3HTKA

Crystal structure of mms21 and smc5 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
60
structure length
60
Chain Sequence
b'KPFANTKKTLENQVEELTEKCSLKTDEFLKAKEKINEIFEKLNTIRDEVIKKKNQNEYYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Structural maintenance of chromosomes protein 5
publication title Structural and functional insights into the roles of the Mms21 subunit of the Smc5/6 complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Recombination/replication/ligase
total genus 28
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2009-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3htkA00
3HE5B 3V5BA 1FAVA 2YO2A 2VRSA 2C9LY 3M9HA 3V4WA 4C46A 4I2LC 1T2KD 3LIEA 3HE4A 3A7OA 1NWQA 2C9NY 5AVYB 2R32A 3V4QA 3L37A 2H7HA 2R5DA 1A02F 2XU6A 2Q7CA 3SWFA 4XE5B 3VMXA 4LC1A 1H8AA 1KQLA 1H88A 4AYCA 3TNUB 4I6MC 5AW7B 5AW4B 2WWWA 1A02J 1MUUA 3A2AA 1OXZA 2R5BA 5AW8B 3L36A 3M91A 1T2KC 1GU4A 1H89A 2QM8A 3IR9A 4AQRD 2W6AA 1NAFA 3KDPB 4HYTB 4M3LA 3VN0A 2WT7A 5APSA 2Z5HA 3B8EB 3NMDA 2W27A 3HTKA 5AVXB 2Q3IA 3TK1A 4EOTA 3L35A 5AW3B 2JJLA 5APUA 5AW2B 2E42A 3NFQA 2WPRA 5APQA 1G2CB 5AVUB 5AVTB 2ZXEB 1X8YA 3OAKA 5AVQB 5AW5B 4AUWA 2IPPA 3UIAA 3NXSA 1J2JB 3VTPC 4C7NA 2R3CA 3A3YB 1CI6A 4JYCA 5AW1B 2QM7A 2BASA 2ZFCA 5APTA 3VMZA 4B86A 1IO4A 5CMZA 3VMYA 1S9KD 3MD0A 3HE4B 1GK6A 2WT7B 1HJBA 1HBWA 1CZQA 5AW0B 4RESB 1JNMA 3P8MC 1GZLA 4JYBA 1DH3A 5APVA 2N9BA 3KQGA 1FOSE 1GK4A 5AVSB 2WPSA 3M06A 3P7KA 4KHXA 2XZRA 4GKGA 3A5TA 5APXA 1S9KE 2Z5IA 3VYIA 3HE5A 2E43A 1GTWA 3I5CA 4C7NB 3M0DA 3M9BA 2YO3A 3TYYA 1CI6B 3MGNA 2P67A 2P7JA 1OWAA 1MFZA 1GD2E 5APWA 1GU5A 2XV5A 2P2UA 3P32A 5AW9B 2WPQA 3M0AA 5AW6B 3T97A 5AVRB 4DZOA 1JUNA 3NTNA 1SLQA 1CSBA 3LIDA 5AVVB 4GT1A 1FOSF 1YYCA 3TNUA 2KP8A 1SP4A 2WTYA 5APYA 2Q5UA 1MV8A 1HWTC 3O8ZA 1HUCA 5AVWB 5AVZB 2YNYA
chains in the Genus database with same CATH superfamily
1KC8Q 3HE5B 2A06G 1SQPJ 2WSSH 1IK7A 1NTKD 1EZVI 3A7OA 2OQQA 4L76A 2ZT9B 5GTIH 5KKZC 1SQBE 4YPCA 1RHZB 1USDA 4H44D 1EZVE 2IYPA 4ZNCA 3L70J 1JTHA 3H1KJ 2K3RA 2XNDH 5C39A 3SSUA 1YJNP 1SFCD 3HTKA 1LTJC 2GA1A 1SQVD 2QJKB 3H1HE 5AVQB 5L8RJ 2Y0DA 1J2JB 2H88C 4JYCA 1FDOA 1SVFA 5TJHA 3BATA 1OVUA 1JB0J 3Q5PA 2AEMA 2P1JA 4N78E 4R4LA 2NRGA 1YITP 1JY3N 2RMZA 1LTBC 1YI2P 3RK3E 3S1KA 4PD4H 3TYYA 3AE7C 3P32A 1SQXG 4O9BA 1OVRA 3HD7D 4H0LC 1LP1B 1NH4A 1BCCD 2FFDC 1UIIA 2HG5D 1YYCA 2E76D 1SS1A 1LTJA 1MV8A 1HUCA 1HF9A 1EDLA 2Q1KA 3CCJP 3CWBE 2A45I 1NTMG 1YBKA 3EWKA 4QMAA 3H1IE 4NPFX 2N9YB 3R4YA 3Q3DA 2WZ7A 2J58A 1N8RQ 3LW5J 1K9MQ 1A02J 4EI2A 1PV3A 1EC5A 3O6QB 3E1IA 3L74D 3BCCD 3QWOC 3TK1A 1BE3D 2LKMA 3B5NC 2UWJE 1JEKA 3L75D 1LTSC 2Y9ZA 1T3JA 1AVYA 2ZXEB 3OAKA 5B66H 1QVFO 1D7MA 3A0BE 2E75B 1HVVA 2L5GB 1DH3A 3M06A 1J1DB 4WWIA 2PAJA 4U7JA 1S9KE 3V6IA 1S1CX 2HODB 1SQQG 2K1AA 3KPEA 1L0NG 4U3FD 2WPQA 1VQ5P 3RBZA 3D6YA 4WBAA 4ASVA 2QEXP 2WVRA 2RH0A 1SP4A 4PV1B 1N73B 3O8ZA 2GM4A 3LW5H 1LWUB 2VRSA 3RK2C 3IAOA 4OVNF 2LXCB 3CC7P 3GHGB 1IFJA 5AVYB 3AE9C 1PPJD 2R5DA 1WMKA 3CCEP 3B4SA 2FXPA 3TDKA 5KLVD 3CLQA 3L71D 4EDFA 3L73E 2OYHB 1HTLC 1OXZA 5AW8B 4IFFA 1USEA 2WMMA 1KV4A 5M1BA 5CCGC 2WT7A 2N1TA 2KLUA 5APUA 2H8PD 2HPCA 1NU1K 1M56D 2WPRA 4YXDC 1NHLA 2ZYDA 4C7NA 1N7SC 2E5YA 1YQ3C 2FYUJ 2ZYGA 5CMZA 1L0LK 1RE4C 1RF0C 4H0LD 3MP7B 5B5EH 1P84D 2WITA 1JNMA 1M1JB 2N9BA 4C7RA 1K73Q 2RKLA 2AXTH 4OGQD 3SWYA 3Q2YA 1SQBJ 4KT0J 4GOFA 3BRTB 2Z4EA 1YHQP 3BCCJ 4MN4C 3LIDA 3H1LJ 4GT1A 5BU5A 3CXHH 3AE6C 4I1LA 3M9HA 1AV1A 4LGDE 4C46A 1PGQA 1KQGB 1KQFB 1VQMP 3A0HE 4WB4A 3H1HJ 1N7SA 1FS0E 3B5ND 1GL2C 4D6TG 4LC1A 3PHLA 3KZIH 1PFIA 1L4AB 1RE4A 1RF0A 1S4XA 4I6MC 3C9IA 1G1IA 4IFDK 3A2AA 1NTKK 1NU1E 3H32A 3D71A 1NTZG 2W6AA 2KOGA 3TGUD 2Z5HA 4U3FJ 1BSHA 3V2QA 1VF5B 2QE7H 5AW2B 1QLED 2IBZD 1L0LE 1JOCA 2N1TD 1BGYD 3P8CD 1LJ2A 2QM7A 3CX5D 3WUUA 1HJBA 3H1JG 3BVHA 2ZJSE 1KTMA 2KXPB 1GZLA 1KB9D 1BGYG 1LT9C 3CWBJ 2AEFA 3JSVC 3W68A 1JMMA 1GL2A 1JY3P 5KLVJ 3RK2D 1BDDA 3PLNA 1IFNA 3H1IJ 1LTTC 1KYOI 1URQC 1K04A 2KUBA 1QVGO 1DIPA 2O3JA 2FYNC 3V4QA 3JCUH 1GMJA 3V5BA 2KSJA 1KYOE 3FWLA 5KTBA 4I2LC 1YIJP 3CC2P 5CCGD 2OGUA 2BCCE 2QRXA 1SQPG 4XE5B 1H8AA 1NVOA 1KQLA 2ZVOB 2R3SA 2KYVA 2NPSC 1NTKE 1N7SD 3E7KA 5E79H 3RL0C 3L36A 3M91A 1T2KC 1LT9A 1Y9BA 1RF1B 1JY2O 4EYYQ 1DX7A 3L70G 1T6AA 3H1KG 2O01N 2YMKA 1SFCA 3AE4C 1URQA 3VTPC 1VQLP 3BRVB 1PGJA 1SQVE 2YXQB 1FZBA 1JTHB 2OYIB 2AXTE 1ZP0C 5AW0B 2A45H 1IC2A 1JMBA 1FOSE 2HR3A 2B89A 3OA7A 5KAIH 3VYIA 2J5UA 2NPSA 3L72D 4BRYA 4GOEA 1KILC 2JKVA 1GL2D 2ITAA 3L73J 2K37A 3RL0g 3KZIE 3A0BH 1FAVA 1OZHA 2W6BA 2G3AA 2IYOA 1BCCE 3LIEA 2PP6A 3HE4A 3MIWA 4GDOA 2H7HA 1PP9G 2W90A 2A06D 2B87B 1VQ7P 1VQKP 1KORA 5APSA 1W2BO 3G4SP 3L35A 2KNCA 2XDJA 1YJ9P 1G2CB 1QL1A 3BCCE 3L74E 5KLVK 4ZKUA 1Q2NA 3H1LE 1BE3E 4I7ZB 4W80A 3A3YB 2AXCA 2KZIA 3L75E 2B88A 4WY4C 3PP5A 2QJYC 3IN6A 1T3UA 1URQD 2O01H 2XZRA 3CCMP 1KZUB 4OWFA 2P67A 1LNQA 3JCUE 1HJ0A 1EQ7A 1YJWP 5CCHC 4DJGA 1MKMA 3MTUE 4OGQB 1SLQA 2NPSD 1SQXD 4U3FE 2IFNA 1WT6A 1KB9H 1NU1J 4A7PA 2ZT9C 4DT0A 1T2KD 5E79E 1ZRTD 2BEZF 2M5AA 1H0TB 1NTMD 1IZNB 1L0LJ 1NAYA 3V2NA 1KMIZ 1PPJE 2LXBA 2QJKC 2FXOA 2Q6QA 1AVOA 2OTKE 3B8EB 5KLVE 3L72J 2IX7C 3L71E 3Q1MA 2M8RA 1NYHA 2HFED 3I56P 1PIXA 2KI7B 1VL2A 5CCHA 3OJAB 4UB6H 5KAIE 2CPBA 3EFFK 5AW1B 3A0HH 1IO4A 5KLIB 2WT7B 1AJYA 1KILD 1HBWA 1S72P 2N1TB 1E5WA 3AEBC 1P84I 2FYUG 3OW2O 4KHXA 3A5TA 3PRJA 1QL2A 4C7NB 3M9BA 1M57D 1P84E 2HLOA 2NZ2A 2FFDA 2BCCJ 2P7JA 4GODA 2P2UA 1SQQD 1L0ND 1NTKJ 3M0AA 3NTNA 5DJTB 3FWNA 1SQBG 3AEDC 2SPZA 1FZFA 1GDTA 4EIJA 5AVWB 1EZVG 3G9RA 1AFOA 1FZCC 3VMAA 2Q7CA 3SWFA 3VMXA 2XKMA 2YIUB 1H88A 1JCDA 2Y9YA 3H1HG 4GIFA 1NKNA 1SQVJ 2KZJA 3B5NA 2IZ1A 4WY4D 2I1JA 1Q86Q 3HRNA 2WSEH 3C8VA 1DD4A 2Q3IA 1N7SB 1X22A 1YTZT 4JQ0D 2IBZI 5AVTB 2E75C 3TGUE 1N2DC 1J1EB 1KYOH 4PJ0H 2QJPB 3NXSA 2R3CA 1QEXA 3AECC 3CX5I 3H32B 3CD6P 1J1DC 2IBZE 2KLVA 3EFGA 2V7QH 5CCHD 4ASWA 1KB9I 1BGYE 3P8CE 4OH8B 1FZCA 4ZKPA 1NTMJ 2YMYA 3CX5E 3VP9A 2KIKA 1BCCJ 4Y99B 2ZT9D 3I5CA 3CCRP 1RY3A 2OARA 1KB9E 3O6QA 3CWBG 1LTAC 4RJTA 1N73C 3GW6A 5AW9B 4L75A 4IL6E 3VOPA 1RQUA 1K05A 3H1IG 1VQNP 2E74B 3GHGC 2A45G 2Q9IA 1VPCA 3S4RA 3CC4P 2YO2A 2C9LY 2W8ZA 2E5TA 4H13B 1NWQA 2C9NY 1N86A 5EFWB 2R32A 1IFDA 4R4MA 1KQSO 1A02F 1R5SA 2OYHC 3L74J 1U57A 1BE3J 5CCGA 3L75J 1EDJA 4D6TD 2FXMA 1MUUA 2ZYAA 3AE5C 4JBZA 4IL6X 4UB6E 1S3JA 4M3LA 4N6JA 4EOTA 3USSA 3AEAC 1NTZD 1L0NJ 3TF5A 5AVUB 1EDIA 1M8OB 4AUWA 2G8YA 1CI6A 1M1JC 1M7LA 3M9QA 3GHGA 1W2EA 3SFEC 1GK6A 4H44B 1ZR2A 3GLMA 2CPSA 1S2EA 3P7KA 3H1JD 5APXA 1LTGC 1SFCB 2OYHA 1URQB 1Q82Q 2YO3A 1NO4A 5CBNA 4TT3H 4YTPC 3BASA 1SQVK 1FOSF 2YXRB 2KP8A 3L72E 1HWTC 1RE3C 1OX3A 3K5BA 3MUDC 3CPWO 3V4WA 3L73G 3L71J 1L4AC 2GUVA 1DD3A 2PFXA 1ZR4A 1CW5A 1SQXK 3AEEC 3II6A 4PD4D 2E75D 5AW4B 1SQPD 1LT1A 2YKOA 2A06E 3FXDA 3HD7B 1JY3O 1VF5C 2R5BA 4PJ0E 3RBXA 3C1LA 2E76B 1ZXGA 1IFIA 3HUSB 1FJPA 3PJSK 2J59M 4BWNA 1NTMK 3L70D 3H1KD 3I55P 2Y0EA 2W83C 1JY2P 3B71A 3MUDA 2JO1A 4WVZA 2WSCJ 1L4AA 4N3YB 1FE6A 1X79B 2I8DA 2FKWB 1OIPA 2IZ0A 2Z5IA 3MGNA 1ZOYC 3F89A 3SWKA 2QSIA 3HTKB 4UB8H 5CJ0A 1K8AQ 3AE1C 3SFDC 3WUVA 1IFMA 3ZDMA 3GMAA 3GG2A 1PL5A 1SQXE 1NU1G 3L37A 1SQQK 2XU6A 1L0NK 2O01J 2RN0A 3TGUJ 5CBOA 4IFMA 1PP9D 1R8EA 5AW7B 1RF1C 2K9JA 1PGOA 1Z56A 3F5HA 1P84H 1ZRTE 1L0LG 3D6ZA 1NTME 1W5CE 3FGAD 5KKZB 3W67A 4AQRD 4HYTB 1R5LA 1BGYJ 4RKUJ 1VQ4P 3H6PA 2WSCH 4Z1MH 2OYIC 1AQTA 1AA0A 1X8YA 2O1JA 1LTJB 1RQVA 3PH0A 2BASA 3MD0A 2K9YA 4XFJA 2IFMA 4RESB 1G1JA 3P8MC 5APVA 1FZEA 1KILA 2JWDA 1KILE 2WQYC 5BVZA 1L4AD 1OWAA 2JR8A 1RF1A 4HJGH 4ZMDA 1GU5A 2WSFJ 3RK3C 3T97A 2BCCG 3TNUA 1FC2C 4RO0A 1GW3A 2WTYA 5TISH 1NTKG 1SQQE 4H0LB 1L0NE 1VF5D 4NPEA 2OYIA 2FFDB 1MZ9A 2XNXA 2D2CC 1RH5B 2QG4A 4NPDA 3CL3D 3CX5H 2PRRA 3M0DC 2H89C 3CCVP 1KD1Q 3RL0D 1GU4A 2QM8A 1SQVG 4IL6H 3VN0A 4HB1A 4HH2A 3MHVA 3CXHD 4I7ZC 5AW3B 3CCUP 4WY4A 4K3AA 3U1AA 3Q5SA 2YKPA 2GUSA 3B5NB 4DOJA 2OTLP 1OW6A 3CMAP 1KN7A 3WU2E 2B87A 1NKZB 2WSFH 1ZLLA 1NTZK 2L91A 3CCLP 5AVSB 4UB8E 2KS1A 1X0TA 3AE8C 3HE5A 1PP9J 2FYUD 3M0DA 4OGQC 3S9OA 2JP3A 1JY2N 1VQ6P 1MFZA 1BCCG 2WSEJ 2H43A 1JM0A 5AVRB 3GF3A 1CSBA 1FZCB 1G2CA 2HPCB 1ZW0A 3GF7A 3R2PA 1NJIQ 5AVZB 1U7JA 1HGZA 1SQBD 1EZVD 1S5LH 3ABVC 5CHXA 2V7QJ 3H1LD 5GTHH 2P10A 1NGMB 3RK2B 4HKZH 4LLHA 3KHUA 1HH0A 4W7ZA 2HYNA 2MKVA 3L74G 3BCCG 1PZQA 1VQPP 3RGUA 5KAFH 3H1LG 1BE3G 3H1HD 3L75G 2K88A 3KDPB 4XA4A 3TSIA 4D6TE 1NOHA 2E42A 5KLIC 1SQPK 1Y47A 2N1TC 3FX0A 3ITKA 5H2FH 2POHA 1EDKA 3AEGC 4N78D 3Q5RA 1XTGB 1NTZE 2I1KA 3L4FA 4B86A 1H0TA 3AE3C 3RK3D 1FDIA 1LP1A 5CJ4A 1X9VA 3KQGA 2WPSA 4JPZB 5GTIE 4GKGA 4U3FG 4Y28J 1SQXJ 1GTWA 1QGKB 5BU8B 5TISE 1CI6B 1IFPA 2ZAEB 3H1JE 5KJ7C 2D2CD 1HGVA 2XV5A 3H25A 2QVAA 3KXDA 3EQ2A 3CWBD 3PTZA 1TU3F 2YNYA 1EXIA 1DEBA 3H1ID 4L74A 1PPJG 2YIUC 3WMM0 1AQ5A 4PV1C 4TLFA 5KLVG 3L71G 3N7NA 3CMEP 1LWUC 5K5GB 4PD4I 4W7YA 2M3BA 2W6JH 3QH9A 1GL2B 3IR9A 4PD4E 1J1EC 1SQPE 1IK9A 2QJPC 2Q3EA 3NMDA 1EXJA 2JJLA 2P58A 3FXEA 5KJ7A 2OTJP 1OW8A 1LTIC 1QX8A 5AW5B 2O1KA 2IPPA 3AE2C 2ZVNB 2HODA 1KFNA 2LR2A 1S9KD 3MZWB 3L70E 4Y99C 3H1KE 1SQQJ 1N73A 2WPVB 1YQ4C 1OMIA 1LWUA 1Q7YQ 3U1CA 2ZXXA 2E74C 1GD2E 1LT9B 5APWA 2FY8A 1FU1A 1U7MA 1S5LE 5AVVB 5GTHE 4H13C 3D70A 5DJUB 3CCSP 4IOIH 5B66E 2C0XA 2JWAA 5KAFE 1XTCC 1VQ8P 1JCCA 1FJKA 1N7LA 2FYNB 3V2RA 3L73D 3IFMA 3G71P 1JO5A 3TGUG 2WWWA 3VP8A 2KK7A 2NPSB 1S5LX 1NAFA 1PP9E 5H2FE 4BRYB 3IF4A 2IBZG 5AVXB 2YKQA 1FBMA 1ZN5A 3RL0B 1M1JA 4BXLA 1L2PA 3KYQA 4H44C 2K9JB 3CI9A 3V2PA 2OYOA 1FDMA 3VMZA 5KJ7D 3VMYA 3HE4B 2B9BA 1CZQA 1SFCC 1FZGA 3AEFC 4L73A 1MFTA 1OW7A 2CK3H 2V4HA 1PGPA 4YXWH 2R44A 1IJDB 4PV1D 1RE3A 2PGDA 5AW6B 3WUTA 1LGHB 2KNCB 1WRGA 1VDFA 2Q5UA 1KILB 1ZMEC 2FYUK 1M1KQ 1Q90D 3WU2H 2M3EA 4D6TJ 1DEEG 2M0BA 1Y8AA 1BSNA 1GW4A 3HD7C 3U59A 3T97B 2JDIH 1NU1D 4AYCA 2E76C 3TNUB 5B5EE 4JF7A 1BDCA 3HUSC 1NTZJ 1VQOP 1SQBK 2QA4P 1H89A 4DCKA 1L0LD 2IDBA 3CXHI 2W27A 4K35A 3G6EP 2MJZA 1OFCX 1UIXA 2BEQD 3NFQA 5APQA 3CCQP 2FBWC 3UIAA 3CXHE 3H1JJ 4KJMA 2C0WA 2ZFCA 5APTA 2E74D 2Y0CA 1ZV8A 2M5AB 4CPGA 3N4XA 4JYBA 1GK4A 2QIWA 4WY4B 1OVVA 2QJYB 4H13D 3JC22 1Q81Q 2DW3A 3L72G 2KB7P 2KSEA 3RK3B 3G3ZA 3HD7A 2E43A 1M90Q 1E79H 2FYZA 1FZAA 1YTZI 2AEJA 3HUSA 2JEEA 1T8ZA 3E1RA 1VQ9P 4DZOA 2FYUE 1JUNA 1KYOD 1KFMA 2D2CB 5APYA 2BCCD 2KS1B
chains in the Genus database with same CATH topology
3HE5B 3V5BA 1HGZA 2KSJA 2YO2A 2C9LY 5KTBA 4I2LC 3A7OA 1NWQA 5CCGD 1N86A 2C9NY 2R32A 1IFDA 5CHXA 1A02F 4XE5B 2OYHC 1H8AA 1KQLA 3RK2B 4LLHA 1HH0A 2KYVA 2NPSC 4W7ZA 5CCGA 2HYNA 1N7SD 2FXMA 3RL0C 1MUUA 3L36A 3M91A 1T2KC 1JTHA 1LT9A 3KDPB 4M3LA 4XA4A 1RF1B 4N6JA 1JY2O 1DX7A 1SFCD 3TSIA 3HTKA 1LTJC 1NOHA 4EOTA 2E42A 5AVUB 1SQPK 5AVQB 4AUWA 1SFCA 2N1TC 1URQA 3VTPC 1J2JB 2POHA 1CI6A 3BRVB 4N78D 4JYCA 1M1JC 1XTGB 1FZBA 1M7LA 1SVFA 2I1KA 3L4FA 1JTHB 3GHGA 3M9QA 4B86A 2OYIB 1W2EA 3BATA 1GK6A 1ZR2A 3RK3D 5AW0B 2A45H 1IC2A 2CPSA 2P1JA 5CJ4A 1X9VA 3KQGA 4N78E 1FOSE 3OA7A 2WPSA 3P7KA 4GKGA 5APXA 1JY3N 1LTBC 3VYIA 1LTGC 1SFCB 2OYHA 1GTWA 1URQB 5BU8B 2YO3A 3TYYA 1CI6B 2NPSA 1NO4A 5KJ7C 1HGVA 2XV5A 3P32A 1KILC 4O9BA 3HD7D 1GL2D 3EQ2A 1NH4A 3BASA 1SQVK 2FFDC 1FOSF 2HG5D 1YYCA 2KP8A 1LTJA 1MV8A 1HWTC 1RE3C 1HUCA 2YNYA 1DEBA 1FAVA 2W6BA 3V4WA 3WMM0 1AQ5A 2A45I 1L4AC 3LIEA 2PP6A 2GUVA 3HE4A 3MIWA 3V4QA 2H7HA 3N7NA 1ZR4A 1LWUC 1CW5A 1SQXK 3II6A 4W7YA 5AW4B 2M3BA 2YKOA 2WZ7A 2J58A 3HD7B 1JY3O 1GL2B 1A02J 2R5BA 3IR9A 3E1IA 1IFIA 3HUSB 1FJPA 5APSA 1J1EC 1IK9A 3NMDA 2J59M 3TK1A 2LKMA 3B5NC 1NTMK 3L35A 2JJLA 1LTSC 2XDJA 5KJ7A 1T3JA 1G2CB 1LTIC 2ZXEB 1QL1A 3OAKA 2O1KA 5AW5B 4ZKUA 5KLVK 2IPPA 2HODA 4W80A 1KFNA 3A3YB 4WY4C 3PP5A 1S9KD 1HVVA 1JY2P 2L5GB 4Y99C 1T3UA 3MUDA 1URQD 2O01H 1L4AA 1DH3A 4N3YB 1X79B 3M06A 2XZRA 1J1DB 1N73A 2PAJA 1S9KE 2FKWB 1KZUB 2Z5IA 2HODB 1LWUA 3KPEA 3U1CA 3MGNA 2P67A 1GD2E 1LT9B 5APWA 1FU1A 2WPQA 1EQ7A 5CCHC 3HTKB 3MTUE 4WBAA 5CJ0A 1SLQA 5AVVB 2NPSD 1SP4A 1N73B 2IFNA 1IFMA 1WT6A 3O8ZA 2GM4A 3LW5H 1LWUB 2VRSA 3RK2C 2C0XA 1T2KD 3GHGB 1IFJA 5AVYB 1XTCC 1JCCA 3L37A 1FJKA 1N7LA 1SQQK 2R5DA 3V2RA 2XU6A 1L0NK 3IFMA 3V2NA 4IFMA 1JO5A 5AW7B 1RF1C 3CLQA 1Z56A 2WWWA 2OYHB 1HTLC 1OXZA 5AW8B 4IFFA 3VP8A 2NPSB 4AQRD 4HYTB 1NAFA 5CCGC 2WT7A 3B8EB 2N1TA 2IX7C 5AVXB 2YKQA 1FBMA 1ZN5A 3H6PA 5APUA 1M1JA 3RL0B 2M8RA 2H8PD 2WSCH 1NU1K 2HPCA 2HFED 2WPRA 2OYIC 3KYQA 1X8YA 2O1JA 5CCHA 1NHLA 3OJAB 1LTJB 4C7NA 3CI9A 1N7SC 2CPBA 3V2PA 5AW1B 2BASA 1FDMA 3VMZA 1IO4A 5KJ7D 5CMZA 3VMYA 1L0LK 3MD0A 3HE4B 1RE4C 1RF0C 2WT7B 1KILD 1HBWA 2IFMA 1CZQA 1SFCC 2N1TB 1E5WA 1FZGA 4RESB 1G1JA 2WITA 1JNMA 3P8MC 1M1JB 2N9BA 5APVA 1FZEA 4KHXA 3A5TA 4C7RA 1KILA 1QL2A 4C7NB 3M9BA 2HLOA 2FFDA 1IJDB 2P7JA 1L4AD 5BVZA 3SWYA 1OWAA 1RF1A 1GU5A 2P2UA 1RE3A 3BRTB 2Z4EA 3RK3C 3M0AA 5AW6B 3T97A 1LGHB 3NTNA 3LIDA 4GT1A 5BU5A 3TNUA 1WRGA 1VDFA 1FZFA 1GW3A 2WTYA 2Q5UA 1GDTA 1KILB 4EIJA 5AVWB 2FYUK 1AFOA 4I1LA 3M9HA 4LGDE 4C46A 2OYIA 2FFDB 1FZCC 1MZ9A 2XNXA 1GW4A 4WB4A 1N7SA 2Q7CA 3SWFA 3B5ND 3HD7C 1GL2C 3U59A 3VMXA 4LC1A 2XKMA 3CL3D 1H88A 3M0DC 1PFIA 1L4AB 4AYCA 3TNUB 1JCDA 1RE4A 1RF0A 4JF7A 3HUSC 4I6MC 4GIFA 1NKNA 3B5NA 3C9IA 1G1IA 1SQBK 4IFDK 3A2AA 3RL0D 1GU4A 4WY4D 2I1JA 1H89A 1NTKK 2QM8A 3H32A 2W6AA 2KOGA 3VN0A 4HH2A 3HRNA 2WSEH 2Z5HA 2W27A 2Q3IA 1N7SB 2MJZA 5AW3B 3V2QA 1YTZT 4WY4A 5AW2B 3NFQA 5APQA 3U1AA 5AVTB 1N2DC 1J1EB 1JOCA 2YKPA 2GUSA 3UIAA 2N1TD 3NXSA 2R3CA 3B5NB 4DOJA 3P8CD 2C0WA 2QM7A 2ZFCA 5APTA 3H32B 1J1DC 2KLVA 3EFGA 1HJBA 1NKZB 3BVHA 5CCHD 2WSFH 1ZV8A 1ZLLA 3N4XA 1GZLA 4JYBA 1NTZK 3P8CE 4OH8B 1FZCA 1GK4A 4WY4B 5AVSB 4ZKPA 2YMYA 3VP9A 1LT9C 2KB7P 3RK3B 1JMMA 3G3ZA 3HD7A 1GL2A 4Y99B 3HE5A 2E43A 3I5CA 1JY3P 3M0DA 2FYZA 3RK2D 1RY3A 2OARA 1FZAA 1JY2N 1IFNA 1YTZI 3HUSA 1MFZA 1LTAC 1N73C 2H43A 1LTTC 2JEEA 5AW9B 1T8ZA 4DZOA 5AVRB 3VOPA 1JUNA 1URQC 1CSBA 1KFMA 1FZCB 1G2CA 2HPCB 3GHGC 2A45G 2Q9IA 3R2PA 5APYA 1VPCA 5AVZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HE5 B;  3V5B A;  1FAV A;  2YO2 A;  2VRS A;  2C9L Y;  3M9H A;  3V4W A;  4C46 A;  4I2L C;  1T2K D;  3LIE A;  3HE4 A;  3A7O A;  1NWQ A;  2C9N Y;  5AVY B;  2R32 A;  3V4Q A;  3L37 A;  2H7H A;  2R5D A;  1A02 F;  2XU6 A;  2Q7C A;  3SWF A;  4XE5 B;  3VMX A;  4LC1 A;  1H8A A;  1KQL A;  1H88 A;  4AYC A;  3TNU B;  4I6M C;  5AW7 B;  5AW4 B;  2WWW A;  1A02 J;  1MUU A;  3A2A A;  1OXZ A;  2R5B A;  5AW8 B;  3L36 A;  3M91 A;  1T2K C;  1GU4 A;  1H89 A;  2QM8 A;  3IR9 A;  4AQR D;  2W6A A;  1NAF A;  3KDP B;  4HYT B;  4M3L A;  3VN0 A;  2WT7 A;  5APS A;  2Z5H A;  3B8E B;  3NMD A;  2W27 A;  3HTK A;  5AVX B;  2Q3I A;  3TK1 A;  4EOT A;  3L35 A;  5AW3 B;  2JJL A;  5APU A;  5AW2 B;  2E42 A;  3NFQ A;  2WPR A;  5APQ A;  1G2C B;  5AVU B;  5AVT B;  2ZXE B;  1X8Y A;  3OAK A;  5AVQ B;  5AW5 B;  4AUW A;  2IPP A;  3UIA A;  3NXS A;  1J2J B;  3VTP C;  4C7N A;  2R3C A;  3A3Y B;  1CI6 A;  4JYC A;  5AW1 B;  2QM7 A;  2BAS A;  2ZFC A;  5APT A;  3VMZ A;  4B86 A;  1IO4 A;  5CMZ A;  3VMY A;  1S9K D;  3MD0 A;  3HE4 B;  1GK6 A;  2WT7 B;  1HJB A;  1HBW A;  1CZQ A;  5AW0 B;  4RES B;  1JNM A;  3P8M C;  1GZL A;  4JYB A;  1DH3 A;  5APV A;  2N9B A;  3KQG A;  1FOS E;  1GK4 A;  5AVS B;  2WPS A;  3M06 A;  3P7K A;  4KHX A;  2XZR A;  4GKG A;  3A5T A;  5APX A;  1S9K E;  2Z5I A;  3VYI A;  3HE5 A;  2E43 A;  1GTW A;  3I5C A;  4C7N B;  3M0D A;  3M9B A;  2YO3 A;  3TYY A;  1CI6 B;  3MGN A;  2P67 A;  2P7J A;  1OWA A;  1MFZ A;  1GD2 E;  5APW A;  1GU5 A;  2XV5 A;  2P2U A;  3P32 A;  5AW9 B;  2WPQ A;  3M0A A;  5AW6 B;  3T97 A;  5AVR B;  4DZO A;  1JUN A;  3NTN A;  1SLQ A;  1CSB A;  3LID A;  5AVV B;  4GT1 A;  1FOS F;  1YYC A;  3TNU A;  2KP8 A;  1SP4 A;  2WTY A;  5APY A;  2Q5U A;  1MV8 A;  1HWT C;  3O8Z A;  1HUC A;  5AVW B;  5AVZ B;  2YNY A; 
#chains in the Genus database with same CATH topology
 1KC8 Q;  3HE5 B;  2A06 G;  1SQP J;  2WSS H;  1IK7 A;  1NTK D;  1EZV I;  3A7O A;  2OQQ A;  4L76 A;  2ZT9 B;  5GTI H;  5KKZ C;  1SQB E;  4YPC A;  1RHZ B;  1USD A;  4H44 D;  1EZV E;  2IYP A;  4ZNC A;  3L70 J;  1JTH A;  3H1K J;  2K3R A;  2XND H;  5C39 A;  3SSU A;  1YJN P;  1SFC D;  3HTK A;  1LTJ C;  2GA1 A;  1SQV D;  2QJK B;  3H1H E;  5AVQ B;  5L8R J;  2Y0D A;  1J2J B;  2H88 C;  4JYC A;  1FDO A;  1SVF A;  5TJH A;  3BAT A;  1OVU A;  1JB0 J;  3Q5P A;  2AEM A;  2P1J A;  4N78 E;  4R4L A;  2NRG A;  1YIT P;  1JY3 N;  2RMZ A;  1LTB C;  1YI2 P;  3RK3 E;  3S1K A;  4PD4 H;  3TYY A;  3AE7 C;  3P32 A;  1SQX G;  4O9B A;  1OVR A;  3HD7 D;  4H0L C;  1LP1 B;  1NH4 A;  1BCC D;  2FFD C;  1UII A;  2HG5 D;  1YYC A;  2E76 D;  1SS1 A;  1LTJ A;  1MV8 A;  1HUC A;  1HF9 A;  1EDL A;  2Q1K A;  3CCJ P;  3CWB E;  2A45 I;  1NTM G;  1YBK A;  3EWK A;  4QMA A;  3H1I E;  4NPF X;  2N9Y B;  3R4Y A;  3Q3D A;  2WZ7 A;  2J58 A;  1N8R Q;  3LW5 J;  1K9M Q;  1A02 J;  4EI2 A;  1PV3 A;  1EC5 A;  3O6Q B;  3E1I A;  3L74 D;  3BCC D;  3QWO C;  3TK1 A;  1BE3 D;  2LKM A;  3B5N C;  2UWJ E;  1JEK A;  3L75 D;  1LTS C;  2Y9Z A;  1T3J A;  1AVY A;  2ZXE B;  3OAK A;  5B66 H;  1QVF O;  1D7M A;  3A0B E;  2E75 B;  1HVV A;  2L5G B;  1DH3 A;  3M06 A;  1J1D B;  4WWI A;  2PAJ A;  4U7J A;  1S9K E;  3V6I A;  1S1C X;  2HOD B;  1SQQ G;  2K1A A;  3KPE A;  1L0N G;  4U3F D;  2WPQ A;  1VQ5 P;  3RBZ A;  3D6Y A;  4WBA A;  4ASV A;  2QEX P;  2WVR A;  2RH0 A;  1SP4 A;  4PV1 B;  1N73 B;  3O8Z A;  2GM4 A;  3LW5 H;  1LWU B;  2VRS A;  3RK2 C;  3IAO A;  4OVN F;  2LXC B;  3CC7 P;  3GHG B;  1IFJ A;  5AVY B;  3AE9 C;  1PPJ D;  2R5D A;  1WMK A;  3CCE P;  3B4S A;  2FXP A;  3TDK A;  5KLV D;  3CLQ A;  3L71 D;  4EDF A;  3L73 E;  2OYH B;  1HTL C;  1OXZ A;  5AW8 B;  4IFF A;  1USE A;  2WMM A;  1KV4 A;  5M1B A;  5CCG C;  2WT7 A;  2N1T A;  2KLU A;  5APU A;  2H8P D;  2HPC A;  1NU1 K;  1M56 D;  2WPR A;  4YXD C;  1NHL A;  2ZYD A;  4C7N A;  1N7S C;  2E5Y A;  1YQ3 C;  2FYU J;  2ZYG A;  5CMZ A;  1L0L K;  1RE4 C;  1RF0 C;  4H0L D;  3MP7 B;  5B5E H;  1P84 D;  2WIT A;  1JNM A;  1M1J B;  2N9B A;  4C7R A;  1K73 Q;  2RKL A;  2AXT H;  4OGQ D;  3SWY A;  3Q2Y A;  1SQB J;  4KT0 J;  4GOF A;  3BRT B;  2Z4E A;  1YHQ P;  3BCC J;  4MN4 C;  3LID A;  3H1L J;  4GT1 A;  5BU5 A;  3CXH H;  3AE6 C;  4I1L A;  3M9H A;  1AV1 A;  4LGD E;  4C46 A;  1PGQ A;  1KQG B;  1KQF B;  1VQM P;  3A0H E;  4WB4 A;  3H1H J;  1N7S A;  1FS0 E;  3B5N D;  1GL2 C;  4D6T G;  4LC1 A;  3PHL A;  3KZI H;  1PFI A;  1L4A B;  1RE4 A;  1RF0 A;  1S4X A;  4I6M C;  3C9I A;  1G1I A;  4IFD K;  3A2A A;  1NTK K;  1NU1 E;  3H32 A;  3D71 A;  1NTZ G;  2W6A A;  2KOG A;  3TGU D;  2Z5H A;  4U3F J;  1BSH A;  3V2Q A;  1VF5 B;  2QE7 H;  5AW2 B;  1QLE D;  2IBZ D;  1L0L E;  1JOC A;  2N1T D;  1BGY D;  3P8C D;  1LJ2 A;  2QM7 A;  3CX5 D;  3WUU A;  1HJB A;  3H1J G;  3BVH A;  2ZJS E;  1KTM A;  2KXP B;  1GZL A;  1KB9 D;  1BGY G;  1LT9 C;  3CWB J;  2AEF A;  3JSV C;  3W68 A;  1JMM A;  1GL2 A;  1JY3 P;  5KLV J;  3RK2 D;  1BDD A;  3PLN A;  1IFN A;  3H1I J;  1LTT C;  1KYO I;  1URQ C;  1K04 A;  2KUB A;  1QVG O;  1DIP A;  2O3J A;  2FYN C;  3V4Q A;  3JCU H;  1GMJ A;  3V5B A;  2KSJ A;  1KYO E;  3FWL A;  5KTB A;  4I2L C;  1YIJ P;  3CC2 P;  5CCG D;  2OGU A;  2BCC E;  2QRX A;  1SQP G;  4XE5 B;  1H8A A;  1NVO A;  1KQL A;  2ZVO B;  2R3S A;  2KYV A;  2NPS C;  1NTK E;  1N7S D;  3E7K A;  5E79 H;  3RL0 C;  3L36 A;  3M91 A;  1T2K C;  1LT9 A;  1Y9B A;  1RF1 B;  1JY2 O;  4EYY Q;  1DX7 A;  3L70 G;  1T6A A;  3H1K G;  2O01 N;  2YMK A;  1SFC A;  3AE4 C;  1URQ A;  3VTP C;  1VQL P;  3BRV B;  1PGJ A;  1SQV E;  2YXQ B;  1FZB A;  1JTH B;  2OYI B;  2AXT E;  1ZP0 C;  5AW0 B;  2A45 H;  1IC2 A;  1JMB A;  1FOS E;  2HR3 A;  2B89 A;  3OA7 A;  5KAI H;  3VYI A;  2J5U A;  2NPS A;  3L72 D;  4BRY A;  4GOE A;  1KIL C;  2JKV A;  1GL2 D;  2ITA A;  3L73 J;  2K37 A;  3RL0 g;  3KZI E;  3A0B H;  1FAV A;  1OZH A;  2W6B A;  2G3A A;  2IYO A;  1BCC E;  3LIE A;  2PP6 A;  3HE4 A;  3MIW A;  4GDO A;  2H7H A;  1PP9 G;  2W90 A;  2A06 D;  2B87 B;  1VQ7 P;  1VQK P;  1KOR A;  5APS A;  1W2B O;  3G4S P;  3L35 A;  2KNC A;  2XDJ A;  1YJ9 P;  1G2C B;  1QL1 A;  3BCC E;  3L74 E;  5KLV K;  4ZKU A;  1Q2N A;  3H1L E;  1BE3 E;  4I7Z B;  4W80 A;  3A3Y B;  2AXC A;  2KZI A;  3L75 E;  2B88 A;  4WY4 C;  3PP5 A;  2QJY C;  3IN6 A;  1T3U A;  1URQ D;  2O01 H;  2XZR A;  3CCM P;  1KZU B;  4OWF A;  2P67 A;  1LNQ A;  3JCU E;  1HJ0 A;  1EQ7 A;  1YJW P;  5CCH C;  4DJG A;  1MKM A;  3MTU E;  4OGQ B;  1SLQ A;  2NPS D;  1SQX D;  4U3F E;  2IFN A;  1WT6 A;  1KB9 H;  1NU1 J;  4A7P A;  2ZT9 C;  4DT0 A;  1T2K D;  5E79 E;  1ZRT D;  2BEZ F;  2M5A A;  1H0T B;  1NTM D;  1IZN B;  1L0L J;  1NAY A;  3V2N A;  1KMI Z;  1PPJ E;  2LXB A;  2QJK C;  2FXO A;  2Q6Q A;  1AVO A;  2OTK E;  3B8E B;  5KLV E;  3L72 J;  2IX7 C;  3L71 E;  3Q1M A;  2M8R A;  1NYH A;  2HFE D;  3I56 P;  1PIX A;  2KI7 B;  1VL2 A;  5CCH A;  3OJA B;  4UB6 H;  5KAI E;  2CPB A;  3EFF K;  5AW1 B;  3A0H H;  1IO4 A;  5KLI B;  2WT7 B;  1AJY A;  1KIL D;  1HBW A;  1S72 P;  2N1T B;  1E5W A;  3AEB C;  1P84 I;  2FYU G;  3OW2 O;  4KHX A;  3A5T A;  3PRJ A;  1QL2 A;  4C7N B;  3M9B A;  1M57 D;  1P84 E;  2HLO A;  2NZ2 A;  2FFD A;  2BCC J;  2P7J A;  4GOD A;  2P2U A;  1SQQ D;  1L0N D;  1NTK J;  3M0A A;  3NTN A;  5DJT B;  3FWN A;  1SQB G;  3AED C;  2SPZ A;  1FZF A;  1GDT A;  4EIJ A;  5AVW B;  1EZV G;  3G9R A;  1AFO A;  1FZC C;  3VMA A;  2Q7C A;  3SWF A;  3VMX A;  2XKM A;  2YIU B;  1H88 A;  1JCD A;  2Y9Y A;  3H1H G;  4GIF A;  1NKN A;  1SQV J;  2KZJ A;  3B5N A;  2IZ1 A;  4WY4 D;  2I1J A;  1Q86 Q;  3HRN A;  2WSE H;  3C8V A;  1DD4 A;  2Q3I A;  1N7S B;  1X22 A;  1YTZ T;  4JQ0 D;  2IBZ I;  5AVT B;  2E75 C;  3TGU E;  1N2D C;  1J1E B;  1KYO H;  4PJ0 H;  2QJP B;  3NXS A;  2R3C A;  1QEX A;  3AEC C;  3CX5 I;  3H32 B;  3CD6 P;  1J1D C;  2IBZ E;  2KLV A;  3EFG A;  2V7Q H;  5CCH D;  4ASW A;  1KB9 I;  1BGY E;  3P8C E;  4OH8 B;  1FZC A;  4ZKP A;  1NTM J;  2YMY A;  3CX5 E;  3VP9 A;  2KIK A;  1BCC J;  4Y99 B;  2ZT9 D;  3I5C A;  3CCR P;  1RY3 A;  2OAR A;  1KB9 E;  3O6Q A;  3CWB G;  1LTA C;  4RJT A;  1N73 C;  3GW6 A;  5AW9 B;  4L75 A;  4IL6 E;  3VOP A;  1RQU A;  1K05 A;  3H1I G;  1VQN P;  2E74 B;  3GHG C;  2A45 G;  2Q9I A;  1VPC A;  3S4R A;  3CC4 P;  2YO2 A;  2C9L Y;  2W8Z A;  2E5T A;  4H13 B;  1NWQ A;  2C9N Y;  1N86 A;  5EFW B;  2R32 A;  1IFD A;  4R4M A;  1KQS O;  1A02 F;  1R5S A;  2OYH C;  3L74 J;  1U57 A;  1BE3 J;  5CCG A;  3L75 J;  1EDJ A;  4D6T D;  2FXM A;  1MUU A;  2ZYA A;  3AE5 C;  4JBZ A;  4IL6 X;  4UB6 E;  1S3J A;  4M3L A;  4N6J A;  4EOT A;  3USS A;  3AEA C;  1NTZ D;  1L0N J;  3TF5 A;  5AVU B;  1EDI A;  1M8O B;  4AUW A;  2G8Y A;  1CI6 A;  1M1J C;  1M7L A;  3M9Q A;  3GHG A;  1W2E A;  3SFE C;  1GK6 A;  4H44 B;  1ZR2 A;  3GLM A;  2CPS A;  1S2E A;  3P7K A;  3H1J D;  5APX A;  1LTG C;  1SFC B;  2OYH A;  1URQ B;  1Q82 Q;  2YO3 A;  1NO4 A;  5CBN A;  4TT3 H;  4YTP C;  3BAS A;  1SQV K;  1FOS F;  2YXR B;  2KP8 A;  3L72 E;  1HWT C;  1RE3 C;  1OX3 A;  3K5B A;  3MUD C;  3CPW O;  3V4W A;  3L73 G;  3L71 J;  1L4A C;  2GUV A;  1DD3 A;  2PFX A;  1ZR4 A;  1CW5 A;  1SQX K;  3AEE C;  3II6 A;  4PD4 D;  2E75 D;  5AW4 B;  1SQP D;  1LT1 A;  2YKO A;  2A06 E;  3FXD A;  3HD7 B;  1JY3 O;  1VF5 C;  2R5B A;  4PJ0 E;  3RBX A;  3C1L A;  2E76 B;  1ZXG A;  1IFI A;  3HUS B;  1FJP A;  3PJS K;  2J59 M;  4BWN A;  1NTM K;  3L70 D;  3H1K D;  3I55 P;  2Y0E A;  2W83 C;  1JY2 P;  3B71 A;  3MUD A;  2JO1 A;  4WVZ A;  2WSC J;  1L4A A;  4N3Y B;  1FE6 A;  1X79 B;  2I8D A;  2FKW B;  1OIP A;  2IZ0 A;  2Z5I A;  3MGN A;  1ZOY C;  3F89 A;  3SWK A;  2QSI A;  3HTK B;  4UB8 H;  5CJ0 A;  1K8A Q;  3AE1 C;  3SFD C;  3WUV A;  1IFM A;  3ZDM A;  3GMA A;  3GG2 A;  1PL5 A;  1SQX E;  1NU1 G;  3L37 A;  1SQQ K;  2XU6 A;  1L0N K;  2O01 J;  2RN0 A;  3TGU J;  5CBO A;  4IFM A;  1PP9 D;  1R8E A;  5AW7 B;  1RF1 C;  2K9J A;  1PGO A;  1Z56 A;  3F5H A;  1P84 H;  1ZRT E;  1L0L G;  3D6Z A;  1NTM E;  1W5C E;  3FGA D;  5KKZ B;  3W67 A;  4AQR D;  4HYT B;  1R5L A;  1BGY J;  4RKU J;  1VQ4 P;  3H6P A;  2WSC H;  4Z1M H;  2OYI C;  1AQT A;  1AA0 A;  1X8Y A;  2O1J A;  1LTJ B;  1RQV A;  3PH0 A;  2BAS A;  3MD0 A;  2K9Y A;  4XFJ A;  2IFM A;  4RES B;  1G1J A;  3P8M C;  5APV A;  1FZE A;  1KIL A;  2JWD A;  1KIL E;  2WQY C;  5BVZ A;  1L4A D;  1OWA A;  2JR8 A;  1RF1 A;  4HJG H;  4ZMD A;  1GU5 A;  2WSF J;  3RK3 C;  3T97 A;  2BCC G;  3TNU A;  1FC2 C;  4RO0 A;  1GW3 A;  2WTY A;  5TIS H;  1NTK G;  1SQQ E;  4H0L B;  1L0N E;  1VF5 D;  4NPE A;  2OYI A;  2FFD B;  1MZ9 A;  2XNX A;  2D2C C;  1RH5 B;  2QG4 A;  4NPD A;  3CL3 D;  3CX5 H;  2PRR A;  3M0D C;  2H89 C;  3CCV P;  1KD1 Q;  3RL0 D;  1GU4 A;  2QM8 A;  1SQV G;  4IL6 H;  3VN0 A;  4HB1 A;  4HH2 A;  3MHV A;  3CXH D;  4I7Z C;  5AW3 B;  3CCU P;  4WY4 A;  4K3A A;  3U1A A;  3Q5S A;  2YKP A;  2GUS A;  3B5N B;  4DOJ A;  2OTL P;  1OW6 A;  3CMA P;  1KN7 A;  3WU2 E;  2B87 A;  1NKZ B;  2WSF H;  1ZLL A;  1NTZ K;  2L91 A;  3CCL P;  5AVS B;  4UB8 E;  2KS1 A;  1X0T A;  3AE8 C;  3HE5 A;  1PP9 J;  2FYU D;  3M0D A;  4OGQ C;  3S9O A;  2JP3 A;  1JY2 N;  1VQ6 P;  1MFZ A;  1BCC G;  2WSE J;  2H43 A;  1JM0 A;  5AVR B;  3GF3 A;  1CSB A;  1FZC B;  1G2C A;  2HPC B;  1ZW0 A;  3GF7 A;  3R2P A;  1NJI Q;  5AVZ B;  1U7J A;  1HGZ A;  1SQB D;  1EZV D;  1S5L H;  3ABV C;  5CHX A;  2V7Q J;  3H1L D;  5GTH H;  2P10 A;  1NGM B;  3RK2 B;  4HKZ H;  4LLH A;  3KHU A;  1HH0 A;  4W7Z A;  2HYN A;  2MKV A;  3L74 G;  3BCC G;  1PZQ A;  1VQP P;  3RGU A;  5KAF H;  3H1L G;  1BE3 G;  3H1H D;  3L75 G;  2K88 A;  3KDP B;  4XA4 A;  3TSI A;  4D6T E;  1NOH A;  2E42 A;  5KLI C;  1SQP K;  1Y47 A;  2N1T C;  3FX0 A;  3ITK A;  5H2F H;  2POH A;  1EDK A;  3AEG C;  4N78 D;  3Q5R A;  1XTG B;  1NTZ E;  2I1K A;  3L4F A;  4B86 A;  1H0T A;  3AE3 C;  3RK3 D;  1FDI A;  1LP1 A;  5CJ4 A;  1X9V A;  3KQG A;  2WPS A;  4JPZ B;  5GTI E;  4GKG A;  4U3F G;  4Y28 J;  1SQX J;  1GTW A;  1QGK B;  5BU8 B;  5TIS E;  1CI6 B;  1IFP A;  2ZAE B;  3H1J E;  5KJ7 C;  2D2C D;  1HGV A;  2XV5 A;  3H25 A;  2QVA A;  3KXD A;  3EQ2 A;  3CWB D;  3PTZ A;  1TU3 F;  2YNY A;  1EXI A;  1DEB A;  3H1I D;  4L74 A;  1PPJ G;  2YIU C;  3WMM 0;  1AQ5 A;  4PV1 C;  4TLF A;  5KLV G;  3L71 G;  3N7N A;  3CME P;  1LWU C;  5K5G B;  4PD4 I;  4W7Y A;  2M3B A;  2W6J H;  3QH9 A;  1GL2 B;  3IR9 A;  4PD4 E;  1J1E C;  1SQP E;  1IK9 A;  2QJP C;  2Q3E A;  3NMD A;  1EXJ A;  2JJL A;  2P58 A;  3FXE A;  5KJ7 A;  2OTJ P;  1OW8 A;  1LTI C;  1QX8 A;  5AW5 B;  2O1K A;  2IPP A;  3AE2 C;  2ZVN B;  2HOD A;  1KFN A;  2LR2 A;  1S9K D;  3MZW B;  3L70 E;  4Y99 C;  3H1K E;  1SQQ J;  1N73 A;  2WPV B;  1YQ4 C;  1OMI A;  1LWU A;  1Q7Y Q;  3U1C A;  2ZXX A;  2E74 C;  1GD2 E;  1LT9 B;  5APW A;  2FY8 A;  1FU1 A;  1U7M A;  1S5L E;  5AVV B;  5GTH E;  4H13 C;  3D70 A;  5DJU B;  3CCS P;  4IOI H;  5B66 E;  2C0X A;  2JWA A;  5KAF E;  1XTC C;  1VQ8 P;  1JCC A;  1FJK A;  1N7L A;  2FYN B;  3V2R A;  3L73 D;  3IFM A;  3G71 P;  1JO5 A;  3TGU G;  2WWW A;  3VP8 A;  2KK7 A;  2NPS B;  1S5L X;  1NAF A;  1PP9 E;  5H2F E;  4BRY B;  3IF4 A;  2IBZ G;  5AVX B;  2YKQ A;  1FBM A;  1ZN5 A;  3RL0 B;  1M1J A;  4BXL A;  1L2P A;  3KYQ A;  4H44 C;  2K9J B;  3CI9 A;  3V2P A;  2OYO A;  1FDM A;  3VMZ A;  5KJ7 D;  3VMY A;  3HE4 B;  2B9B A;  1CZQ A;  1SFC C;  1FZG A;  3AEF C;  4L73 A;  1MFT A;  1OW7 A;  2CK3 H;  2V4H A;  1PGP A;  4YXW H;  2R44 A;  1IJD B;  4PV1 D;  1RE3 A;  2PGD A;  5AW6 B;  3WUT A;  1LGH B;  2KNC B;  1WRG A;  1VDF A;  2Q5U A;  1KIL B;  1ZME C;  2FYU K;  1M1K Q;  1Q90 D;  3WU2 H;  2M3E A;  4D6T J;  1DEE G;  2M0B A;  1Y8A A;  1BSN A;  1GW4 A;  3HD7 C;  3U59 A;  3T97 B;  2JDI H;  1NU1 D;  4AYC A;  2E76 C;  3TNU B;  5B5E E;  4JF7 A;  1BDC A;  3HUS C;  1NTZ J;  1VQO P;  1SQB K;  2QA4 P;  1H89 A;  4DCK A;  1L0L D;  2IDB A;  3CXH I;  2W27 A;  4K35 A;  3G6E P;  2MJZ A;  1OFC X;  1UIX A;  2BEQ D;  3NFQ A;  5APQ A;  3CCQ P;  2FBW C;  3UIA A;  3CXH E;  3H1J J;  4KJM A;  2C0W A;  2ZFC A;  5APT A;  2E74 D;  2Y0C A;  1ZV8 A;  2M5A B;  4CPG A;  3N4X A;  4JYB A;  1GK4 A;  2QIW A;  4WY4 B;  1OVV A;  2QJY B;  4H13 D;  3JC2 2;  1Q81 Q;  2DW3 A;  3L72 G;  2KB7 P;  2KSE A;  3RK3 B;  3G3Z A;  3HD7 A;  2E43 A;  1M90 Q;  1E79 H;  2FYZ A;  1FZA A;  1YTZ I;  2AEJ A;  3HUS A;  2JEE A;  1T8Z A;  3E1R A;  1VQ9 P;  4DZO A;  2FYU E;  1JUN A;  1KYO D;  1KFM A;  2D2C B;  5APY A;  2BCC D;  2KS1 B; 
#chains in the Genus database with same CATH homology
 3HE5 B;  3V5B A;  1HGZ A;  2KSJ A;  2YO2 A;  2C9L Y;  5KTB A;  4I2L C;  3A7O A;  1NWQ A;  5CCG D;  1N86 A;  2C9N Y;  2R32 A;  1IFD A;  5CHX A;  1A02 F;  4XE5 B;  2OYH C;  1H8A A;  1KQL A;  3RK2 B;  4LLH A;  1HH0 A;  2KYV A;  2NPS C;  4W7Z A;  5CCG A;  2HYN A;  1N7S D;  2FXM A;  3RL0 C;  1MUU A;  3L36 A;  3M91 A;  1T2K C;  1JTH A;  1LT9 A;  3KDP B;  4M3L A;  4XA4 A;  1RF1 B;  4N6J A;  1JY2 O;  1DX7 A;  1SFC D;  3TSI A;  3HTK A;  1LTJ C;  1NOH A;  4EOT A;  2E42 A;  5AVU B;  1SQP K;  5AVQ B;  4AUW A;  1SFC A;  2N1T C;  1URQ A;  3VTP C;  1J2J B;  2POH A;  1CI6 A;  3BRV B;  4N78 D;  4JYC A;  1M1J C;  1XTG B;  1FZB A;  1M7L A;  1SVF A;  2I1K A;  3L4F A;  1JTH B;  3GHG A;  3M9Q A;  4B86 A;  2OYI B;  1W2E A;  3BAT A;  1GK6 A;  1ZR2 A;  3RK3 D;  5AW0 B;  2A45 H;  1IC2 A;  2CPS A;  2P1J A;  5CJ4 A;  1X9V A;  3KQG A;  4N78 E;  1FOS E;  3OA7 A;  2WPS A;  3P7K A;  4GKG A;  5APX A;  1JY3 N;  1LTB C;  3VYI A;  1LTG C;  1SFC B;  2OYH A;  1GTW A;  1URQ B;  5BU8 B;  2YO3 A;  3TYY A;  1CI6 B;  2NPS A;  1NO4 A;  5KJ7 C;  1HGV A;  2XV5 A;  3P32 A;  1KIL C;  4O9B A;  3HD7 D;  1GL2 D;  3EQ2 A;  1NH4 A;  3BAS A;  1SQV K;  2FFD C;  1FOS F;  2HG5 D;  1YYC A;  2KP8 A;  1LTJ A;  1MV8 A;  1HWT C;  1RE3 C;  1HUC A;  2YNY A;  1DEB A;  1FAV A;  2W6B A;  3V4W A;  3WMM 0;  1AQ5 A;  2A45 I;  1L4A C;  3LIE A;  2PP6 A;  2GUV A;  3HE4 A;  3MIW A;  3V4Q A;  2H7H A;  3N7N A;  1ZR4 A;  1LWU C;  1CW5 A;  1SQX K;  3II6 A;  4W7Y A;  5AW4 B;  2M3B A;  2YKO A;  2WZ7 A;  2J58 A;  3HD7 B;  1JY3 O;  1GL2 B;  1A02 J;  2R5B A;  3IR9 A;  3E1I A;  1IFI A;  3HUS B;  1FJP A;  5APS A;  1J1E C;  1IK9 A;  3NMD A;  2J59 M;  3TK1 A;  2LKM A;  3B5N C;  1NTM K;  3L35 A;  2JJL A;  1LTS C;  2XDJ A;  5KJ7 A;  1T3J A;  1G2C B;  1LTI C;  2ZXE B;  1QL1 A;  3OAK A;  2O1K A;  5AW5 B;  4ZKU A;  5KLV K;  2IPP A;  2HOD A;  4W80 A;  1KFN A;  3A3Y B;  4WY4 C;  3PP5 A;  1S9K D;  1HVV A;  1JY2 P;  2L5G B;  4Y99 C;  1T3U A;  3MUD A;  1URQ D;  2O01 H;  1L4A A;  1DH3 A;  4N3Y B;  1X79 B;  3M06 A;  2XZR A;  1J1D B;  1N73 A;  2PAJ A;  1S9K E;  2FKW B;  1KZU B;  2Z5I A;  2HOD B;  1LWU A;  3KPE A;  3U1C A;  3MGN A;  2P67 A;  1GD2 E;  1LT9 B;  5APW A;  1FU1 A;  2WPQ A;  1EQ7 A;  5CCH C;  3HTK B;  3MTU E;  4WBA A;  5CJ0 A;  1SLQ A;  5AVV B;  2NPS D;  1SP4 A;  1N73 B;  2IFN A;  1IFM A;  1WT6 A;  3O8Z A;  2GM4 A;  3LW5 H;  1LWU B;  2VRS A;  3RK2 C;  2C0X A;  1T2K D;  3GHG B;  1IFJ A;  5AVY B;  1XTC C;  1JCC A;  3L37 A;  1FJK A;  1N7L A;  1SQQ K;  2R5D A;  3V2R A;  2XU6 A;  1L0N K;  3IFM A;  3V2N A;  4IFM A;  1JO5 A;  5AW7 B;  1RF1 C;  3CLQ A;  1Z56 A;  2WWW A;  2OYH B;  1HTL C;  1OXZ A;  5AW8 B;  4IFF A;  3VP8 A;  2NPS B;  4AQR D;  4HYT B;  1NAF A;  5CCG C;  2WT7 A;  3B8E B;  2N1T A;  2IX7 C;  5AVX B;  2YKQ A;  1FBM A;  1ZN5 A;  3H6P A;  5APU A;  1M1J A;  3RL0 B;  2M8R A;  2H8P D;  2WSC H;  1NU1 K;  2HPC A;  2HFE D;  2WPR A;  2OYI C;  3KYQ A;  1X8Y A;  2O1J A;  5CCH A;  1NHL A;  3OJA B;  1LTJ B;  4C7N A;  3CI9 A;  1N7S C;  2CPB A;  3V2P A;  5AW1 B;  2BAS A;  1FDM A;  3VMZ A;  1IO4 A;  5KJ7 D;  5CMZ A;  3VMY A;  1L0L K;  3MD0 A;  3HE4 B;  1RE4 C;  1RF0 C;  2WT7 B;  1KIL D;  1HBW A;  2IFM A;  1CZQ A;  1SFC C;  2N1T B;  1E5W A;  1FZG A;  4RES B;  1G1J A;  2WIT A;  1JNM A;  3P8M C;  1M1J B;  2N9B A;  5APV A;  1FZE A;  4KHX A;  3A5T A;  4C7R A;  1KIL A;  1QL2 A;  4C7N B;  3M9B A;  2HLO A;  2FFD A;  1IJD B;  2P7J A;  1L4A D;  5BVZ A;  3SWY A;  1OWA A;  1RF1 A;  1GU5 A;  2P2U A;  1RE3 A;  3BRT B;  2Z4E A;  3RK3 C;  3M0A A;  5AW6 B;  3T97 A;  1LGH B;  3NTN A;  3LID A;  4GT1 A;  5BU5 A;  3TNU A;  1WRG A;  1VDF A;  1FZF A;  1GW3 A;  2WTY A;  2Q5U A;  1GDT A;  1KIL B;  4EIJ A;  5AVW B;  2FYU K;  1AFO A;  4I1L A;  3M9H A;  4LGD E;  4C46 A;  2OYI A;  2FFD B;  1FZC C;  1MZ9 A;  2XNX A;  1GW4 A;  4WB4 A;  1N7S A;  2Q7C A;  3SWF A;  3B5N D;  3HD7 C;  1GL2 C;  3U59 A;  3VMX A;  4LC1 A;  2XKM A;  3CL3 D;  1H88 A;  3M0D C;  1PFI A;  1L4A B;  4AYC A;  3TNU B;  1JCD A;  1RE4 A;  1RF0 A;  4JF7 A;  3HUS C;  4I6M C;  4GIF A;  1NKN A;  3B5N A;  3C9I A;  1G1I A;  1SQB K;  4IFD K;  3A2A A;  3RL0 D;  1GU4 A;  4WY4 D;  2I1J A;  1H89 A;  1NTK K;  2QM8 A;  3H32 A;  2W6A A;  2KOG A;  3VN0 A;  4HH2 A;  3HRN A;  2WSE H;  2Z5H A;  2W27 A;  2Q3I A;  1N7S B;  2MJZ A;  5AW3 B;  3V2Q A;  1YTZ T;  4WY4 A;  5AW2 B;  3NFQ A;  5APQ A;  3U1A A;  5AVT B;  1N2D C;  1J1E B;  1JOC A;  2YKP A;  2GUS A;  3UIA A;  2N1T D;  3NXS A;  2R3C A;  3B5N B;  4DOJ A;  3P8C D;  2C0W A;  2QM7 A;  2ZFC A;  5APT A;  3H32 B;  1J1D C;  2KLV A;  3EFG A;  1HJB A;  1NKZ B;  3BVH A;  5CCH D;  2WSF H;  1ZV8 A;  1ZLL A;  3N4X A;  1GZL A;  4JYB A;  1NTZ K;  3P8C E;  4OH8 B;  1FZC A;  1GK4 A;  4WY4 B;  5AVS B;  4ZKP A;  2YMY A;  3VP9 A;  1LT9 C;  2KB7 P;  3RK3 B;  1JMM A;  3G3Z A;  3HD7 A;  1GL2 A;  4Y99 B;  3HE5 A;  2E43 A;  3I5C A;  1JY3 P;  3M0D A;  2FYZ A;  3RK2 D;  1RY3 A;  2OAR A;  1FZA A;  1JY2 N;  1IFN A;  1YTZ I;  3HUS A;  1MFZ A;  1LTA C;  1N73 C;  2H43 A;  1LTT C;  2JEE A;  5AW9 B;  1T8Z A;  4DZO A;  5AVR B;  3VOP A;  1JUN A;  1URQ C;  1CSB A;  1KFM A;  1FZC B;  1G2C A;  2HPC B;  3GHG C;  2A45 G;  2Q9I A;  3R2P A;  5APY A;  1VPC A;  5AVZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...