3HTKA

Crystal structure of mms21 and smc5 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
60
structure length
60
Chain Sequence
KPFANTKKTLENQVEELTEKCSLKTDEFLKAKEKINEIFEKLNTIRDEVIKKKNQNEYYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Recombination/replication/ligase
molecule keywords Structural maintenance of chromosomes protein 5
publication title Structural and functional insights into the roles of the Mms21 subunit of the Smc5/6 complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 28
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2009-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3htkA00
5AVQB 3M06A 3VMXA 2YNYA 5AW0B 4KHXA 2Q3IA 2XU6A 3VTPC 1SP4A 3VN0A 3TYYA 3I5CA 5AVYB 1DH3A 2XZRA 1OXZA 1GK4A 2N9BA 2Q7CA 2C9NY 5AVUB 3A3YB 1CSBA 3M91A 5AW3B 5AVSB 2BASA 3NXSA 4DZOA 4AYCA 3MGNA 2H7HA 4AUWA 4RESB 5AW6B 1FAVA 4I2LC 1NAFA 1G2CB 4LC1A 4C7NB 5AW4B 2VRSA 3V4WA 1IO4A 3KDPB 5AW2B 5APWA 3P7KA 1GD2E 5AVVB 3A7OA 3M0DA 3LIDA 2WT7B 1GK6A 2P7JA 1CI6B 3NTNA 1HWTC 2R3CA 1MUUA 1S9KD 3M9HA 1H89A 2W6AA 3VMYA 1HJBA 3V4QA 2QM8A 3L35A 5AW8B 3VMZA 3NMDA 3L36A 3P8MC 5AW5B 3A5TA 1S9KE 5AVRB 1H88A 1A02F 5AVXB 2C9LY 2Q5UA 2WPQA 1KQLA 4JYCA 3V5BA 1NWQA 3L37A 4C46A 4M3LA 2WPSA 2JJLA 1FOSF 4EOTA 5APQA 3HE4A 1HUCA 2WWWA 5CMZA 3TNUA 1A02J 2E43A 4GKGA 2R32A 2QM7A 2YO2A 5APYA 3T97A 5AW7B 1JNMA 4XE5B 5APSA 1HBWA 3IR9A 3HE4B 3KQGA 5AVWB 3O8ZA 1GU4A 2R5DA 3HE5A 3VYIA 1JUNA 3A2AA 1SLQA 1FOSE 2Z5HA 1CZQA 2Z5IA 3LIEA 4HYTB 1GTWA 2ZXEB 3HE5B 2P2UA 5AW1B 2YO3A 3B8EB 1GU5A 3HTKA 2P67A 5APVA 2R5BA 2IPPA 1T2KC 1T2KD 3MD0A 5AVTB 2WTYA 2KP8A 5AVZB 2XV5A 1YYCA 1GZLA 5AW9B 3TK1A 5APUA 1H8AA 2WPRA 1MV8A 4B86A 3M0AA 3P32A 3TNUB 5APXA 1J2JB 1MFZA 1OWAA 4AQRD 4C7NA 4GT1A 3SWFA 3M9BA 3UIAA 5APTA 1X8YA 2ZFCA 2WT7A 3OAKA 3NFQA 2E42A 1CI6A 4JYBA 4I6MC 2W27A
chains in the Genus database with same CATH superfamily
1VF5B 2R44A 1J1EB 5KLVK 2W90A 4WBAA 2ZYGA 3HUSC 3CLQA 4PV1B 1FZFA 1KILE 1RF0C 3HD7A 1NTME 4KT0J 3AE3C 1N8RQ 1SQPK 1IK9A 1IFIA 1KYOD 1YJ9P 4R4MA 2A45G 1LWUC 1HWTC 3RBXA 3PP5A 3M9HA 3Q5RA 2QM8A 1RE3C 3H1JD 4OWFA 2OARA 1VQ5P 3L37A 1IFPA 1MKMA 2E43A 2M8RA 2FYUK 4GIFA 1JNMA 5KLIB 2RKLA 1JUNA 1BCCD 4U3FD 2CPSA 1M1KQ 3TDKA 2FXOA 1GW4A 1GU5A 2OYIB 3D6ZA 1HVVA 3RK3B 1SQVJ 3H1IG 2YMYA 1AQ5A 1M1JB 2H43A 1Y8AA 2W8ZA 1H0TB 1H8AA 1JO5A 3GF7A 3RK2D 3CX5D 1KB9E 1L0LG 2KSEA 2ZT9D 1SQQG 1VF5C 1J1EC 1SQXD 2AEMA 2LR2A 4PV1C 1GMJA 4YXWH 4C7RA 1CW5A 1LNQA 1NHLA 1IJDB 2E76B 2JDIH 1LTBC 1HH0A 2BASA 1XTCC 3MGNA 1IFDA 3D71A 4I2LC 2ZYAA 4IL6E 4C7NB 1IO4A 2RN0A 3PHLA 2WSCH 3A7OA 3U1AA 3CCSP 4EYYQ 3AECC 1BDDA 1SQXJ 2IYOA 3O6QB 1NOHA 2IFMA 2B89A 1KB9H 3GLMA 3GHGB 1VQNP 1EDJA 3L72G 2O01N 1HTLC 2QJKB 1KQSO 2IBZD 3H1JE 1A02J 4H0LB 4W80A 2FBWC 3T97A 2A06G 3KHUA 1HBWA 5DJUB 5KLIC 5K5GB 1VQ8P 4YTPC 1FOSE 2FFDC 2I1KA 1AVOA 4IL6H 3CCJP 5EFWB 2YO3A 4XA4A 2OYIC 3B4SA 1BCCE 4U3FE 3H1HG 3RK3C 1NAYA 4DOJA 1AV1A 5B5EE 1LP1B 1M1JC 1LGHB 1N7SD 1OWAA 3CXHI 5M1BA 4HH2A 1NTZK 1ZV8A 3L73G 1AJYA 3V2QA 5AVYB 3L71J 3CCVP 3MUDA 1OXZA 5CBNA 2E76C 3H1KG 1OVRA 3TSIA 3W68A 1VQLP 3VP8A 1LTJB 3V4WA 1LT9A 5B5EH 2IFNA 4UB8E 1M56D 3AEGC 1P84I 3F5HA 3BRTB 5CJ4A 1R5SA 4TLFA 3GHGC 4NPEA 1AVYA 1YI2P 5GTHE 5AVXB 3AE6C 1QEXA 2QJKC 2WPSA 4H0LC 2O01J 1S5LE 1U7JA 2AXTE 3L4FA 2IBZE 2Z5IA 1ZN5A 1EDIA 1BGYG 3AE7C 3GW6A 5BU8B 4UB8H 1FZBA 3AEDC 1L2PA 1FU1A 2IZ0A 4B86A 2E74B 1RF1A 2OTKE 5GTHH 3GMAA 4RO0A 1YTZT 2FYUG 1SQBK 3H1ID 3V2PA 1VF5D 1EQ7A 1JMMA 1S5LH 4PV1D 2AXTH 1ZW0A 1NU1K 1L0LD 4N3YB 1SQQD 3RK2B 2KOGA 1JEKA 5AW6B 1NAFA 2IYPA 2ZT9B 1LTJC 2RMZA 5AW2B 4IOIH 3Q2YA 3V4QA 2O3JA 1YHQP 1AA0A 2RH0A 2W83C 2KZJA 3PRJA 1GDTA 2WITA 1SQVG 2QSIA 1FBMA 3AEBC 2XNDH 2QM7A 1G1IA 4XE5B 4DT0A 2N1TA 4RKUJ 2PAJA 2J58A 2Z5HA 4H44D 3FWNA 3L72D 3BASA 2WMMA 1KQGB 2O1JA 3CMEP 1KFNA 1NTKK 3PLNA 5APVA 1E79H 4DJGA 1KORA 3MD0A 3RK3D 1NKZB 1J2JB 5KJ7A 2E74C 3W67A 4GT1A 1NVOA 3H1HD 3IF4A 4CPGA 3Q3DA 2A45H 2K9JA 1PV3A 2JO1A 3H1IE 3CWBD 1N73A 2Q1KA 1N7SB 1X0TA 3A3YB 1G2CA 1DEBA 5AVSB 3HRNA 3CXHD 4LC1A 2ZT9C 1L0LE 1SQQE 3LIDA 1GK6A 1EZVI 2L91A 1LT9B 3AEFC 3H1KD 2WSFH 2GA1A 1RQUA 1EZVG 2JWDA 3CWBJ 1JY2N 1HF9A 1FDMA 2QE7H 2D2CD 3HE4A 1JY2O 4H0LD 2OTLP 3M9QA 1GTWA 1NYHA 1SQPD 2V7QJ 3KPEA 3L72E 3H6PA 2KP8A 2FXPA 2H89C 3L71G 1QLED 1BGYD 1MV8A 3M0AA 2A06E 3RK3E 3S1KA 4EDFA 4JBZA 2YIUB 1VQ6P 5KLVJ 1RF1B 1ZP0C 1URQA 1KN7A 4KHXA 4N78D 1S4XA 3H1HE 1OW6A 1SQPJ 2J5UA 4LLHA 2KNCA 1N7SC 2FYUD 1NTMK 5CCGA 3HD7D 3KDPB 3C1LA 4W7ZA 3P7KA 2WT7B 3G3ZA 1KQFB 2P7JA 3L73E 3V6IA 3CXHE 1LT9C 3VMYA 1SQBG 3H1KE 4H13D 1H88A 3BRVB 5DJTB 3IAOA 1KQLA 2FYUJ 3BVHA 1W2BO 3H32A 2R32A 1WMKA 2HR3A 2WQYC 3O8ZA 5CCHA 2KK7A 2R5DA 1CZQA 3L75E 5BU5A 1OVVA 2PP6A 1ZR4A 1EDLA 2KSJA 1SQVD 1NGMB 2Y0EA 1FZCB 3CXHH 3WUTA 3JSVC 3CCUP 2YKPA 3CC7P 2FYNB 2NZ2A 1PPJG 1EXJA 2E74D 1OX3A 4H44B 2FFDB 1UIXA 1USDA 2YIUC 2HPCA 1FZEA 1RF1C 2WSEJ 1BGYE 1KMIZ 3FX0A 1E5WA 5CJ0A 4KJMA 2PFXA 1PFIA 5BVZA 3VP9A 1OMIA 3VN0A 1RHZB 1JTHA 2K9JB 1NTKG 1GK4A 2Q7CA 4N78E 3CCMP 5AVUB 2XNXA 3AE1C 4DZOA 5TJHA 1N73B 1OIPA 1G2CB 2YKQA 3PTZA 2UWJE 2KLVA 2M3BA 3EFGA 5AVVB 3M0DA 1BSNA 2R3CA 3EFFK 1S9KD 1JOCA 2AEJA 1KTMA 1PP9G 2IZ1A 4NPFX 3L74J 1USEA 5AVRB 3FXDA 3U59A 1AQTA 4ASVA 2QJYB 3CCRP 1FOSF 2WWWA 3AEEC 1KYOE 3HE4B 1EZVD 1Q82Q 4EI2A 4IFFA 5AW1B 2R5BA 1FZCC 2D2CB 2FYNC 1FZAA 1SQVE 3FGAD 1VPCA 2BEQD 5APXA 4BRYA 2B87A 4H44C 4K3AA 1NTZJ 1IFNA 2P10A 5KJ7C 3AE4C 1CI6A 1T3JA 3KZIE 2CK3H 2M3EA 3L71D 3VTPC 1KYOH 2B9BA 1SFCA 3LW5J 1GL2A 1YBKA 2Y9ZA 1N86A 2N9BA 3C8VA 4GOFA 2LKMA 2KNCB 1N73C 3CWBG 2O1KA 3C9IA 3AE8C 3VOPA 3CX5E 4OGQD 5KKZC 2ZJSE 1SQXE 1AFOA 2BCCD 3HD7B 3KZIH 1S9KE 4M3LA 2JKVA 4BWNA 2QJYC 2ITAA 3TNUA 1HUCA 1SQBD 2KZIA 4GOEA 3WU2E 1M8OB 4BXLA 1FDOA 3KQGA 2AXCA 3H32B 5TISE 5KLVG 4H13B 3HUSA 1NU1D 1EZVE 3HTKA 3V2NA 3CX5H 1PGOA 2BCCJ 2D2CC 1SQPG 3JCUE 1L0NJ 5KAIE 2OGUA 1FZGA 3B71A 2K9YA 2M5AA 1SQBJ 3D70A 3CCEP 2ZFCA 1LWUA 3IFMA 3N4XA 1LTTC 2H8PD 2HPCB 1PPJD 3WU2H 1JM0A 1NU1J 2P58A 3TYYA 1PZQA 3RBZA 5TISH 1T3UA 3L71E 1L0NK 2V4HA 2Q9IA 2C9NY 1DEEG 1JTHB 3MP7B 2CPBA 3CMAP 1FAVA 2YMKA 3SFDC 4D6TJ 4O9BA 2VRSA 5CCGC 3FWLA 3JCUH 1Z56A 5KAIH 1KB9I 1NTKD 1JCCA 3NTNA 2OYHA 3S4RA 1H89A 2W6AA 1QVGO 1DD3A 2R3SA 3HD7C 2HODA 2L5GB 2WSSH 4JYCA 1NWQA 1PP9D 1ZR2A 4I7ZB 1NTKJ 3LIEA 4HYTB 1SQBE 2B88A 2P2UA 2N1TD 4H13C 3B8EB 1PIXA 2IPPA 2KLUA 3MZWB 2K88A 2KS1A 3II6A 3F89A 5AVZB 1YYCA 3A0HE 1FC2C 2DW3A 3WUVA 4AQRD 3T97B 4DCKA 1PP9J 3M9BA 4I1LA 5APTA 2K37A 1VQKP 1NO4A 4BRYB 3NFQA 5KJ7D 3RL0D 3TGUJ 5H2FE 3H1LJ 4ZKUA 1QL1A 2Q3IA 2JP3A 1Q7YQ 2O01H 2HLOA 3N7NA 2E5YA 1ZXGA 1RE4A 1SFCB 1PPJE 3L74G 1JB0J 1LJ2A 1DX7A 3NXSA 2BEZF 1IZNB 1Q81Q 4TT3H 4PD4I 1L0LK 1RH5B 3A0HH 2JR8A 3M0DC 2KXPB 3CC4P 3L35A 1NTKE 4WB4A 2OYIA 2IX7C 5H2FH 3BCCJ 1IFMA 1L4AA 4K35A 4IL6X 1PGPA 3GF3A 1M7LA 1J1DB 5CBOA 3KXDA 5APQA 3CI9A 2OQQA 5APYA 1QGKB 4OGQB 4MN4C 2I8DA 3V2RA 4I7ZC 1K04A 1NTZG 2G3AA 4L74A 1VQMP 1KILD 3IN6A 1IK7A 3HTKB 3CC2P 5AW9B 5KLVD 1EXIA 2JEEA 2QRXA 2HYNA 1KILA 4C7NA 1BE3J 1P84D 1X8YA 2M5AB 1VDFA 2Z4EA 2NPSA 4I6MC 3B5ND 1VQ4P 1VQ9P 5CHXA 3AE5C 1G1JA 1URQD 1NTMJ 3I5CA 3A0BE 2K1AA 3QH9A 1SFCC 1RQVA 2Q3EA 1CSBA 3B5NA 1FJKA 2XKMA 3R4YA 1Q90D 5CCGD 1OW8A 1MZ9A 3MIWA 4HJGH 1RY3A 2YKOA 2G8YA 4NPDA 1MUUA 2W6BA 5GTIE 1D7MA 1KC8Q 2OYHB 1LT1A 3SWKA 1S2EA 3L36A 3Q1MA 5B66E 3MUDC 3CWBE 2BCCG 1J1DC 1YITP 3VMAA 4EOTA 1L0NG 2HODB 3A0BH 4EIJA 4WY4A 4OGQC 3IR9A 1LTAC 3A2AA 4R4LA 4ZNCA 2QG4A 5CCHD 4OVNF 1T2KC 2WTYA 1NU1G 3E1RA 1S5LX 2WSCJ 2XV5A 5GTIH 2E75B 1GZLA 2KS1B 2A45I 3G4SP 4ZMDA 5B66H 1LTJA 3SWFA 3GG2A 2N1TB 3OAKA 4D6TG 5KLVE 3CCLP 1X9VA 4JYBA 5AVQB 2YNYA 4L76A 5AW0B 1TU3F 1M90Q 1P84E 4PJ0E 3KYQA 1SP4A 3AEAC 1SQPE 1N2DC 5E79E 1UIIA 2I1JA 2FKWB 2V7QH 2H7HA 4A7PA 3RL0B 3PH0A 1JCDA 2HG5D 2H88C 3E1IA 4XFJA 2SPZA 1DIPA 3L74D 2XDJA 1OW7A 4YXDC 4JF7A 3OA7A 2J59M 1HJBA 2FXMA 3L70G 3VMZA 2OYHC 1WRGA 2QEXP 2QJPB 3CL3D 1P84H 4PJ0H 2K3RA 2WPQA 3V5BA 3H1JJ 1L4AB 2FYUE 1OFCX 2PGDA 3CPWO 2GUSA 4PD4D 2W6JH 1KFMA 2ZAEB 1LTGC 5KKZB 2ZVNB 5KTBA 3AE9C 5E79H 1FE6A 5C39A 1SLQA 3TGUG 3R2PA 1BCCJ 3H1LG 4U3FJ 1WT6A 2C0XA 4L75A 1QVFO 1S1CX 2E75C 3TK1A 1NTZD 5APUA 1QX8A 1SQVK 1FJPA 4W7YA 1MFTA 2N1TC 1KILB 2FYZA 1Y9BA 1T6AA 3M06A 3VMXA 2NPSB 2XZRA 3E7KA 1SFCD 3PJSK 1GL2D 5AW3B 3BCCG 3P8CD 1RE4C 4AUWA 3G6EP 3RL0C 1W2EA 3B5NB 3I55P 3AE2C 1URQB 4ZKPA 3RL0g 3MHVA 1YJWP 2JWAA 3NMDA 2WSEH 5AW5B 3L74E 1SQXK 2QJPC 1A02F 2C9LY 1ZOYC 1FDIA 2WVRA 3S9OA 1L4AC 2YXRB 5AW7B 1Q86Q 5APSA 5AVWB 1KD1Q 3HE5A 1BE3G 3K5BA 4WY4B 1BDCA 4PD4E 1L0ND 1M57D 1QL2A 2P1JA 1T2KD 2NRGA 1FS0E 5AVTB 1SS1A 1N7SA 1NTMG 4Y28J 4RJTA 1NJIQ 1MFZA 1XTGB 1EDKA 3UIAA 4L73A 1NTZE 3CCQP 1KILC 2W27A 3QWOC 2M0BA 2XU6A 1RF0A 2MJZA 2NPSC 1Q2NA 3L75G 4Y99B 4ASWA 1K05A 4D6TD 4PD4H 3M91A 2KI7B 1IFJA 1ZRTD 3B5NC 5KAFE 3P8CE 1SVFA 1HGZA 1RE3A 1URQC 1YIJP 4UB6E 1U57A 3P8MC 2GUVA 1VQPP 4C46A 1T8ZA 3LW5H 4GKGA 2YO2A 3L70D 4GODA 5L8RJ 4WY4C 3SFEC 2ZXEB 2Y0DA 5KAFH 2QA4P 4JPZB 2QIWA 2P67A 3SSUA 2BCCE 2KUBA 1PGJA 1L0NE 2E75D 4UB6H 2ZVOB 3ZDMA 2WSFJ 1R5LA 3TGUD 3EWKA 1KYOI 1K9MQ 3D6YA 3H1LD 3L70J 2WT7A 5CCHC 1PGQA 3Q5SA 1NU1E 3EQ2A 2AEFA 3H1IJ 1DH3A 2FY8A 4Y99C 1JY3P 1YTZI 4U7JA 1YQ4C 4AYCA 2WPVB 2B87B 1L0LJ 5AW4B 4D6TE 1LTIC 1KV4A 3H1JG 1SQQJ 3JC22 3OW2O 2OTJP 3G71P 1VL2A 3BATA 1BSHA 1CI6B 3FXEA 1ZRTE 3BCCD 3USSA 1VQOP 5AW8B 1GL2B 1FZCA 1N7LA 1OZHA 3RGUA 1YQ3C 1BCCG 4U3FG 2Q5UA 3ITKA 2IDBA 4GDOA 2A06D 1L4AD 1YJNP 1DD4A 2FFDA 1JY3N 1SQQK 1ZLLA 2LXBA 4HKZH 2KIKA 3CX5I 3Q5PA 2LXCB 1R8EA 1JY3O 1HJ0A 3L70E 3OJAB 3HE5B 4HB1A 3WUUA 2WZ7A 1JY2P 3L72J 1M1JA 1H0TA 4YPCA 1Y47A 3U1CA 1BE3D 2MKVA 2QVAA 1SQXG 3WMM0 3G9RA 2N9YB 3P32A 3TNUB 2E76D 1IC2A 3RK2C 1PP9E 2Q6QA 2Y9YA 3L73D 3SWYA 2E42A 3TGUE 1NTMD 3H1LE 3H1HJ 3HUSB 2C0WA 2HFED 2NPSD 1PL5A 1U7MA 2PRRA 2KB7P 4RESB 2IBZI 3ABVC 2KYVA 1EC5A 5APWA 1LWUB 3L75D 1GD2E 3L73J 3I56P 3O6QA 2GM4A 3GHGA 1KZUB 2IBZG 1VQ7P 3CD6P 1NH4A 1GL2C 3H1KJ 4Z1MH 3A5TA 2ZXXA 2E5TA 3BCCE 4N6JA 4JQ0D 4IFDK 2JJLA 1LTSC 2ZYDA 5CMZA 2POHA 2Y0CA 1OVUA 3MTUE 1K8AQ 3TF5A 4LGDE 1X22A 4WVZA 1W5CE 1GW3A 1GU4A 1NKNA 3L75J 3VYIA 2YXQB 4WY4D 4IFMA 1X79B 1ZMEC 1JMBA 1S3JA 3H25A 1LP1A 2OYOA 1S72P 4OH8B 1HGVA 1KB9D 2WPRA 4WWIA 4QMAA 1BE3E 1BGYJ 1K73Q
chains in the Genus database with same CATH topology
3M06A 3VMXA 2A45H 1LTTC 1J1EB 5KLVK 2H8PD 2HPCB 4WBAA 3HUSC 2NPSB 3CLQA 3TYYA 1FZFA 1RF0C 2XZRA 3HD7A 1T3UA 1N73A 1N7SB 1L0NK 1SQPK 1SFCD 2Q9IA 2C9NY 1IK9A 3A3YB 1G2CA 1GL2D 1IFIA 1JTHB 1DEBA 5AW3B 5AVSB 2CPBA 3P8CD 1RE4C 4AUWA 3HRNA 1FAVA 3RL0C 1W2EA 4LC1A 3B5NB 4O9BA 2VRSA 5CCGC 1Z56A 2A45G 1LWUC 3LIDA 1GK6A 1JCCA 3NTNA 1HWTC 1LT9B 1URQB 2OYHA 2WSFH 3PP5A 3M9HA 1H89A 2W6AA 4ZKPA 2QM8A 1RE3C 3NMDA 2WSEH 5AW5B 1SQXK 3HD7C 1A02F 2C9LY 2HODA 1JY2N 2L5GB 2OARA 4JYCA 1NWQA 1FDMA 3L37A 1L4AC 3HE4A 1JY2O 2E43A 2M8RA 2FYUK 5AW7B 4GIFA 1JNMA 1ZR2A 5APSA 5AVWB 3HE5A 1JUNA 3M9QA 3LIEA 4HYTB 2CPSA 1GTWA 4WY4B 2P2UA 2N1TD 1GW4A 1GU5A 3B8EB 1QL2A 2IPPA 2P1JA 1T2KD 2OYIB 3KPEA 1HVVA 3RK3B 5AVTB 3II6A 3H6PA 2KP8A 5AVZB 1N7SA 1YYCA 2YMYA 1AQ5A 1M1JB 2H43A 1H8AA 1MV8A 1JO5A 3M0AA 1MFZA 1XTGB 4AQRD 3M9BA 4I1LA 5APTA 3RK2D 3UIAA 1RF1B 1NO4A 3NFQA 5KJ7D 3RL0D 1KILC 2W27A 1URQA 1J1EC 4ZKUA 4KHXA 1QL1A 2Q3IA 2XU6A 1RF0A 4N78D 2MJZA 2O01H 2NPSC 2HLOA 4C7RA 1CW5A 4LLHA 3N7NA 4Y99B 1NHLA 1RE4A 1IJDB 1SFCB 1N7SC 3M91A 1LTBC 1NTMK 5CCGA 1DX7A 1HH0A 2BASA 3NXSA 1XTCC 3MGNA 3HD7D 1IFDA 4I2LC 1IFJA 4C7NB 3B5NC 1IO4A 3KDPB 4W7ZA 3P7KA 2WT7B 2WSCH 3A7OA 3G3ZA 3U1AA 1L0LK 3P8CE 2P7JA 1SVFA 1LT9C 1HGZA 1RE3A 1URQC 3M0DC 3VMYA 1NOHA 2IFMA 3L35A 4WB4A 2OYIA 2IX7C 3GHGB 3P8MC 1IFMA 1L4AA 1H88A 2GUVA 3BRVB 1M7LA 1J1DB 1HTLC 1KQLA 4C46A 3BVHA 5APQA 1T8ZA 3LW5H 1A02J 3CI9A 4GKGA 3H32A 2R32A 4W80A 2YO2A 5APYA 3T97A 1HBWA 5CCHA 3O8ZA 2R5DA 3V2RA 1FOSE 1CZQA 2FFDC 2I1KA 5BU5A 2PP6A 4WY4C 1ZR4A 2KSJA 2ZXEB 2YO3A 1KILD 2P67A 4XA4A 2OYIC 3RK3C 1FZCB 2YKPA 3HTKB 4DOJA 5AW9B 1M1JC 2JEEA 1LGHB 2HYNA 1N7SD 1OWAA 1KILA 4C7NA 2FFDB 4HH2A 1X8YA 2WT7A 2HPCA 1FZEA 1VDFA 5CCHC 1RF1C 2Z4EA 2NPSA 1E5WA 4I6MC 3B5ND 1NTZK 1ZV8A 5CJ0A 5CHXA 1PFIA 5BVZA 1G1JA 3VP9A 3VN0A 3EQ2A 1URQD 3V2QA 1JTHA 3I5CA 5AVYB 1DH3A 4Y99C 1JY3P 1OXZA 3MUDA 1GK4A 1YTZI 4N78E 1SFCC 2Q7CA 5AVUB 2XNXA 1CSBA 3B5NA 1FJKA 4DZOA 2XKMA 4AYCA 1N73B 3TSIA 1G2CB 3VP8A 1LTJB 2YKQA 5AW4B 1LTIC 3V4WA 5CCGD 1LT9A 2KLVA 2M3BA 3EFGA 1MZ9A 5AVVB 3M0DA 2IFNA 3MIWA 3BATA 1CI6B 1RY3A 2YKOA 2R3CA 1MUUA 1S9KD 1JOCA 2W6BA 3BRTB 5CJ4A 5AW8B 1GL2B 2OYHB 3GHGC 1FZCA 3L36A 1N7LA 5AVRB 5AVXB 3U59A 2Q5UA 1J1DC 2WPSA 1FOSF 4EOTA 1L4AD 2WWWA 2HODB 4EIJA 2FFDA 1JY3N 1SQQK 1ZLLA 4WY4A 3IR9A 3HE4B 1LTAC 3L4FA 3A2AA 1JY3O 2Z5IA 4IFFA 1ZN5A 3OJAB 3HE5B 5CCHD 5AW1B 2R5BA 2WZ7A 1T2KC 5BU8B 1JY2P 1M1JA 2WTYA 1FZCC 2XV5A 3U1CA 1FZAA 1FZBA 1GZLA 1FU1A 3WMM0 1VPCA 2A45I 4B86A 3P32A 3TNUB 5APXA 1RF1A 1IC2A 1LTJA 3RK2C 3SWFA 1IFNA 3SWYA 2N1TB 3OAKA 5KJ7C 1YTZT 1X9VA 1CI6A 1SQBK 1T3JA 4JYBA 2E42A 5AVQB 2YNYA 3V2PA 1EQ7A 5AW0B 3VTPC 3HUSB 1JMMA 2C0WA 3KYQA 2HFED 1SP4A 1SFCA 2NPSD 1GL2A 1N2DC 1N86A 2N9BA 1NU1K 4N3YB 2KB7P 3RK2B 2KOGA 2I1JA 2LKMA 2FKWB 2H7HA 4RESB 1N73C 5AW6B 2O1KA 1NAFA 3RL0B 3C9IA 2KYVA 1LTJC 1JCDA 2HG5D 5AW2B 3E1IA 5APWA 1LWUB 1GD2E 3VOPA 2GM4A 2XDJA 3GHGA 1KZUB 4JF7A 3OA7A 2J59M 1HJBA 3V4QA 2FXMA 1AFOA 3VMZA 1NH4A 1GL2C 2OYHC 1WRGA 3A5TA 3HD7B 1S9KE 3CL3D 4N6JA 1GDTA 2WPQA 4IFDK 3V5BA 4M3LA 1L4AB 2JJLA 2WITA 1LTSC 3TNUA 1FBMA 1HUCA 5CMZA 2POHA 2QM7A 3MTUE 2GUSA 1G1IA 1KFMA 4LGDE 1LTGC 4XE5B 3KQGA 1GW3A 5KTBA 2N1TA 1GU4A 1NKNA 3H32B 2PAJA 3VYIA 2J58A 1SLQA 2Z5HA 3BASA 4WY4D 4IFMA 2O1JA 3HUSA 1X79B 1KFNA 1NTKK 3HTKA 3R2PA 5APVA 3V2NA 1WT6A 2C0XA 3MD0A 3RK3D 4OH8B 1HGVA 3TK1A 5APUA 2WPRA 1FZGA 1NKZB 1SQVK 1J2JB 5KJ7A 4GT1A 1FJPA 2ZFCA 1LWUA 3IFMA 4W7YA 3N4XA 2N1TC 1KILB 2FYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVQ B;  3M06 A;  3VMX A;  2YNY A;  5AW0 B;  4KHX A;  2Q3I A;  2XU6 A;  3VTP C;  1SP4 A;  3VN0 A;  3TYY A;  3I5C A;  5AVY B;  1DH3 A;  2XZR A;  1OXZ A;  1GK4 A;  2N9B A;  2Q7C A;  2C9N Y;  5AVU B;  3A3Y B;  1CSB A;  3M91 A;  5AW3 B;  5AVS B;  2BAS A;  3NXS A;  4DZO A;  4AYC A;  3MGN A;  2H7H A;  4AUW A;  4RES B;  5AW6 B;  1FAV A;  4I2L C;  1NAF A;  1G2C B;  4LC1 A;  4C7N B;  5AW4 B;  2VRS A;  3V4W A;  1IO4 A;  3KDP B;  5AW2 B;  5APW A;  3P7K A;  1GD2 E;  5AVV B;  3A7O A;  3M0D A;  3LID A;  2WT7 B;  1GK6 A;  2P7J A;  1CI6 B;  3NTN A;  1HWT C;  2R3C A;  1MUU A;  1S9K D;  3M9H A;  1H89 A;  2W6A A;  3VMY A;  1HJB A;  3V4Q A;  2QM8 A;  3L35 A;  5AW8 B;  3VMZ A;  3NMD A;  3L36 A;  3P8M C;  5AW5 B;  3A5T A;  1S9K E;  5AVR B;  1H88 A;  1A02 F;  5AVX B;  2C9L Y;  2Q5U A;  2WPQ A;  1KQL A;  4JYC A;  3V5B A;  1NWQ A;  3L37 A;  4C46 A;  4M3L A;  2WPS A;  2JJL A;  1FOS F;  4EOT A;  5APQ A;  3HE4 A;  1HUC A;  2WWW A;  5CMZ A;  3TNU A;  1A02 J;  2E43 A;  4GKG A;  2R32 A;  2QM7 A;  2YO2 A;  5APY A;  3T97 A;  5AW7 B;  1JNM A;  4XE5 B;  5APS A;  1HBW A;  3IR9 A;  3HE4 B;  3KQG A;  5AVW B;  3O8Z A;  1GU4 A;  2R5D A;  3HE5 A;  3VYI A;  1JUN A;  3A2A A;  1SLQ A;  1FOS E;  2Z5H A;  1CZQ A;  2Z5I A;  3LIE A;  4HYT B;  1GTW A;  2ZXE B;  3HE5 B;  2P2U A;  5AW1 B;  2YO3 A;  3B8E B;  1GU5 A;  3HTK A;  2P67 A;  5APV A;  2R5B A;  2IPP A;  1T2K C;  1T2K D;  3MD0 A;  5AVT B;  2WTY A;  2KP8 A;  5AVZ B;  2XV5 A;  1YYC A;  1GZL A;  5AW9 B;  3TK1 A;  5APU A;  1H8A A;  2WPR A;  1MV8 A;  4B86 A;  3M0A A;  3P32 A;  3TNU B;  5APX A;  1J2J B;  1MFZ A;  1OWA A;  4AQR D;  4C7N A;  4GT1 A;  3SWF A;  3M9B A;  3UIA A;  5APT A;  1X8Y A;  2ZFC A;  2WT7 A;  3OAK A;  3NFQ A;  2E42 A;  1CI6 A;  4JYB A;  4I6M C;  2W27 A; 
#chains in the Genus database with same CATH topology
 1VF5 B;  2R44 A;  1J1E B;  5KLV K;  2W90 A;  4WBA A;  2ZYG A;  3HUS C;  3CLQ A;  4PV1 B;  1FZF A;  1KIL E;  1RF0 C;  3HD7 A;  1NTM E;  4KT0 J;  3AE3 C;  1N8R Q;  1SQP K;  1IK9 A;  1IFI A;  1KYO D;  1YJ9 P;  4R4M A;  2A45 G;  1LWU C;  1HWT C;  3RBX A;  3PP5 A;  3M9H A;  3Q5R A;  2QM8 A;  1RE3 C;  3H1J D;  4OWF A;  2OAR A;  1VQ5 P;  3L37 A;  1IFP A;  1MKM A;  2E43 A;  2M8R A;  2FYU K;  4GIF A;  1JNM A;  5KLI B;  2RKL A;  1JUN A;  1BCC D;  4U3F D;  2CPS A;  1M1K Q;  3TDK A;  2FXO A;  1GW4 A;  1GU5 A;  2OYI B;  3D6Z A;  1HVV A;  3RK3 B;  1SQV J;  3H1I G;  2YMY A;  1AQ5 A;  1M1J B;  2H43 A;  1Y8A A;  2W8Z A;  1H0T B;  1H8A A;  1JO5 A;  3GF7 A;  3RK2 D;  3CX5 D;  1KB9 E;  1L0L G;  2KSE A;  2ZT9 D;  1SQQ G;  1VF5 C;  1J1E C;  1SQX D;  2AEM A;  2LR2 A;  4PV1 C;  1GMJ A;  4YXW H;  4C7R A;  1CW5 A;  1LNQ A;  1NHL A;  1IJD B;  2E76 B;  2JDI H;  1LTB C;  1HH0 A;  2BAS A;  1XTC C;  3MGN A;  1IFD A;  3D71 A;  4I2L C;  2ZYA A;  4IL6 E;  4C7N B;  1IO4 A;  2RN0 A;  3PHL A;  2WSC H;  3A7O A;  3U1A A;  3CCS P;  4EYY Q;  3AEC C;  1BDD A;  1SQX J;  2IYO A;  3O6Q B;  1NOH A;  2IFM A;  2B89 A;  1KB9 H;  3GLM A;  3GHG B;  1VQN P;  1EDJ A;  3L72 G;  2O01 N;  1HTL C;  2QJK B;  1KQS O;  2IBZ D;  3H1J E;  1A02 J;  4H0L B;  4W80 A;  2FBW C;  3T97 A;  2A06 G;  3KHU A;  1HBW A;  5DJU B;  5KLI C;  5K5G B;  1VQ8 P;  4YTP C;  1FOS E;  2FFD C;  2I1K A;  1AVO A;  4IL6 H;  3CCJ P;  5EFW B;  2YO3 A;  4XA4 A;  2OYI C;  3B4S A;  1BCC E;  4U3F E;  3H1H G;  3RK3 C;  1NAY A;  4DOJ A;  1AV1 A;  5B5E E;  1LP1 B;  1M1J C;  1LGH B;  1N7S D;  1OWA A;  3CXH I;  5M1B A;  4HH2 A;  1NTZ K;  1ZV8 A;  3L73 G;  1AJY A;  3V2Q A;  5AVY B;  3L71 J;  3CCV P;  3MUD A;  1OXZ A;  5CBN A;  2E76 C;  3H1K G;  1OVR A;  3TSI A;  3W68 A;  1VQL P;  3VP8 A;  1LTJ B;  3V4W A;  1LT9 A;  5B5E H;  2IFN A;  4UB8 E;  1M56 D;  3AEG C;  1P84 I;  3F5H A;  3BRT B;  5CJ4 A;  1R5S A;  4TLF A;  3GHG C;  4NPE A;  1AVY A;  1YI2 P;  5GTH E;  5AVX B;  3AE6 C;  1QEX A;  2QJK C;  2WPS A;  4H0L C;  2O01 J;  1S5L E;  1U7J A;  2AXT E;  3L4F A;  2IBZ E;  2Z5I A;  1ZN5 A;  1EDI A;  1BGY G;  3AE7 C;  3GW6 A;  5BU8 B;  4UB8 H;  1FZB A;  3AED C;  1L2P A;  1FU1 A;  2IZ0 A;  4B86 A;  2E74 B;  1RF1 A;  2OTK E;  5GTH H;  3GMA A;  4RO0 A;  1YTZ T;  2FYU G;  1SQB K;  3H1I D;  3V2P A;  1VF5 D;  1EQ7 A;  1JMM A;  1S5L H;  4PV1 D;  2AXT H;  1ZW0 A;  1NU1 K;  1L0L D;  4N3Y B;  1SQQ D;  3RK2 B;  2KOG A;  1JEK A;  5AW6 B;  1NAF A;  2IYP A;  2ZT9 B;  1LTJ C;  2RMZ A;  5AW2 B;  4IOI H;  3Q2Y A;  3V4Q A;  2O3J A;  1YHQ P;  1AA0 A;  2RH0 A;  2W83 C;  2KZJ A;  3PRJ A;  1GDT A;  2WIT A;  1SQV G;  2QSI A;  1FBM A;  3AEB C;  2XND H;  2QM7 A;  1G1I A;  4XE5 B;  4DT0 A;  2N1T A;  4RKU J;  2PAJ A;  2J58 A;  2Z5H A;  4H44 D;  3FWN A;  3L72 D;  3BAS A;  2WMM A;  1KQG B;  2O1J A;  3CME P;  1KFN A;  1NTK K;  3PLN A;  5APV A;  1E79 H;  4DJG A;  1KOR A;  3MD0 A;  3RK3 D;  1NKZ B;  1J2J B;  5KJ7 A;  2E74 C;  3W67 A;  4GT1 A;  1NVO A;  3H1H D;  3IF4 A;  4CPG A;  3Q3D A;  2A45 H;  2K9J A;  1PV3 A;  2JO1 A;  3H1I E;  3CWB D;  1N73 A;  2Q1K A;  1N7S B;  1X0T A;  3A3Y B;  1G2C A;  1DEB A;  5AVS B;  3HRN A;  3CXH D;  4LC1 A;  2ZT9 C;  1L0L E;  1SQQ E;  3LID A;  1GK6 A;  1EZV I;  2L91 A;  1LT9 B;  3AEF C;  3H1K D;  2WSF H;  2GA1 A;  1RQU A;  1EZV G;  2JWD A;  3CWB J;  1JY2 N;  1HF9 A;  1FDM A;  2QE7 H;  2D2C D;  3HE4 A;  1JY2 O;  4H0L D;  2OTL P;  3M9Q A;  1GTW A;  1NYH A;  1SQP D;  2V7Q J;  3KPE A;  3L72 E;  3H6P A;  2KP8 A;  2FXP A;  2H89 C;  3L71 G;  1QLE D;  1BGY D;  1MV8 A;  3M0A A;  2A06 E;  3RK3 E;  3S1K A;  4EDF A;  4JBZ A;  2YIU B;  1VQ6 P;  5KLV J;  1RF1 B;  1ZP0 C;  1URQ A;  1KN7 A;  4KHX A;  4N78 D;  1S4X A;  3H1H E;  1OW6 A;  1SQP J;  2J5U A;  4LLH A;  2KNC A;  1N7S C;  2FYU D;  1NTM K;  5CCG A;  3HD7 D;  3KDP B;  3C1L A;  4W7Z A;  3P7K A;  2WT7 B;  3G3Z A;  1KQF B;  2P7J A;  3L73 E;  3V6I A;  3CXH E;  1LT9 C;  3VMY A;  1SQB G;  3H1K E;  4H13 D;  1H88 A;  3BRV B;  5DJT B;  3IAO A;  1KQL A;  2FYU J;  3BVH A;  1W2B O;  3H32 A;  2R32 A;  1WMK A;  2HR3 A;  2WQY C;  3O8Z A;  5CCH A;  2KK7 A;  2R5D A;  1CZQ A;  3L75 E;  5BU5 A;  1OVV A;  2PP6 A;  1ZR4 A;  1EDL A;  2KSJ A;  1SQV D;  1NGM B;  2Y0E A;  1FZC B;  3CXH H;  3WUT A;  3JSV C;  3CCU P;  2YKP A;  3CC7 P;  2FYN B;  2NZ2 A;  1PPJ G;  1EXJ A;  2E74 D;  1OX3 A;  4H44 B;  2FFD B;  1UIX A;  1USD A;  2YIU C;  2HPC A;  1FZE A;  1RF1 C;  2WSE J;  1BGY E;  1KMI Z;  3FX0 A;  1E5W A;  5CJ0 A;  4KJM A;  2PFX A;  1PFI A;  5BVZ A;  3VP9 A;  1OMI A;  3VN0 A;  1RHZ B;  1JTH A;  2K9J B;  1NTK G;  1GK4 A;  2Q7C A;  4N78 E;  3CCM P;  5AVU B;  2XNX A;  3AE1 C;  4DZO A;  5TJH A;  1N73 B;  1OIP A;  1G2C B;  2YKQ A;  3PTZ A;  2UWJ E;  2KLV A;  2M3B A;  3EFG A;  5AVV B;  3M0D A;  1BSN A;  2R3C A;  3EFF K;  1S9K D;  1JOC A;  2AEJ A;  1KTM A;  1PP9 G;  2IZ1 A;  4NPF X;  3L74 J;  1USE A;  5AVR B;  3FXD A;  3U59 A;  1AQT A;  4ASV A;  2QJY B;  3CCR P;  1FOS F;  2WWW A;  3AEE C;  1KYO E;  3HE4 B;  1EZV D;  1Q82 Q;  4EI2 A;  4IFF A;  5AW1 B;  2R5B A;  1FZC C;  2D2C B;  2FYN C;  1FZA A;  1SQV E;  3FGA D;  1VPC A;  2BEQ D;  5APX A;  4BRY A;  2B87 A;  4H44 C;  4K3A A;  1NTZ J;  1IFN A;  2P10 A;  5KJ7 C;  3AE4 C;  1CI6 A;  1T3J A;  3KZI E;  2CK3 H;  2M3E A;  3L71 D;  3VTP C;  1KYO H;  2B9B A;  1SFC A;  3LW5 J;  1GL2 A;  1YBK A;  2Y9Z A;  1N86 A;  2N9B A;  3C8V A;  4GOF A;  2LKM A;  2KNC B;  1N73 C;  3CWB G;  2O1K A;  3C9I A;  3AE8 C;  3VOP A;  3CX5 E;  4OGQ D;  5KKZ C;  2ZJS E;  1SQX E;  1AFO A;  2BCC D;  3HD7 B;  3KZI H;  1S9K E;  4M3L A;  2JKV A;  4BWN A;  2QJY C;  2ITA A;  3TNU A;  1HUC A;  1SQB D;  2KZI A;  4GOE A;  3WU2 E;  1M8O B;  4BXL A;  1FDO A;  3KQG A;  2AXC A;  3H32 B;  5TIS E;  5KLV G;  4H13 B;  3HUS A;  1NU1 D;  1EZV E;  3HTK A;  3V2N A;  3CX5 H;  1PGO A;  2BCC J;  2D2C C;  1SQP G;  3JCU E;  1L0N J;  5KAI E;  2OGU A;  1FZG A;  3B71 A;  2K9Y A;  2M5A A;  1SQB J;  3D70 A;  3CCE P;  2ZFC A;  1LWU A;  3IFM A;  3N4X A;  1LTT C;  2H8P D;  2HPC B;  1PPJ D;  3WU2 H;  1JM0 A;  1NU1 J;  2P58 A;  3TYY A;  1PZQ A;  3RBZ A;  5TIS H;  1T3U A;  3L71 E;  1L0N K;  2V4H A;  2Q9I A;  2C9N Y;  1DEE G;  1JTH B;  3MP7 B;  2CPB A;  3CMA P;  1FAV A;  2YMK A;  3SFD C;  4D6T J;  4O9B A;  2VRS A;  5CCG C;  3FWL A;  3JCU H;  1Z56 A;  5KAI H;  1KB9 I;  1NTK D;  1JCC A;  3NTN A;  2OYH A;  3S4R A;  1H89 A;  2W6A A;  1QVG O;  1DD3 A;  2R3S A;  3HD7 C;  2HOD A;  2L5G B;  2WSS H;  4JYC A;  1NWQ A;  1PP9 D;  1ZR2 A;  4I7Z B;  1NTK J;  3LIE A;  4HYT B;  1SQB E;  2B88 A;  2P2U A;  2N1T D;  4H13 C;  3B8E B;  1PIX A;  2IPP A;  2KLU A;  3MZW B;  2K88 A;  2KS1 A;  3II6 A;  3F89 A;  5AVZ B;  1YYC A;  3A0H E;  1FC2 C;  2DW3 A;  3WUV A;  4AQR D;  3T97 B;  4DCK A;  1PP9 J;  3M9B A;  4I1L A;  5APT A;  2K37 A;  1VQK P;  1NO4 A;  4BRY B;  3NFQ A;  5KJ7 D;  3RL0 D;  3TGU J;  5H2F E;  3H1L J;  4ZKU A;  1QL1 A;  2Q3I A;  2JP3 A;  1Q7Y Q;  2O01 H;  2HLO A;  3N7N A;  2E5Y A;  1ZXG A;  1RE4 A;  1SFC B;  1PPJ E;  3L74 G;  1JB0 J;  1LJ2 A;  1DX7 A;  3NXS A;  2BEZ F;  1IZN B;  1Q81 Q;  4TT3 H;  4PD4 I;  1L0L K;  1RH5 B;  3A0H H;  2JR8 A;  3M0D C;  2KXP B;  3CC4 P;  3L35 A;  1NTK E;  4WB4 A;  2OYI A;  2IX7 C;  5H2F H;  3BCC J;  1IFM A;  1L4A A;  4K35 A;  4IL6 X;  1PGP A;  3GF3 A;  1M7L A;  1J1D B;  5CBO A;  3KXD A;  5APQ A;  3CI9 A;  2OQQ A;  5APY A;  1QGK B;  4OGQ B;  4MN4 C;  2I8D A;  3V2R A;  4I7Z C;  1K04 A;  1NTZ G;  2G3A A;  4L74 A;  1VQM P;  1KIL D;  3IN6 A;  1IK7 A;  3HTK B;  3CC2 P;  5AW9 B;  5KLV D;  1EXI A;  2JEE A;  2QRX A;  2HYN A;  1KIL A;  4C7N A;  1BE3 J;  1P84 D;  1X8Y A;  2M5A B;  1VDF A;  2Z4E A;  2NPS A;  4I6M C;  3B5N D;  1VQ4 P;  1VQ9 P;  5CHX A;  3AE5 C;  1G1J A;  1URQ D;  1NTM J;  3I5C A;  3A0B E;  2K1A A;  3QH9 A;  1SFC C;  1RQV A;  2Q3E A;  1CSB A;  3B5N A;  1FJK A;  2XKM A;  3R4Y A;  1Q90 D;  5CCG D;  1OW8 A;  1MZ9 A;  3MIW A;  4HJG H;  1RY3 A;  2YKO A;  2G8Y A;  4NPD A;  1MUU A;  2W6B A;  5GTI E;  1D7M A;  1KC8 Q;  2OYH B;  1LT1 A;  3SWK A;  1S2E A;  3L36 A;  3Q1M A;  5B66 E;  3MUD C;  3CWB E;  2BCC G;  1J1D C;  1YIT P;  3VMA A;  4EOT A;  1L0N G;  2HOD B;  3A0B H;  4EIJ A;  4WY4 A;  4OGQ C;  3IR9 A;  1LTA C;  3A2A A;  4R4L A;  4ZNC A;  2QG4 A;  5CCH D;  4OVN F;  1T2K C;  2WTY A;  1NU1 G;  3E1R A;  1S5L X;  2WSC J;  2XV5 A;  5GTI H;  2E75 B;  1GZL A;  2KS1 B;  2A45 I;  3G4S P;  4ZMD A;  5B66 H;  1LTJ A;  3SWF A;  3GG2 A;  2N1T B;  3OAK A;  4D6T G;  5KLV E;  3CCL P;  1X9V A;  4JYB A;  5AVQ B;  2YNY A;  4L76 A;  5AW0 B;  1TU3 F;  1M90 Q;  1P84 E;  4PJ0 E;  3KYQ A;  1SP4 A;  3AEA C;  1SQP E;  1N2D C;  5E79 E;  1UII A;  2I1J A;  2FKW B;  2V7Q H;  2H7H A;  4A7P A;  3RL0 B;  3PH0 A;  1JCD A;  2HG5 D;  2H88 C;  3E1I A;  4XFJ A;  2SPZ A;  1DIP A;  3L74 D;  2XDJ A;  1OW7 A;  4YXD C;  4JF7 A;  3OA7 A;  2J59 M;  1HJB A;  2FXM A;  3L70 G;  3VMZ A;  2OYH C;  1WRG A;  2QEX P;  2QJP B;  3CL3 D;  1P84 H;  4PJ0 H;  2K3R A;  2WPQ A;  3V5B A;  3H1J J;  1L4A B;  2FYU E;  1OFC X;  2PGD A;  3CPW O;  2GUS A;  4PD4 D;  2W6J H;  1KFM A;  2ZAE B;  1LTG C;  5KKZ B;  2ZVN B;  5KTB A;  3AE9 C;  5E79 H;  1FE6 A;  5C39 A;  1SLQ A;  3TGU G;  3R2P A;  1BCC J;  3H1L G;  4U3F J;  1WT6 A;  2C0X A;  4L75 A;  1QVF O;  1S1C X;  2E75 C;  3TK1 A;  1NTZ D;  5APU A;  1QX8 A;  1SQV K;  1FJP A;  4W7Y A;  1MFT A;  2N1T C;  1KIL B;  2FYZ A;  1Y9B A;  1T6A A;  3M06 A;  3VMX A;  2NPS B;  2XZR A;  3E7K A;  1SFC D;  3PJS K;  1GL2 D;  5AW3 B;  3BCC G;  3P8C D;  1RE4 C;  4AUW A;  3G6E P;  3RL0 C;  1W2E A;  3B5N B;  3I55 P;  3AE2 C;  1URQ B;  4ZKP A;  3RL0 g;  3MHV A;  1YJW P;  2JWA A;  3NMD A;  2WSE H;  5AW5 B;  3L74 E;  1SQX K;  2QJP C;  1A02 F;  2C9L Y;  1ZOY C;  1FDI A;  2WVR A;  3S9O A;  1L4A C;  2YXR B;  5AW7 B;  1Q86 Q;  5APS A;  5AVW B;  1KD1 Q;  3HE5 A;  1BE3 G;  3K5B A;  4WY4 B;  1BDC A;  4PD4 E;  1L0N D;  1M57 D;  1QL2 A;  2P1J A;  1T2K D;  2NRG A;  1FS0 E;  5AVT B;  1SS1 A;  1N7S A;  1NTM G;  4Y28 J;  4RJT A;  1NJI Q;  1MFZ A;  1XTG B;  1EDK A;  3UIA A;  4L73 A;  1NTZ E;  3CCQ P;  1KIL C;  2W27 A;  3QWO C;  2M0B A;  2XU6 A;  1RF0 A;  2MJZ A;  2NPS C;  1Q2N A;  3L75 G;  4Y99 B;  4ASW A;  1K05 A;  4D6T D;  4PD4 H;  3M91 A;  2KI7 B;  1IFJ A;  1ZRT D;  3B5N C;  5KAF E;  3P8C E;  1SVF A;  1HGZ A;  1RE3 A;  1URQ C;  1YIJ P;  4UB6 E;  1U57 A;  3P8M C;  2GUV A;  1VQP P;  4C46 A;  1T8Z A;  3LW5 H;  4GKG A;  2YO2 A;  3L70 D;  4GOD A;  5L8R J;  4WY4 C;  3SFE C;  2ZXE B;  2Y0D A;  5KAF H;  2QA4 P;  4JPZ B;  2QIW A;  2P67 A;  3SSU A;  2BCC E;  2KUB A;  1PGJ A;  1L0N E;  2E75 D;  4UB6 H;  2ZVO B;  3ZDM A;  2WSF J;  1R5L A;  3TGU D;  3EWK A;  1KYO I;  1K9M Q;  3D6Y A;  3H1L D;  3L70 J;  2WT7 A;  5CCH C;  1PGQ A;  3Q5S A;  1NU1 E;  3EQ2 A;  2AEF A;  3H1I J;  1DH3 A;  2FY8 A;  4Y99 C;  1JY3 P;  1YTZ I;  4U7J A;  1YQ4 C;  4AYC A;  2WPV B;  2B87 B;  1L0L J;  5AW4 B;  4D6T E;  1LTI C;  1KV4 A;  3H1J G;  1SQQ J;  3JC2 2;  3OW2 O;  2OTJ P;  3G71 P;  1VL2 A;  3BAT A;  1BSH A;  1CI6 B;  3FXE A;  1ZRT E;  3BCC D;  3USS A;  1VQO P;  5AW8 B;  1GL2 B;  1FZC A;  1N7L A;  1OZH A;  3RGU A;  1YQ3 C;  1BCC G;  4U3F G;  2Q5U A;  3ITK A;  2IDB A;  4GDO A;  2A06 D;  1L4A D;  1YJN P;  1DD4 A;  2FFD A;  1JY3 N;  1SQQ K;  1ZLL A;  2LXB A;  4HKZ H;  2KIK A;  3CX5 I;  3Q5P A;  2LXC B;  1R8E A;  1JY3 O;  1HJ0 A;  3L70 E;  3OJA B;  3HE5 B;  4HB1 A;  3WUU A;  2WZ7 A;  1JY2 P;  3L72 J;  1M1J A;  1H0T A;  4YPC A;  1Y47 A;  3U1C A;  1BE3 D;  2MKV A;  2QVA A;  1SQX G;  3WMM 0;  3G9R A;  2N9Y B;  3P32 A;  3TNU B;  2E76 D;  1IC2 A;  3RK2 C;  1PP9 E;  2Q6Q A;  2Y9Y A;  3L73 D;  3SWY A;  2E42 A;  3TGU E;  1NTM D;  3H1L E;  3H1H J;  3HUS B;  2C0W A;  2HFE D;  2NPS D;  1PL5 A;  1U7M A;  2PRR A;  2KB7 P;  4RES B;  2IBZ I;  3ABV C;  2KYV A;  1EC5 A;  5APW A;  1LWU B;  3L75 D;  1GD2 E;  3L73 J;  3I56 P;  3O6Q A;  2GM4 A;  3GHG A;  1KZU B;  2IBZ G;  1VQ7 P;  3CD6 P;  1NH4 A;  1GL2 C;  3H1K J;  4Z1M H;  3A5T A;  2ZXX A;  2E5T A;  3BCC E;  4N6J A;  4JQ0 D;  4IFD K;  2JJL A;  1LTS C;  2ZYD A;  5CMZ A;  2POH A;  2Y0C A;  1OVU A;  3MTU E;  1K8A Q;  3TF5 A;  4LGD E;  1X22 A;  4WVZ A;  1W5C E;  1GW3 A;  1GU4 A;  1NKN A;  3L75 J;  3VYI A;  2YXQ B;  4WY4 D;  4IFM A;  1X79 B;  1ZME C;  1JMB A;  1S3J A;  3H25 A;  1LP1 A;  2OYO A;  1S72 P;  4OH8 B;  1HGV A;  1KB9 D;  2WPR A;  4WWI A;  4QMA A;  1BE3 E;  1BGY J;  1K73 Q; 
#chains in the Genus database with same CATH homology
 3M06 A;  3VMX A;  2A45 H;  1LTT C;  1J1E B;  5KLV K;  2H8P D;  2HPC B;  4WBA A;  3HUS C;  2NPS B;  3CLQ A;  3TYY A;  1FZF A;  1RF0 C;  2XZR A;  3HD7 A;  1T3U A;  1N73 A;  1N7S B;  1L0N K;  1SQP K;  1SFC D;  2Q9I A;  2C9N Y;  1IK9 A;  3A3Y B;  1G2C A;  1GL2 D;  1IFI A;  1JTH B;  1DEB A;  5AW3 B;  5AVS B;  2CPB A;  3P8C D;  1RE4 C;  4AUW A;  3HRN A;  1FAV A;  3RL0 C;  1W2E A;  4LC1 A;  3B5N B;  4O9B A;  2VRS A;  5CCG C;  1Z56 A;  2A45 G;  1LWU C;  3LID A;  1GK6 A;  1JCC A;  3NTN A;  1HWT C;  1LT9 B;  1URQ B;  2OYH A;  2WSF H;  3PP5 A;  3M9H A;  1H89 A;  2W6A A;  4ZKP A;  2QM8 A;  1RE3 C;  3NMD A;  2WSE H;  5AW5 B;  1SQX K;  3HD7 C;  1A02 F;  2C9L Y;  2HOD A;  1JY2 N;  2L5G B;  2OAR A;  4JYC A;  1NWQ A;  1FDM A;  3L37 A;  1L4A C;  3HE4 A;  1JY2 O;  2E43 A;  2M8R A;  2FYU K;  5AW7 B;  4GIF A;  1JNM A;  1ZR2 A;  5APS A;  5AVW B;  3HE5 A;  1JUN A;  3M9Q A;  3LIE A;  4HYT B;  2CPS A;  1GTW A;  4WY4 B;  2P2U A;  2N1T D;  1GW4 A;  1GU5 A;  3B8E B;  1QL2 A;  2IPP A;  2P1J A;  1T2K D;  2OYI B;  3KPE A;  1HVV A;  3RK3 B;  5AVT B;  3II6 A;  3H6P A;  2KP8 A;  5AVZ B;  1N7S A;  1YYC A;  2YMY A;  1AQ5 A;  1M1J B;  2H43 A;  1H8A A;  1MV8 A;  1JO5 A;  3M0A A;  1MFZ A;  1XTG B;  4AQR D;  3M9B A;  4I1L A;  5APT A;  3RK2 D;  3UIA A;  1RF1 B;  1NO4 A;  3NFQ A;  5KJ7 D;  3RL0 D;  1KIL C;  2W27 A;  1URQ A;  1J1E C;  4ZKU A;  4KHX A;  1QL1 A;  2Q3I A;  2XU6 A;  1RF0 A;  4N78 D;  2MJZ A;  2O01 H;  2NPS C;  2HLO A;  4C7R A;  1CW5 A;  4LLH A;  3N7N A;  4Y99 B;  1NHL A;  1RE4 A;  1IJD B;  1SFC B;  1N7S C;  3M91 A;  1LTB C;  1NTM K;  5CCG A;  1DX7 A;  1HH0 A;  2BAS A;  3NXS A;  1XTC C;  3MGN A;  3HD7 D;  1IFD A;  4I2L C;  1IFJ A;  4C7N B;  3B5N C;  1IO4 A;  3KDP B;  4W7Z A;  3P7K A;  2WT7 B;  2WSC H;  3A7O A;  3G3Z A;  3U1A A;  1L0L K;  3P8C E;  2P7J A;  1SVF A;  1LT9 C;  1HGZ A;  1RE3 A;  1URQ C;  3M0D C;  3VMY A;  1NOH A;  2IFM A;  3L35 A;  4WB4 A;  2OYI A;  2IX7 C;  3GHG B;  3P8M C;  1IFM A;  1L4A A;  1H88 A;  2GUV A;  3BRV B;  1M7L A;  1J1D B;  1HTL C;  1KQL A;  4C46 A;  3BVH A;  5APQ A;  1T8Z A;  3LW5 H;  1A02 J;  3CI9 A;  4GKG A;  3H32 A;  2R32 A;  4W80 A;  2YO2 A;  5APY A;  3T97 A;  1HBW A;  5CCH A;  3O8Z A;  2R5D A;  3V2R A;  1FOS E;  1CZQ A;  2FFD C;  2I1K A;  5BU5 A;  2PP6 A;  4WY4 C;  1ZR4 A;  2KSJ A;  2ZXE B;  2YO3 A;  1KIL D;  2P67 A;  4XA4 A;  2OYI C;  3RK3 C;  1FZC B;  2YKP A;  3HTK B;  4DOJ A;  5AW9 B;  1M1J C;  2JEE A;  1LGH B;  2HYN A;  1N7S D;  1OWA A;  1KIL A;  4C7N A;  2FFD B;  4HH2 A;  1X8Y A;  2WT7 A;  2HPC A;  1FZE A;  1VDF A;  5CCH C;  1RF1 C;  2Z4E A;  2NPS A;  1E5W A;  4I6M C;  3B5N D;  1NTZ K;  1ZV8 A;  5CJ0 A;  5CHX A;  1PFI A;  5BVZ A;  1G1J A;  3VP9 A;  3VN0 A;  3EQ2 A;  1URQ D;  3V2Q A;  1JTH A;  3I5C A;  5AVY B;  1DH3 A;  4Y99 C;  1JY3 P;  1OXZ A;  3MUD A;  1GK4 A;  1YTZ I;  4N78 E;  1SFC C;  2Q7C A;  5AVU B;  2XNX A;  1CSB A;  3B5N A;  1FJK A;  4DZO A;  2XKM A;  4AYC A;  1N73 B;  3TSI A;  1G2C B;  3VP8 A;  1LTJ B;  2YKQ A;  5AW4 B;  1LTI C;  3V4W A;  5CCG D;  1LT9 A;  2KLV A;  2M3B A;  3EFG A;  1MZ9 A;  5AVV B;  3M0D A;  2IFN A;  3MIW A;  3BAT A;  1CI6 B;  1RY3 A;  2YKO A;  2R3C A;  1MUU A;  1S9K D;  1JOC A;  2W6B A;  3BRT B;  5CJ4 A;  5AW8 B;  1GL2 B;  2OYH B;  3GHG C;  1FZC A;  3L36 A;  1N7L A;  5AVR B;  5AVX B;  3U59 A;  2Q5U A;  1J1D C;  2WPS A;  1FOS F;  4EOT A;  1L4A D;  2WWW A;  2HOD B;  4EIJ A;  2FFD A;  1JY3 N;  1SQQ K;  1ZLL A;  4WY4 A;  3IR9 A;  3HE4 B;  1LTA C;  3L4F A;  3A2A A;  1JY3 O;  2Z5I A;  4IFF A;  1ZN5 A;  3OJA B;  3HE5 B;  5CCH D;  5AW1 B;  2R5B A;  2WZ7 A;  1T2K C;  5BU8 B;  1JY2 P;  1M1J A;  2WTY A;  1FZC C;  2XV5 A;  3U1C A;  1FZA A;  1FZB A;  1GZL A;  1FU1 A;  3WMM 0;  1VPC A;  2A45 I;  4B86 A;  3P32 A;  3TNU B;  5APX A;  1RF1 A;  1IC2 A;  1LTJ A;  3RK2 C;  3SWF A;  1IFN A;  3SWY A;  2N1T B;  3OAK A;  5KJ7 C;  1YTZ T;  1X9V A;  1CI6 A;  1SQB K;  1T3J A;  4JYB A;  2E42 A;  5AVQ B;  2YNY A;  3V2P A;  1EQ7 A;  5AW0 B;  3VTP C;  3HUS B;  1JMM A;  2C0W A;  3KYQ A;  2HFE D;  1SP4 A;  1SFC A;  2NPS D;  1GL2 A;  1N2D C;  1N86 A;  2N9B A;  1NU1 K;  4N3Y B;  2KB7 P;  3RK2 B;  2KOG A;  2I1J A;  2LKM A;  2FKW B;  2H7H A;  4RES B;  1N73 C;  5AW6 B;  2O1K A;  1NAF A;  3RL0 B;  3C9I A;  2KYV A;  1LTJ C;  1JCD A;  2HG5 D;  5AW2 B;  3E1I A;  5APW A;  1LWU B;  1GD2 E;  3VOP A;  2GM4 A;  2XDJ A;  3GHG A;  1KZU B;  4JF7 A;  3OA7 A;  2J59 M;  1HJB A;  3V4Q A;  2FXM A;  1AFO A;  3VMZ A;  1NH4 A;  1GL2 C;  2OYH C;  1WRG A;  3A5T A;  3HD7 B;  1S9K E;  3CL3 D;  4N6J A;  1GDT A;  2WPQ A;  4IFD K;  3V5B A;  4M3L A;  1L4A B;  2JJL A;  2WIT A;  1LTS C;  3TNU A;  1FBM A;  1HUC A;  5CMZ A;  2POH A;  2QM7 A;  3MTU E;  2GUS A;  1G1I A;  1KFM A;  4LGD E;  1LTG C;  4XE5 B;  3KQG A;  1GW3 A;  5KTB A;  2N1T A;  1GU4 A;  1NKN A;  3H32 B;  2PAJ A;  3VYI A;  2J58 A;  1SLQ A;  2Z5H A;  3BAS A;  4WY4 D;  4IFM A;  2O1J A;  3HUS A;  1X79 B;  1KFN A;  1NTK K;  3HTK A;  3R2P A;  5APV A;  3V2N A;  1WT6 A;  2C0X A;  3MD0 A;  3RK3 D;  4OH8 B;  1HGV A;  3TK1 A;  5APU A;  2WPR A;  1FZG A;  1NKZ B;  1SQV K;  1J2J B;  5KJ7 A;  4GT1 A;  1FJP A;  2ZFC A;  1LWU A;  3IFM A;  4W7Y A;  3N4X A;  2N1T C;  1KIL B;  2FYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...