1NOHA

The structure of bacteriophage phi29 scaffolding protein gp7 after prohead assembly
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
73
structure length
73
Chain Sequence
PLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKSHEKLAAEKDDLIVSNSKLFRQIGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAD MORPHOGENESIS PROTEIN
publication title Bacteriophage f29 scaffolding protein gp7 before and after prohead assembly
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Viral protein
total genus 30
structure length 73
sequence length 73
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11418 Scaffolding_pro Phi29 scaffolding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.400 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nohA00
1NO4A 3MTUE 1NOHA 4IFFA 3OA7A
chains in the Genus database with same CATH superfamily
4ZMDA 2YIUB 2ITAA 2UWJE 5GTIE 3KZIE 1NGMB 4RJTA 1VQMP 1SFCD 3U1CA 3S9OA 1N86A 1FZBA 4W7ZA 1ZMEC 2YXQB 1ZOYC 2D2CD 2AEMA 3CX5H 1QLED 2Y9YA 1LGHB 2VRSA 4BRYA 5APSA 1RY3A 1JY3N 3P8MC 1L2PA 1HGZA 1QVGO 3KQGA 2IYOA 4IFFA 4K3AA 2W6BA 1X8YA 3FX0A 4GKGA 2WSFH 3CCSP 2JP3A 2P58A 1BE3D 3AEAC 1FZCC 3P7KA 3T97A 3AE3C 1S5LE 1MV8A 1DD4A 1P84D 4XFJA 1NTMG 1T3JA 3KXDA 1ZLLA 2N1TA 3TK1A 1M56D 1NTZG 2KS1B 1W2BO 1LNQA 1FU1A 4GT1A 1YTZT 2OGUA 1WT6A 1FZCB 1HTLC 4GODA 4N3YB 3WU2E 1KQLA 4NPEA 3L71E 5GTHE 4H13D 1FE6A 1L0LJ 4YXWH 1RE4A 1MKMA 2IFMA 4R4MA 1KZUB 2OYIA 2BASA 3MUDA 2JWAA 2N9BA 3B5NA 3G4SP 5KJ7C 1FOSF 1A02F 1PPJD 1BGYJ 1PPJE 1K8AQ 2AXCA 2GUSA 4TT3H 3II6A 3D70A 1OMIA 3EFFK 1EXJA 2Q7CA 1RF1C 1KN7A 1BCCJ 3L74D 3QWOC 4NPFX 5CCHC 3AE8C 1VQ4P 2CK3H 2E76D 2ZYAA 5BU5A 3M06A 4JQ0D 4R4LA 2FYZA 1DEEG 1SQQD 2KZJA 4DCKA 2V7QJ 2R3SA 2KUBA 3L75G 3V6IA 1OVRA 4K35A 1RF1B 1T6AA 3G3ZA 3M9BA 3USSA 2R5BA 2FBWC 2BCCD 2WPVB 3O6QA 2P10A 1GL2C 1X9VA 3RK3C 5APWA 1GTWA 2YKQA 1JB0J 3CWBG 1YJNP 2WSCJ 2K88A 2YXRB 5APQA 2JKVA 1KB9H 2WSSH 1M8OB 2W83C 3L72G 4MN4C 1YQ3C 1JNMA 1FAVA 1KYOH 4WWIA 3LW5J 3RK3B 3V4WA 1KYOI 4WY4A 3F89A 3NFQA 1SQQK 2QJPC 4TLFA 2IFNA 3TF5A 2W8ZA 2H89C 1SQVK 3N4XA 1T3UA 2QM8A 4OWFA 4PD4D 1PZQA 1ZXGA 1YYCA 1BE3J 3V2PA 5KAFH 2R44A 2AEJA 2QJPB 2IBZI 4U3FJ 3AE6C 4EDFA 3CXHE 3H6PA 2OTJP 4HJGH 1AVOA 1FZFA 2XNXA 1QGKB 1KV4A 1USDA 3IN6A 3AECC 1N7SC 1JCCA 3PLNA 3GLMA 2Q3EA 2OQQA 3FWLA 1KORA 1S3JA 5H2FH 4ASVA 1BSNA 3H32A 3GMAA 5AW9B 2P67A 1U7MA 1M7LA 1ZR4A 3I55P 2B88A 3AE7C 5KTBA 1N7SB 3O8ZA 1NTKK 3M91A 5KJ7A 2FFDA 2H88C 1Y9BA 1PP9J 1HJ0A 3L71G 1FBMA 1QL2A 1YJWP 1EC5A 4DZOA 2FXOA 1GK6A 4KT0J 3L74J 1OXZA 1NU1D 3VN0A 1CW5A 2FYUK 5KJ7D 2YKPA 1OX3A 2O1JA 1SQQJ 2WSFJ 1JUNA 3TGUD 4UB6H 2IDBA 1PPJG 1Q90D 5APXA 3L73J 1SFCC 1SQVJ 2ZXEB 2ZYDA 4L74A 1FS0E 1YJ9P 5CCHD 4DT0A 3JCUH 3BVHA 2O01H 3OJAB 1JY2O 3P32A 5CJ4A 2BCCJ 1G1JA 3HE4B 1HJBA 3LIDA 2K37A 2LXBA 1GL2A 1SQQG 5CCGA 1SFCB 4JPZB 4IFMA 3P8CD 2WZ7A 4C7RA 1OVUA 3H25A 2YMYA 1GW3A 5AVTB 5KLVD 4B86A 3I5CA 3CC7P 2I8DA 3R4YA 4C46A 1GL2D 2BCCG 5APVA 3RK2C 1MUUA 5CCGD 3RK3D 2G8YA 3RK3E 5B5EH 1NU1K 3OW2O 1NTZE 5KKZC 2Q6QA 1VQKP 1HF9A 3NMDA 3KHUA 2AEFA 3H1JD 3BCCJ 1DD3A 1NTKJ 4AUWA 3RK2B 3CPWO 2O3JA 3L4FA 4PJ0E 1YIJP 2N1TC 5KKZB 4Y28J 2QVAA 2YKOA 2HG5D 2XDJA 2R3CA 2LR2A 2E5TA 4DJGA 2FYUJ 3T97B 2WPSA 1FDOA 5AW3B 1LTJA 1GDTA 2N1TB 1N8RQ 3PJSK 1L0LD 1L0LE 5KLVK 3RL0D 3SWKA 1N7SA 2WVRA 3A0HE 1KILC 1HVVA 2OYIC 2WT7A 1L4AA 3W67A 2JR8A 3MUDC 3B5NC 4RKUJ 3V5BA 5GTIH 1BGYE 2ZXXA 1JO5A 5TISE 2A45G 2ZVNB 1NYHA 4RESB 1X22A 1N7SD 1LTSC 1BSHA 1BCCD 4IL6X 1BCCE 1KILB 2OYIB 2WWWA 1M90Q 3B5NB 3VOPA 2IZ0A 4ASWA 3B8EB 3MZWB 3M0DC 3CC2P 1NU1J 3SWYA 2E43A 3WUVA 1RQUA 2Z5HA 1U7JA 1EDKA 4GOEA 3L70J 1N2DC 1DX7A 3TGUJ 2QSIA 2WPRA 1S5LH 2I1JA 1L0LK 3IR9A 2JEEA 5AVZB 3PP5A 1K04A 3FXEA 1P84I 1HH0A 2ZT9C 2FXPA 1IO4A 3B4SA 2E5YA 3WU2H 2XNDH 3VMZA 3D6ZA 3TGUG 3O6QB 3CMEP 1AA0A 2R32A 1LWUC 1SQPK 1N73A 3CC4P 2PAJA 3H1IJ 3MP7B 5AW0B 1IFPA 4WY4C 2IPPA 5KLVJ 5L8RJ 2B87A 3AEGC 2ZT9B 4YTPC 1UIXA 2FY8A 3I56P 1L0NK 3L35A 5AVUB 2M5AA 1LWUB 2A06D 4W80A 1BE3E 3H1JJ 2HYNA 3Q5SA 4WY4B 4PV1C 3V2RA 1P84E 3RK2D 1NJIQ 3VMAA 2OYHA 4U3FD 4U3FE 2K3RA 5DJUB 4HYTB 5AW6B 1RF0A 1CI6A 1SQXD 2K9YA 3HUSC 1YHQP 4UB8H 4IOIH 3AEBC 3V4QA 1NWQA 2H43A 1SP4A 2N1TD 2K9JA 2O01J 4GDOA 2KP8A 1LT9A 3AEEC 3HUSB 1VQ8P 1KILA 3D6YA 2PGDA 2P1JA 3CCLP 1ZN5A 2FFDC 5KLIC 3CX5D 1PP9D 3CX5E 1PP9E 3H32B 2PRRA 1AVYA 1L0LG 1SQPJ 4W7YA 1KILD 3L74E 3H1HD 3PHLA 1NOHA 3B5ND 4JF7A 2FFDB 1RHZB 1SQQE 1SLQA 2BEZF 2NPSA 5KLIB 1L0NJ 1SQXK 1BGYG 3M0DA 3L73D 3L73E 1SQVD 1SQVE 1FDMA 1NAYA 3S1KA 2FYNC 2KLUA 3M0AA 1GU5A 2J59M 3GF3A 1Q81Q 3CL3D 3BASA 1BCCG 3EQ2A 2OARA 4PD4I 2BCCE 1JMMA 3ABVC 4LGDE 1VQ7P 3AE9C 1LP1B 1VL2A 2AXTE 5AW8B 1K73Q 5CCGC 1PGJA 3CXHH 4KJMA 1S5LX 2FYNB 3BATA 2Y9ZA 3HTKA 3N7NA 1R8EA 3CCUP 3CXHI 3QH9A 3G71P 2A45I 1GL2B 1NAFA 4I7ZC 3KPEA 5B66H 1LWUA 4RO0A 4L75A 1IC2A 1TU3F 2ZT9D 2C9NY 2ZJSE 1OWAA 3CI9A 3BCCD 3LIEA 3BCCE 1IK9A 4DOJA 3C1LA 1NTKD 1Y8AA 1NTKE 2E75C 3RL0g 1PL5A 4I7ZB 4PD4E 3E1RA 1SQBD 2WITA 4WY4D 3Q1MA 1Z56A 1K05A 3RL0C 2DW3A 2FYUD 2FYUE 2GA1A 3PH0A 2E75B 1VQ6P 1LTJC 5AW4B 3H1LJ 1SQXJ 3HE5A 2W27A 2A06G 4HKZH 3HUSA 1URQA 4PV1D 1BE3G 3RL0B 4CPGA 3A2AA 1L4AC 3UIAA 3Q2YA 2L91A 4U3FG 3GG2A 1LTJB 1J1EC 3IAOA 1KB9D 1JOCA 1LTTC 1KB9E 2KSEA 1OZHA 3IFMA 4IL6H 5KAIE 2SPZA 4NPDA 4EOTA 1KYOD 1T2KC 2J58A 1FC2C 2WT7B 1QEXA 1L4AB 2WSEH 1SQBK 4JYBA 1J1EB 2HPCA 1PFIA 3H1HJ 3MIWA 1NU1E 2HFED 1OVVA 1S1CX 2CPSA 3GHGA 4Z1MH 5CHXA 3L70D 3L70E 4A7PA 1VQPP 1LP1A 3TGUE 1PGPA 4C7NA 3M9QA 5KAFE 1PP9G 1MZ9A 1W5CE 1EZVD 2KXPB 3G6EP 1QX8A 4JYCA 3A7OA 3L74G 5AVWB 1X79B 1OW8A 3TNUA 4WBAA 3Q3DA 2QM7A 3SFEC 1OFCX 1JY3O 2BEQD 5C39A 1XTGB 5E79E 2Z4EA 1FZAA 3L73G 1SQVG 2Y0EA 3P8CE 1N73C 5H2FE 2M3EA 3NTNA 5CJ0A 2QRXA 1M57D 2Q5UA 3H1ID 3H1IE 3CLQA 3W68A 4D6TJ 3Q5PA 3A0HH 5KLVE 2KNCA 5AW2B 1VQ9P 2JDIH 2G3AA 1RH5B 3RBXA 1IFIA 2POHA 2WPQA 4I1LA 1MFTA 2YNYA 2H7HA 1KFMA 2N9YB 2MJZA 1J1DC 1N73B 5TISH 1KD1Q 1Y47A 2K1AA 3VP9A 1NTMD 3H1JE 2B87B 5BVZA 3BRVB 1OIPA 2QEXP 2YO2A 1PGOA 1VF5C 3KYQA 2OYHC 4XE5B 1SQBJ 1SVFA 3PTZA 4WB4A 2M5AB 1RF0C 3CCVP 1OW6A 1J1DB 4UB6E 2KI7B 2B9BA 2QE7H 2I1KA 1LTIC 2E75D 2Q3IA 3BCCG 1FJKA 2Z5IA 3KDPB 4H44C 1VF5B 1NTKG 2W6JH 1H8AA 3IF4A 2OYHB 3HD7C 3SFDC 1IK7A 3VMYA 1YQ4C 3C8VA 2HODA 1AFOA 3OA7A 1CI6B 1GD2E 1LT9C 1ZW0A 2RKLA 1DH3A 1VPCA 1LTBC 4H44B 2FYUG 3KZIH 5AW7B 3HD7B 2K9JB 2YMKA 2ZVOB 2FXMA 1S2EA 3G9RA 1YI2P 1NTMK 1SQPD 1LT9B 1SQPE 1L4AD 4BWNA 1KC8Q 2WTYA 1JY2P 2NPSC 4KHXA 5AVYB 1L0ND 1AJYA 1L0NE 3H1KJ 5DJTB 5M1BA 3MHVA 2CPBA 1VQOP 3S4RA 1T2KD 2PP6A 3RGUA 2GUVA 1P84H 4EI2A 4AQRD 2NPSB 3CCMP 2IZ1A 5K5GB 1HUCA 1NKNA 2LXCB 1NU1G 1JCDA 2ZAEB 1RQVA 2L5GB 1LTGC 3L70G 1PIXA 2QJYC 4ZNCA 1YTZI 5AVSB 1U57A 1DEBA 1EZVG 5GTHH 1S4XA 1AV1A 1KQSO 2P2UA 3HTKB 1ZR2A 1WMKA 2QJYB 2C0WA 1M1JA 2A06E 2WSEJ 1JY2N 4EYYQ 1VQLP 1NTMJ 3WUUA 3H1IG 1H0TA 3L37A 1JTHA 3CX5I 5KLVG 1NTZJ 1NH4A 1YBKA 3A5TA 2P7JA 3H1LD 2E74C 3H1LE 2OTKE 1SQXE 1URQC 1RE3A 4BXLA 2C0XA 1JEKA 4AYCA 4PV1B 1ZRTD 1ZRTE 3H1JG 4HH2A 1VF5D 2O01N 3A3YB 3AE4C 3A0BE 1NO4A 3HD7A 3GW6A 4N6JA 4L76A 1AQTA 2AXTH 2E74B 1KQGB 3JSVC 3HE5B 1IFNA 2RMZA 1URQB 4QMAA 3CCEP 3L71D 5AW5B 4H44D 2NZ2A 1A02J 2XZRA 3HD7D 3WUTA 3SSUA 1GMJA 3TDKA 4YXDC 1IZNB 1IFDA 4GOFA 2XKMA 1KILE 3H1HE 2QA4P 4IFDK 4OVNF 1G2CA 3GHGC 3L75J 1PV3A 2WQYC 1HWTC 2J5UA 3JC22 3L36A 4PD4H 2E42A 1UIIA 2HPCB 3EFGA 1KTMA 1EDIA 1Q86Q 5AVQB 4I2LC 1LTAC 1SQPG 3M9HA 3GHGB 2NPSD 3CWBJ 4C7NB 1KQFB 4UB8E 1L0NG 4EIJA 3L72J 2A45H 3ZDMA 2XU6A 4D6TD 4D6TE 3TNUB 4YPCA 2ZYGA 2JO1A 1JMBA 1CZQA 3NXSA 5AW1B 2KSJA 4XA4A 4H0LC 5KAIH 3MD0A 3ITKA 1T8ZA 3E7KA 1PGQA 1HGVA 2M8RA 1FZEA 4LLHA 1KB9I 2KNCB 2GM4A 1VQNP 4ZKPA 1SQBE 2B89A 4H0LB 2IYPA 1EXIA 2IX7C 1XTCC 3C9IA 4OGQC 3FGAD 1YITP 2KYVA 2KS1A 1S72P 4OH8B 5CMZA 2LKMA 1FZCA 2KZIA 1GZLA 1NHLA 3GF7A 1AQ5A 3CXHD 1FDIA 2QJKC 3OAKA 4OGQB 1EZVI 3AE2C 1R5SA 2E74D 2ZFCA 1GK4A 5CBNA 1LJ2A 3D71A 5E79H 3RBZA 1URQD 3H1LG 2R5DA 1SQXG 2HODB 5AVRB 1E5WA 1GW4A 3L71J 1KYOE 1IFJA 2KK7A 2V4HA 5B66E 3CCJP 1BDCA 2QJKB 1S9KD 1FJPA 1S9KE 4ZKUA 1J2JB 4GIFA 3E1IA 1K9MQ 2M3BA 4LC1A 3H1KD 3H1KE 3AE5C 1EDJA 1H89A 3FXDA 3AEFC 1BDDA 1MFZA 5CBOA 2YO3A 1GU4A 2IBZD 2IBZE 1RF1A 1Q7YQ 3VTPC 5CCHA 2JJLA 4PJ0H 1EZVE 3U1AA 1Q82Q 3V2NA 2KB7P 3H1HG 3WMM0 2OTLP 3CMAP 5APYA 3R2PA 2Y0CA 1VDFA 2W6AA 3VP8A 5APUA 2D2CC 4HB1A 1G1IA 2QG4A 3VYIA 1ZP0C 2PFXA 2RN0A 4IL6E 1CSBA 3F5HA 5EFWB 2D2CB 2H8PD 1M1JC 3CD6P 2XV5A 1NTME 4U7JA 5AVVB 3TSIA 4D6TG 2WMMA 1NTZD 3CCQP 4Y99C 4H0LD 3MTUE 1E79H 3EWKA 1M1JB 2V7QH 1EDLA 1WRGA 1RE3C 4BRYB 3VMXA 2NRGA 2M0BA 1H0TB 1D7MA 1JTHB 2O1KA 2Q9IA 2Y0DA 3JCUE 3MGNA 4I6MC 3CCRP 1IFMA 4H13C 1W2EA 1M1KQ 4Y99B 2FKWB 1SQBG 1EQ7A 3K5BA 1ZV8A 1SS1A 2RH0A 1VQ5P 1OW7A 1KFNA 2HR3A 4L73A 2OYOA 1N7LA 4OGQD 4M3LA 2WSCH 5AVXB 1FOSE 2HLOA 5TJHA 4H13B 2KIKA 5BU8B 2JWDA 3V2QA 1RE4C 2KLVA 3PRJA 3LW5H 4WVZA 2Q1KA 2QIWA 2E76C 5B5EE 1H88A 1NTZK 2MKVA 1BGYD 3L75D 3L75E 3BRTB 2W90A 3FWNA 1FZGA 1QL1A 1Q2NA 1JY3P 1X0TA 1HBWA 5APTA 1QVFO 1DIPA 4N78D 4N78E 2E76B 3AEDC 1USEA 3B71A 1G2CB 1IJDB 1KMIZ 2C9LY 3AE1C 3CWBD 3CWBE 2KOGA 1LT1A 4JBZA 2YIUC 3H1KG 3SWFA 3HE4A 3L72D 3L72E 1NVOA 3TYYA 4O9BA 1SFCA 1NKZB 3U59A 1JM0A 2IBZG 1R5LA 3A0BH 3HRNA 3Q5RA
chains in the Genus database with same CATH topology
1L4AC 3UIAA 1HWTC 4AUWA 3L36A 1LTJB 2E42A 1J1EC 3RK2B 2HPCB 1JOCA 1LTTC 3IFMA 3EFGA 3L4FA 5AVQB 4I2LC 1SFCD 2N1TC 3U1CA 1LTAC 1N86A 4EOTA 3M9HA 3GHGB 1FZBA 4W7ZA 1T2KC 2YKOA 2HG5D 2J58A 2XDJA 2R3CA 2NPSD 2WT7B 4C7NB 1L4AB 2WSEH 1SQBK 1LGHB 2VRSA 2WPSA 4EIJA 4JYBA 1J1EB 5AW3B 5APSA 1LTJA 1RY3A 1JY3N 2HPCA 1GDTA 2A45H 2N1TB 3P8MC 1PFIA 3MIWA 2HFED 2XU6A 1HGZA 2CPSA 3KQGA 4IFFA 3TNUB 5KLVK 3GHGA 3RL0D 1N7SA 2W6BA 1X8YA 4GKGA 5CHXA 2WSFH 1KILC 1HVVA 2OYIC 2WT7A 4C7NA 3M9QA 1L4AA 1FZCC 1CZQA 3NXSA 3B5NC 3P7KA 5AW1B 3T97A 2KSJA 1MZ9A 4XA4A 3V5BA 1MV8A 3MD0A 1T8ZA 1T3JA 1ZLLA 1JO5A 2N1TA 1HGVA 4JYCA 3TK1A 3A7OA 5AVWB 1X79B 2M8RA 1FZEA 2A45G 4RESB 1N7SD 4LLHA 1LTSC 3TNUA 2GM4A 1FU1A 4WBAA 1KILB 4GT1A 2QM7A 2OYIB 1YTZT 1WT6A 2WWWA 1HTLC 1JY3O 4ZKPA 1FZCB 4N3YB 3B5NB 3VOPA 1XTGB 1KQLA 2Z4EA 1FZAA 3B8EB 3M0DC 3P8CE 1N73C 3NTNA 5CJ0A 2IX7C 3SWYA 2Q5UA 2E43A 2Z5HA 3CLQA 1XTCC 3C9IA 2KYVA 5AW2B 1RE4A 2IFMA 1N2DC 1DX7A 4OH8B 1KZUB 2OYIA 5CMZA 2LKMA 1FZCA 1IFIA 2BASA 2WPRA 3MUDA 2N9BA 3B5NA 2POHA 2I1JA 1GZLA 2WPQA 4I1LA 5KJ7C 1L0LK 1FOSF 1A02F 2YNYA 3IR9A 2H7HA 1NHLA 1KFMA 2MJZA 1J1DC 1N73B 2JEEA 5AVZB 1AQ5A 2GUSA 3PP5A 3II6A 3OAKA 3VP9A 1HH0A 2Q7CA 1RF1C 5BVZA 3BRVB 2YO2A 5CCHC 1IO4A 3KYQA 2ZFCA 2OYHC 1GK4A 4XE5B 3VMZA 5BU5A 3M06A 1URQD 1SVFA 2R5DA 2FYZA 2HODB 5AVRB 4WB4A 2R32A 1E5WA 1RF0C 1GW4A 1IFJA 1J1DB 1LWUC 1SQPK 1N73A 2PAJA 1S9KD 1FJPA 1S9KE 5AW0B 2I1KA 1LTIC 1RF1B 4WY4C 2IPPA 4ZKUA 2Q3IA 3G3ZA 3M9BA 1FJKA 1J2JB 2Z5IA 3KDPB 4GIFA 1H8AA 3E1IA 2OYHB 1L0NK 3HD7C 2M3BA 4LC1A 3L35A 3VMYA 2R5BA 2HODA 5AVUB 1AFOA 1H89A 1LWUB 1GL2C 3OA7A 1CI6B 1GD2E 1X9VA 3RK3C 1LT9C 1MFZA 2YO3A 4W80A 5APWA 1GTWA 1GU4A 2YKQA 2HYNA 4WY4B 1RF1A 1VPCA 1DH3A 1LTBC 3VTPC 5APQA 3V2RA 3RK2D 5AW7B 5CCHA 2JJLA 3HD7B 3U1AA 2OYHA 3V2NA 2FXMA 1JNMA 4HYTB 2KB7P 5AW6B 1NTMK 1FAVA 3WMM0 1RF0A 3RK3B 5APYA 1CI6A 1LT9B 3R2PA 1VDFA 3HUSC 1L4AD 2W6AA 3V4WA 4WY4A 3VP8A 5APUA 3NFQA 2WTYA 1SQQK 2IFNA 1JY2P 3V4QA 2NPSC 1NWQA 4KHXA 2H43A 1SP4A 5AVYB 2N1TD 1G1IA 1SQVK 3N4XA 3VYIA 1T3UA 2KP8A 2QM8A 2CPBA 1T2KD 2PP6A 1LT9A 3HUSB 1KILA 1YYCA 3V2PA 1CSBA 2P1JA 2GUVA 4AQRD 1ZN5A 2FFDC 2NPSB 2H8PD 1M1JC 3H32B 3H6PA 1FZFA 1HUCA 1NKNA 2XNXA 2XV5A 1JCDA 5AVVB 3TSIA 4W7YA 1KILD 2L5GB 1LTGC 1NOHA 3B5ND 1N7SC 4JF7A 1JCCA 4Y99C 1YTZI 5AVSB 2FFDB 3MTUE 1SLQA 1M1JB 2NPSA 1DEBA 1SQXK 1WRGA 3M0DA 1RE3C 3H32A 1FDMA 3VMXA 3M0AA 2J59M 1GU5A 5AW9B 1JTHB 2O1KA 2P67A 2Q9IA 2P2UA 3HTKB 3CL3D 1M7LA 1ZR2A 3BASA 1ZR4A 3MGNA 4I6MC 1IFMA 2C0WA 3EQ2A 1W2EA 2OARA 5KTBA 1N7SB 3O8ZA 1NTKK 4Y99B 2FKWB 1JMMA 3M91A 5KJ7A 1EQ7A 4LGDE 2FFDA 1ZV8A 1M1JA 5AW8B 5CCGC 1FBMA 1JY2N 1QL2A 1KFNA 1N7LA 3BATA 4DZOA 4M3LA 1GK6A 2WSCH 3L37A 1JTHA 5AVXB 3HTKA 1OXZA 3N7NA 1FOSE 2HLOA 1NH4A 3VN0A 1CW5A 2FYUK 5BU8B 5KJ7D 3V2QA 2YKPA 1RE4C 2KLVA 2O1JA 3A5TA 2A45I 3LW5H 1GL2B 2P7JA 1NAFA 1JUNA 3KPEA 1LWUA 5APXA 1H88A 1SFCC 1URQC 1RE3A 1NTZK 2ZXEB 1IC2A 2C0XA 4AYCA 3BRTB 4HH2A 5CCHD 2C9NY 1OWAA 3A3YB 3CI9A 1NO4A 1FZGA 3HD7A 3LIEA 1QL1A 1IK9A 4N6JA 2O01H 4DOJA 3OJAB 1JY2O 3P32A 5CJ4A 1JY3P 1G1JA 3HE4B 1HJBA 3LIDA 1HBWA 5APTA 1GL2A 3HE5B 1IFNA 4N78D 4N78E 5CCGA 1SFCB 1URQB 2WITA 1G2CB 4WY4D 1IJDB 4IFMA 1Z56A 5AW5B 3P8CD 2WZ7A 4C7RA 2C9LY 3RL0C 1A02J 2YMYA 2XZRA 3HD7D 2KOGA 1GW3A 5AVTB 4B86A 3I5CA 3SWFA 3HE4A 4C46A 1GL2D 1IFDA 1LTJC 5APVA 3RK2C 5AW4B 1MUUA 5CCGD 3RK3D 2XKMA 3TYYA 3HE5A 2W27A 1NU1K 3HUSA 4O9BA 1SFCA 1URQA 1NKZB 4IFDK 1G2CA 3U59A 3GHGC 3RL0B 3NMDA 3A2AA 3HRNA 3BVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NO4 A;  3MTU E;  1NOH A;  4IFF A;  3OA7 A; 
#chains in the Genus database with same CATH topology
 4ZMD A;  2YIU B;  2ITA A;  2UWJ E;  5GTI E;  3KZI E;  1NGM B;  4RJT A;  1VQM P;  1SFC D;  3U1C A;  3S9O A;  1N86 A;  1FZB A;  4W7Z A;  1ZME C;  2YXQ B;  1ZOY C;  2D2C D;  2AEM A;  3CX5 H;  1QLE D;  2Y9Y A;  1LGH B;  2VRS A;  4BRY A;  5APS A;  1RY3 A;  1JY3 N;  3P8M C;  1L2P A;  1HGZ A;  1QVG O;  3KQG A;  2IYO A;  4IFF A;  4K3A A;  2W6B A;  1X8Y A;  3FX0 A;  4GKG A;  2WSF H;  3CCS P;  2JP3 A;  2P58 A;  1BE3 D;  3AEA C;  1FZC C;  3P7K A;  3T97 A;  3AE3 C;  1S5L E;  1MV8 A;  1DD4 A;  1P84 D;  4XFJ A;  1NTM G;  1T3J A;  3KXD A;  1ZLL A;  2N1T A;  3TK1 A;  1M56 D;  1NTZ G;  2KS1 B;  1W2B O;  1LNQ A;  1FU1 A;  4GT1 A;  1YTZ T;  2OGU A;  1WT6 A;  1FZC B;  1HTL C;  4GOD A;  4N3Y B;  3WU2 E;  1KQL A;  4NPE A;  3L71 E;  5GTH E;  4H13 D;  1FE6 A;  1L0L J;  4YXW H;  1RE4 A;  1MKM A;  2IFM A;  4R4M A;  1KZU B;  2OYI A;  2BAS A;  3MUD A;  2JWA A;  2N9B A;  3B5N A;  3G4S P;  5KJ7 C;  1FOS F;  1A02 F;  1PPJ D;  1BGY J;  1PPJ E;  1K8A Q;  2AXC A;  2GUS A;  4TT3 H;  3II6 A;  3D70 A;  1OMI A;  3EFF K;  1EXJ A;  2Q7C A;  1RF1 C;  1KN7 A;  1BCC J;  3L74 D;  3QWO C;  4NPF X;  5CCH C;  3AE8 C;  1VQ4 P;  2CK3 H;  2E76 D;  2ZYA A;  5BU5 A;  3M06 A;  4JQ0 D;  4R4L A;  2FYZ A;  1DEE G;  1SQQ D;  2KZJ A;  4DCK A;  2V7Q J;  2R3S A;  2KUB A;  3L75 G;  3V6I A;  1OVR A;  4K35 A;  1RF1 B;  1T6A A;  3G3Z A;  3M9B A;  3USS A;  2R5B A;  2FBW C;  2BCC D;  2WPV B;  3O6Q A;  2P10 A;  1GL2 C;  1X9V A;  3RK3 C;  5APW A;  1GTW A;  2YKQ A;  1JB0 J;  3CWB G;  1YJN P;  2WSC J;  2K88 A;  2YXR B;  5APQ A;  2JKV A;  1KB9 H;  2WSS H;  1M8O B;  2W83 C;  3L72 G;  4MN4 C;  1YQ3 C;  1JNM A;  1FAV A;  1KYO H;  4WWI A;  3LW5 J;  3RK3 B;  3V4W A;  1KYO I;  4WY4 A;  3F89 A;  3NFQ A;  1SQQ K;  2QJP C;  4TLF A;  2IFN A;  3TF5 A;  2W8Z A;  2H89 C;  1SQV K;  3N4X A;  1T3U A;  2QM8 A;  4OWF A;  4PD4 D;  1PZQ A;  1ZXG A;  1YYC A;  1BE3 J;  3V2P A;  5KAF H;  2R44 A;  2AEJ A;  2QJP B;  2IBZ I;  4U3F J;  3AE6 C;  4EDF A;  3CXH E;  3H6P A;  2OTJ P;  4HJG H;  1AVO A;  1FZF A;  2XNX A;  1QGK B;  1KV4 A;  1USD A;  3IN6 A;  3AEC C;  1N7S C;  1JCC A;  3PLN A;  3GLM A;  2Q3E A;  2OQQ A;  3FWL A;  1KOR A;  1S3J A;  5H2F H;  4ASV A;  1BSN A;  3H32 A;  3GMA A;  5AW9 B;  2P67 A;  1U7M A;  1M7L A;  1ZR4 A;  3I55 P;  2B88 A;  3AE7 C;  5KTB A;  1N7S B;  3O8Z A;  1NTK K;  3M91 A;  5KJ7 A;  2FFD A;  2H88 C;  1Y9B A;  1PP9 J;  1HJ0 A;  3L71 G;  1FBM A;  1QL2 A;  1YJW P;  1EC5 A;  4DZO A;  2FXO A;  1GK6 A;  4KT0 J;  3L74 J;  1OXZ A;  1NU1 D;  3VN0 A;  1CW5 A;  2FYU K;  5KJ7 D;  2YKP A;  1OX3 A;  2O1J A;  1SQQ J;  2WSF J;  1JUN A;  3TGU D;  4UB6 H;  2IDB A;  1PPJ G;  1Q90 D;  5APX A;  3L73 J;  1SFC C;  1SQV J;  2ZXE B;  2ZYD A;  4L74 A;  1FS0 E;  1YJ9 P;  5CCH D;  4DT0 A;  3JCU H;  3BVH A;  2O01 H;  3OJA B;  1JY2 O;  3P32 A;  5CJ4 A;  2BCC J;  1G1J A;  3HE4 B;  1HJB A;  3LID A;  2K37 A;  2LXB A;  1GL2 A;  1SQQ G;  5CCG A;  1SFC B;  4JPZ B;  4IFM A;  3P8C D;  2WZ7 A;  4C7R A;  1OVU A;  3H25 A;  2YMY A;  1GW3 A;  5AVT B;  5KLV D;  4B86 A;  3I5C A;  3CC7 P;  2I8D A;  3R4Y A;  4C46 A;  1GL2 D;  2BCC G;  5APV A;  3RK2 C;  1MUU A;  5CCG D;  3RK3 D;  2G8Y A;  3RK3 E;  5B5E H;  1NU1 K;  3OW2 O;  1NTZ E;  5KKZ C;  2Q6Q A;  1VQK P;  1HF9 A;  3NMD A;  3KHU A;  2AEF A;  3H1J D;  3BCC J;  1DD3 A;  1NTK J;  4AUW A;  3RK2 B;  3CPW O;  2O3J A;  3L4F A;  4PJ0 E;  1YIJ P;  2N1T C;  5KKZ B;  4Y28 J;  2QVA A;  2YKO A;  2HG5 D;  2XDJ A;  2R3C A;  2LR2 A;  2E5T A;  4DJG A;  2FYU J;  3T97 B;  2WPS A;  1FDO A;  5AW3 B;  1LTJ A;  1GDT A;  2N1T B;  1N8R Q;  3PJS K;  1L0L D;  1L0L E;  5KLV K;  3RL0 D;  3SWK A;  1N7S A;  2WVR A;  3A0H E;  1KIL C;  1HVV A;  2OYI C;  2WT7 A;  1L4A A;  3W67 A;  2JR8 A;  3MUD C;  3B5N C;  4RKU J;  3V5B A;  5GTI H;  1BGY E;  2ZXX A;  1JO5 A;  5TIS E;  2A45 G;  2ZVN B;  1NYH A;  4RES B;  1X22 A;  1N7S D;  1LTS C;  1BSH A;  1BCC D;  4IL6 X;  1BCC E;  1KIL B;  2OYI B;  2WWW A;  1M90 Q;  3B5N B;  3VOP A;  2IZ0 A;  4ASW A;  3B8E B;  3MZW B;  3M0D C;  3CC2 P;  1NU1 J;  3SWY A;  2E43 A;  3WUV A;  1RQU A;  2Z5H A;  1U7J A;  1EDK A;  4GOE A;  3L70 J;  1N2D C;  1DX7 A;  3TGU J;  2QSI A;  2WPR A;  1S5L H;  2I1J A;  1L0L K;  3IR9 A;  2JEE A;  5AVZ B;  3PP5 A;  1K04 A;  3FXE A;  1P84 I;  1HH0 A;  2ZT9 C;  2FXP A;  1IO4 A;  3B4S A;  2E5Y A;  3WU2 H;  2XND H;  3VMZ A;  3D6Z A;  3TGU G;  3O6Q B;  3CME P;  1AA0 A;  2R32 A;  1LWU C;  1SQP K;  1N73 A;  3CC4 P;  2PAJ A;  3H1I J;  3MP7 B;  5AW0 B;  1IFP A;  4WY4 C;  2IPP A;  5KLV J;  5L8R J;  2B87 A;  3AEG C;  2ZT9 B;  4YTP C;  1UIX A;  2FY8 A;  3I56 P;  1L0N K;  3L35 A;  5AVU B;  2M5A A;  1LWU B;  2A06 D;  4W80 A;  1BE3 E;  3H1J J;  2HYN A;  3Q5S A;  4WY4 B;  4PV1 C;  3V2R A;  1P84 E;  3RK2 D;  1NJI Q;  3VMA A;  2OYH A;  4U3F D;  4U3F E;  2K3R A;  5DJU B;  4HYT B;  5AW6 B;  1RF0 A;  1CI6 A;  1SQX D;  2K9Y A;  3HUS C;  1YHQ P;  4UB8 H;  4IOI H;  3AEB C;  3V4Q A;  1NWQ A;  2H43 A;  1SP4 A;  2N1T D;  2K9J A;  2O01 J;  4GDO A;  2KP8 A;  1LT9 A;  3AEE C;  3HUS B;  1VQ8 P;  1KIL A;  3D6Y A;  2PGD A;  2P1J A;  3CCL P;  1ZN5 A;  2FFD C;  5KLI C;  3CX5 D;  1PP9 D;  3CX5 E;  1PP9 E;  3H32 B;  2PRR A;  1AVY A;  1L0L G;  1SQP J;  4W7Y A;  1KIL D;  3L74 E;  3H1H D;  3PHL A;  1NOH A;  3B5N D;  4JF7 A;  2FFD B;  1RHZ B;  1SQQ E;  1SLQ A;  2BEZ F;  2NPS A;  5KLI B;  1L0N J;  1SQX K;  1BGY G;  3M0D A;  3L73 D;  3L73 E;  1SQV D;  1SQV E;  1FDM A;  1NAY A;  3S1K A;  2FYN C;  2KLU A;  3M0A A;  1GU5 A;  2J59 M;  3GF3 A;  1Q81 Q;  3CL3 D;  3BAS A;  1BCC G;  3EQ2 A;  2OAR A;  4PD4 I;  2BCC E;  1JMM A;  3ABV C;  4LGD E;  1VQ7 P;  3AE9 C;  1LP1 B;  1VL2 A;  2AXT E;  5AW8 B;  1K73 Q;  5CCG C;  1PGJ A;  3CXH H;  4KJM A;  1S5L X;  2FYN B;  3BAT A;  2Y9Z A;  3HTK A;  3N7N A;  1R8E A;  3CCU P;  3CXH I;  3QH9 A;  3G71 P;  2A45 I;  1GL2 B;  1NAF A;  4I7Z C;  3KPE A;  5B66 H;  1LWU A;  4RO0 A;  4L75 A;  1IC2 A;  1TU3 F;  2ZT9 D;  2C9N Y;  2ZJS E;  1OWA A;  3CI9 A;  3BCC D;  3LIE A;  3BCC E;  1IK9 A;  4DOJ A;  3C1L A;  1NTK D;  1Y8A A;  1NTK E;  2E75 C;  3RL0 g;  1PL5 A;  4I7Z B;  4PD4 E;  3E1R A;  1SQB D;  2WIT A;  4WY4 D;  3Q1M A;  1Z56 A;  1K05 A;  3RL0 C;  2DW3 A;  2FYU D;  2FYU E;  2GA1 A;  3PH0 A;  2E75 B;  1VQ6 P;  1LTJ C;  5AW4 B;  3H1L J;  1SQX J;  3HE5 A;  2W27 A;  2A06 G;  4HKZ H;  3HUS A;  1URQ A;  4PV1 D;  1BE3 G;  3RL0 B;  4CPG A;  3A2A A;  1L4A C;  3UIA A;  3Q2Y A;  2L91 A;  4U3F G;  3GG2 A;  1LTJ B;  1J1E C;  3IAO A;  1KB9 D;  1JOC A;  1LTT C;  1KB9 E;  2KSE A;  1OZH A;  3IFM A;  4IL6 H;  5KAI E;  2SPZ A;  4NPD A;  4EOT A;  1KYO D;  1T2K C;  2J58 A;  1FC2 C;  2WT7 B;  1QEX A;  1L4A B;  2WSE H;  1SQB K;  4JYB A;  1J1E B;  2HPC A;  1PFI A;  3H1H J;  3MIW A;  1NU1 E;  2HFE D;  1OVV A;  1S1C X;  2CPS A;  3GHG A;  4Z1M H;  5CHX A;  3L70 D;  3L70 E;  4A7P A;  1VQP P;  1LP1 A;  3TGU E;  1PGP A;  4C7N A;  3M9Q A;  5KAF E;  1PP9 G;  1MZ9 A;  1W5C E;  1EZV D;  2KXP B;  3G6E P;  1QX8 A;  4JYC A;  3A7O A;  3L74 G;  5AVW B;  1X79 B;  1OW8 A;  3TNU A;  4WBA A;  3Q3D A;  2QM7 A;  3SFE C;  1OFC X;  1JY3 O;  2BEQ D;  5C39 A;  1XTG B;  5E79 E;  2Z4E A;  1FZA A;  3L73 G;  1SQV G;  2Y0E A;  3P8C E;  1N73 C;  5H2F E;  2M3E A;  3NTN A;  5CJ0 A;  2QRX A;  1M57 D;  2Q5U A;  3H1I D;  3H1I E;  3CLQ A;  3W68 A;  4D6T J;  3Q5P A;  3A0H H;  5KLV E;  2KNC A;  5AW2 B;  1VQ9 P;  2JDI H;  2G3A A;  1RH5 B;  3RBX A;  1IFI A;  2POH A;  2WPQ A;  4I1L A;  1MFT A;  2YNY A;  2H7H A;  1KFM A;  2N9Y B;  2MJZ A;  1J1D C;  1N73 B;  5TIS H;  1KD1 Q;  1Y47 A;  2K1A A;  3VP9 A;  1NTM D;  3H1J E;  2B87 B;  5BVZ A;  3BRV B;  1OIP A;  2QEX P;  2YO2 A;  1PGO A;  1VF5 C;  3KYQ A;  2OYH C;  4XE5 B;  1SQB J;  1SVF A;  3PTZ A;  4WB4 A;  2M5A B;  1RF0 C;  3CCV P;  1OW6 A;  1J1D B;  4UB6 E;  2KI7 B;  2B9B A;  2QE7 H;  2I1K A;  1LTI C;  2E75 D;  2Q3I A;  3BCC G;  1FJK A;  2Z5I A;  3KDP B;  4H44 C;  1VF5 B;  1NTK G;  2W6J H;  1H8A A;  3IF4 A;  2OYH B;  3HD7 C;  3SFD C;  1IK7 A;  3VMY A;  1YQ4 C;  3C8V A;  2HOD A;  1AFO A;  3OA7 A;  1CI6 B;  1GD2 E;  1LT9 C;  1ZW0 A;  2RKL A;  1DH3 A;  1VPC A;  1LTB C;  4H44 B;  2FYU G;  3KZI H;  5AW7 B;  3HD7 B;  2K9J B;  2YMK A;  2ZVO B;  2FXM A;  1S2E A;  3G9R A;  1YI2 P;  1NTM K;  1SQP D;  1LT9 B;  1SQP E;  1L4A D;  4BWN A;  1KC8 Q;  2WTY A;  1JY2 P;  2NPS C;  4KHX A;  5AVY B;  1L0N D;  1AJY A;  1L0N E;  3H1K J;  5DJT B;  5M1B A;  3MHV A;  2CPB A;  1VQO P;  3S4R A;  1T2K D;  2PP6 A;  3RGU A;  2GUV A;  1P84 H;  4EI2 A;  4AQR D;  2NPS B;  3CCM P;  2IZ1 A;  5K5G B;  1HUC A;  1NKN A;  2LXC B;  1NU1 G;  1JCD A;  2ZAE B;  1RQV A;  2L5G B;  1LTG C;  3L70 G;  1PIX A;  2QJY C;  4ZNC A;  1YTZ I;  5AVS B;  1U57 A;  1DEB A;  1EZV G;  5GTH H;  1S4X A;  1AV1 A;  1KQS O;  2P2U A;  3HTK B;  1ZR2 A;  1WMK A;  2QJY B;  2C0W A;  1M1J A;  2A06 E;  2WSE J;  1JY2 N;  4EYY Q;  1VQL P;  1NTM J;  3WUU A;  3H1I G;  1H0T A;  3L37 A;  1JTH A;  3CX5 I;  5KLV G;  1NTZ J;  1NH4 A;  1YBK A;  3A5T A;  2P7J A;  3H1L D;  2E74 C;  3H1L E;  2OTK E;  1SQX E;  1URQ C;  1RE3 A;  4BXL A;  2C0X A;  1JEK A;  4AYC A;  4PV1 B;  1ZRT D;  1ZRT E;  3H1J G;  4HH2 A;  1VF5 D;  2O01 N;  3A3Y B;  3AE4 C;  3A0B E;  1NO4 A;  3HD7 A;  3GW6 A;  4N6J A;  4L76 A;  1AQT A;  2AXT H;  2E74 B;  1KQG B;  3JSV C;  3HE5 B;  1IFN A;  2RMZ A;  1URQ B;  4QMA A;  3CCE P;  3L71 D;  5AW5 B;  4H44 D;  2NZ2 A;  1A02 J;  2XZR A;  3HD7 D;  3WUT A;  3SSU A;  1GMJ A;  3TDK A;  4YXD C;  1IZN B;  1IFD A;  4GOF A;  2XKM A;  1KIL E;  3H1H E;  2QA4 P;  4IFD K;  4OVN F;  1G2C A;  3GHG C;  3L75 J;  1PV3 A;  2WQY C;  1HWT C;  2J5U A;  3JC2 2;  3L36 A;  4PD4 H;  2E42 A;  1UII A;  2HPC B;  3EFG A;  1KTM A;  1EDI A;  1Q86 Q;  5AVQ B;  4I2L C;  1LTA C;  1SQP G;  3M9H A;  3GHG B;  2NPS D;  3CWB J;  4C7N B;  1KQF B;  4UB8 E;  1L0N G;  4EIJ A;  3L72 J;  2A45 H;  3ZDM A;  2XU6 A;  4D6T D;  4D6T E;  3TNU B;  4YPC A;  2ZYG A;  2JO1 A;  1JMB A;  1CZQ A;  3NXS A;  5AW1 B;  2KSJ A;  4XA4 A;  4H0L C;  5KAI H;  3MD0 A;  3ITK A;  1T8Z A;  3E7K A;  1PGQ A;  1HGV A;  2M8R A;  1FZE A;  4LLH A;  1KB9 I;  2KNC B;  2GM4 A;  1VQN P;  4ZKP A;  1SQB E;  2B89 A;  4H0L B;  2IYP A;  1EXI A;  2IX7 C;  1XTC C;  3C9I A;  4OGQ C;  3FGA D;  1YIT P;  2KYV A;  2KS1 A;  1S72 P;  4OH8 B;  5CMZ A;  2LKM A;  1FZC A;  2KZI A;  1GZL A;  1NHL A;  3GF7 A;  1AQ5 A;  3CXH D;  1FDI A;  2QJK C;  3OAK A;  4OGQ B;  1EZV I;  3AE2 C;  1R5S A;  2E74 D;  2ZFC A;  1GK4 A;  5CBN A;  1LJ2 A;  3D71 A;  5E79 H;  3RBZ A;  1URQ D;  3H1L G;  2R5D A;  1SQX G;  2HOD B;  5AVR B;  1E5W A;  1GW4 A;  3L71 J;  1KYO E;  1IFJ A;  2KK7 A;  2V4H A;  5B66 E;  3CCJ P;  1BDC A;  2QJK B;  1S9K D;  1FJP A;  1S9K E;  4ZKU A;  1J2J B;  4GIF A;  3E1I A;  1K9M Q;  2M3B A;  4LC1 A;  3H1K D;  3H1K E;  3AE5 C;  1EDJ A;  1H89 A;  3FXD A;  3AEF C;  1BDD A;  1MFZ A;  5CBO A;  2YO3 A;  1GU4 A;  2IBZ D;  2IBZ E;  1RF1 A;  1Q7Y Q;  3VTP C;  5CCH A;  2JJL A;  4PJ0 H;  1EZV E;  3U1A A;  1Q82 Q;  3V2N A;  2KB7 P;  3H1H G;  3WMM 0;  2OTL P;  3CMA P;  5APY A;  3R2P A;  2Y0C A;  1VDF A;  2W6A A;  3VP8 A;  5APU A;  2D2C C;  4HB1 A;  1G1I A;  2QG4 A;  3VYI A;  1ZP0 C;  2PFX A;  2RN0 A;  4IL6 E;  1CSB A;  3F5H A;  5EFW B;  2D2C B;  2H8P D;  1M1J C;  3CD6 P;  2XV5 A;  1NTM E;  4U7J A;  5AVV B;  3TSI A;  4D6T G;  2WMM A;  1NTZ D;  3CCQ P;  4Y99 C;  4H0L D;  3MTU E;  1E79 H;  3EWK A;  1M1J B;  2V7Q H;  1EDL A;  1WRG A;  1RE3 C;  4BRY B;  3VMX A;  2NRG A;  2M0B A;  1H0T B;  1D7M A;  1JTH B;  2O1K A;  2Q9I A;  2Y0D A;  3JCU E;  3MGN A;  4I6M C;  3CCR P;  1IFM A;  4H13 C;  1W2E A;  1M1K Q;  4Y99 B;  2FKW B;  1SQB G;  1EQ7 A;  3K5B A;  1ZV8 A;  1SS1 A;  2RH0 A;  1VQ5 P;  1OW7 A;  1KFN A;  2HR3 A;  4L73 A;  2OYO A;  1N7L A;  4OGQ D;  4M3L A;  2WSC H;  5AVX B;  1FOS E;  2HLO A;  5TJH A;  4H13 B;  2KIK A;  5BU8 B;  2JWD A;  3V2Q A;  1RE4 C;  2KLV A;  3PRJ A;  3LW5 H;  4WVZ A;  2Q1K A;  2QIW A;  2E76 C;  5B5E E;  1H88 A;  1NTZ K;  2MKV A;  1BGY D;  3L75 D;  3L75 E;  3BRT B;  2W90 A;  3FWN A;  1FZG A;  1QL1 A;  1Q2N A;  1JY3 P;  1X0T A;  1HBW A;  5APT A;  1QVF O;  1DIP A;  4N78 D;  4N78 E;  2E76 B;  3AED C;  1USE A;  3B71 A;  1G2C B;  1IJD B;  1KMI Z;  2C9L Y;  3AE1 C;  3CWB D;  3CWB E;  2KOG A;  1LT1 A;  4JBZ A;  2YIU C;  3H1K G;  3SWF A;  3HE4 A;  3L72 D;  3L72 E;  1NVO A;  3TYY A;  4O9B A;  1SFC A;  1NKZ B;  3U59 A;  1JM0 A;  2IBZ G;  1R5L A;  3A0B H;  3HRN A;  3Q5R A; 
#chains in the Genus database with same CATH homology
 1L4A C;  3UIA A;  1HWT C;  4AUW A;  3L36 A;  1LTJ B;  2E42 A;  1J1E C;  3RK2 B;  2HPC B;  1JOC A;  1LTT C;  3IFM A;  3EFG A;  3L4F A;  5AVQ B;  4I2L C;  1SFC D;  2N1T C;  3U1C A;  1LTA C;  1N86 A;  4EOT A;  3M9H A;  3GHG B;  1FZB A;  4W7Z A;  1T2K C;  2YKO A;  2HG5 D;  2J58 A;  2XDJ A;  2R3C A;  2NPS D;  2WT7 B;  4C7N B;  1L4A B;  2WSE H;  1SQB K;  1LGH B;  2VRS A;  2WPS A;  4EIJ A;  4JYB A;  1J1E B;  5AW3 B;  5APS A;  1LTJ A;  1RY3 A;  1JY3 N;  2HPC A;  1GDT A;  2A45 H;  2N1T B;  3P8M C;  1PFI A;  3MIW A;  2HFE D;  2XU6 A;  1HGZ A;  2CPS A;  3KQG A;  4IFF A;  3TNU B;  5KLV K;  3GHG A;  3RL0 D;  1N7S A;  2W6B A;  1X8Y A;  4GKG A;  5CHX A;  2WSF H;  1KIL C;  1HVV A;  2OYI C;  2WT7 A;  4C7N A;  3M9Q A;  1L4A A;  1FZC C;  1CZQ A;  3NXS A;  3B5N C;  3P7K A;  5AW1 B;  3T97 A;  2KSJ A;  1MZ9 A;  4XA4 A;  3V5B A;  1MV8 A;  3MD0 A;  1T8Z A;  1T3J A;  1ZLL A;  1JO5 A;  2N1T A;  1HGV A;  4JYC A;  3TK1 A;  3A7O A;  5AVW B;  1X79 B;  2M8R A;  1FZE A;  2A45 G;  4RES B;  1N7S D;  4LLH A;  1LTS C;  3TNU A;  2GM4 A;  1FU1 A;  4WBA A;  1KIL B;  4GT1 A;  2QM7 A;  2OYI B;  1YTZ T;  1WT6 A;  2WWW A;  1HTL C;  1JY3 O;  4ZKP A;  1FZC B;  4N3Y B;  3B5N B;  3VOP A;  1XTG B;  1KQL A;  2Z4E A;  1FZA A;  3B8E B;  3M0D C;  3P8C E;  1N73 C;  3NTN A;  5CJ0 A;  2IX7 C;  3SWY A;  2Q5U A;  2E43 A;  2Z5H A;  3CLQ A;  1XTC C;  3C9I A;  2KYV A;  5AW2 B;  1RE4 A;  2IFM A;  1N2D C;  1DX7 A;  4OH8 B;  1KZU B;  2OYI A;  5CMZ A;  2LKM A;  1FZC A;  1IFI A;  2BAS A;  2WPR A;  3MUD A;  2N9B A;  3B5N A;  2POH A;  2I1J A;  1GZL A;  2WPQ A;  4I1L A;  5KJ7 C;  1L0L K;  1FOS F;  1A02 F;  2YNY A;  3IR9 A;  2H7H A;  1NHL A;  1KFM A;  2MJZ A;  1J1D C;  1N73 B;  2JEE A;  5AVZ B;  1AQ5 A;  2GUS A;  3PP5 A;  3II6 A;  3OAK A;  3VP9 A;  1HH0 A;  2Q7C A;  1RF1 C;  5BVZ A;  3BRV B;  2YO2 A;  5CCH C;  1IO4 A;  3KYQ A;  2ZFC A;  2OYH C;  1GK4 A;  4XE5 B;  3VMZ A;  5BU5 A;  3M06 A;  1URQ D;  1SVF A;  2R5D A;  2FYZ A;  2HOD B;  5AVR B;  4WB4 A;  2R32 A;  1E5W A;  1RF0 C;  1GW4 A;  1IFJ A;  1J1D B;  1LWU C;  1SQP K;  1N73 A;  2PAJ A;  1S9K D;  1FJP A;  1S9K E;  5AW0 B;  2I1K A;  1LTI C;  1RF1 B;  4WY4 C;  2IPP A;  4ZKU A;  2Q3I A;  3G3Z A;  3M9B A;  1FJK A;  1J2J B;  2Z5I A;  3KDP B;  4GIF A;  1H8A A;  3E1I A;  2OYH B;  1L0N K;  3HD7 C;  2M3B A;  4LC1 A;  3L35 A;  3VMY A;  2R5B A;  2HOD A;  5AVU B;  1AFO A;  1H89 A;  1LWU B;  1GL2 C;  3OA7 A;  1CI6 B;  1GD2 E;  1X9V A;  3RK3 C;  1LT9 C;  1MFZ A;  2YO3 A;  4W80 A;  5APW A;  1GTW A;  1GU4 A;  2YKQ A;  2HYN A;  4WY4 B;  1RF1 A;  1VPC A;  1DH3 A;  1LTB C;  3VTP C;  5APQ A;  3V2R A;  3RK2 D;  5AW7 B;  5CCH A;  2JJL A;  3HD7 B;  3U1A A;  2OYH A;  3V2N A;  2FXM A;  1JNM A;  4HYT B;  2KB7 P;  5AW6 B;  1NTM K;  1FAV A;  3WMM 0;  1RF0 A;  3RK3 B;  5APY A;  1CI6 A;  1LT9 B;  3R2P A;  1VDF A;  3HUS C;  1L4A D;  2W6A A;  3V4W A;  4WY4 A;  3VP8 A;  5APU A;  3NFQ A;  2WTY A;  1SQQ K;  2IFN A;  1JY2 P;  3V4Q A;  2NPS C;  1NWQ A;  4KHX A;  2H43 A;  1SP4 A;  5AVY B;  2N1T D;  1G1I A;  1SQV K;  3N4X A;  3VYI A;  1T3U A;  2KP8 A;  2QM8 A;  2CPB A;  1T2K D;  2PP6 A;  1LT9 A;  3HUS B;  1KIL A;  1YYC A;  3V2P A;  1CSB A;  2P1J A;  2GUV A;  4AQR D;  1ZN5 A;  2FFD C;  2NPS B;  2H8P D;  1M1J C;  3H32 B;  3H6P A;  1FZF A;  1HUC A;  1NKN A;  2XNX A;  2XV5 A;  1JCD A;  5AVV B;  3TSI A;  4W7Y A;  1KIL D;  2L5G B;  1LTG C;  1NOH A;  3B5N D;  1N7S C;  4JF7 A;  1JCC A;  4Y99 C;  1YTZ I;  5AVS B;  2FFD B;  3MTU E;  1SLQ A;  1M1J B;  2NPS A;  1DEB A;  1SQX K;  1WRG A;  3M0D A;  1RE3 C;  3H32 A;  1FDM A;  3VMX A;  3M0A A;  2J59 M;  1GU5 A;  5AW9 B;  1JTH B;  2O1K A;  2P67 A;  2Q9I A;  2P2U A;  3HTK B;  3CL3 D;  1M7L A;  1ZR2 A;  3BAS A;  1ZR4 A;  3MGN A;  4I6M C;  1IFM A;  2C0W A;  3EQ2 A;  1W2E A;  2OAR A;  5KTB A;  1N7S B;  3O8Z A;  1NTK K;  4Y99 B;  2FKW B;  1JMM A;  3M91 A;  5KJ7 A;  1EQ7 A;  4LGD E;  2FFD A;  1ZV8 A;  1M1J A;  5AW8 B;  5CCG C;  1FBM A;  1JY2 N;  1QL2 A;  1KFN A;  1N7L A;  3BAT A;  4DZO A;  4M3L A;  1GK6 A;  2WSC H;  3L37 A;  1JTH A;  5AVX B;  3HTK A;  1OXZ A;  3N7N A;  1FOS E;  2HLO A;  1NH4 A;  3VN0 A;  1CW5 A;  2FYU K;  5BU8 B;  5KJ7 D;  3V2Q A;  2YKP A;  1RE4 C;  2KLV A;  2O1J A;  3A5T A;  2A45 I;  3LW5 H;  1GL2 B;  2P7J A;  1NAF A;  1JUN A;  3KPE A;  1LWU A;  5APX A;  1H88 A;  1SFC C;  1URQ C;  1RE3 A;  1NTZ K;  2ZXE B;  1IC2 A;  2C0X A;  4AYC A;  3BRT B;  4HH2 A;  5CCH D;  2C9N Y;  1OWA A;  3A3Y B;  3CI9 A;  1NO4 A;  1FZG A;  3HD7 A;  3LIE A;  1QL1 A;  1IK9 A;  4N6J A;  2O01 H;  4DOJ A;  3OJA B;  1JY2 O;  3P32 A;  5CJ4 A;  1JY3 P;  1G1J A;  3HE4 B;  1HJB A;  3LID A;  1HBW A;  5APT A;  1GL2 A;  3HE5 B;  1IFN A;  4N78 D;  4N78 E;  5CCG A;  1SFC B;  1URQ B;  2WIT A;  1G2C B;  4WY4 D;  1IJD B;  4IFM A;  1Z56 A;  5AW5 B;  3P8C D;  2WZ7 A;  4C7R A;  2C9L Y;  3RL0 C;  1A02 J;  2YMY A;  2XZR A;  3HD7 D;  2KOG A;  1GW3 A;  5AVT B;  4B86 A;  3I5C A;  3SWF A;  3HE4 A;  4C46 A;  1GL2 D;  1IFD A;  1LTJ C;  5APV A;  3RK2 C;  5AW4 B;  1MUU A;  5CCG D;  3RK3 D;  2XKM A;  3TYY A;  3HE5 A;  2W27 A;  1NU1 K;  3HUS A;  4O9B A;  1SFC A;  1URQ A;  1NKZ B;  4IFD K;  1G2C A;  3U59 A;  3GHG C;  3RL0 B;  3NMD A;  3A2A A;  3HRN A;  3BVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...