG2A 1FJKA 3L71E 1NTZK 2E74D 3P8CD 3TGUG 3RBXA 2M8RA 2OYHC 3LW5J 1FZGA 2YXRB 2O3JA 5CBOA 1HJBA 5KAFE 1KB9H 1SQBJ 1KC8Q 1KQGB 1G1IA 1RF0C 2M0BA 3CL3D 2GA1A 4C7NA 2IDBA 3B5ND 1P84E 5APSA 2WMMA 3CWBD 5CJ0A 1GDTA 1KMIZ 3JCUE 1NTZD 2R5BA 3L72D 2P58A 4GDOA 1SFCC 1YQ3C 2NPSD 1SP4A 3I55P 2E75D 1IFMA 3V2NA 3V5BA 2ZYGA 1Q82Q 2H7HA 2CPSA 1W5CE 3AE3C 2POHA 3JC22 1T3UA 2NPSC 5AVYB 4DOJA 3FX0A 3PHLA 1YHQP 1SQBK 2WT7A 1DD4A 1OFCX 4D6TG 1URQC 2GUVA 3H1KD 1ZXGA 3AEEC 4WVZA 1FZFA 1LTBC 1OW6A 3IAOA 2A06D 1MKMA 2LKMA 3RK2C 4BRYB 1FE6A 2Q1KA 4MN4C 2A45H 4DJGA 5AVXB 3CMAP 1W2BO 2Z5HA 1KV4A 2FYNB 4NPEA 2FBWC 2P10A 1HWTC 3Q3DA 2BCCG 2PP6A 3I5CA 3RL0g 1L0NG 1PGPA 1NU1K 2IBZI 2Q6QA 3R2PA 1YQ4C 2N1TB 1VL2A 1S5LX 1FZAA 4I1LA 1JY2P 2WSFH 2XDJA 1DEBA 1QVFO 2AEMA 2QM7A 1OVVA 4OGQD 3AECC 1URQB 2IZ1A 3L36A 1VQKP 4KT0J 3L73J 4LLHA 5APXA 1PZQA 4OGQC 4ZMDA 1PFIA 3TYYA 1DIPA 2FKWB
chains in the Genus database with same CATH topology
4WY4C 1HTLC 4C7NB 1GL2D 1J1DC 3A5TA 3HUSB 2IFMA 1KQLA 1SLQA 3H32A 3OAKA 3HE4B 3RK3D 3VOPA 1RE3A 1NKZB 2KOGA 2OARA 2GUSA 5AW9B 2I1KA 1CZQA 1NOHA 1RF0A 3H6PA 1GZLA 1L4AC 2A45I 2E42A 2FYZA 3B5NC 1IFDA 3TNUB 5AW7B 1A02F 1Z56A 5KJ7C 2W6BA 3EQ2A 4I2LC 1NH4A 5APWA 2M3BA 1NO4A 1HVVA 1M1JA 1SVFA 1G2CB 2Z4EA 5AVUB 3L35A 2A45G 1S9KE 3TSIA 4IFDK 1FJPA 5APUA 1NWQA 2FFDC 1ZR4A 1FBMA 3E1IA 5CHXA 2H43A 4GT1A 3L4FA 2OYIA 1N7LA 3HE5B 1ZLLA 1HGVA 3MGNA 3N4XA 3O8ZA 2E43A 1IFIA 3KDPB 2C9NY 1N7SD 3V2QA 4B86A 2WPQA 4HH2A 5KJ7D 1ZN5A 3GHGB 1RY3A 3RL0C 5AVRB 2OYIC 4IFMA 5BU5A 3CLQA 1KILA 5CCHA 2YNYA 1GK6A 1T2KD 2R32A 3NXSA 1URQA 4Y99B 2O01H 3NTNA 2HPCA 3M9BA 2XZRA 1LT9A 4GIFA 2HODA 1GL2B 1NHLA 1SFCA 3HUSA 1JUNA 1JCCA 1RE4A 5BU8B 3HD7A 1L4AA 4LC1A 1IFNA 3WMM0 4DZOA 4W80A 2GM4A 5AVZB 5CCGA 3KYQA 4OH8B 4N78E 4WB4A 1CI6B 1RF1C 1HH0A 3KPEA 1E5WA 3BRVB 3HRNA 3IFMA 3OA7A 5AVVB 1YTZT 3OJAB 1HJBA 3HE5A 1LWUC 1KFMA 1QL1A 2HLOA 1FZEA 4JF7A 3BASA 2Q5UA 3RL0D 2Q3IA 1GU4A 1M1JB 3V4QA 1G2CA 2WSEH 2FFDB 3M9HA 1VPCA 1XTCC 3U59A 1N7SC 3A7OA 4LGDE 2WPRA 2FXMA 2XKMA 1VDFA 2H8PD 1LWUB 2WWWA 4W7YA 3MUDA 4XA4A 1YTZI 2O1KA 4C46A 2P7JA 3VN0A 2I1JA 2J58A 5APVA 3V2PA 5APYA 1QL2A 2HYNA 1L0LK 1L0NK 1MUUA 2P2UA 3U1AA 1NKNA 3NFQA 2Q7CA 5AW5B 1RE4C 5AVTB 1XTGB 5AW6B 3VTPC 3HD7B 1SQPK 5CCGD 2XV5A 2R3CA 5AW3B 1X9VA 1GW3A 4GKGA 4RESB 1L4AD 2W6AA 1FZCA 5AVWB 1CI6A 1GTWA 1X8YA 2C0WA 1CSBA 1JY3P 1H8AA 1KILC 1AFOA 1DX7A 3CI9A 3T97A 1GK4A 1MV8A 1N2DC 3RK3C 1SQXK 1SQVK 1FDMA 5CCGC 2N1TC 1LGHB 1LT9C 2KP8A 2BASA 1JO5A 1WRGA 3PP5A 3B8EB 1S9KD 2FFDA 1OWAA 3N7NA 2YKQA 5KLVK 1KILD 1JTHA 3LIEA 1W2EA 1LWUA 2OYHB 1AQ5A 3VMZA 3M9QA 1KFNA 1GL2A 2ZXEB 2YMYA 3MD0A 1SFCB 1T8ZA 2IX7C 5CJ4A 3SWYA 2IFNA 3VMYA 2YKOA 1LTGC 1A02J 5AW1B 4W7ZA 1IK9A 2JEEA 3BATA 3HD7C 2OYIB 1N86A 3G3ZA 3GHGC 1IO4A 1J1EB 1N73B 3A2AA 1JY3N 1FOSF 2HPCB 4IFFA 1NTMK 4N6JA 3VYIA 2P1JA 3L37A 3B5NB 1FAVA 5AVQB 3P8MC 3BRTB 3LW5H 3TK1A 1MZ9A 1N7SA 3IR9A 1RF1A 3HD7D 2J59M 1H88A 2OYHA 3V2RA 1YYCA 1JY2O 4M3LA 3VP8A 4DOJA 1X79B 2N1TD 1EQ7A 3TNUA 2XNXA 1LTSC 1N7SB 2N9BA 3HE4A 3V4WA 2WSCH 3EFGA 2JJLA 4WBAA 2Q9IA 2C0XA 4WY4B 4KHXA 2HODB 1FU1A 3C9IA 1N73A 1HGZA 1HUCA 3A3YB 1L4AB 4N3YB 3B5NA 1JCDA 4WY4A 1IJDB 2O1JA 2WTYA 5KJ7A 2QM8A 4HYTB 3HTKA 5CMZA 3VMXA 1FZCC 1RF1B 1M7LA 1JY3O 3RK3B 5APTA 3M0AA 5KTBA 3SWFA 2P67A 2KLVA 5BVZA 2C9LY 1LTAC 3P7KA 3MTUE 3UIAA 1SFCD 4EOTA 5AW8B 1LTJC 1G1JA 4Y99C 3GHGA 3HTKB 2R5DA 1LTJB 1IFJA 3BVHA 2WPSA 1URQD 1GL2C 2XU6A 2VRSA 1SQQK 3NMDA 1MFZA 2YO2A 2WT7B 2WITA 3M06A 1T3JA 4AQRD 3H32B 1JMMA 2NPSA 3M91A 1LTJA 4XE5B 3KQGA 1JY2N 1LT9B 3RK2B 1FOSE 2YKPA 2N1TA 2IPPA 3RL0B 1JTHB 2NPSB 1T2KC 1KILB 1RE3C 5CCHC 4EIJA 1DH3A 3LIDA 4JYCA 3P32A 2MJZA 1CW5A 2KB7P 1H89A 3II6A 3P8CE 1JOCA 2PAJA 2KSJA 5AW4B 1GD2E 2WZ7A 4AUWA 3M0DC 4ZKPA 2KYVA 4JYBA 1ZV8A 4ZKUA 1HBWA 1FZBA 1NTKK 1JNMA 5AVSB 2FYUK 2HG5D 4N78D 1J2JB 1WT6A 4AYCA 2W27A 3U1CA 2L5GB 1IC2A 1LTIC 2CPBA 4C7RA 1LTTC 3RK2D 1OXZA 4WY4D 3VP9A 3M0DA 2YO3A 4I6MC 1ZR2A 4O9BA 2ZFCA 2Z5IA 5APQA 1KZUB 5CCHD 5AW0B 3HUSC 1NAFA 5AW2B 1N73C 1J1DB 1J1EC 1GW4A 3MIWA 2HFED 1GU5A 1M1JC 3P8CD 1FJKA 1NTZK 2OYHC 2M8RA 1FZGA 1G1IA 1RF0C 3CL3D 4C7NA 3B5ND 5APSA 5CJ0A 1GDTA 2R5BA 1SFCC 2NPSD 1SP4A 1IFMA 3V2NA 3V5BA 2H7HA 2CPSA 2POHA 1T3UA 2NPSC 5AVYB 1SQBK 2WT7A 1URQC 2GUVA 1FZFA 1LTBC 2LKMA 1FZCB 3RK2C 2A45H 5AVXB 2Z5HA 1HWTC 2PP6A 3I5CA 1NU1K 3R2PA 2N1TB 4I1LA 1FZAA 1JY2P 2WSFH 2XDJA 1DEBA 2QM7A 1URQB 3L36A 4LLHA 5APXA 1PFIA 3TYYA 2FKWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NOH A;  3MTU E;  1NO4 A;  3OA7 A;  4IFF A; 
#chains in the Genus database with same CATH topology
 4WY4 C;  4U3F J;  1VQ7 P;  1HTL C;  2ZYD A;  3L70 E;  3CC2 P;  4C7N B;  3G71 P;  1E79 H;  1GL2 D;  2W6J H;  1J1D C;  3A5T A;  3H1H J;  2JWD A;  3HUS B;  3JCU H;  1PPJ G;  1SQQ E;  4BWN A;  1BGY G;  3AE1 C;  1JEK A;  3ZDM A;  4TLF A;  2IFM A;  4PJ0 H;  1KQL A;  1SLQ A;  3H32 A;  2IBZ G;  3HE4 B;  3OAK A;  3CD6 P;  1NTZ J;  1PL5 A;  2PRR A;  3RK3 D;  4H13 D;  3VOP A;  1BCC J;  1RE3 A;  3H1H D;  3VMA A;  1L0N E;  1Q7Y Q;  1NKZ B;  2KOG A;  2OAR A;  3H1J G;  3H1I D;  3L74 G;  2GUS A;  3PLN A;  2WVR A;  5AW9 B;  3SSU A;  2I1K A;  1CZQ A;  1NOH A;  2FYU E;  2QSI A;  2WSC J;  3SFE C;  3L73 D;  2AXT H;  1RF0 A;  3H6P A;  1GZL A;  1NTK G;  1L4A C;  1ZW0 A;  2A45 I;  3L74 E;  5K5G B;  2E42 A;  2FYZ A;  3B5N C;  1IFD A;  3QWO C;  1NTZ E;  3F5H A;  4UB8 E;  3SWK A;  1L0N D;  3TNU B;  3L70 G;  5AW7 B;  4ASW A;  5KKZ B;  3CCE P;  3KXD A;  3RBZ A;  4UB6 E;  1Z56 A;  1A02 F;  5KJ7 C;  2W6B A;  3EQ2 A;  4I2L C;  1YIJ P;  1NH4 A;  1L0L E;  5APW A;  1R5L A;  1NTM G;  2M3B A;  1TU3 F;  3R4Y A;  1K04 A;  4H0L C;  3OW2 O;  4DCK A;  3K5B A;  1NO4 A;  2YMK A;  1HVV A;  1M1J A;  1L2P A;  1SVF A;  2QVA A;  1YJW P;  1G2C B;  3Q2Y A;  2Z4E A;  4U3F G;  3L35 A;  5AVU B;  2RN0 A;  1EZV I;  1KYO H;  2A45 G;  1OW7 A;  1S9K E;  3TSI A;  4IFD K;  2ZT9 C;  1FJP A;  5APU A;  4TT3 H;  1NWQ A;  1VQN P;  2E5Y A;  1NTK E;  2FFD C;  1ZR4 A;  1FBM A;  2H88 C;  2ZT9 D;  1NVO A;  3E1I A;  5CHX A;  3CWB J;  2H43 A;  4GT1 A;  3W68 A;  1KB9 E;  3L4F A;  2OYI A;  1AA0 A;  1N7L A;  1RHZ B;  1ZLL A;  3H1K E;  3HE5 B;  1OW8 A;  2M5A B;  1K73 Q;  3BCC J;  4RO0 A;  2N9Y B;  4I7Z B;  1K9M Q;  2NZ2 A;  2SPZ A;  4KJM A;  1HGV A;  1U7M A;  3L71 G;  3MGN A;  3N4X A;  3O8Z A;  4OVN F;  3TGU D;  1NTM J;  4PD4 E;  2K3R A;  2E43 A;  2FYU D;  1IFI A;  3KDP B;  2C9N Y;  1SQV G;  1N7S D;  2KNC A;  4GOE A;  3V2Q A;  1L0L D;  2WPQ A;  3L75 J;  4B86 A;  2KZI A;  1AVY A;  2WQY C;  4HH2 A;  5KJ7 D;  3KZI H;  2XND H;  1VQM P;  1OX3 A;  2AEJ A;  1ZN5 A;  1SQV E;  3RK3 E;  3GHG B;  4H44 B;  1RY3 A;  1BCC G;  3RL0 C;  2ZAE B;  5AVR B;  2OYI C;  4IFM A;  3TDK A;  5BU5 A;  2KS1 A;  1NJI Q;  3CCU P;  3CLQ A;  1R5S A;  1KIL A;  1AV1 A;  1SQP D;  5CCH A;  4UB8 H;  2K88 A;  5CBN A;  2HR3 A;  1IFP A;  3PH0 A;  2LXB A;  2YNY A;  1SQB D;  4U3F D;  1GK6 A;  2BEZ F;  2R32 A;  3USS A;  1T2K D;  1SQP J;  1Y47 A;  1BCC D;  3NXS A;  4IL6 X;  1URQ A;  4Y99 B;  2E75 B;  4YPC A;  2O01 H;  3NTN A;  1QEX A;  2CK3 H;  4L76 A;  2HPC A;  3M9B A;  2XZR A;  1LT9 A;  4OGQ B;  4GIF A;  2G3A A;  2B87 A;  2HOD A;  2JWA A;  1GL2 B;  1NHL A;  3CC7 P;  1NU1 D;  2UWJ E;  1SFC A;  3HUS A;  4JQ0 D;  5KLV E;  1KYO E;  1JUN A;  2ZVO B;  1L0L J;  1D7M A;  1JCC A;  1X0T A;  1Q90 D;  5KAI H;  1DD3 A;  1RE4 A;  5BU8 B;  3HD7 A;  1L4A A;  4LC1 A;  1IFN A;  3CME P;  1UIX A;  2KXP B;  3WMM 0;  4HJG H;  4DZO A;  4W80 A;  3S4R A;  1PPJ E;  1SQQ G;  3G6E P;  5AVZ B;  3AE8 C;  1KYO D;  3KYQ A;  1RQV A;  5KLV D;  4OH8 B;  5CCG A;  4N78 E;  3Q5S A;  4I7Z C;  3EFF K;  2Y0C A;  4WB4 A;  1CI6 B;  1RF1 C;  1KIL E;  3CC4 P;  2AXT E;  1EDK A;  1AQT A;  4Y28 J;  1BE3 G;  2PGD A;  1QGK B;  1HH0 A;  3H1K J;  1E5W A;  1S1C X;  2QRX A;  3BRV B;  3HRN A;  3IFM A;  3KPE A;  2KK7 A;  3OA7 A;  1YTZ T;  3OJA B;  3C8V A;  5AVV B;  4EI2 A;  2Y9Z A;  3HE5 A;  1LWU C;  1KFM A;  1OMI A;  1QL1 A;  2YXQ B;  2WSE J;  4NPD A;  2HLO A;  1FZE A;  4GOF A;  4JF7 A;  2A06 E;  3BAS A;  3GW6 A;  1OVU A;  2RH0 A;  3CCS P;  1H0T B;  2FYU G;  3F89 A;  2Q5U A;  1EZV G;  1BE3 D;  3RL0 D;  2Q3I A;  1GU4 A;  3GF3 A;  1M1J B;  2RMZ A;  2Y0E A;  3V4Q A;  4D6T J;  1BSH A;  1G2C A;  1PGJ A;  5B5E H;  2WSE H;  3AED C;  2FFD B;  3M9H A;  1VPC A;  1XTC C;  3U59 A;  5GTH E;  4R4L A;  5KAI E;  1YJ9 P;  2YIU B;  2FXO A;  1R8E A;  1N7S C;  3A7O A;  4LGD E;  2WPR A;  3L72 E;  2QJY B;  2JKV A;  1PGQ A;  2FXM A;  2O01 J;  1VDF A;  2H8P D;  2XKM A;  1IZN B;  5TIS E;  1LWU B;  3D6Z A;  2WWW A;  4JBZ A;  1BGY J;  3MUD A;  4PD4 D;  4W7Y A;  4XA4 A;  1FC2 C;  1YTZ I;  3H1I J;  2O1K A;  2V7Q J;  4H0L B;  3AE4 C;  4C46 A;  1QVG O;  3G9R A;  2P7J A;  5L8R J;  1M8O B;  2IYO A;  3VN0 A;  3QH9 A;  2I1J A;  3L71 D;  1VQO P;  3CCL P;  2W83 C;  3RGU A;  4Z1M H;  2O01 N;  3S1K A;  1USD A;  2J58 A;  2W90 A;  5APV A;  5TIS H;  3V2P A;  1KYO I;  3L72 J;  1QL2 A;  5APY A;  2HYN A;  5TJH A;  4YXD C;  1L0L K;  1L0N K;  1L0L G;  1MUU A;  2P2U A;  1FS0 E;  3U1A A;  3WUU A;  1NKN A;  2BCC D;  2E76 D;  3NFQ A;  2Q7C A;  1VQP P;  5AW5 B;  3TF5 A;  1BCC E;  1RE4 C;  1XTG B;  1ZRT E;  2LR2 A;  2QJY C;  3MIW A;  3MHV A;  4H0L D;  2E76 B;  5AVT B;  5AW6 B;  2G8Y A;  4A7P A;  3VTP C;  1N73 C;  4PJ0 E;  1S4X A;  2JO1 A;  4H13 C;  5B66 E;  3FXD A;  1YIT P;  3AE9 C;  2OGU A;  3HD7 B;  3D71 A;  1SQP K;  4K35 A;  1SQP G;  2QE7 H;  1Q2N A;  1Y8A A;  3L74 J;  3PRJ A;  5CCG D;  3GMA A;  2QA4 P;  2XV5 A;  1EXI A;  2R3C A;  5AW3 B;  1X9V A;  1GW3 A;  3L70 D;  1QLE D;  1ZOY C;  4GKG A;  4RES B;  3H1K G;  4L74 A;  2NRG A;  1L4A D;  2W6A A;  4BRY A;  5AVW B;  3CXH E;  3Q5R A;  1FZC A;  1CI6 A;  1GTW A;  1X8Y A;  2KLU A;  1H0T A;  4L75 A;  2IBZ D;  2C0W A;  1CSB A;  1JY3 P;  1ZP0 C;  2FYN C;  3MUD C;  1KIL C;  1H8A A;  2OTL P;  1AFO A;  3D70 A;  1DX7 A;  1VF5 C;  3CI9 A;  1KTM A;  3T97 A;  1OIP A;  1WMK A;  4JPZ B;  1GK4 A;  1MV8 A;  1N2D C;  3CWB G;  3FGA D;  1JM0 A;  3RK3 C;  1KB9 D;  1SQX K;  1S3J A;  1SQV K;  4H44 C;  1FDM A;  5CCG C;  4EDF A;  1VF5 B;  2N1T C;  1LGH B;  1LT9 C;  3E7K A;  2KP8 A;  2KS1 B;  2BAS A;  4D6T E;  4H44 D;  4IL6 E;  1WRG A;  1ZRT D;  1JO5 A;  3PP5 A;  3B8E B;  4RKU J;  1YI2 P;  1S9K D;  1SQQ D;  2OTJ P;  1SQQ J;  2M3E A;  1HF9 A;  2FFD A;  3T97 B;  1NYH A;  1OWA A;  2V4H A;  3N7N A;  3H1L E;  1PIX A;  1USE A;  2YKQ A;  1KIL D;  1JTH A;  5KLV K;  1PP9 J;  3CXH H;  2I8D A;  3LIE A;  3CCV P;  2KNC B;  1M90 Q;  1W2E A;  1LWU A;  1EDJ A;  2OYH B;  1AQ5 A;  1RH5 B;  3VMZ A;  1FZC B;  3M9Q A;  2JDI H;  2W8Z A;  1MFT A;  1NU1 G;  1KFN A;  1GL2 A;  2ZXE B;  2YMY A;  3MD0 A;  4PV1 C;  1SQX D;  1SFC B;  1M56 D;  2ITA A;  2KSE A;  1T8Z A;  2IX7 C;  4HKZ H;  3SWY A;  5CJ4 A;  1LJ2 A;  2IFN A;  2ZT9 B;  4PD4 H;  5B66 H;  3VMY A;  2E5T A;  3W67 A;  3AE5 C;  3FWN A;  2YKO A;  1NTK D;  1PP9 E;  1EZV D;  4WWI A;  1KQF B;  1LTG C;  3AE6 C;  2V7Q H;  3CX5 I;  1KD1 Q;  1A02 J;  1JMB A;  5EFW B;  3MP7 B;  5AW1 B;  4W7Z A;  1IK9 A;  2JEE A;  3BAT A;  3C1L A;  3HD7 C;  1Q86 Q;  2OYI B;  4QMA A;  4RJT A;  4U3F E;  1N86 A;  5KAF H;  3L70 J;  1VQ8 P;  3G3Z A;  1EXJ A;  3AE7 C;  3GHG C;  2JR8 A;  4L73 A;  1IO4 A;  1J1E B;  1HJ0 A;  1VQ6 P;  1GU5 A;  3A2A A;  3L75 G;  3H1H E;  1N73 B;  1NAY A;  1JY3 N;  1FOS F;  1ZME C;  2HPC B;  4IFF A;  1NTM K;  4N6J A;  3VYI A;  1PP9 D;  1S72 P;  2P1J A;  2QJK C;  2MKV A;  1SQB E;  3L37 A;  1KB9 I;  2OTK E;  3B5N B;  3CXH D;  1FAV A;  3H1H G;  3H1J J;  1FDO A;  4HB1 A;  3FWL A;  5AVQ B;  2E74 C;  3P8M C;  3BRT B;  1FDI A;  3LW5 H;  1RQU A;  1QX8 A;  3TK1 A;  1MZ9 A;  3KHU A;  1N7S A;  3IR9 A;  1RF1 A;  1NTZ G;  1NTK J;  1OZH A;  3HD7 D;  4BXL A;  1U7J A;  2J59 M;  3B71 A;  5E79 H;  1PP9 G;  2Y9Y A;  3AEF C;  1H88 A;  3V2R A;  2K37 A;  2OYH A;  1YYC A;  1JY2 O;  4M3L A;  5B5E E;  2IYP A;  3VP8 A;  1U57 A;  2B88 A;  2L91 A;  1EC5 A;  1X79 B;  2FXP A;  1EQ7 A;  2K9Y A;  2N1T D;  3B4S A;  1UII A;  3H1L D;  3H1J E;  4XFJ A;  3TNU A;  2XNX A;  3WU2 E;  1LTS C;  1N7S B;  3CXH I;  3CCJ P;  2N9B A;  2D2C D;  2R3S A;  2KZJ A;  3HE4 A;  3V4W A;  2WSC H;  3EFG A;  1GMJ A;  2K1A A;  2JJL A;  4WBA A;  2Q9I A;  2H89 C;  2B9B A;  1AVO A;  2C0X A;  3ITK A;  2LXC B;  1LP1 A;  3O6Q B;  4KHX A;  4WY4 B;  2R44 A;  2ZXX A;  2HOD B;  3H1I G;  3H1J D;  3H1L J;  2FY8 A;  3L74 D;  1FU1 A;  1Y9B A;  3C9I A;  1N73 A;  4YTP C;  3ABV C;  3GF7 A;  1P84 H;  3IF4 A;  3L73 E;  5KKZ C;  1HGZ A;  1HUC A;  3A3Y B;  1SS1 A;  1BDC A;  3PJS K;  2QIW A;  4PV1 D;  1L4A B;  2IZ0 A;  3B5N A;  4N3Y B;  1EDL A;  1JCD A;  3E1R A;  3O6Q A;  4WY4 A;  1IJD B;  3CWB E;  1SQP E;  2O1J A;  3Q5P A;  2WTY A;  1K05 A;  1LT1 A;  5KJ7 A;  4R4M A;  2QM8 A;  4HYT B;  1VQ9 P;  3HTK A;  5CMZ A;  4K3A A;  3VMX A;  3FXE A;  1M7L A;  3CCM P;  1RF1 B;  1FZC C;  1JY3 O;  3RK3 B;  5APT A;  3CPW O;  1VF5 D;  1P84 I;  1IK7 A;  3A0B E;  3M0A A;  5E79 E;  5KTB A;  3SWF A;  2QEX P;  1SQV D;  3AE2 C;  2P67 A;  2KLV A;  5BVZ A;  4IL6 H;  2C9L Y;  1LTA C;  1AJY A;  3P7K A;  3MTU E;  1S5L E;  1SFC D;  2OYO A;  3S9O A;  3UIA A;  5KLV J;  5GTH H;  3H1L G;  1LTJ C;  5AW8 B;  5KLI C;  1G1J A;  4Y99 C;  4EOT A;  3H1I E;  2D2C C;  3JSV C;  4PV1 B;  3GHG A;  3HTK B;  2GM4 A;  1SQV J;  2R5D A;  1LTJ B;  2K9J A;  1VQ4 P;  3L73 G;  4U7J A;  1KQS O;  1IFJ A;  4DT0 A;  2Y0D A;  2WPS A;  2WPV B;  5M1B A;  3BVH A;  1URQ D;  1GL2 C;  2XU6 A;  1M1K Q;  3G4S P;  1KN7 A;  2VRS A;  1P84 D;  1SQQ K;  3NMD A;  1NU1 J;  1MFZ A;  2BCC E;  2YO2 A;  2WT7 B;  3CCQ P;  3WU2 H;  2WIT A;  3MZW B;  4H13 B;  1PPJ D;  1T3J A;  2E75 C;  3M06 A;  4AQR D;  3TGU J;  2ZVN B;  2JP3 A;  3H32 B;  1JMM A;  2NPS A;  3M91 A;  1LTJ A;  4XE5 B;  2E76 C;  2D2C B;  2DW3 A;  3KQG A;  5KLI B;  1JY2 N;  3L71 J;  1LT9 B;  1YBK A;  1NGM B;  5H2F H;  3RK2 B;  3GLM A;  1FOS E;  2AXC A;  1PGO A;  4ASV A;  2YKP A;  2N1T A;  1PV3 A;  1NU1 E;  2BCC J;  1KOR A;  2IPP A;  3I56 P;  3A0H H;  2IBZ E;  4GOD A;  3RL0 B;  1Q81 Q;  1JTH B;  2NPS B;  2BEQ D;  1T2K C;  1KIL B;  1BSN A;  1RE3 C;  5CCH C;  4EIJ A;  4NPF X;  1DH3 A;  3LID A;  1M57 D;  4ZNC A;  3BCC E;  3D6Y A;  4JYC A;  3CX5 E;  3P32 A;  2MJZ A;  1CW5 A;  3KZI E;  2KB7 P;  4EYY Q;  3V6I A;  4D6T D;  5KLV G;  2M5A A;  1BE3 E;  1H89 A;  3A0H E;  3CX5 D;  1BGY D;  1NTM E;  3EWK A;  3II6 A;  1JOC A;  2YIU C;  3P8C E;  2PAJ A;  5C39 A;  3H25 A;  2Q3E A;  2KSJ A;  3L75 E;  5GTI E;  1BGY E;  1NTM D;  5AW4 B;  1GD2 E;  2WZ7 A;  4OWF A;  2B87 B;  4AUW A;  1S5L H;  1S2E A;  3M0D C;  3BCC D;  5H2F E;  4ZKP A;  2KYV A;  5DJT B;  1EZV E;  4JYB A;  1ZV8 A;  1X22 A;  1LNQ A;  4ZKU A;  1HBW A;  1FZB A;  1T6A A;  1NTK K;  2E74 B;  4CPG A;  1BE3 J;  1JNM A;  3AEB C;  2QJP B;  4IOI H;  2FYU K;  2OQQ A;  2HG5 D;  1SQX E;  5AVS B;  4N78 D;  2QJK B;  1J2J B;  1LP1 B;  1WT6 A;  2J5U A;  3PTZ A;  2W27 A;  4AYC A;  3U1C A;  1VQ5 P;  2B89 A;  2L5G B;  1K8A Q;  2KUB A;  1IC2 A;  1LTI C;  2CPB A;  3BCC G;  2AEF A;  3WUT A;  1SQB G;  3WUV A;  4C7R A;  1LTT C;  4YXW H;  3RK2 D;  1YJN P;  1VQL P;  1SQX G;  3SFD C;  1OXZ A;  3AEA C;  4WY4 D;  3VP9 A;  1N8R Q;  3A0B H;  3IN6 A;  3M0D A;  2A06 G;  3Q1M A;  2K9J B;  2RKL A;  2YO3 A;  4I6M C;  1SQX J;  2PFX A;  2QJP C;  3CX5 H;  1ZR2 A;  4O9B A;  2ZFC A;  2Z5I A;  1BDD A;  3CCR P;  3AEG C;  5APQ A;  1KZU B;  2KIK A;  2ZYA A;  5CCH D;  3TGU E;  1L0N J;  2WSS H;  5DJU B;  3HUS C;  1NAF A;  4PD4 I;  1DEE G;  2ZJS E;  4UB6 H;  5AW0 B;  5AW2 B;  3L75 D;  1J1D B;  1EDI A;  1J1E C;  1JB0 J;  2QG4 A;  3L72 G;  2WSF J;  5GTI H;  1GW4 A;  1OVR A;  2HFE D;  2FYU J;  2KI7 B;  1M1J C;  3GG2 A;  1FJK A;  3L71 E;  1NTZ K;  2E74 D;  3P8C D;  3TGU G;  3RBX A;  2M8R A;  2OYH C;  3LW5 J;  1FZG A;  2YXR B;  2O3J A;  5CBO A;  1HJB A;  5KAF E;  1KB9 H;  1SQB J;  1KC8 Q;  1KQG B;  1G1I A;  1RF0 C;  2M0B A;  3CL3 D;  2GA1 A;  4C7N A;  2IDB A;  3B5N D;  1P84 E;  5APS A;  2WMM A;  3CWB D;  5CJ0 A;  1GDT A;  1KMI Z;  3JCU E;  1NTZ D;  2R5B A;  3L72 D;  2P58 A;  4GDO A;  1SFC C;  1YQ3 C;  2NPS D;  1SP4 A;  3I55 P;  2E75 D;  1IFM A;  3V2N A;  3V5B A;  2ZYG A;  1Q82 Q;  2H7H A;  2CPS A;  1W5C E;  3AE3 C;  2POH A;  3JC2 2;  1T3U A;  2NPS C;  5AVY B;  4DOJ A;  3FX0 A;  3PHL A;  1YHQ P;  1SQB K;  2WT7 A;  1DD4 A;  1OFC X;  4D6T G;  1URQ C;  2GUV A;  3H1K D;  1ZXG A;  3AEE C;  4WVZ A;  1FZF A;  1LTB C;  1OW6 A;  3IAO A;  2A06 D;  1MKM A;  2LKM A;  3RK2 C;  4BRY B;  1FE6 A;  2Q1K A;  4MN4 C;  2A45 H;  4DJG A;  5AVX B;  3CMA P;  1W2B O;  2Z5H A;  1KV4 A;  2FYN B;  4NPE A;  2FBW C;  2P10 A;  1HWT C;  3Q3D A;  2BCC G;  2PP6 A;  3I5C A;  3RL0 g;  1L0N G;  1PGP A;  1NU1 K;  2IBZ I;  2Q6Q A;  3R2P A;  1YQ4 C;  2N1T B;  1VL2 A;  1S5L X;  1FZA A;  4I1L A;  1JY2 P;  2WSF H;  2XDJ A;  1DEB A;  1QVF O;  2AEM A;  2QM7 A;  1OVV A;  4OGQ D;  3AEC C;  1URQ B;  2IZ1 A;  3L36 A;  1VQK P;  4KT0 J;  3L73 J;  4LLH A;  5APX A;  1PZQ A;  4OGQ C;  4ZMD A;  1PFI A;  3TYY A;  1DIP A;  2FKW B; 
#chains in the Genus database with same CATH homology
 4WY4 C;  1HTL C;  4C7N B;  1GL2 D;  1J1D C;  3A5T A;  3HUS B;  2IFM A;  1KQL A;  1SLQ A;  3H32 A;  3OAK A;  3HE4 B;  3RK3 D;  3VOP A;  1RE3 A;  1NKZ B;  2KOG A;  2OAR A;  2GUS A;  5AW9 B;  2I1K A;  1CZQ A;  1NOH A;  1RF0 A;  3H6P A;  1GZL A;  1L4A C;  2A45 I;  2E42 A;  2FYZ A;  3B5N C;  1IFD A;  3TNU B;  5AW7 B;  1A02 F;  1Z56 A;  5KJ7 C;  2W6B A;  3EQ2 A;  4I2L C;  1NH4 A;  5APW A;  2M3B A;  1NO4 A;  1HVV A;  1M1J A;  1SVF A;  1G2C B;  2Z4E A;  5AVU B;  3L35 A;  2A45 G;  1S9K E;  3TSI A;  4IFD K;  1FJP A;  5APU A;  1NWQ A;  2FFD C;  1ZR4 A;  1FBM A;  3E1I A;  5CHX A;  2H43 A;  4GT1 A;  3L4F A;  2OYI A;  1N7L A;  3HE5 B;  1ZLL A;  1HGV A;  3MGN A;  3N4X A;  3O8Z A;  2E43 A;  1IFI A;  3KDP B;  2C9N Y;  1N7S D;  3V2Q A;  4B86 A;  2WPQ A;  4HH2 A;  5KJ7 D;  1ZN5 A;  3GHG B;  1RY3 A;  3RL0 C;  5AVR B;  2OYI C;  4IFM A;  5BU5 A;  3CLQ A;  1KIL A;  5CCH A;  2YNY A;  1GK6 A;  1T2K D;  2R32 A;  3NXS A;  1URQ A;  4Y99 B;  2O01 H;  3NTN A;  2HPC A;  3M9B A;  2XZR A;  1LT9 A;  4GIF A;  2HOD A;  1GL2 B;  1NHL A;  1SFC A;  3HUS A;  1JUN A;  1JCC A;  1RE4 A;  5BU8 B;  3HD7 A;  1L4A A;  4LC1 A;  1IFN A;  3WMM 0;  4DZO A;  4W80 A;  2GM4 A;  5AVZ B;  5CCG A;  3KYQ A;  4OH8 B;  4N78 E;  4WB4 A;  1CI6 B;  1RF1 C;  1HH0 A;  3KPE A;  1E5W A;  3BRV B;  3HRN A;  3IFM A;  3OA7 A;  5AVV B;  1YTZ T;  3OJA B;  1HJB A;  3HE5 A;  1LWU C;  1KFM A;  1QL1 A;  2HLO A;  1FZE A;  4JF7 A;  3BAS A;  2Q5U A;  3RL0 D;  2Q3I A;  1GU4 A;  1M1J B;  3V4Q A;  1G2C A;  2WSE H;  2FFD B;  3M9H A;  1VPC A;  1XTC C;  3U59 A;  1N7S C;  3A7O A;  4LGD E;  2WPR A;  2FXM A;  2XKM A;  1VDF A;  2H8P D;  1LWU B;  2WWW A;  4W7Y A;  3MUD A;  4XA4 A;  1YTZ I;  2O1K A;  4C46 A;  2P7J A;  3VN0 A;  2I1J A;  2J58 A;  5APV A;  3V2P A;  5APY A;  1QL2 A;  2HYN A;  1L0L K;  1L0N K;  1MUU A;  2P2U A;  3U1A A;  1NKN A;  3NFQ A;  2Q7C A;  5AW5 B;  1RE4 C;  5AVT B;  1XTG B;  5AW6 B;  3VTP C;  3HD7 B;  1SQP K;  5CCG D;  2XV5 A;  2R3C A;  5AW3 B;  1X9V A;  1GW3 A;  4GKG A;  4RES B;  1L4A D;  2W6A A;  1FZC A;  5AVW B;  1CI6 A;  1GTW A;  1X8Y A;  2C0W A;  1CSB A;  1JY3 P;  1H8A A;  1KIL C;  1AFO A;  1DX7 A;  3CI9 A;  3T97 A;  1GK4 A;  1MV8 A;  1N2D C;  3RK3 C;  1SQX K;  1SQV K;  1FDM A;  5CCG C;  2N1T C;  1LGH B;  1LT9 C;  2KP8 A;  2BAS A;  1JO5 A;  1WRG A;  3PP5 A;  3B8E B;  1S9K D;  2FFD A;  1OWA A;  3N7N A;  2YKQ A;  5KLV K;  1KIL D;  1JTH A;  3LIE A;  1W2E A;  1LWU A;  2OYH B;  1AQ5 A;  3VMZ A;  3M9Q A;  1KFN A;  1GL2 A;  2ZXE B;  2YMY A;  3MD0 A;  1SFC B;  1T8Z A;  2IX7 C;  5CJ4 A;  3SWY A;  2IFN A;  3VMY A;  2YKO A;  1LTG C;  1A02 J;  5AW1 B;  4W7Z A;  1IK9 A;  2JEE A;  3BAT A;  3HD7 C;  2OYI B;  1N86 A;  3G3Z A;  3GHG C;  1IO4 A;  1J1E B;  1N73 B;  3A2A A;  1JY3 N;  1FOS F;  2HPC B;  4IFF A;  1NTM K;  4N6J A;  3VYI A;  2P1J A;  3L37 A;  3B5N B;  1FAV A;  5AVQ B;  3P8M C;  3BRT B;  3LW5 H;  3TK1 A;  1MZ9 A;  1N7S A;  3IR9 A;  1RF1 A;  3HD7 D;  2J59 M;  1H88 A;  2OYH A;  3V2R A;  1YYC A;  1JY2 O;  4M3L A;  3VP8 A;  4DOJ A;  1X79 B;  2N1T D;  1EQ7 A;  3TNU A;  2XNX A;  1LTS C;  1N7S B;  2N9B A;  3HE4 A;  3V4W A;  2WSC H;  3EFG A;  2JJL A;  4WBA A;  2Q9I A;  2C0X A;  4WY4 B;  4KHX A;  2HOD B;  1FU1 A;  3C9I A;  1N73 A;  1HGZ A;  1HUC A;  3A3Y B;  1L4A B;  4N3Y B;  3B5N A;  1JCD A;  4WY4 A;  1IJD B;  2O1J A;  2WTY A;  5KJ7 A;  2QM8 A;  4HYT B;  3HTK A;  5CMZ A;  3VMX A;  1FZC C;  1RF1 B;  1M7L A;  1JY3 O;  3RK3 B;  5APT A;  3M0A A;  5KTB A;  3SWF A;  2P67 A;  2KLV A;  5BVZ A;  2C9L Y;  1LTA C;  3P7K A;  3MTU E;  3UIA A;  1SFC D;  4EOT A;  5AW8 B;  1LTJ C;  1G1J A;  4Y99 C;  3GHG A;  3HTK B;  2R5D A;  1LTJ B;  1IFJ A;  3BVH A;  2WPS A;  1URQ D;  1GL2 C;  2XU6 A;  2VRS A;  1SQQ K;  3NMD A;  1MFZ A;  2YO2 A;  2WT7 B;  2WIT A;  3M06 A;  1T3J A;  4AQR D;  3H32 B;  1JMM A;  2NPS A;  3M91 A;  1LTJ A;  4XE5 B;  3KQG A;  1JY2 N;  1LT9 B;  3RK2 B;  1FOS E;  2YKP A;  2N1T A;  2IPP A;  3RL0 B;  1JTH B;  2NPS B;  1T2K C;  1KIL B;  1RE3 C;  5CCH C;  4EIJ A;  1DH3 A;  3LID A;  4JYC A;  3P32 A;  2MJZ A;  1CW5 A;  2KB7 P;  1H89 A;  3II6 A;  3P8C E;  1JOC A;  2PAJ A;  2KSJ A;  5AW4 B;  1GD2 E;  2WZ7 A;  4AUW A;  3M0D C;  4ZKP A;  2KYV A;  4JYB A;  1ZV8 A;  4ZKU A;  1HBW A;  1FZB A;  1NTK K;  1JNM A;  5AVS B;  2FYU K;  2HG5 D;  4N78 D;  1J2J B;  1WT6 A;  4AYC A;  2W27 A;  3U1C A;  2L5G B;  1IC2 A;  1LTI C;  2CPB A;  4C7R A;  1LTT C;  3RK2 D;  1OXZ A;  4WY4 D;  3VP9 A;  3M0D A;  2YO3 A;  4I6M C;  1ZR2 A;  4O9B A;  2ZFC A;  2Z5I A;  5APQ A;  1KZU B;  5CCH D;  5AW0 B;  3HUS C;  1NAF A;  5AW2 B;  1N73 C;  1J1D B;  1J1E C;  1GW4 A;  3MIW A;  2HFE D;  1GU5 A;  1M1J C;  3P8C D;  1FJK A;  1NTZ K;  2OYH C;  2M8R A;  1FZG A;  1G1I A;  1RF0 C;  3CL3 D;  4C7N A;  3B5N D;  5APS A;  5CJ0 A;  1GDT A;  2R5B A;  1SFC C;  2NPS D;  1SP4 A;  1IFM A;  3V2N A;  3V5B A;  2H7H A;  2CPS A;  2POH A;  1T3U A;  2NPS C;  5AVY B;  1SQB K;  2WT7 A;  1URQ C;  2GUV A;  1FZF A;  1LTB C;  2LKM A;  1FZC B;  3RK2 C;  2A45 H;  5AVX B;  2Z5H A;  1HWT C;  2PP6 A;  3I5C A;  1NU1 K;  3R2P A;  2N1T B;  4I1L A;  1FZA A;  1JY2 P;  2WSF H;  2XDJ A;  1DEB A;  2QM7 A;  1URQ B;  3L36 A;  4LLH A;  5APX A;  1PFI A;  3TYY A;  2FKW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...