1NOHA

The structure of bacteriophage phi29 scaffolding protein gp7 after prohead assembly
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
73
structure length
73
Chain Sequence
PLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKSHEKLAAEKDDLIVSNSKLFRQIGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords HEAD MORPHOGENESIS PROTEIN
publication title Bacteriophage f29 scaffolding protein gp7 before and after prohead assembly
pubmed doi rcsb
source organism Bacillus phage phi29
total genus 30
structure length 73
sequence length 73
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11418 Scaffolding_pro Phi29 scaffolding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.400 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nohA00
3MTUE 1NOHA 3OA7A 1NO4A 4IFFA
chains in the Genus database with same CATH superfamily
3JSVC 1A02J 1Q81Q 2PAJA 3N7NA 2RKLA 1OIPA 1NU1K 1M1KQ 1RF1C 4IOIH 4RESB 3BVHA 3B5NA 2Y0EA 2BCCE 5AVUB 3L72J 4KT0J 3CXHE 1VF5B 3AEFC 3OW2O 2ZT9B 1NYHA 5AW6B 1BDDA 4AYCA 1LTSC 2YKOA 3SFEC 1SQPK 3KPEA 3PRJA 3G6EP 4EOTA 5APWA 1U57A 3P8CD 1H8AA 1JUNA 2P10A 1FJPA 2YMYA 1EDLA 2O1JA 2N1TD 1OX3A 3PJSK 4YXWH 2P58A 1HGZA 4HKZH 1U7JA 1NTKG 1K05A 3JCUE 3TGUE 3MZWB 2CPBA 3AEBC 1NU1D 2POHA 4PD4I 3AE8C 3K5BA 2E74D 3GMAA 1GL2A 2R5BA 1YJNP 1YIJP 1AJYA 3H1JG 1AFOA 3MHVA 1KYOE 1NTKJ 3H1HE 3H1IE 2J59M 1SQBD 2FYUE 1NKNA 1URQB 2MKVA 1EC5A 3R4YA 1KN7A 4GT1A 2IFNA 3H1JJ 1K04A 2H88C 3AEGC 1M1JA 3HUSA 1GDTA 3M9HA 4U7JA 2JWDA 1K73Q 1M90Q 1ZR4A 2B87A 3C1LA 3RK2C 2L5GB 4NPDA 1N2DC 4IL6E 2W6JH 2XV5A 4DT0A 1G1JA 3TYYA 1RHZB 2FY8A 4GOEA 3Q3DA 2D2CB 2IBZE 1NTZK 4WY4A 3L37A 1L0NK 1PP9D 5H2FH 3CX5I 3C8VA 2RN0A 3L70G 1GD2E 2O01N 2AEJA 5CHXA 4IFFA 4U3FE 3AE1C 1M1JC 3IAOA 3KQGA 1DH3A 2Y0DA 5KJ7A 1JY3P 2QEXP 1DD3A 2WPSA 1NHLA 3CMAP 5CJ4A 3CCEP 3L70J 4Z1MH 1ZV8A 2E76C 3KDPB 4UB6H 1NKZB 5AVSB 1UIIA 1FZFA 3T97A 2XU6A 5KAIH 3CC7P 1AV1A 1FZAA 4B86A 1SQQD 1KILA 1OW7A 3TDKA 1SQBE 3M91A 1N8RQ 1SQVG 1M56D 1P84D 1EXJA 1VPCA 1NTZD 4A7PA 3KHUA 1L0ND 2OYIA 4BRYA 3CCSP 3ABVC 3LIEA 1SQVJ 2BEQD 4RJTA 3AEEC 3IF4A 1LNQA 1KB9D 1IK9A 1NTKK 4OVNF 1L0LG 1HGVA 2IX7C 3GG2A 2L91A 1KTMA 3NMDA 4BWNA 2ZYAA 3PH0A 1PZQA 3S4RA 1CI6A 2NPSB 2W90A 1JO5A 4WWIA 1LTJA 3USSA 1VQ5P 1IFJA 3ZDMA 3A0HE 3VMZA 2WSSH 1IFMA 3VYIA 2QM7A 3AE6C 2Q3EA 1M7LA 1PP9E 1VL2A 3U1CA 5C39A 1N73B 2WITA 5AW9B 4C7NB 1CW5A 2ZAEB 5L8RJ 3H1IJ 1H89A 4XA4A 1N7LA 3H1KG 2W83C 1PGOA 2OYIC 3CC4P 3GF7A 1W5CE 3HD7B 1EQ7A 1OZHA 1LJ2A 1JOCA 4H44B 3TSIA 2A45I 3H1KJ 1NTKD 1PL5A 1IFPA 4D6TG 2ZYGA 1HUCA 3CL3D 3RK2D 1OXZA 2AXTH 5AVXB 1P84H 3CI9A 1SQQE 5GTIH 3SSUA 5TISE 3H1JD 2FYNC 1FZGA 2E42A 2GUSA 1H88A 4U3FG 4RKUJ 3OAKA 4HB1A 1JCDA 2I1JA 1KB9H 1BSNA 1OMIA 2J5UA 1PFIA 3P8MC 1FAVA 1HTLC 3BCCD 1ZOYC 4U3FJ 1BDCA 3SWKA 2QM8A 3RL0B 5E79H 2WPQA 1S5LE 3CWBG 5B5EE 1J1EB 3WUTA 3D71A 3HRNA 2QG4A 4H0LB 3L35A 1BGYD 3L71G 4N6JA 1NO4A 2E76D 2YXRB 2M5AA 2A45G 1TU3F 3CWBJ 1SQVK 2WPVB 3Q5PA 2YO3A 3L71J 1OVVA 5CCGA 1Q7YQ 4ZNCA 3WUUA 1Q2NA 4GODA 1Q86Q 1USEA 3L4FA 2WT7A 2OTJP 2E75B 2ZXEB 3L70D 3KZIE 3O8ZA 2KI7B 1VF5C 1L0LK 2OYHB 3M9BA 4Y99B 2KNCB 2ZT9C 1BE3E 2W6AA 3B71A 1NAYA 4OGQB 1X22A 3TNUB 1LTTC 2HPCB 1URQA 2WSCJ 1AQ5A 3W67A 1ZR2A 1FBMA 4UB8E 1UIXA 2O01H 1SFCB 2ITAA 2P2UA 5DJTB 4IL6X 1BSHA 2O1KA 2IFMA 2WTYA 1YYCA 2JKVA 4TT3H 1RQVA 3QH9A 2QVAA 2XZRA 1VQ4P 1PV3A 3L74G 3VMAA 1KQSO 5CCGC 1FE6A 1VQ8P 1Q82Q 2KS1B 5AW7B 4EYYQ 2AEFA 2ZFCA 2XDJA 3VMYA 1BCCE 2H8PD 1NTME 1GTWA 3BCCE 1HJBA 4DCKA 3L74J 2KIKA 3D70A 1LP1B 1PGQA 1N7SB 2N9YB 1L0LD 2KLVA 1BGYE 4JBZA 2B89A 1URQC 4PD4H 3VN0A 1L4AB 3BASA 5B66H 1GW4A 4JYCA 2NRGA 1FC2C 1IZNB 1S72P 3L72G 4I6MC 5KLVD 1RH5B 1AQTA 1JM0A 2KZIA 2KXPB 1KZUB 1YQ3C 2WSFJ 2R3CA 5APTA 4DJGA 2YKPA 2E5TA 2OYOA 3HE5A 2M8RA 3L75G 4M3LA 3VMXA 1PPJG 5APYA 3GF3A 2LXCB 2QSIA 2IYOA 1DX7A 1JY3N 2D2CC 2A06E 2FFDB 3MD0A 1FDOA 1J1DB 1WMKA 1SQXG 4ZKPA 3L75J 1MKMA 2OQQA 3SWFA 1CZQA 5GTHE 5DJUB 4D6TD 3E7KA 3CMEP 3AE7C 3AEAC 1X8YA 2E5YA 5AVQB 1SQXJ 1ZRTD 3KXDA 1NVOA 1VQMP 3CX5H 1KILE 1RF0A 4PV1B 2NPSA 4GOFA 1SS1A 3JCUH 1R8EA 2KZJA 1FDMA 2WMMA 2KP8A 3RK3B 3M06A 2WPRA 3CPWO 3VOPA 1EZVE 2C9LY 1VDFA 1VF5D 1AVOA 1LT1A 1N73A 3PLNA 5AVRB 4W7ZA 1BE3J 2ZT9D 2RMZA 1E5WA 2GUVA 1SQPD 1JTHA 2ZYDA 2R32A 3HD7A 5KLVE 2ZXXA 3AE3C 1YJ9P 3CXHI 4W7YA 5AW4B 1DEBA 1M8OB 3MTUE 2HFED 5CCHC 1HBWA 3D6ZA 3Q2YA 5EFWB 3L73G 1RF0C 1EDIA 1MV8A 2NPSC 2AEMA 1LGHB 5CCGD 3HE4A 2OGUA 4JF7A 4I7ZB 4IFMA 2M3BA 2YMKA 3GHGB 1KQFB 1U7MA 3G4SP 3L73J 3R2PA 1OVRA 1NTMJ 1IC2A 2R3SA 1N73C 2PRRA 3H1LD 3P8CE 1VQLP 1S5LX 4R4LA 3AECC 4MN4C 2V7QH 2KYVA 4KHXA 5H2FE 1URQD 2QJPB 3HD7C 3V5BA 3A2AA 1ZRTE 1PGPA 2BCCG 2Q7CA 4H44C 2OTKE 2I1KA 1KYOI 1K9MQ 1NU1E 3HTKB 2WVRA 5AVZB 1IFIA 3EFFK 1WT6A 2YXQB 5KLIB 1VQPP 2G8YA 3PP5A 2JEEA 2BCCJ 2HG5D 4UB6E 5KKZB 2Q1KA 3B5NB 2HR3A 2N9BA 1SQXK 1LT9B 2JO1A 2A45H 2IPPA 5KAIE 4PJ0H 3FXDA 1NAFA 1HWTC 2D2CD 3H6PA 1SQPE 2C9NY 2WSEH 4OH8B 2OYHA 2AXCA 3MGNA 2FBWC 2KNCA 3TGUG 2MJZA 3L72D 2BEZF 3RL0C 2WSCH 4ASWA 3TNUA 2UWJE 2FXPA 1J1EC 3M0AA 3L36A 2HPCA 3H32A 1YBKA 4H0LC 2IBZI 1D7MA 4K35A 2WQYC 1YI2P 1SFCA 1X9VA 3TGUJ 1VQ7P 4LLHA 4XE5B 3H1HG 3H1IG 2FYUG 2Z4EA 1N86A 3H25A 1YQ4C 2K9JB 3H1LE 1IFDA 5M1BA 2G3AA 5TJHA 1LWUB 1GL2B 1DIPA 4WB4A 3H1HJ 1KV4A 1QVFO 2KB7P 3NFQA 1FJKA 2E75C 2FYUJ 2QJYB 4YTPC 1NWQA 4H13B 1S9KD 2OYHC 2E43A 1QEXA 3E1IA 4Y99C 3AE9C 1N7SA 2M3EA 4OGQC 1T2KC 1YJWP 3HUSB 5CCHD 3G9RA 3PTZA 1MFZA 2B9BA 1SFCC 2Q5UA 2H7HA 2IBZG 2OARA 3W68A 3V4QA 2NPSD 2KK7A 2JR8A 1GMJA 2QJKB 3P32A 4IFDK 2WSFH 1RE3A 1P84E 5GTIE 1ZXGA 1NTZE 4N78D 2C0XA 1L0NE 1KORA 3RL0g 2CK3H 2KUBA 1ZN5A 3EQ2A 1QL1A 1G2CB 1KB9E 2ZVOB 4WY4B 3MUDA 3VP8A 1VQ6P 1HH0A 3C9IA 1OFCX 5CJ0A 1N7SC 2FFDA 2FXMA 1JY2O 3JC22 3HD7D 2Z5HA 4EIJA 1ZLLA 2JJLA 3L73D 3WU2H 5E79E 4H44D 1L4AC 2QE7H 1AA0A 1JNMA 1EDJA 1NU1J 1SQBG 1RE4A 4L74A 1NGMB 1FZCB 3V4WA 4PD4D 5BU5A 3CCLP 1RE3C 3Q5RA 3NXSA 3B8EB 1SQBJ 5AVVB 4WVZA 2K37A 3CCRP 1KFNA 5AVYB 1MZ9A 1KILB 1S9KE 4L73A 1YITP 4RO0A 2KSJA 3MUDC 1JMMA 2GM4A 3V2PA 4L76A 2QIWA 3UIAA 1XTGB 2FFDC 1J1DC 1NTKE 1QL2A 3A3YB 3O6QB 3CXHD 3RL0D 2ZVNB 3V6IA 2PFXA 2FYUK 2YIUB 5CBOA 4H0LD 1RE4C 1PP9G 5BU8B 3H1JE 1OWAA 3LW5J 2CPSA 1G1IA 1RY3A 1J2JB 4NPEA 1CI6B 1KMIZ 3A0BH 1SQVD 1R5LA 4PV1C 1LTJB 4N78E 4HYTB 1PP9J 3I56P 3RBZA 4R4MA 3AE2C 4AUWA 3CX5D 3RK3C 4EI2A 2E75D 3TGUD 2P7JA 4K3AA 1GZLA 3AEDC 5KTBA 3CCJP 1SQQG 5KAFE 1DEEG 4OGQD 1T2KD 2VRSA 3CCMP 1KYOD 4GIFA 4PD4E 3H1HD 3H1ID 4C46A 2XNDH 1Z56A 3Q1MA 1NTZG 1SFCD 5B66E 2N1TB 1SQQJ 2W27A 3CLQA 2FXOA 3L70E 1USDA 4LGDE 2PGDA 3H1KD 1CSBA 2O3JA 1NTZJ 2E74B 4I7ZC 2B88A 3I55P 3CXHH 1L0NJ 3GHGC 1LT9A 4YPCA 5AVTB 2IZ0A 1KD1Q 3CD6P 4TLFA 1SQBK 3TF5A 1N7SD 3G3ZA 5APUA 1M57D 2K9YA 3RGUA 5GTHH 2QJPC 3A7OA 2IBZD 4QMAA 3S9OA 3G71P 1L4AD 5CCHA 3FWNA 1FOSE 1SQVE 4O9BA 5AW2B 3AE4C 2R5DA 2M5AB 3BRVB 4U3FD 1JEKA 2C0WA 5KLIC 3NTNA 5APVA 3CX5E 3OA7A 1QVGO 1BE3G 1EXIA 1SVFA 3LIDA 5KKZC 2K9JA 3B5NC 1LT9C 1L0LE 5APQA 3S1KA 1KYOH 4OWFA 2WT7B 1PGJA 2FYZA 4DZOA 3CWBD 1LWUA 1LTAC 4C7NA 2LR2A 1VQOP 2WWWA 1FOSF 3TK1A 3L71D 1QLED 5AW8B 1GU4A 1KQGB 2DW3A 1QX8A 2Y9YA 4HJGH 2BASA 4JQ0D 1KC8Q 1WRGA 1FS0E 2IYPA 1BCCG 2QRXA 1NTMG 1LTBC 3BCCG 3U59A 2O01J 3H1KE 4IL6H 2YNYA 4HH2A 4PV1D 1NJIQ 1RF1B 1BGYG 3F5HA 1LTGC 1BCCJ 3CC2P 3BCCJ 3RK3D 1SQQK 3IFMA 1H0TB 1IO4A 2KSEA 1LWUC 3PHLA 1GL2C 4D6TE 4JYBA 5AW5B 2QJYC 1BGYJ 1S4XA 1G2CA 4C7RA 1GK4A 3CCQP 2J58A 4H13C 4NPFX 1VQKP 2HYNA 3Q5SA 2HODB 1PIXA 3MP7B 1JY2N 1YHQP 2FKWB 1IJDB 3L74D 1EZVI 1T3UA 3HUSC 3VTPC 1FDIA 1HF9A 3WUVA 3E1RA 1FZCA 2A06G 1FZEA 2P1JA 4DOJA 2QJKC 3FX0A 3FWLA 3CWBE 2SPZA 4ZKUA 3HE5B 1HVVA 2PP6A 3L71E 3RBXA 4KJMA 3GLMA 3P7KA 2H43A 2W8ZA 4PJ0E 2Q3IA 1S1CX 1JY3O 1GU5A 1ZMEC 1AVYA 4WY4C 3BRTB 5APSA 3F89A 5CMZA 3O6QA 2YKQA 1GK6A 3OJAB 5KJ7C 3LW5H 1EZVG 3V2RA 4I1LA 3L75D 1YTZT 1FZCC 3KYQA 1PPJD 3RK2B 4BXLA 1JMBA 2K88A 2HLOA 1E79H 3RK3E 3GW6A 3FGAD 3CCUP 3A0HH 4YXDC 4AQRD 1EDKA 3B5ND 1SQXD 3WMM0 1L0LJ 3CCVP 2KS1A 5KLVG 2M0BA 1OW6A 1KILC 1LTIC 1W2EA 2OTLP 1SLQA 5AW3B 1LP1A 2ZJSE 1X79B 3N4XA 1NTMK 3SWYA 4EDFA 3L74E 5KLVJ 1M1JB 1FZBA 1JTHB 3IR9A 1L4AA 4GDOA 2YIUC 4W80A 5K5GB 2B87B 1T8ZA 5CBNA 1BE3D 2E76B 1JY2P 2N1TA 5TISH 2AXTE 2RH0A 2WZ7A 3M9QA 1IK7A 4XFJA 3V2NA 1LTJC 3HE4B 5AVWB 4Y28J 1KFMA 2Q9IA 3A5TA 1Y47A 3SFDC 3M0DA 4GKGA 1GL2D 1OVUA 4D6TJ 3L72E 2LKMA 4I2LC 1NU1G 3B4SA 4WBAA 1RQUA 4H13D 1A02F 1S5LH 5B5EH 1JB0J 1BCCD 4ASVA 2V7QJ 1NTMD 3BATA 1Y8AA 2KOGA 3MIWA 1SP4A 3L75E 2IZ1A 1PPJE 2Y0CA 1OW8A 2YO2A 3WU2E 3ITKA 1SQPG 2N1TC 1FU1A 3T97B 2K3RA 1SQXE 4JPZB 1NOHA 3II6A 3AE5C 2JDIH 3VP9A 1S2EA 4CPGA 1DD4A 1L2PA 1T6AA 2E74C 2KLUA 3KZIH 2XNXA 3M0DC 1SQPJ 1R5SA 2NZ2A 3FXEA 1XTCC 1QGKB 2BCCD 1X0TA 4WY4D 2OYIB 4BRYB 2Y9ZA 3U1AA 3V2QA 2H89C 2WSEJ 2V4HA 1P84I 4UB8H 2JWAA 1ZW0A 4ZMDA 2A06D 2W6BA 3H1LG 5KJ7D 3H32B 1Y9BA 1JCCA 3EFGA 1VQ9P 4L75A 1KB9I 5KLVK 1S3JA 2IDBA 3QWOC 4N3YB 1IFNA 1Q90D 1KQLA 3H1LJ 2FYNB 3A0BE 3EWKA 1YTZI 5AW0B 1RF1A 4LC1A 3GHGA 3D6YA 2GA1A 1W2BO 1KILD 3IN6A 1MUUA 1H0TA 1GW3A 3L73E 2QA4P 2Z5IA 2XKMA 5BVZA 1T3JA 2I8DA 2LXBA 5AW1B 1MFTA 5KAFH 1EZVD 1HJ0A 2P67A 2HODA 2R44A 2FYUD 2JP3A 1VQNP 2K1AA 1K8AQ 1NH4A 2Q6QA 1L0NG 5APXA 3HTKA 3I5CA 1ZP0C
chains in the Genus database with same CATH topology
1LTBC 2A45G 3U59A 1A02J 2PAJA 1SFCA 1X9VA 3N7NA 4LLHA 4XE5B 1SQVK 2YNYA 4HH2A 1NU1K 1RF1B 2Z4EA 1N86A 1RF1C 2YO3A 4RESB 3BVHA 1LTGC 3B5NA 5CCGA 1IFDA 3RK3D 1SQQK 3IFMA 1LWUB 3L4FA 1GL2B 1IO4A 2WT7A 5AVUB 4WB4A 1LWUC 1GL2C 2ZXEB 2KB7P 3NFQA 1FJKA 3O8ZA 4JYBA 5AW5B 1L0LK 1NWQA 2OYHB 3M9BA 1G2CA 2OYHC 4C7RA 1S9KD 1GK4A 2E43A 4Y99B 2J58A 5AW6B 4AYCA 3E1IA 4Y99C 1LTSC 2YKOA 2HYNA 2W6AA 1SQPK 3KPEA 1N7SA 2HODB 3TNUB 1LTTC 1T2KC 1JY2N 1URQA 2HPCB 4EOTA 1AQ5A 2FKWB 1IJDB 1ZR2A 1FBMA 5APWA 3HUSB 3P8CD 1T3UA 3HUSC 1H8AA 5CCHD 3VTPC 1JUNA 1FJPA 2O01H 1SFCB 1MFZA 2P2UA 2YMYA 1SFCC 2O1JA 2Q5UA 2H7HA 2OARA 2N1TD 2O1KA 2IFMA 2WTYA 3V4QA 2NPSD 1YYCA 1FZCA 1HGZA 1FZEA 2P1JA 4DOJA 2XZRA 3P32A 5CCGC 4IFDK 2WSFH 1RE3A 2CPBA 2POHA 4ZKUA 3HE5B 1GL2A 2R5BA 1HVVA 2PP6A 4N78D 5AW7B 2C0XA 2ZFCA 2XDJA 3VMYA 3P7KA 2H43A 2H8PD 1GTWA 1HJBA 1AFOA 1ZN5A 2Q3IA 1QL1A 3EQ2A 1G2CB 1JY3O 1GU5A 4WY4B 3MUDA 3VP8A 1HH0A 4WY4C 3BRTB 2J59M 3C9IA 1N7SB 5CJ0A 2KLVA 1N7SC 2FFDA 2FXMA 1JY2O 1NKNA 1URQB 5APSA 3HD7D 1URQC 2Z5HA 4EIJA 1ZLLA 4GT1A 2IFNA 2JJLA 3VN0A 1M1JA 5CMZA 3HUSA 1L4AB 3BASA 2YKQA 1GK6A 1GDTA 1L4AC 3M9HA 3OJAB 1GW4A 5KJ7C 4JYCA 1JNMA 1RE4A 3LW5H 3V2RA 4I1LA 1FZCB 4I6MC 1ZR4A 1YTZT 3V4WA 3KYQA 1FZCC 3RK2B 5BU5A 3RK2C 2HLOA 2L5GB 1KZUB 1N2DC 1RE3C 2R3CA 5APTA 3NXSA 3B8EB 5AVVB 4AQRD 2YKPA 3B5ND 2XV5A 3WMM0 3HE5A 2M8RA 1KFNA 4M3LA 5AVYB 1MZ9A 1G1JA 1KILB 3VMXA 1S9KE 1KILC 3TYYA 5APYA 1LTIC 1W2EA 2KSJA 1DX7A 1NTZK 1JY3N 4WY4A 1JMMA 3L37A 2GM4A 1SLQA 1L0NK 3V2PA 5AW3B 2FFDB 3MD0A 1J1DB 1X79B 3N4XA 1XTGB 3UIAA 1NTMK 3SWYA 2FFDC 1J1DC 1QL2A 4ZKPA 1GD2E 5CHXA 4IFFA 1M1JB 1FZBA 3SWFA 1JTHB 3A3YB 1CZQA 1M1JC 3RL0D 3KQGA 2FYUK 3IR9A 1L4AA 1DH3A 5KJ7A 1JY3P 1RE4C 5BU8B 2WPSA 1NHLA 1X8YA 1OWAA 4W80A 5CJ4A 2CPSA 1G1IA 1RY3A 1T8ZA 5AVQB 1J2JB 1ZV8A 1JY2P 1CI6B 2N1TA 1RF0A 3KDPB 1NKZB 2NPSA 5AVSB 1LTJB 4N78E 3T97A 1FZFA 2WZ7A 3M9QA 4HYTB 3V2NA 1LTJC 3HE4B 5AVWB 2XU6A 1FDMA 1KFMA 2Q9IA 2KP8A 3RK3B 3A5TA 1FZAA 4B86A 4AUWA 3RK3C 1KILA 3M06A 3M0DA 2WPRA 1GL2D 4GKGA 3VOPA 3M91A 2LKMA 4I2LC 2C9LY 1VDFA 2P7JA 4WBAA 1GZLA 1N73A 5AVRB 5KTBA 4W7ZA 1VPCA 1A02F 1E5WA 2OYIA 2GUVA 1JTHA 2R32A 3BATA 1T2KD 2VRSA 2KOGA 3LIEA 3MIWA 1SP4A 3HD7A 1IK9A 1NTKK 4GIFA 4C46A 4W7YA 1HGVA 2IX7C 5AW4B 1DEBA 1Z56A 3MTUE 2HFED 5CCHC 1HBWA 2YO2A 1SFCD 3NMDA 2N1TB 2N1TC 1CI6A 2NPSB 1RF0C 1FU1A 1MV8A 2W27A 2NPSC 3CLQA 1JO5A 1NOHA 3II6A 1LGHB 1LTJA 3VP9A 5CCGD 3HE4A 4LGDE 4JF7A 1CSBA 4IFMA 1IFJA 2M3BA 3VMZA 1IFMA 3GHGB 3VYIA 2QM7A 2XNXA 3M0DC 3GHGC 1M7LA 3R2PA 1LT9A 1IC2A 5AVTB 3U1CA 1XTCC 1N73B 2WITA 5AW9B 4C7NB 1CW5A 1N73C 1H89A 4XA4A 1N7LA 3P8CE 4WY4D 1SQBK 2OYIB 3U1AA 2OYIC 1N7SD 3V2QA 3G3ZA 2KYVA 5APUA 3HD7B 4KHXA 1URQD 1EQ7A 3HD7C 3V5BA 3A2AA 3A7OA 1JOCA 2W6BA 1L4AD 5CCHA 2Q7CA 5KJ7D 3TSIA 2A45I 3H32B 1FOSE 4O9BA 1JCCA 2I1KA 3EFGA 5AW2B 3HTKB 2R5DA 3BRVB 5AVZB 5KLVK 1IFIA 1WT6A 1HUCA 4N3YB 3CL3D 3RK2D 1IFNA 2C0WA 1OXZA 3PP5A 2JEEA 1KQLA 3NTNA 5APVA 5AVXB 3CI9A 3OA7A 1YTZI 2E42A 2HG5D 5AW0B 1FZGA 1RF1A 1SVFA 3B5NB 2N9BA 3LIDA 1SQXK 4LC1A 1LT9B 3GHGA 2GUSA 3B5NC 1LT9C 2A45H 1H88A 2IPPA 3OAKA 5APQA 1JCDA 2I1JA 1KILD 1NAFA 2WT7B 2FYZA 4DZOA 1MUUA 1LWUA 1LTAC 4C7NA 1HWTC 1GW3A 2WWWA 3H6PA 1FOSF 2Z5IA 3TK1A 1PFIA 3P8MC 1FAVA 2XKMA 5BVZA 2C9NY 2WSEH 5AW8B 4OH8B 1T3JA 1GU4A 1HTLC 2OYHA 5AW1B 3MGNA 2QM8A 2MJZA 3RL0B 2BASA 2P67A 2WPQA 3RL0C 1J1EB 2HODA 2WSCH 3TNUA 3M0AA 1J1EC 3HRNA 3L36A 2HPCA 1NH4A 3L35A 3H32A 1WRGA 4N6JA 5APXA 3HTKA 3I5CA 1NO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MTU E;  1NOH A;  3OA7 A;  1NO4 A;  4IFF A; 
#chains in the Genus database with same CATH topology
 3JSV C;  1A02 J;  1Q81 Q;  2PAJ A;  3N7N A;  2RKL A;  1OIP A;  1NU1 K;  1M1K Q;  1RF1 C;  4IOI H;  4RES B;  3BVH A;  3B5N A;  2Y0E A;  2BCC E;  5AVU B;  3L72 J;  4KT0 J;  3CXH E;  1VF5 B;  3AEF C;  3OW2 O;  2ZT9 B;  1NYH A;  5AW6 B;  1BDD A;  4AYC A;  1LTS C;  2YKO A;  3SFE C;  1SQP K;  3KPE A;  3PRJ A;  3G6E P;  4EOT A;  5APW A;  1U57 A;  3P8C D;  1H8A A;  1JUN A;  2P10 A;  1FJP A;  2YMY A;  1EDL A;  2O1J A;  2N1T D;  1OX3 A;  3PJS K;  4YXW H;  2P58 A;  1HGZ A;  4HKZ H;  1U7J A;  1NTK G;  1K05 A;  3JCU E;  3TGU E;  3MZW B;  2CPB A;  3AEB C;  1NU1 D;  2POH A;  4PD4 I;  3AE8 C;  3K5B A;  2E74 D;  3GMA A;  1GL2 A;  2R5B A;  1YJN P;  1YIJ P;  1AJY A;  3H1J G;  1AFO A;  3MHV A;  1KYO E;  1NTK J;  3H1H E;  3H1I E;  2J59 M;  1SQB D;  2FYU E;  1NKN A;  1URQ B;  2MKV A;  1EC5 A;  3R4Y A;  1KN7 A;  4GT1 A;  2IFN A;  3H1J J;  1K04 A;  2H88 C;  3AEG C;  1M1J A;  3HUS A;  1GDT A;  3M9H A;  4U7J A;  2JWD A;  1K73 Q;  1M90 Q;  1ZR4 A;  2B87 A;  3C1L A;  3RK2 C;  2L5G B;  4NPD A;  1N2D C;  4IL6 E;  2W6J H;  2XV5 A;  4DT0 A;  1G1J A;  3TYY A;  1RHZ B;  2FY8 A;  4GOE A;  3Q3D A;  2D2C B;  2IBZ E;  1NTZ K;  4WY4 A;  3L37 A;  1L0N K;  1PP9 D;  5H2F H;  3CX5 I;  3C8V A;  2RN0 A;  3L70 G;  1GD2 E;  2O01 N;  2AEJ A;  5CHX A;  4IFF A;  4U3F E;  3AE1 C;  1M1J C;  3IAO A;  3KQG A;  1DH3 A;  2Y0D A;  5KJ7 A;  1JY3 P;  2QEX P;  1DD3 A;  2WPS A;  1NHL A;  3CMA P;  5CJ4 A;  3CCE P;  3L70 J;  4Z1M H;  1ZV8 A;  2E76 C;  3KDP B;  4UB6 H;  1NKZ B;  5AVS B;  1UII A;  1FZF A;  3T97 A;  2XU6 A;  5KAI H;  3CC7 P;  1AV1 A;  1FZA A;  4B86 A;  1SQQ D;  1KIL A;  1OW7 A;  3TDK A;  1SQB E;  3M91 A;  1N8R Q;  1SQV G;  1M56 D;  1P84 D;  1EXJ A;  1VPC A;  1NTZ D;  4A7P A;  3KHU A;  1L0N D;  2OYI A;  4BRY A;  3CCS P;  3ABV C;  3LIE A;  1SQV J;  2BEQ D;  4RJT A;  3AEE C;  3IF4 A;  1LNQ A;  1KB9 D;  1IK9 A;  1NTK K;  4OVN F;  1L0L G;  1HGV A;  2IX7 C;  3GG2 A;  2L91 A;  1KTM A;  3NMD A;  4BWN A;  2ZYA A;  3PH0 A;  1PZQ A;  3S4R A;  1CI6 A;  2NPS B;  2W90 A;  1JO5 A;  4WWI A;  1LTJ A;  3USS A;  1VQ5 P;  1IFJ A;  3ZDM A;  3A0H E;  3VMZ A;  2WSS H;  1IFM A;  3VYI A;  2QM7 A;  3AE6 C;  2Q3E A;  1M7L A;  1PP9 E;  1VL2 A;  3U1C A;  5C39 A;  1N73 B;  2WIT A;  5AW9 B;  4C7N B;  1CW5 A;  2ZAE B;  5L8R J;  3H1I J;  1H89 A;  4XA4 A;  1N7L A;  3H1K G;  2W83 C;  1PGO A;  2OYI C;  3CC4 P;  3GF7 A;  1W5C E;  3HD7 B;  1EQ7 A;  1OZH A;  1LJ2 A;  1JOC A;  4H44 B;  3TSI A;  2A45 I;  3H1K J;  1NTK D;  1PL5 A;  1IFP A;  4D6T G;  2ZYG A;  1HUC A;  3CL3 D;  3RK2 D;  1OXZ A;  2AXT H;  5AVX B;  1P84 H;  3CI9 A;  1SQQ E;  5GTI H;  3SSU A;  5TIS E;  3H1J D;  2FYN C;  1FZG A;  2E42 A;  2GUS A;  1H88 A;  4U3F G;  4RKU J;  3OAK A;  4HB1 A;  1JCD A;  2I1J A;  1KB9 H;  1BSN A;  1OMI A;  2J5U A;  1PFI A;  3P8M C;  1FAV A;  1HTL C;  3BCC D;  1ZOY C;  4U3F J;  1BDC A;  3SWK A;  2QM8 A;  3RL0 B;  5E79 H;  2WPQ A;  1S5L E;  3CWB G;  5B5E E;  1J1E B;  3WUT A;  3D71 A;  3HRN A;  2QG4 A;  4H0L B;  3L35 A;  1BGY D;  3L71 G;  4N6J A;  1NO4 A;  2E76 D;  2YXR B;  2M5A A;  2A45 G;  1TU3 F;  3CWB J;  1SQV K;  2WPV B;  3Q5P A;  2YO3 A;  3L71 J;  1OVV A;  5CCG A;  1Q7Y Q;  4ZNC A;  3WUU A;  1Q2N A;  4GOD A;  1Q86 Q;  1USE A;  3L4F A;  2WT7 A;  2OTJ P;  2E75 B;  2ZXE B;  3L70 D;  3KZI E;  3O8Z A;  2KI7 B;  1VF5 C;  1L0L K;  2OYH B;  3M9B A;  4Y99 B;  2KNC B;  2ZT9 C;  1BE3 E;  2W6A A;  3B71 A;  1NAY A;  4OGQ B;  1X22 A;  3TNU B;  1LTT C;  2HPC B;  1URQ A;  2WSC J;  1AQ5 A;  3W67 A;  1ZR2 A;  1FBM A;  4UB8 E;  1UIX A;  2O01 H;  1SFC B;  2ITA A;  2P2U A;  5DJT B;  4IL6 X;  1BSH A;  2O1K A;  2IFM A;  2WTY A;  1YYC A;  2JKV A;  4TT3 H;  1RQV A;  3QH9 A;  2QVA A;  2XZR A;  1VQ4 P;  1PV3 A;  3L74 G;  3VMA A;  1KQS O;  5CCG C;  1FE6 A;  1VQ8 P;  1Q82 Q;  2KS1 B;  5AW7 B;  4EYY Q;  2AEF A;  2ZFC A;  2XDJ A;  3VMY A;  1BCC E;  2H8P D;  1NTM E;  1GTW A;  3BCC E;  1HJB A;  4DCK A;  3L74 J;  2KIK A;  3D70 A;  1LP1 B;  1PGQ A;  1N7S B;  2N9Y B;  1L0L D;  2KLV A;  1BGY E;  4JBZ A;  2B89 A;  1URQ C;  4PD4 H;  3VN0 A;  1L4A B;  3BAS A;  5B66 H;  1GW4 A;  4JYC A;  2NRG A;  1FC2 C;  1IZN B;  1S72 P;  3L72 G;  4I6M C;  5KLV D;  1RH5 B;  1AQT A;  1JM0 A;  2KZI A;  2KXP B;  1KZU B;  1YQ3 C;  2WSF J;  2R3C A;  5APT A;  4DJG A;  2YKP A;  2E5T A;  2OYO A;  3HE5 A;  2M8R A;  3L75 G;  4M3L A;  3VMX A;  1PPJ G;  5APY A;  3GF3 A;  2LXC B;  2QSI A;  2IYO A;  1DX7 A;  1JY3 N;  2D2C C;  2A06 E;  2FFD B;  3MD0 A;  1FDO A;  1J1D B;  1WMK A;  1SQX G;  4ZKP A;  3L75 J;  1MKM A;  2OQQ A;  3SWF A;  1CZQ A;  5GTH E;  5DJU B;  4D6T D;  3E7K A;  3CME P;  3AE7 C;  3AEA C;  1X8Y A;  2E5Y A;  5AVQ B;  1SQX J;  1ZRT D;  3KXD A;  1NVO A;  1VQM P;  3CX5 H;  1KIL E;  1RF0 A;  4PV1 B;  2NPS A;  4GOF A;  1SS1 A;  3JCU H;  1R8E A;  2KZJ A;  1FDM A;  2WMM A;  2KP8 A;  3RK3 B;  3M06 A;  2WPR A;  3CPW O;  3VOP A;  1EZV E;  2C9L Y;  1VDF A;  1VF5 D;  1AVO A;  1LT1 A;  1N73 A;  3PLN A;  5AVR B;  4W7Z A;  1BE3 J;  2ZT9 D;  2RMZ A;  1E5W A;  2GUV A;  1SQP D;  1JTH A;  2ZYD A;  2R32 A;  3HD7 A;  5KLV E;  2ZXX A;  3AE3 C;  1YJ9 P;  3CXH I;  4W7Y A;  5AW4 B;  1DEB A;  1M8O B;  3MTU E;  2HFE D;  5CCH C;  1HBW A;  3D6Z A;  3Q2Y A;  5EFW B;  3L73 G;  1RF0 C;  1EDI A;  1MV8 A;  2NPS C;  2AEM A;  1LGH B;  5CCG D;  3HE4 A;  2OGU A;  4JF7 A;  4I7Z B;  4IFM A;  2M3B A;  2YMK A;  3GHG B;  1KQF B;  1U7M A;  3G4S P;  3L73 J;  3R2P A;  1OVR A;  1NTM J;  1IC2 A;  2R3S A;  1N73 C;  2PRR A;  3H1L D;  3P8C E;  1VQL P;  1S5L X;  4R4L A;  3AEC C;  4MN4 C;  2V7Q H;  2KYV A;  4KHX A;  5H2F E;  1URQ D;  2QJP B;  3HD7 C;  3V5B A;  3A2A A;  1ZRT E;  1PGP A;  2BCC G;  2Q7C A;  4H44 C;  2OTK E;  2I1K A;  1KYO I;  1K9M Q;  1NU1 E;  3HTK B;  2WVR A;  5AVZ B;  1IFI A;  3EFF K;  1WT6 A;  2YXQ B;  5KLI B;  1VQP P;  2G8Y A;  3PP5 A;  2JEE A;  2BCC J;  2HG5 D;  4UB6 E;  5KKZ B;  2Q1K A;  3B5N B;  2HR3 A;  2N9B A;  1SQX K;  1LT9 B;  2JO1 A;  2A45 H;  2IPP A;  5KAI E;  4PJ0 H;  3FXD A;  1NAF A;  1HWT C;  2D2C D;  3H6P A;  1SQP E;  2C9N Y;  2WSE H;  4OH8 B;  2OYH A;  2AXC A;  3MGN A;  2FBW C;  2KNC A;  3TGU G;  2MJZ A;  3L72 D;  2BEZ F;  3RL0 C;  2WSC H;  4ASW A;  3TNU A;  2UWJ E;  2FXP A;  1J1E C;  3M0A A;  3L36 A;  2HPC A;  3H32 A;  1YBK A;  4H0L C;  2IBZ I;  1D7M A;  4K35 A;  2WQY C;  1YI2 P;  1SFC A;  1X9V A;  3TGU J;  1VQ7 P;  4LLH A;  4XE5 B;  3H1H G;  3H1I G;  2FYU G;  2Z4E A;  1N86 A;  3H25 A;  1YQ4 C;  2K9J B;  3H1L E;  1IFD A;  5M1B A;  2G3A A;  5TJH A;  1LWU B;  1GL2 B;  1DIP A;  4WB4 A;  3H1H J;  1KV4 A;  1QVF O;  2KB7 P;  3NFQ A;  1FJK A;  2E75 C;  2FYU J;  2QJY B;  4YTP C;  1NWQ A;  4H13 B;  1S9K D;  2OYH C;  2E43 A;  1QEX A;  3E1I A;  4Y99 C;  3AE9 C;  1N7S A;  2M3E A;  4OGQ C;  1T2K C;  1YJW P;  3HUS B;  5CCH D;  3G9R A;  3PTZ A;  1MFZ A;  2B9B A;  1SFC C;  2Q5U A;  2H7H A;  2IBZ G;  2OAR A;  3W68 A;  3V4Q A;  2NPS D;  2KK7 A;  2JR8 A;  1GMJ A;  2QJK B;  3P32 A;  4IFD K;  2WSF H;  1RE3 A;  1P84 E;  5GTI E;  1ZXG A;  1NTZ E;  4N78 D;  2C0X A;  1L0N E;  1KOR A;  3RL0 g;  2CK3 H;  2KUB A;  1ZN5 A;  3EQ2 A;  1QL1 A;  1G2C B;  1KB9 E;  2ZVO B;  4WY4 B;  3MUD A;  3VP8 A;  1VQ6 P;  1HH0 A;  3C9I A;  1OFC X;  5CJ0 A;  1N7S C;  2FFD A;  2FXM A;  1JY2 O;  3JC2 2;  3HD7 D;  2Z5H A;  4EIJ A;  1ZLL A;  2JJL A;  3L73 D;  3WU2 H;  5E79 E;  4H44 D;  1L4A C;  2QE7 H;  1AA0 A;  1JNM A;  1EDJ A;  1NU1 J;  1SQB G;  1RE4 A;  4L74 A;  1NGM B;  1FZC B;  3V4W A;  4PD4 D;  5BU5 A;  3CCL P;  1RE3 C;  3Q5R A;  3NXS A;  3B8E B;  1SQB J;  5AVV B;  4WVZ A;  2K37 A;  3CCR P;  1KFN A;  5AVY B;  1MZ9 A;  1KIL B;  1S9K E;  4L73 A;  1YIT P;  4RO0 A;  2KSJ A;  3MUD C;  1JMM A;  2GM4 A;  3V2P A;  4L76 A;  2QIW A;  3UIA A;  1XTG B;  2FFD C;  1J1D C;  1NTK E;  1QL2 A;  3A3Y B;  3O6Q B;  3CXH D;  3RL0 D;  2ZVN B;  3V6I A;  2PFX A;  2FYU K;  2YIU B;  5CBO A;  4H0L D;  1RE4 C;  1PP9 G;  5BU8 B;  3H1J E;  1OWA A;  3LW5 J;  2CPS A;  1G1I A;  1RY3 A;  1J2J B;  4NPE A;  1CI6 B;  1KMI Z;  3A0B H;  1SQV D;  1R5L A;  4PV1 C;  1LTJ B;  4N78 E;  4HYT B;  1PP9 J;  3I56 P;  3RBZ A;  4R4M A;  3AE2 C;  4AUW A;  3CX5 D;  3RK3 C;  4EI2 A;  2E75 D;  3TGU D;  2P7J A;  4K3A A;  1GZL A;  3AED C;  5KTB A;  3CCJ P;  1SQQ G;  5KAF E;  1DEE G;  4OGQ D;  1T2K D;  2VRS A;  3CCM P;  1KYO D;  4GIF A;  4PD4 E;  3H1H D;  3H1I D;  4C46 A;  2XND H;  1Z56 A;  3Q1M A;  1NTZ G;  1SFC D;  5B66 E;  2N1T B;  1SQQ J;  2W27 A;  3CLQ A;  2FXO A;  3L70 E;  1USD A;  4LGD E;  2PGD A;  3H1K D;  1CSB A;  2O3J A;  1NTZ J;  2E74 B;  4I7Z C;  2B88 A;  3I55 P;  3CXH H;  1L0N J;  3GHG C;  1LT9 A;  4YPC A;  5AVT B;  2IZ0 A;  1KD1 Q;  3CD6 P;  4TLF A;  1SQB K;  3TF5 A;  1N7S D;  3G3Z A;  5APU A;  1M57 D;  2K9Y A;  3RGU A;  5GTH H;  2QJP C;  3A7O A;  2IBZ D;  4QMA A;  3S9O A;  3G71 P;  1L4A D;  5CCH A;  3FWN A;  1FOS E;  1SQV E;  4O9B A;  5AW2 B;  3AE4 C;  2R5D A;  2M5A B;  3BRV B;  4U3F D;  1JEK A;  2C0W A;  5KLI C;  3NTN A;  5APV A;  3CX5 E;  3OA7 A;  1QVG O;  1BE3 G;  1EXI A;  1SVF A;  3LID A;  5KKZ C;  2K9J A;  3B5N C;  1LT9 C;  1L0L E;  5APQ A;  3S1K A;  1KYO H;  4OWF A;  2WT7 B;  1PGJ A;  2FYZ A;  4DZO A;  3CWB D;  1LWU A;  1LTA C;  4C7N A;  2LR2 A;  1VQO P;  2WWW A;  1FOS F;  3TK1 A;  3L71 D;  1QLE D;  5AW8 B;  1GU4 A;  1KQG B;  2DW3 A;  1QX8 A;  2Y9Y A;  4HJG H;  2BAS A;  4JQ0 D;  1KC8 Q;  1WRG A;  1FS0 E;  2IYP A;  1BCC G;  2QRX A;  1NTM G;  1LTB C;  3BCC G;  3U59 A;  2O01 J;  3H1K E;  4IL6 H;  2YNY A;  4HH2 A;  4PV1 D;  1NJI Q;  1RF1 B;  1BGY G;  3F5H A;  1LTG C;  1BCC J;  3CC2 P;  3BCC J;  3RK3 D;  1SQQ K;  3IFM A;  1H0T B;  1IO4 A;  2KSE A;  1LWU C;  3PHL A;  1GL2 C;  4D6T E;  4JYB A;  5AW5 B;  2QJY C;  1BGY J;  1S4X A;  1G2C A;  4C7R A;  1GK4 A;  3CCQ P;  2J58 A;  4H13 C;  4NPF X;  1VQK P;  2HYN A;  3Q5S A;  2HOD B;  1PIX A;  3MP7 B;  1JY2 N;  1YHQ P;  2FKW B;  1IJD B;  3L74 D;  1EZV I;  1T3U A;  3HUS C;  3VTP C;  1FDI A;  1HF9 A;  3WUV A;  3E1R A;  1FZC A;  2A06 G;  1FZE A;  2P1J A;  4DOJ A;  2QJK C;  3FX0 A;  3FWL A;  3CWB E;  2SPZ A;  4ZKU A;  3HE5 B;  1HVV A;  2PP6 A;  3L71 E;  3RBX A;  4KJM A;  3GLM A;  3P7K A;  2H43 A;  2W8Z A;  4PJ0 E;  2Q3I A;  1S1C X;  1JY3 O;  1GU5 A;  1ZME C;  1AVY A;  4WY4 C;  3BRT B;  5APS A;  3F89 A;  5CMZ A;  3O6Q A;  2YKQ A;  1GK6 A;  3OJA B;  5KJ7 C;  3LW5 H;  1EZV G;  3V2R A;  4I1L A;  3L75 D;  1YTZ T;  1FZC C;  3KYQ A;  1PPJ D;  3RK2 B;  4BXL A;  1JMB A;  2K88 A;  2HLO A;  1E79 H;  3RK3 E;  3GW6 A;  3FGA D;  3CCU P;  3A0H H;  4YXD C;  4AQR D;  1EDK A;  3B5N D;  1SQX D;  3WMM 0;  1L0L J;  3CCV P;  2KS1 A;  5KLV G;  2M0B A;  1OW6 A;  1KIL C;  1LTI C;  1W2E A;  2OTL P;  1SLQ A;  5AW3 B;  1LP1 A;  2ZJS E;  1X79 B;  3N4X A;  1NTM K;  3SWY A;  4EDF A;  3L74 E;  5KLV J;  1M1J B;  1FZB A;  1JTH B;  3IR9 A;  1L4A A;  4GDO A;  2YIU C;  4W80 A;  5K5G B;  2B87 B;  1T8Z A;  5CBN A;  1BE3 D;  2E76 B;  1JY2 P;  2N1T A;  5TIS H;  2AXT E;  2RH0 A;  2WZ7 A;  3M9Q A;  1IK7 A;  4XFJ A;  3V2N A;  1LTJ C;  3HE4 B;  5AVW B;  4Y28 J;  1KFM A;  2Q9I A;  3A5T A;  1Y47 A;  3SFD C;  3M0D A;  4GKG A;  1GL2 D;  1OVU A;  4D6T J;  3L72 E;  2LKM A;  4I2L C;  1NU1 G;  3B4S A;  4WBA A;  1RQU A;  4H13 D;  1A02 F;  1S5L H;  5B5E H;  1JB0 J;  1BCC D;  4ASV A;  2V7Q J;  1NTM D;  3BAT A;  1Y8A A;  2KOG A;  3MIW A;  1SP4 A;  3L75 E;  2IZ1 A;  1PPJ E;  2Y0C A;  1OW8 A;  2YO2 A;  3WU2 E;  3ITK A;  1SQP G;  2N1T C;  1FU1 A;  3T97 B;  2K3R A;  1SQX E;  4JPZ B;  1NOH A;  3II6 A;  3AE5 C;  2JDI H;  3VP9 A;  1S2E A;  4CPG A;  1DD4 A;  1L2P A;  1T6A A;  2E74 C;  2KLU A;  3KZI H;  2XNX A;  3M0D C;  1SQP J;  1R5S A;  2NZ2 A;  3FXE A;  1XTC C;  1QGK B;  2BCC D;  1X0T A;  4WY4 D;  2OYI B;  4BRY B;  2Y9Z A;  3U1A A;  3V2Q A;  2H89 C;  2WSE J;  2V4H A;  1P84 I;  4UB8 H;  2JWA A;  1ZW0 A;  4ZMD A;  2A06 D;  2W6B A;  3H1L G;  5KJ7 D;  3H32 B;  1Y9B A;  1JCC A;  3EFG A;  1VQ9 P;  4L75 A;  1KB9 I;  5KLV K;  1S3J A;  2IDB A;  3QWO C;  4N3Y B;  1IFN A;  1Q90 D;  1KQL A;  3H1L J;  2FYN B;  3A0B E;  3EWK A;  1YTZ I;  5AW0 B;  1RF1 A;  4LC1 A;  3GHG A;  3D6Y A;  2GA1 A;  1W2B O;  1KIL D;  3IN6 A;  1MUU A;  1H0T A;  1GW3 A;  3L73 E;  2QA4 P;  2Z5I A;  2XKM A;  5BVZ A;  1T3J A;  2I8D A;  2LXB A;  5AW1 B;  1MFT A;  5KAF H;  1EZV D;  1HJ0 A;  2P67 A;  2HOD A;  2R44 A;  2FYU D;  2JP3 A;  1VQN P;  2K1A A;  1K8A Q;  1NH4 A;  2Q6Q A;  1L0N G;  5APX A;  3HTK A;  3I5C A;  1ZP0 C; 
#chains in the Genus database with same CATH homology
 1LTB C;  2A45 G;  3U59 A;  1A02 J;  2PAJ A;  1SFC A;  1X9V A;  3N7N A;  4LLH A;  4XE5 B;  1SQV K;  2YNY A;  4HH2 A;  1NU1 K;  1RF1 B;  2Z4E A;  1N86 A;  1RF1 C;  2YO3 A;  4RES B;  3BVH A;  1LTG C;  3B5N A;  5CCG A;  1IFD A;  3RK3 D;  1SQQ K;  3IFM A;  1LWU B;  3L4F A;  1GL2 B;  1IO4 A;  2WT7 A;  5AVU B;  4WB4 A;  1LWU C;  1GL2 C;  2ZXE B;  2KB7 P;  3NFQ A;  1FJK A;  3O8Z A;  4JYB A;  5AW5 B;  1L0L K;  1NWQ A;  2OYH B;  3M9B A;  1G2C A;  2OYH C;  4C7R A;  1S9K D;  1GK4 A;  2E43 A;  4Y99 B;  2J58 A;  5AW6 B;  4AYC A;  3E1I A;  4Y99 C;  1LTS C;  2YKO A;  2HYN A;  2W6A A;  1SQP K;  3KPE A;  1N7S A;  2HOD B;  3TNU B;  1LTT C;  1T2K C;  1JY2 N;  1URQ A;  2HPC B;  4EOT A;  1AQ5 A;  2FKW B;  1IJD B;  1ZR2 A;  1FBM A;  5APW A;  3HUS B;  3P8C D;  1T3U A;  3HUS C;  1H8A A;  5CCH D;  3VTP C;  1JUN A;  1FJP A;  2O01 H;  1SFC B;  1MFZ A;  2P2U A;  2YMY A;  1SFC C;  2O1J A;  2Q5U A;  2H7H A;  2OAR A;  2N1T D;  2O1K A;  2IFM A;  2WTY A;  3V4Q A;  2NPS D;  1YYC A;  1FZC A;  1HGZ A;  1FZE A;  2P1J A;  4DOJ A;  2XZR A;  3P32 A;  5CCG C;  4IFD K;  2WSF H;  1RE3 A;  2CPB A;  2POH A;  4ZKU A;  3HE5 B;  1GL2 A;  2R5B A;  1HVV A;  2PP6 A;  4N78 D;  5AW7 B;  2C0X A;  2ZFC A;  2XDJ A;  3VMY A;  3P7K A;  2H43 A;  2H8P D;  1GTW A;  1HJB A;  1AFO A;  1ZN5 A;  2Q3I A;  1QL1 A;  3EQ2 A;  1G2C B;  1JY3 O;  1GU5 A;  4WY4 B;  3MUD A;  3VP8 A;  1HH0 A;  4WY4 C;  3BRT B;  2J59 M;  3C9I A;  1N7S B;  5CJ0 A;  2KLV A;  1N7S C;  2FFD A;  2FXM A;  1JY2 O;  1NKN A;  1URQ B;  5APS A;  3HD7 D;  1URQ C;  2Z5H A;  4EIJ A;  1ZLL A;  4GT1 A;  2IFN A;  2JJL A;  3VN0 A;  1M1J A;  5CMZ A;  3HUS A;  1L4A B;  3BAS A;  2YKQ A;  1GK6 A;  1GDT A;  1L4A C;  3M9H A;  3OJA B;  1GW4 A;  5KJ7 C;  4JYC A;  1JNM A;  1RE4 A;  3LW5 H;  3V2R A;  4I1L A;  1FZC B;  4I6M C;  1ZR4 A;  1YTZ T;  3V4W A;  3KYQ A;  1FZC C;  3RK2 B;  5BU5 A;  3RK2 C;  2HLO A;  2L5G B;  1KZU B;  1N2D C;  1RE3 C;  2R3C A;  5APT A;  3NXS A;  3B8E B;  5AVV B;  4AQR D;  2YKP A;  3B5N D;  2XV5 A;  3WMM 0;  3HE5 A;  2M8R A;  1KFN A;  4M3L A;  5AVY B;  1MZ9 A;  1G1J A;  1KIL B;  3VMX A;  1S9K E;  1KIL C;  3TYY A;  5APY A;  1LTI C;  1W2E A;  2KSJ A;  1DX7 A;  1NTZ K;  1JY3 N;  4WY4 A;  1JMM A;  3L37 A;  2GM4 A;  1SLQ A;  1L0N K;  3V2P A;  5AW3 B;  2FFD B;  3MD0 A;  1J1D B;  1X79 B;  3N4X A;  1XTG B;  3UIA A;  1NTM K;  3SWY A;  2FFD C;  1J1D C;  1QL2 A;  4ZKP A;  1GD2 E;  5CHX A;  4IFF A;  1M1J B;  1FZB A;  3SWF A;  1JTH B;  3A3Y B;  1CZQ A;  1M1J C;  3RL0 D;  3KQG A;  2FYU K;  3IR9 A;  1L4A A;  1DH3 A;  5KJ7 A;  1JY3 P;  1RE4 C;  5BU8 B;  2WPS A;  1NHL A;  1X8Y A;  1OWA A;  4W80 A;  5CJ4 A;  2CPS A;  1G1I A;  1RY3 A;  1T8Z A;  5AVQ B;  1J2J B;  1ZV8 A;  1JY2 P;  1CI6 B;  2N1T A;  1RF0 A;  3KDP B;  1NKZ B;  2NPS A;  5AVS B;  1LTJ B;  4N78 E;  3T97 A;  1FZF A;  2WZ7 A;  3M9Q A;  4HYT B;  3V2N A;  1LTJ C;  3HE4 B;  5AVW B;  2XU6 A;  1FDM A;  1KFM A;  2Q9I A;  2KP8 A;  3RK3 B;  3A5T A;  1FZA A;  4B86 A;  4AUW A;  3RK3 C;  1KIL A;  3M06 A;  3M0D A;  2WPR A;  1GL2 D;  4GKG A;  3VOP A;  3M91 A;  2LKM A;  4I2L C;  2C9L Y;  1VDF A;  2P7J A;  4WBA A;  1GZL A;  1N73 A;  5AVR B;  5KTB A;  4W7Z A;  1VPC A;  1A02 F;  1E5W A;  2OYI A;  2GUV A;  1JTH A;  2R32 A;  3BAT A;  1T2K D;  2VRS A;  2KOG A;  3LIE A;  3MIW A;  1SP4 A;  3HD7 A;  1IK9 A;  1NTK K;  4GIF A;  4C46 A;  4W7Y A;  1HGV A;  2IX7 C;  5AW4 B;  1DEB A;  1Z56 A;  3MTU E;  2HFE D;  5CCH C;  1HBW A;  2YO2 A;  1SFC D;  3NMD A;  2N1T B;  2N1T C;  1CI6 A;  2NPS B;  1RF0 C;  1FU1 A;  1MV8 A;  2W27 A;  2NPS C;  3CLQ A;  1JO5 A;  1NOH A;  3II6 A;  1LGH B;  1LTJ A;  3VP9 A;  5CCG D;  3HE4 A;  4LGD E;  4JF7 A;  1CSB A;  4IFM A;  1IFJ A;  2M3B A;  3VMZ A;  1IFM A;  3GHG B;  3VYI A;  2QM7 A;  2XNX A;  3M0D C;  3GHG C;  1M7L A;  3R2P A;  1LT9 A;  1IC2 A;  5AVT B;  3U1C A;  1XTC C;  1N73 B;  2WIT A;  5AW9 B;  4C7N B;  1CW5 A;  1N73 C;  1H89 A;  4XA4 A;  1N7L A;  3P8C E;  4WY4 D;  1SQB K;  2OYI B;  3U1A A;  2OYI C;  1N7S D;  3V2Q A;  3G3Z A;  2KYV A;  5APU A;  3HD7 B;  4KHX A;  1URQ D;  1EQ7 A;  3HD7 C;  3V5B A;  3A2A A;  3A7O A;  1JOC A;  2W6B A;  1L4A D;  5CCH A;  2Q7C A;  5KJ7 D;  3TSI A;  2A45 I;  3H32 B;  1FOS E;  4O9B A;  1JCC A;  2I1K A;  3EFG A;  5AW2 B;  3HTK B;  2R5D A;  3BRV B;  5AVZ B;  5KLV K;  1IFI A;  1WT6 A;  1HUC A;  4N3Y B;  3CL3 D;  3RK2 D;  1IFN A;  2C0W A;  1OXZ A;  3PP5 A;  2JEE A;  1KQL A;  3NTN A;  5APV A;  5AVX B;  3CI9 A;  3OA7 A;  1YTZ I;  2E42 A;  2HG5 D;  5AW0 B;  1FZG A;  1RF1 A;  1SVF A;  3B5N B;  2N9B A;  3LID A;  1SQX K;  4LC1 A;  1LT9 B;  3GHG A;  2GUS A;  3B5N C;  1LT9 C;  2A45 H;  1H88 A;  2IPP A;  3OAK A;  5APQ A;  1JCD A;  2I1J A;  1KIL D;  1NAF A;  2WT7 B;  2FYZ A;  4DZO A;  1MUU A;  1LWU A;  1LTA C;  4C7N A;  1HWT C;  1GW3 A;  2WWW A;  3H6P A;  1FOS F;  2Z5I A;  3TK1 A;  1PFI A;  3P8M C;  1FAV A;  2XKM A;  5BVZ A;  2C9N Y;  2WSE H;  5AW8 B;  4OH8 B;  1T3J A;  1GU4 A;  1HTL C;  2OYH A;  5AW1 B;  3MGN A;  2QM8 A;  2MJZ A;  3RL0 B;  2BAS A;  2P67 A;  2WPQ A;  3RL0 C;  1J1E B;  2HOD A;  2WSC H;  3TNU A;  3M0A A;  1J1E C;  3HRN A;  3L36 A;  2HPC A;  1NH4 A;  3L35 A;  3H32 A;  1WRG A;  4N6J A;  5APX A;  3HTK A;  3I5C A;  1NO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...