3HTKA

Crystal structure of mms21 and smc5 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
60
structure length
60
Chain Sequence
KPFANTKKTLENQVEELTEKCSLKTDEFLKAKEKINEIFEKLNTIRDEVIKKKNQNEYYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional insights into the roles of the Mms21 subunit of the Smc5/6 complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Recombination/replication/ligase
molecule keywords Structural maintenance of chromosomes protein 5
total genus 28
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2009-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3htkA00
1FOSE 2P2UA 3A7OA 5AVXB 5AW8B 2H7HA 1GK4A 1HBWA 1OWAA 5AW2B 3P32A 4M3LA 1X8YA 3VMZA 4C7NB 2W6AA 2P67A 3O8ZA 1J2JB 4DZOA 2XU6A 4B86A 5AVZB 2WTYA 5AVRB 1GZLA 5AW4B 5AW6B 1GK6A 5AVVB 3M91A 1A02J 1NWQA 1KQLA 3TNUA 3VTPC 1H88A 3HE4A 1H8AA 3M0DA 2ZXEB 3A3YB 3V5BA 2WT7B 3V4QA 2Z5HA 1FAVA 3HE5B 5AW5B 4GT1A 2Q3IA 1JUNA 3KDPB 4GKGA 5AW9B 1NAFA 5AVQB 1SP4A 2WWWA 3NTNA 3HE5A 4JYBA 2JJLA 5APYA 4I6MC 2Q7CA 2C9LY 1MUUA 2ZFCA 5APXA 3P8MC 3VYIA 2QM7A 5APUA 3NMDA 3UIAA 1MFZA 1T2KC 1G2CB 4HYTB 1IO4A 3NFQA 2YO2A 1HJBA 3TK1A 1YYCA 2R3CA 2WPRA 3L35A 5APSA 1S9KE 2VRSA 2IPPA 2YO3A 3M0AA 1MV8A 2BASA 5AW1B 2Q5UA 1H89A 3M9HA 5APWA 5AW0B 5APQA 4AQRD 2YNYA 1CSBA 5AW3B 5AVUB 5AVWB 1SLQA 5APTA 2C9NY 3I5CA 3VMXA 2N9BA 3TNUB 5AVSB 2R32A 3HE4B 3A2AA 3HTKA 2R5DA 3VN0A 3NXSA 1GU4A 2R5BA 5AVTB 2WT7A 1FOSF 3P7KA 1GTWA 1T2KD 2WPQA 2P7JA 3L36A 3LIDA 2KP8A 2W27A 5AVYB 5AW7B 1GU5A 2Z5IA 3MD0A 3SWFA 2WPSA 3L37A 1HWTC 5CMZA 1A02F 1JNMA 4LC1A 1HUCA 1CZQA 1GD2E 2XV5A 4JYCA 2QM8A 3V4WA 3M9BA 4AUWA 4EOTA 3T97A 3LIEA 4KHXA 2E43A 3VMYA 1OXZA 3A5TA 3M06A 1CI6A 3IR9A 3OAKA 3MGNA 4C46A 2E42A 3KQGA 3TYYA 1S9KD 4I2LC 4AYCA 3B8EB 4RESB 4C7NA 5APVA 1CI6B 4XE5B 1DH3A 2XZRA
chains in the Genus database with same CATH superfamily
1N8RQ 1FOSE 3A7OA 4TT3H 2H7HA 2OGUA 1HBWA 3VMZA 3P32A 1S2EA 2HPCA 2YIUB 1UIXA 2OQQA 3QH9A 5GTIH 1JB0J 2K37A 2P67A 3O8ZA 1N7SD 1NGMB 2OYIA 1JCCA 1GMJA 1K04A 4TLFA 5AVZB 4D6TE 1LP1A 5AVRB 3CC7P 1GZLA 3AECC 5KJ7C 4H13C 2CPBA 5AW4B 2ZXXA 3AE9C 5DJUB 5CJ0A 1SQXG 5AW6B 3M91A 3K5BA 3FXDA 1N73B 1NTME 1IFJA 2E74B 4OH8B 5L8RJ 3BVHA 1P84I 2FKWB 3CD6P 1H8AA 3M0DA 2JEEA 2NPSD 2ZXEB 1L2PA 3A3YB 4EDFA 1M1JA 2ZVNB 1MFTA 1YIJP 1L0LG 1N7SC 1BSNA 1USEA 1NAYA 1J1DC 2D2CD 1GW3A 5GTHE 5KLVE 2Z5HA 1FAVA 3H1HJ 4U3FD 1FBMA 1RHZB 2B9BA 2FYUJ 1NHLA 1NTKE 2D2CB 2WPVB 3CX5I 4WBAA 5KAIE 1K9MQ 1VQMP 1SQPG 3EFFK 1PZQA 4H44B 1NTMD 2K9JA 1QEXA 1NTZK 1N86A 2WVRA 1RF1C 5CCGA 3L74E 2CPSA 2HG5D 1RE3A 4WY4C 1Q7YQ 3R4YA 4I6MC 1J1DB 3KXDA 4QMAA 1WMKA 2XKMA 1Y9BA 3L72J 1VQ9P 2OYOA 2KLVA 3D70A 1YTZI 2QM7A 1AA0A 3B5NA 4ZMDA 2FYUE 1X0TA 1JTHB 3I55P 2IZ1A 1S72P 4RJTA 1DX7A 3ZDMA 1K73Q 3AE6C 2KI7B 2RKLA 1NTMK 4IFFA 1ZV8A 4JQ0D 4OWFA 3RL0D 1IO4A 1ZR2A 1KILC 1Q81Q 4YXDC 2V7QJ 1N2DC 2Q9IA 1FDMA 3H6PA 1HJBA 4PV1D 3TK1A 3G71P 1YYCA 1LWUA 1Z56A 2FYNB 5TJHA 3RK2D 5H2FE 3ITKA 1ZP0C 1SQVJ 2YO3A 2BASA 4N3YB 4PV1B 2WMMA 1NTKK 2FYUD 3M9HA 3GHGB 3CCLP 5APQA 1M8OB 2WSEH 2P1JA 1PPJE 3PP5A 4GIFA 5AVUB 2J58A 2O01J 3RK3D 1SLQA 3W67A 1WRGA 1AV1A 2R3SA 5APTA 3C1LA 4YTPC 2C9NY 3TNUB 1SQPD 3H32B 3HE4B 3JCUH 1Q2NA 3A2AA 3HTKA 3L74D 1VQKP 3CWBJ 4N78D 5B66H 3HD7A 4OGQD 1JY2P 1KQFB 1RQVA 5E79H 5AVTB 1LT9A 2V7QH 3B71A 3P7KA 2WT7A 1T2KD 3L36A 1RQUA 2W27A 3H1IG 5AVYB 2BCCE 1SQXJ 1SFCA 4O9BA 3L37A 1T3UA 1S1CX 1Q90D 2KOGA 2PFXA 1FDOA 3V2PA 1W5CE 1JOCA 3GMAA 3AEFC 3V6IA 2JO1A 3PLNA 1LGHB 2O01H 2L5GB 3BCCE 3CXHI 2JWDA 3AE4C 3L74J 4LC1A 1CZQA 1HUCA 1EQ7A 2XV5A 1Q82Q 1EDIA 3WUUA 1L0NG 1MZ9A 3IFMA 1S3JA 3CWBE 2KLUA 1JEKA 1KMIZ 3H1HG 1G2CA 2NRGA 4KHXA 2E43A 3H1LG 1XTCC 3C9IA 4R4MA 4UB6E 4W80A 2O1KA 2KK7A 1FJPA 1JO5A 1FZCA 2FYZA 2KSEA 4BWNA 5GTIE 3AEBC 5KLVK 1L4AB 4L74A 2YKQA 1LTJA 4HJGH 1EXIA 3B8EB 2ZT9B 3TSIA 5KLIB 1SQQK 3RK2C 4EIJA 3AE1C 1L4AD 1DEEG 5APVA 1DH3A 1KILE 4EI2A 1R5LA 2HPCB 2B89A 1JY3P 3GG2A 2XNDH 1EZVG 4ASVA 1ZLLA 4L76A 4C7NB 1LP1B 2JR8A 3H1LE 1IFNA 3HUSA 3MZWB 1NU1E 2W6AA 1SVFA 2Y0DA 2K3RA 4U7JA 2GM4A 1QVGO 1H0TA 4B86A 2N1TB 3AEAC 4K3AA 1N73A 3H1KJ 3RL0B 1FZCC 3CC2P 1M56D 2K88A 3L73G 5KLVJ 1PFIA 1L4AC 1SQQE 1GK6A 3CX5H 5AVVB 1VQ4P 1OMIA 2I1JA 3P8CE 4DJGA 1P84E 3AE8C 3GF3A 1A02J 1IJDB 1BGYD 4DOJA 2OARA 4YXWH 1VQ8P 1LT1A 1AQTA 2WSCJ 5KKZB 2YKPA 3H1HD 1HVVA 1JY3O 1M57D 2M5AB 1JY2O 3H1LJ 3V4QA 5CCGD 3TGUE 3BCCG 3AEEC 1NOHA 2W6BA 3CC4P 1JUNA 1SQBJ 1FS0E 2P58A 2KB7P 2HODA 3II6A 5AW9B 1BE3D 3CXHE 4W7YA 1SQBK 1L0LD 1Y47A 3NTNA 1LTIC 4N6JA 4JPZB 1U57A 2LR2A 4BRYA 1PIXA 2YMKA 1OW6A 2OYHB 2W90A 2SPZA 3A0HH 5KLVG 1NTZJ 1KB9D 4PD4E 3SFDC 5KAFE 2QA4P 1JMMA 2Y9ZA 1JTHA 2C9LY 1MUUA 1IFDA 1GL2B 1YQ3C 1VDFA 2WSCH 3H1JD 1YQ4C 3NMDA 1GL2D 3RBXA 3T97B 1BCCJ 5BU8B 1SQVK 2H89C 2WSSH 1T2KC 1KB9H 1LTJC 1LWUB 1KQGB 3GLMA 4HYTB 2KS1A 1SQBD 3L73J 3CLQA 2IFMA 2K1AA 3OA7A 4U3FJ 3TF5A 3FXEA 1AVYA 3MUDA 2P10A 1DD4A 4NPFX 2QJPC 1NTMJ 2WPRA 5APSA 1S9KE 2PP6A 4WB4A 4H0LC 2IPPA 1MV8A 5AW1B 3R2PA 3SSUA 3MUDC 1RE4A 1KQSO 1KILA 2A06G 2HR3A 2LKMA 3H32A 4JBZA 4CPGA 1DEBA 4UB6H 2YMYA 2FYNC 3L70G 1M7LA 1KYOD 4RKUJ 2PGDA 2QIWA 2V4HA 1R5SA 1VQOP 3I5CA 5CHXA 1BDCA 2N9BA 3V2QA 1SFCD 3L73D 2R5DA 3CL3D 3VN0A 2FFDC 1BDDA 3H1ID 1FC2C 4XA4A 1NJIQ 2QVAA 1GTWA 3RGUA 3BRVB 5CCGC 3LIDA 4MN4C 1NTKD 2FYUK 2KP8A 1Q86Q 2Z5IA 4WWIA 2XDJA 5KLVD 2A06E 2A06D 2WPSA 2NPSB 3EWKA 4WY4B 3HD7C 2KNCA 2QJKB 2IX7C 1OZHA 2FFDA 3H1KG 1LTSC 1TU3F 2BCCG 2KZIA 4ZKUA 5TISE 4H0LD 3VOPA 4XFJA 2FYUG 1GD2E 1SQPJ 3Q5RA 4H0LB 3E1RA 3L75G 4GDOA 2BEQD 1SQBG 1J1EB 1RE4C 4EOTA 2E76B 3L71J 1RY3A 4D6TD 3LIEA 1FZCB 1AQ5A 3BCCJ 1U7JA 1L4AA 2FBWC 3IAOA 2UWJE 1LWUC 2I8DA 4BXLA 4IFMA 1FJKA 1L0ND 4A7PA 1KTMA 1AFOA 3A0BH 3AE2C 3KYQA 1YJNP 2NZ2A 1ZRTD 1PP9G 4ASWA 3JSVC 3MGNA 2QJYC 4Y99C 3H1JG 1M90Q 1VQ5P 1S9KD 2AXTH 3B5NB 3HUSC 1NTZG 3L4FA 3Q3DA 2W83C 2ZAEB 1S5LE 2GUVA 1EZVI 5KJ7D 4XE5B 3SWKA 4C7NA 2XZRA 1SQBE 2FXMA 2E74D 1NTKJ 1DD3A 2KIKA 5AW8B 1SS1A 1GK4A 1OIPA 2N1TA 3CMAP 1FZAA 1OWAA 2BCCJ 2C0WA 2W6JH 3L74G 2B87B 2H8PD 5AW2B 3L72D 1W2BO 2QSIA 1L0LK 1AJYA 4I7ZC 1EXJA 1X79B 2E75C 1J2JB 1SQVG 2OTLP 2XU6A 1EZVE 3L70D 4U3FG 1BCCE 2OTJP 1KB9E 1KD1Q 1BGYG 3RK3B 1NU1G 4HB1A 3V2RA 4EYYQ 3CX5D 1HH0A 1SQXK 2J59M 3H1KD 3G6EP 1KORA 4ZKPA 2K9YA 5B66E 1BSHA 1KQLA 3TNUA 3VTPC 2LXBA 1OW8A 3HE4A 1H88A 1M1JC 2QG4A 3Q5PA 1PGOA 1EDLA 3AEDC 4R4LA 2DW3A 3HD7B 2E75D 2ZYDA 1LT9B 2PAJA 1N7SB 3L72G 5C39A 2WT7B 3FGAD 3RBZA 2Q3IA 2E75B 2YKOA 3H1HE 2YXRB 3KDPB 1OFCX 3L75E 1NAFA 2E74C 1EC5A 1BGYE 3L71E 5AVQB 3S4RA 3HE5A 5BVZA 4JYBA 1N73C 1GL2A 4IL6X 2O01N 5APYA 3KHUA 4PJ0E 1LT9C 3D6YA 3L70E 1FZBA 2IFNA 1PV3A 2M8RA 4WVZA 1PP9E 1ZXGA 2ZFCA 2KS1B 1BE3G 3EQ2A 4Y99B 3GHGC 1NTZE 1HGVA 1LTAC 3W68A 4I1LA 1SQXE 1KYOH 3V2NA 1YI2P 1G2CB 2AEJA 2IBZE 3TDKA 2RMZA 2WITA 2IZ0A 3M9QA 1KILD 1T3JA 1ZN5A 1LTTC 2M3EA 3PHLA 1HTLC 1KFMA 3L75J 3RL0C 1KN7A 5B5EE 2E76D 3L35A 2O1JA 2AEFA 4I7ZB 1LTJB 2IBZD 2QJYB 1ZRTE 3M0AA 3FWNA 1SQQG 3L70J 1SQXD 2Q5UA 4UB8E 3F5HA 1FDIA 4IOIH 2QEXP 1NTZD 1L0NE 1H89A 1PGJA 2RN0A 1IK9A 5AW0B 1FZGA 1Y8AA 2IYPA 2WQYC 5AW3B 3IN6A 3CCUP 1GDTA 1PL5A 3VP8A 1NTKG 2Q1KA 3CCQP 4DCKA 2BEZF 3H1IJ 3VMXA 2E76C 3B4SA 2POHA 2R32A 3B5NC 4L75A 1E79H 2J5UA 5AVSB 1H0TB 2MJZA 3C8VA 3A0HE 1FU1A 1M1JB 3NXSA 2QE7H 1NKZB 3BCCD 5TISH 1P84H 1U7MA 2Y0EA 3EFGA 1SFCC 3CPWO 1L0NK 1FOSF 3G3ZA 1RE3C 2WPQA 2P7JA 4WY4A 1FZEA 5KTBA 3H25A 3AE7C 1RH5B 2D2CC 3MP7B 3CCJP 1KYOI 1ZMEC 2L91A 3RK3C 1K8AQ 3PJSK 1J1EC 2K9JB 4PD4I 5CMZA 4YPCA 1USDA 1A02F 3O6QA 2KUBA 2ITAA 3IF4A 3U59A 2WSEJ 4ZNCA 1JNMA 2HFED 1SQQJ 4GOEA 3CXHH 3VP9A 3QWOC 3FWLA 1WT6A 4OGQB 4N78E 3H1KE 1ZR4A 1SQVD 2B88A 2KZJA 2QM8A 2QJKC 2E5YA 1URQB 3L73E 3M9BA 4IL6E 1HJ0A 2QJPB 2CK3H 3WMM0 1E5WA 1IFMA 5KAFH 1EZVD 1URQD 3ABVC 1RF0C 4K35A 2W8ZA 3RK3E 1QL2A 5CCHD 1PPJD 4NPDA 3VMYA 1BCCG 2IBZI 4LGDE 5CJ4A 5KJ7A 2Q6QA 1NH4A 1JMBA 1IFIA 3BASA 1YJWP 3IR9A 3OAKA 2N1TD 4C46A 5KAIH 2RH0A 2Z4EA 1VF5B 3KZIE 3TGUG 4I2LC 1BE3J 1T6AA 3WU2E 3CI9A 3RK2B 3OJAB 4AYCA 1L0NJ 2I1KA 2WZ7A 1BGYJ 1LTBC 1VF5D 5KLIC 1CI6B 2B87A 1QVFO 2E5TA 3CMEP 4AQRD 2P2UA 1KFNA 2ZYAA 3N7NA 5AVXB 4M3LA 1NVOA 1X8YA 2O3JA 3H1JE 3A0BE 3GF7A 1NTMG 3MIWA 4KT0J 5GTHH 3FX0A 1G1JA 2N9YB 4KJMA 2JDIH 1RF1A 5DJTB 3S1KA 4DZOA 1OVRA 2AXTE 1PGQA 2M3BA 3SFEC 2NPSC 2WTYA 2G8YA 3PH0A 1PP9J 1VF5C 2G3AA 1OVUA 1QX8A 1SQVE 2IDBA 1RF0A 3RL0g 2H43A 1R8EA 5E79E 1L0LE 4GOFA 1NWQA 3Q2YA 4H13D 1BE3E 1N7SA 1ZW0A 3CXHD 1NKNA 1OW7A 2KYVA 4NPEA 1YTZT 2YXQB 3MHVA 2XNXA 3E1IA 2FXPA 3M0DC 1VQLP 2C0XA 4H13B 4U3FE 3V5BA 1KB9I 1SQPK 2IBZG 1LJ2A 1VQPP 1HF9A 2A45H 1VL2A 1W2EA 3HE5B 1JY2N 1QGKB 4GT1A 5AW5B 2FXOA 1PGPA 1VQ7P 2R44A 2HYNA 4GODA 4OGQC 4GKGA 4Z1MH 3CCSP 2A45G 2NPSA 1SP4A 2WWWA 4Y28J 1D7MA 2JP3A 2KNCB 2JJLA 3H1IE 3P8CD 2FFDB 2OYIC 3AE3C 3PTZA 2Y0CA 2KSJA 3D6ZA 2OTKE 3BATA 4IFDK 2Q7CA 1MKMA 3OW2O 1KYOE 1VPCA 3I56P 1YITP 2AEMA 5APXA 1NU1D 4W7ZA 3P8MC 2AXCA 3VYIA 3H1LD 5APUA 3G9RA 3UIAA 2JWAA 3WUVA 3AE5C 4D6TJ 2ZYGA 2PRRA 1MFZA 3LW5J 1XTGB 2ZT9D 3BRTB 4PV1C 1IK7A 3NFQA 3USSA 3KPEA 3CWBG 1PPJG 2MKVA 2YO2A 1NO4A 2R3CA 1S5LH 3SWYA 3B5ND 3HUSB 3E7KA 4IL6H 2VRSA 2IYOA 3MTUE 1LTGC 2LXCB 1FZFA 1YJ9P 5APWA 5B5EH 2Q3EA 5CCHC 1LNQA 1S4XA 2KXPB 2YNYA 5H2FH 1CSBA 1KC8Q 1PP9D 2JKVA 3S9OA 3U1AA 5EFWB 5AVWB 4WY4D 1L0LJ 4C7RA 3CCVP 1QLED 1KV4A 3CWBD 4HKZH 2HLOA 2A45I 2GUSA 3GHGA 4PD4D 1URQC 3F89A 1YBKA 2M0BA 3LW5H 1FE6A 4RO0A 3CCMP 2OYHC 1VQ6P 1X22A 4H44D 3Q5SA 4JF7A 5M1BA 5KKZC 4D6TG 1IFPA 2M5AA 2R5BA 3PRJA 4H44C 4UB8H 1GU4A 3L71D 1UIIA 1NU1J 3HTKB 3L75D 1AVOA 3O6QB 1GU5A 1DIPA 1GL2C 5AW7B 2QRXA 4DT0A 3CCEP 4L73A 2HODB 3MD0A 3SWFA 3TGUD 1CW5A 1G1IA 5K5GB 3VMAA 1HWTC 1K05A 4OVNF 4BRYB 3Q1MA 1GW4A 3HD7D 2BCCD 2ZJSE 1JM0A 2OYHA 2FY8A 3AEGC 1YHQP 1EDJA 1URQA 1S5LX 1IZNB 1NU1K 1SFCB 5CCHA 2WSFJ 2H88C 3JC22 1P84D 3GW6A 1T8ZA 2ZVOB 5CBNA 3L71G 4LLHA 1X9VA 3CX5E 4JYCA 1SQQD 3V4WA 5BU5A 1JCDA 3WU2H 1IC2A 1KZUB 1JY3N 1SQPE 4PD4H 1BCCD 4PJ0H 3T97A 4AUWA 1ZOYC 1N7LA 3H1JJ 3U1CA 2ZT9C 1NYHA 3G4SP 1OX3A 2OYIB 1HGZA 3L72E 3TGUJ 1OXZA 3N4XA 2YIUC 3A5TA 1QL1A 3M06A 1M1KQ 1OVVA 3WUTA 1CI6A 2E42A 3CCRP 3JCUE 3KQGA 3TYYA 1VQNP 1EDKA 4RESB 3HRNA 2N1TC 5CBOA 2WSFH 2Y9YA 1KILB 2GA1A 3KZIH 4HH2A 3D71A 1RF1B
chains in the Genus database with same CATH topology
1FOSE 3A7OA 2H7HA 3VMZA 3P32A 2HPCA 2P67A 3O8ZA 1N7SD 2OYIA 1JCCA 5AVZB 5AVRB 1GZLA 5KJ7C 5AW4B 2CPBA 5AW6B 5CJ0A 3M91A 1N73B 1IFJA 4OH8B 2FKWB 1H8AA 3M0DA 2JEEA 2NPSD 2ZXEB 3A3YB 1M1JA 1N7SC 3BVHA 1J1DC 1GW3A 2Z5HA 1FAVA 1FBMA 4WBAA 1NHLA 1NTZK 1N86A 1RF1C 5CCGA 2CPSA 2HG5D 1RE3A 4WY4C 4I6MC 1J1DB 2XKMA 2KLVA 1YTZI 2QM7A 3B5NA 1JTHB 4IFFA 1NTMK 1IO4A 1ZV8A 3RL0D 1ZR2A 1KILC 2Q9IA 1N2DC 1FDMA 3H6PA 1HJBA 3TK1A 1YYCA 1LWUA 1Z56A 3RK2D 2YO3A 2BASA 4N3YB 1NTKK 3M9HA 3GHGB 5APQA 2WSEH 2P1JA 4GIFA 3PP5A 5AVUB 2J58A 3RK3D 1SLQA 1WRGA 5APTA 2C9NY 3TNUB 3H32B 3HE4B 3A2AA 3HTKA 4N78D 3HD7A 1JY2P 5AVTB 1LT9A 2WT7A 3P7KA 1T2KD 3L36A 2W27A 5AVYB 1SFCA 4O9BA 3L37A 1T3UA 2KOGA 3V2PA 1JOCA 1LGHB 2O01H 2L5GB 4LC1A 1CZQA 1HUCA 1EQ7A 2XV5A 1MZ9A 3IFMA 1G2CA 4KHXA 2E43A 1XTCC 3C9IA 4W80A 2O1KA 1FJPA 1JO5A 1FZCA 2FYZA 5KLVK 1L4AB 2YKQA 1LTJA 3B8EB 3TSIA 1SQQK 3RK2C 4EIJA 1L4AD 5APVA 1DH3A 2HPCB 1JY3P 1ZLLA 4C7NB 3HUSA 1IFNA 2W6AA 1SVFA 2GM4A 4B86A 2N1TB 1N73A 1FZCC 3RL0B 1PFIA 1L4AC 1GK6A 5AVVB 3P8CE 2I1JA 1A02J 1IJDB 4DOJA 2OARA 2YKPA 1HVVA 1JY3O 1JY2O 3V4QA 5CCGD 1NOHA 2W6BA 1JUNA 3II6A 2KB7P 2HODA 5AW9B 4W7YA 1SQBK 3NTNA 4N6JA 1LTIC 2OYHB 1JMMA 1JTHA 2C9LY 1MUUA 1IFDA 1GL2B 1VDFA 2WSCH 3NMDA 1GL2D 5BU8B 1SQVK 1T2KC 1LTJC 1LWUB 1DX7A 4HYTB 3OA7A 3CLQA 2IFMA 3MUDA 2WPRA 5APSA 1S9KE 2PP6A 4WB4A 2IPPA 1MV8A 5AW1B 3R2PA 1RE4A 1KILA 2LKMA 3H32A 1DEBA 2YMYA 1M7LA 3I5CA 5CHXA 2N9BA 3V2QA 1SFCD 2R5DA 3CL3D 3VN0A 2FFDC 4XA4A 1GTWA 3BRVB 5CCGC 3LIDA 2FYUK 2KP8A 2Z5IA 2XDJA 2WPSA 2NPSB 4WY4B 3HD7C 2IX7C 2FFDA 1LTSC 4ZKUA 3VOPA 1GD2E 1J1EB 1RE4C 4EOTA 1RY3A 3LIEA 1FZCB 1AQ5A 1L4AA 1LWUC 4IFMA 1FJKA 1AFOA 3KYQA 3MGNA 4Y99C 1S9KD 3B5NB 3HUSC 3L4FA 4C7NA 2GUVA 5KJ7D 4XE5B 2XZRA 2FXMA 5AW8B 1GK4A 2N1TA 1HBWA 1FZAA 1OWAA 5AW2B 2C0WA 2H8PD 1L0LK 1X79B 1J2JB 2XU6A 3RK3B 3V2RA 1HH0A 1SQXK 2J59M 4ZKPA 1KQLA 3TNUA 3VTPC 1H88A 3HE4A 1M1JC 3HD7B 1LT9B 2PAJA 1N7SB 2WT7B 2Q3IA 2YKOA 3KDPB 1NAFA 5AVQB 5BVZA 3HE5A 1N73C 4JYBA 1GL2A 5APYA 1LT9C 1FZBA 2IFNA 2M8RA 2ZFCA 4Y99B 3EQ2A 3GHGC 1HGVA 1LTAC 4I1LA 3V2NA 1G2CB 2WITA 3M9QA 1KILD 1T3JA 1ZN5A 1LTTC 3RL0C 1HTLC 1KFMA 3L35A 2O1JA 1LTJB 3M0AA 2OYIB 2Q5UA 1H89A 5AW0B 1FZGA 1IK9A 5AW3B 1GDTA 3VP8A 3VMXA 5CCHC 3B5NC 2POHA 2R32A 5AVSB 2MJZA 1FU1A 1M1JB 3NXSA 1NKZB 3EFGA 1SFCC 1FOSF 1L0NK 3G3ZA 1RE3C 2WPQA 2P7JA 4WY4A 1FZEA 5KTBA 3RK3C 1J1EC 5CMZA 1A02F 3U59A 1JNMA 2HFED 3VP9A 1WT6A 4N78E 1ZR4A 2QM8A 1URQB 3M9BA 3WMM0 1E5WA 1IFMA 1URQD 1RF0C 5CCHD 1QL2A 3VMYA 5CJ4A 5KJ7A 4LGDE 1NH4A 1IFIA 3BASA 3IR9A 3OAKA 2N1TD 4C46A 2Z4EA 4I2LC 4AYCA 3CI9A 3RK2B 3OJAB 2I1KA 2WZ7A 1LTBC 1CI6B 4AQRD 2P2UA 1KFNA 3N7NA 5AVXB 4M3LA 1X8YA 3MIWA 1G1JA 1RF1A 4DZOA 2M3BA 2NPSC 2WTYA 1RF0A 2H43A 1NWQA 1N7SA 1NKNA 2KYVA 1YTZT 2XNXA 3E1IA 3M0DC 2C0XA 3V5BA 1SQPK 2A45H 1W2EA 3HE5B 1JY2N 5AW5B 4GT1A 2HYNA 4GKGA 2A45G 2NPSA 1SP4A 2WWWA 2JJLA 3P8CD 2FFDB 2OYIC 2KSJA 3BATA 4IFDK 2Q7CA 1VPCA 5APXA 4W7ZA 3P8MC 3VYIA 3UIAA 5APUA 1MFZA 1XTGB 3BRTB 3NFQA 3KPEA 2YO2A 1NO4A 2R3CA 3SWYA 3B5ND 3HUSB 2VRSA 3MTUE 1LTGC 1FZFA 5APWA 2YNYA 1CSBA 3U1AA 5AVWB 4WY4D 4C7RA 2HLOA 2A45I 2GUSA 3GHGA 1URQC 3LW5H 2OYHC 4JF7A 1GU4A 2R5BA 3HTKB 1GU5A 1GL2C 5AW7B 2HODB 3MD0A 3SWFA 1CW5A 1G1IA 1HWTC 1GW4A 3HD7D 2OYHA 1URQA 1SFCB 1NU1K 5CCHA 1T8ZA 4LLHA 1X9VA 4JYCA 5BU5A 3V4WA 1JCDA 1IC2A 1KZUB 1JY3N 4AUWA 3T97A 3U1CA 1N7LA 1HGZA 1OXZA 3N4XA 3A5TA 1QL1A 3M06A 1CI6A 2E42A 3KQGA 3TYYA 4RESB 3HRNA 2N1TC 2WSFH 1KILB 4HH2A 1RF1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOS E;  2P2U A;  3A7O A;  5AVX B;  5AW8 B;  2H7H A;  1GK4 A;  1HBW A;  1OWA A;  5AW2 B;  3P32 A;  4M3L A;  1X8Y A;  3VMZ A;  4C7N B;  2W6A A;  2P67 A;  3O8Z A;  1J2J B;  4DZO A;  2XU6 A;  4B86 A;  5AVZ B;  2WTY A;  5AVR B;  1GZL A;  5AW4 B;  5AW6 B;  1GK6 A;  5AVV B;  3M91 A;  1A02 J;  1NWQ A;  1KQL A;  3TNU A;  3VTP C;  1H88 A;  3HE4 A;  1H8A A;  3M0D A;  2ZXE B;  3A3Y B;  3V5B A;  2WT7 B;  3V4Q A;  2Z5H A;  1FAV A;  3HE5 B;  5AW5 B;  4GT1 A;  2Q3I A;  1JUN A;  3KDP B;  4GKG A;  5AW9 B;  1NAF A;  5AVQ B;  1SP4 A;  2WWW A;  3NTN A;  3HE5 A;  4JYB A;  2JJL A;  5APY A;  4I6M C;  2Q7C A;  2C9L Y;  1MUU A;  2ZFC A;  5APX A;  3P8M C;  3VYI A;  2QM7 A;  5APU A;  3NMD A;  3UIA A;  1MFZ A;  1T2K C;  1G2C B;  4HYT B;  1IO4 A;  3NFQ A;  2YO2 A;  1HJB A;  3TK1 A;  1YYC A;  2R3C A;  2WPR A;  3L35 A;  5APS A;  1S9K E;  2VRS A;  2IPP A;  2YO3 A;  3M0A A;  1MV8 A;  2BAS A;  5AW1 B;  2Q5U A;  1H89 A;  3M9H A;  5APW A;  5AW0 B;  5APQ A;  4AQR D;  2YNY A;  1CSB A;  5AW3 B;  5AVU B;  5AVW B;  1SLQ A;  5APT A;  2C9N Y;  3I5C A;  3VMX A;  2N9B A;  3TNU B;  5AVS B;  2R32 A;  3HE4 B;  3A2A A;  3HTK A;  2R5D A;  3VN0 A;  3NXS A;  1GU4 A;  2R5B A;  5AVT B;  2WT7 A;  1FOS F;  3P7K A;  1GTW A;  1T2K D;  2WPQ A;  2P7J A;  3L36 A;  3LID A;  2KP8 A;  2W27 A;  5AVY B;  5AW7 B;  1GU5 A;  2Z5I A;  3MD0 A;  3SWF A;  2WPS A;  3L37 A;  1HWT C;  5CMZ A;  1A02 F;  1JNM A;  4LC1 A;  1HUC A;  1CZQ A;  1GD2 E;  2XV5 A;  4JYC A;  2QM8 A;  3V4W A;  3M9B A;  4AUW A;  4EOT A;  3T97 A;  3LIE A;  4KHX A;  2E43 A;  3VMY A;  1OXZ A;  3A5T A;  3M06 A;  1CI6 A;  3IR9 A;  3OAK A;  3MGN A;  4C46 A;  2E42 A;  3KQG A;  3TYY A;  1S9K D;  4I2L C;  4AYC A;  3B8E B;  4RES B;  4C7N A;  5APV A;  1CI6 B;  4XE5 B;  1DH3 A;  2XZR A; 
#chains in the Genus database with same CATH topology
 1N8R Q;  1FOS E;  3A7O A;  4TT3 H;  2H7H A;  2OGU A;  1HBW A;  3VMZ A;  3P32 A;  1S2E A;  2HPC A;  2YIU B;  1UIX A;  2OQQ A;  3QH9 A;  5GTI H;  1JB0 J;  2K37 A;  2P67 A;  3O8Z A;  1N7S D;  1NGM B;  2OYI A;  1JCC A;  1GMJ A;  1K04 A;  4TLF A;  5AVZ B;  4D6T E;  1LP1 A;  5AVR B;  3CC7 P;  1GZL A;  3AEC C;  5KJ7 C;  4H13 C;  2CPB A;  5AW4 B;  2ZXX A;  3AE9 C;  5DJU B;  5CJ0 A;  1SQX G;  5AW6 B;  3M91 A;  3K5B A;  3FXD A;  1N73 B;  1NTM E;  1IFJ A;  2E74 B;  4OH8 B;  5L8R J;  3BVH A;  1P84 I;  2FKW B;  3CD6 P;  1H8A A;  3M0D A;  2JEE A;  2NPS D;  2ZXE B;  1L2P A;  3A3Y B;  4EDF A;  1M1J A;  2ZVN B;  1MFT A;  1YIJ P;  1L0L G;  1N7S C;  1BSN A;  1USE A;  1NAY A;  1J1D C;  2D2C D;  1GW3 A;  5GTH E;  5KLV E;  2Z5H A;  1FAV A;  3H1H J;  4U3F D;  1FBM A;  1RHZ B;  2B9B A;  2FYU J;  1NHL A;  1NTK E;  2D2C B;  2WPV B;  3CX5 I;  4WBA A;  5KAI E;  1K9M Q;  1VQM P;  1SQP G;  3EFF K;  1PZQ A;  4H44 B;  1NTM D;  2K9J A;  1QEX A;  1NTZ K;  1N86 A;  2WVR A;  1RF1 C;  5CCG A;  3L74 E;  2CPS A;  2HG5 D;  1RE3 A;  4WY4 C;  1Q7Y Q;  3R4Y A;  4I6M C;  1J1D B;  3KXD A;  4QMA A;  1WMK A;  2XKM A;  1Y9B A;  3L72 J;  1VQ9 P;  2OYO A;  2KLV A;  3D70 A;  1YTZ I;  2QM7 A;  1AA0 A;  3B5N A;  4ZMD A;  2FYU E;  1X0T A;  1JTH B;  3I55 P;  2IZ1 A;  1S72 P;  4RJT A;  1DX7 A;  3ZDM A;  1K73 Q;  3AE6 C;  2KI7 B;  2RKL A;  1NTM K;  4IFF A;  1ZV8 A;  4JQ0 D;  4OWF A;  3RL0 D;  1IO4 A;  1ZR2 A;  1KIL C;  1Q81 Q;  4YXD C;  2V7Q J;  1N2D C;  2Q9I A;  1FDM A;  3H6P A;  1HJB A;  4PV1 D;  3TK1 A;  3G71 P;  1YYC A;  1LWU A;  1Z56 A;  2FYN B;  5TJH A;  3RK2 D;  5H2F E;  3ITK A;  1ZP0 C;  1SQV J;  2YO3 A;  2BAS A;  4N3Y B;  4PV1 B;  2WMM A;  1NTK K;  2FYU D;  3M9H A;  3GHG B;  3CCL P;  5APQ A;  1M8O B;  2WSE H;  2P1J A;  1PPJ E;  3PP5 A;  4GIF A;  5AVU B;  2J58 A;  2O01 J;  3RK3 D;  1SLQ A;  3W67 A;  1WRG A;  1AV1 A;  2R3S A;  5APT A;  3C1L A;  4YTP C;  2C9N Y;  3TNU B;  1SQP D;  3H32 B;  3HE4 B;  3JCU H;  1Q2N A;  3A2A A;  3HTK A;  3L74 D;  1VQK P;  3CWB J;  4N78 D;  5B66 H;  3HD7 A;  4OGQ D;  1JY2 P;  1KQF B;  1RQV A;  5E79 H;  5AVT B;  1LT9 A;  2V7Q H;  3B71 A;  3P7K A;  2WT7 A;  1T2K D;  3L36 A;  1RQU A;  2W27 A;  3H1I G;  5AVY B;  2BCC E;  1SQX J;  1SFC A;  4O9B A;  3L37 A;  1T3U A;  1S1C X;  1Q90 D;  2KOG A;  2PFX A;  1FDO A;  3V2P A;  1W5C E;  1JOC A;  3GMA A;  3AEF C;  3V6I A;  2JO1 A;  3PLN A;  1LGH B;  2O01 H;  2L5G B;  3BCC E;  3CXH I;  2JWD A;  3AE4 C;  3L74 J;  4LC1 A;  1CZQ A;  1HUC A;  1EQ7 A;  2XV5 A;  1Q82 Q;  1EDI A;  3WUU A;  1L0N G;  1MZ9 A;  3IFM A;  1S3J A;  3CWB E;  2KLU A;  1JEK A;  1KMI Z;  3H1H G;  1G2C A;  2NRG A;  4KHX A;  2E43 A;  3H1L G;  1XTC C;  3C9I A;  4R4M A;  4UB6 E;  4W80 A;  2O1K A;  2KK7 A;  1FJP A;  1JO5 A;  1FZC A;  2FYZ A;  2KSE A;  4BWN A;  5GTI E;  3AEB C;  5KLV K;  1L4A B;  4L74 A;  2YKQ A;  1LTJ A;  4HJG H;  1EXI A;  3B8E B;  2ZT9 B;  3TSI A;  5KLI B;  1SQQ K;  3RK2 C;  4EIJ A;  3AE1 C;  1L4A D;  1DEE G;  5APV A;  1DH3 A;  1KIL E;  4EI2 A;  1R5L A;  2HPC B;  2B89 A;  1JY3 P;  3GG2 A;  2XND H;  1EZV G;  4ASV A;  1ZLL A;  4L76 A;  4C7N B;  1LP1 B;  2JR8 A;  3H1L E;  1IFN A;  3HUS A;  3MZW B;  1NU1 E;  2W6A A;  1SVF A;  2Y0D A;  2K3R A;  4U7J A;  2GM4 A;  1QVG O;  1H0T A;  4B86 A;  2N1T B;  3AEA C;  4K3A A;  1N73 A;  3H1K J;  3RL0 B;  1FZC C;  3CC2 P;  1M56 D;  2K88 A;  3L73 G;  5KLV J;  1PFI A;  1L4A C;  1SQQ E;  1GK6 A;  3CX5 H;  5AVV B;  1VQ4 P;  1OMI A;  2I1J A;  3P8C E;  4DJG A;  1P84 E;  3AE8 C;  3GF3 A;  1A02 J;  1IJD B;  1BGY D;  4DOJ A;  2OAR A;  4YXW H;  1VQ8 P;  1LT1 A;  1AQT A;  2WSC J;  5KKZ B;  2YKP A;  3H1H D;  1HVV A;  1JY3 O;  1M57 D;  2M5A B;  1JY2 O;  3H1L J;  3V4Q A;  5CCG D;  3TGU E;  3BCC G;  3AEE C;  1NOH A;  2W6B A;  3CC4 P;  1JUN A;  1SQB J;  1FS0 E;  2P58 A;  2KB7 P;  2HOD A;  3II6 A;  5AW9 B;  1BE3 D;  3CXH E;  4W7Y A;  1SQB K;  1L0L D;  1Y47 A;  3NTN A;  1LTI C;  4N6J A;  4JPZ B;  1U57 A;  2LR2 A;  4BRY A;  1PIX A;  2YMK A;  1OW6 A;  2OYH B;  2W90 A;  2SPZ A;  3A0H H;  5KLV G;  1NTZ J;  1KB9 D;  4PD4 E;  3SFD C;  5KAF E;  2QA4 P;  1JMM A;  2Y9Z A;  1JTH A;  2C9L Y;  1MUU A;  1IFD A;  1GL2 B;  1YQ3 C;  1VDF A;  2WSC H;  3H1J D;  1YQ4 C;  3NMD A;  1GL2 D;  3RBX A;  3T97 B;  1BCC J;  5BU8 B;  1SQV K;  2H89 C;  2WSS H;  1T2K C;  1KB9 H;  1LTJ C;  1LWU B;  1KQG B;  3GLM A;  4HYT B;  2KS1 A;  1SQB D;  3L73 J;  3CLQ A;  2IFM A;  2K1A A;  3OA7 A;  4U3F J;  3TF5 A;  3FXE A;  1AVY A;  3MUD A;  2P10 A;  1DD4 A;  4NPF X;  2QJP C;  1NTM J;  2WPR A;  5APS A;  1S9K E;  2PP6 A;  4WB4 A;  4H0L C;  2IPP A;  1MV8 A;  5AW1 B;  3R2P A;  3SSU A;  3MUD C;  1RE4 A;  1KQS O;  1KIL A;  2A06 G;  2HR3 A;  2LKM A;  3H32 A;  4JBZ A;  4CPG A;  1DEB A;  4UB6 H;  2YMY A;  2FYN C;  3L70 G;  1M7L A;  1KYO D;  4RKU J;  2PGD A;  2QIW A;  2V4H A;  1R5S A;  1VQO P;  3I5C A;  5CHX A;  1BDC A;  2N9B A;  3V2Q A;  1SFC D;  3L73 D;  2R5D A;  3CL3 D;  3VN0 A;  2FFD C;  1BDD A;  3H1I D;  1FC2 C;  4XA4 A;  1NJI Q;  2QVA A;  1GTW A;  3RGU A;  3BRV B;  5CCG C;  3LID A;  4MN4 C;  1NTK D;  2FYU K;  2KP8 A;  1Q86 Q;  2Z5I A;  4WWI A;  2XDJ A;  5KLV D;  2A06 E;  2A06 D;  2WPS A;  2NPS B;  3EWK A;  4WY4 B;  3HD7 C;  2KNC A;  2QJK B;  2IX7 C;  1OZH A;  2FFD A;  3H1K G;  1LTS C;  1TU3 F;  2BCC G;  2KZI A;  4ZKU A;  5TIS E;  4H0L D;  3VOP A;  4XFJ A;  2FYU G;  1GD2 E;  1SQP J;  3Q5R A;  4H0L B;  3E1R A;  3L75 G;  4GDO A;  2BEQ D;  1SQB G;  1J1E B;  1RE4 C;  4EOT A;  2E76 B;  3L71 J;  1RY3 A;  4D6T D;  3LIE A;  1FZC B;  1AQ5 A;  3BCC J;  1U7J A;  1L4A A;  2FBW C;  3IAO A;  2UWJ E;  1LWU C;  2I8D A;  4BXL A;  4IFM A;  1FJK A;  1L0N D;  4A7P A;  1KTM A;  1AFO A;  3A0B H;  3AE2 C;  3KYQ A;  1YJN P;  2NZ2 A;  1ZRT D;  1PP9 G;  4ASW A;  3JSV C;  3MGN A;  2QJY C;  4Y99 C;  3H1J G;  1M90 Q;  1VQ5 P;  1S9K D;  2AXT H;  3B5N B;  3HUS C;  1NTZ G;  3L4F A;  3Q3D A;  2W83 C;  2ZAE B;  1S5L E;  2GUV A;  1EZV I;  5KJ7 D;  4XE5 B;  3SWK A;  4C7N A;  2XZR A;  1SQB E;  2FXM A;  2E74 D;  1NTK J;  1DD3 A;  2KIK A;  5AW8 B;  1SS1 A;  1GK4 A;  1OIP A;  2N1T A;  3CMA P;  1FZA A;  1OWA A;  2BCC J;  2C0W A;  2W6J H;  3L74 G;  2B87 B;  2H8P D;  5AW2 B;  3L72 D;  1W2B O;  2QSI A;  1L0L K;  1AJY A;  4I7Z C;  1EXJ A;  1X79 B;  2E75 C;  1J2J B;  1SQV G;  2OTL P;  2XU6 A;  1EZV E;  3L70 D;  4U3F G;  1BCC E;  2OTJ P;  1KB9 E;  1KD1 Q;  1BGY G;  3RK3 B;  1NU1 G;  4HB1 A;  3V2R A;  4EYY Q;  3CX5 D;  1HH0 A;  1SQX K;  2J59 M;  3H1K D;  3G6E P;  1KOR A;  4ZKP A;  2K9Y A;  5B66 E;  1BSH A;  1KQL A;  3TNU A;  3VTP C;  2LXB A;  1OW8 A;  3HE4 A;  1H88 A;  1M1J C;  2QG4 A;  3Q5P A;  1PGO A;  1EDL A;  3AED C;  4R4L A;  2DW3 A;  3HD7 B;  2E75 D;  2ZYD A;  1LT9 B;  2PAJ A;  1N7S B;  3L72 G;  5C39 A;  2WT7 B;  3FGA D;  3RBZ A;  2Q3I A;  2E75 B;  2YKO A;  3H1H E;  2YXR B;  3KDP B;  1OFC X;  3L75 E;  1NAF A;  2E74 C;  1EC5 A;  1BGY E;  3L71 E;  5AVQ B;  3S4R A;  3HE5 A;  5BVZ A;  4JYB A;  1N73 C;  1GL2 A;  4IL6 X;  2O01 N;  5APY A;  3KHU A;  4PJ0 E;  1LT9 C;  3D6Y A;  3L70 E;  1FZB A;  2IFN A;  1PV3 A;  2M8R A;  4WVZ A;  1PP9 E;  1ZXG A;  2ZFC A;  2KS1 B;  1BE3 G;  3EQ2 A;  4Y99 B;  3GHG C;  1NTZ E;  1HGV A;  1LTA C;  3W68 A;  4I1L A;  1SQX E;  1KYO H;  3V2N A;  1YI2 P;  1G2C B;  2AEJ A;  2IBZ E;  3TDK A;  2RMZ A;  2WIT A;  2IZ0 A;  3M9Q A;  1KIL D;  1T3J A;  1ZN5 A;  1LTT C;  2M3E A;  3PHL A;  1HTL C;  1KFM A;  3L75 J;  3RL0 C;  1KN7 A;  5B5E E;  2E76 D;  3L35 A;  2O1J A;  2AEF A;  4I7Z B;  1LTJ B;  2IBZ D;  2QJY B;  1ZRT E;  3M0A A;  3FWN A;  1SQQ G;  3L70 J;  1SQX D;  2Q5U A;  4UB8 E;  3F5H A;  1FDI A;  4IOI H;  2QEX P;  1NTZ D;  1L0N E;  1H89 A;  1PGJ A;  2RN0 A;  1IK9 A;  5AW0 B;  1FZG A;  1Y8A A;  2IYP A;  2WQY C;  5AW3 B;  3IN6 A;  3CCU P;  1GDT A;  1PL5 A;  3VP8 A;  1NTK G;  2Q1K A;  3CCQ P;  4DCK A;  2BEZ F;  3H1I J;  3VMX A;  2E76 C;  3B4S A;  2POH A;  2R32 A;  3B5N C;  4L75 A;  1E79 H;  2J5U A;  5AVS B;  1H0T B;  2MJZ A;  3C8V A;  3A0H E;  1FU1 A;  1M1J B;  3NXS A;  2QE7 H;  1NKZ B;  3BCC D;  5TIS H;  1P84 H;  1U7M A;  2Y0E A;  3EFG A;  1SFC C;  3CPW O;  1L0N K;  1FOS F;  3G3Z A;  1RE3 C;  2WPQ A;  2P7J A;  4WY4 A;  1FZE A;  5KTB A;  3H25 A;  3AE7 C;  1RH5 B;  2D2C C;  3MP7 B;  3CCJ P;  1KYO I;  1ZME C;  2L91 A;  3RK3 C;  1K8A Q;  3PJS K;  1J1E C;  2K9J B;  4PD4 I;  5CMZ A;  4YPC A;  1USD A;  1A02 F;  3O6Q A;  2KUB A;  2ITA A;  3IF4 A;  3U59 A;  2WSE J;  4ZNC A;  1JNM A;  2HFE D;  1SQQ J;  4GOE A;  3CXH H;  3VP9 A;  3QWO C;  3FWL A;  1WT6 A;  4OGQ B;  4N78 E;  3H1K E;  1ZR4 A;  1SQV D;  2B88 A;  2KZJ A;  2QM8 A;  2QJK C;  2E5Y A;  1URQ B;  3L73 E;  3M9B A;  4IL6 E;  1HJ0 A;  2QJP B;  2CK3 H;  3WMM 0;  1E5W A;  1IFM A;  5KAF H;  1EZV D;  1URQ D;  3ABV C;  1RF0 C;  4K35 A;  2W8Z A;  3RK3 E;  1QL2 A;  5CCH D;  1PPJ D;  4NPD A;  3VMY A;  1BCC G;  2IBZ I;  4LGD E;  5CJ4 A;  5KJ7 A;  2Q6Q A;  1NH4 A;  1JMB A;  1IFI A;  3BAS A;  1YJW P;  3IR9 A;  3OAK A;  2N1T D;  4C46 A;  5KAI H;  2RH0 A;  2Z4E A;  1VF5 B;  3KZI E;  3TGU G;  4I2L C;  1BE3 J;  1T6A A;  3WU2 E;  3CI9 A;  3RK2 B;  3OJA B;  4AYC A;  1L0N J;  2I1K A;  2WZ7 A;  1BGY J;  1LTB C;  1VF5 D;  5KLI C;  1CI6 B;  2B87 A;  1QVF O;  2E5T A;  3CME P;  4AQR D;  2P2U A;  1KFN A;  2ZYA A;  3N7N A;  5AVX B;  4M3L A;  1NVO A;  1X8Y A;  2O3J A;  3H1J E;  3A0B E;  3GF7 A;  1NTM G;  3MIW A;  4KT0 J;  5GTH H;  3FX0 A;  1G1J A;  2N9Y B;  4KJM A;  2JDI H;  1RF1 A;  5DJT B;  3S1K A;  4DZO A;  1OVR A;  2AXT E;  1PGQ A;  2M3B A;  3SFE C;  2NPS C;  2WTY A;  2G8Y A;  3PH0 A;  1PP9 J;  1VF5 C;  2G3A A;  1OVU A;  1QX8 A;  1SQV E;  2IDB A;  1RF0 A;  3RL0 g;  2H43 A;  1R8E A;  5E79 E;  1L0L E;  4GOF A;  1NWQ A;  3Q2Y A;  4H13 D;  1BE3 E;  1N7S A;  1ZW0 A;  3CXH D;  1NKN A;  1OW7 A;  2KYV A;  4NPE A;  1YTZ T;  2YXQ B;  3MHV A;  2XNX A;  3E1I A;  2FXP A;  3M0D C;  1VQL P;  2C0X A;  4H13 B;  4U3F E;  3V5B A;  1KB9 I;  1SQP K;  2IBZ G;  1LJ2 A;  1VQP P;  1HF9 A;  2A45 H;  1VL2 A;  1W2E A;  3HE5 B;  1JY2 N;  1QGK B;  4GT1 A;  5AW5 B;  2FXO A;  1PGP A;  1VQ7 P;  2R44 A;  2HYN A;  4GOD A;  4OGQ C;  4GKG A;  4Z1M H;  3CCS P;  2A45 G;  2NPS A;  1SP4 A;  2WWW A;  4Y28 J;  1D7M A;  2JP3 A;  2KNC B;  2JJL A;  3H1I E;  3P8C D;  2FFD B;  2OYI C;  3AE3 C;  3PTZ A;  2Y0C A;  2KSJ A;  3D6Z A;  2OTK E;  3BAT A;  4IFD K;  2Q7C A;  1MKM A;  3OW2 O;  1KYO E;  1VPC A;  3I56 P;  1YIT P;  2AEM A;  5APX A;  1NU1 D;  4W7Z A;  3P8M C;  2AXC A;  3VYI A;  3H1L D;  5APU A;  3G9R A;  3UIA A;  2JWA A;  3WUV A;  3AE5 C;  4D6T J;  2ZYG A;  2PRR A;  1MFZ A;  3LW5 J;  1XTG B;  2ZT9 D;  3BRT B;  4PV1 C;  1IK7 A;  3NFQ A;  3USS A;  3KPE A;  3CWB G;  1PPJ G;  2MKV A;  2YO2 A;  1NO4 A;  2R3C A;  1S5L H;  3SWY A;  3B5N D;  3HUS B;  3E7K A;  4IL6 H;  2VRS A;  2IYO A;  3MTU E;  1LTG C;  2LXC B;  1FZF A;  1YJ9 P;  5APW A;  5B5E H;  2Q3E A;  5CCH C;  1LNQ A;  1S4X A;  2KXP B;  2YNY A;  5H2F H;  1CSB A;  1KC8 Q;  1PP9 D;  2JKV A;  3S9O A;  3U1A A;  5EFW B;  5AVW B;  4WY4 D;  1L0L J;  4C7R A;  3CCV P;  1QLE D;  1KV4 A;  3CWB D;  4HKZ H;  2HLO A;  2A45 I;  2GUS A;  3GHG A;  4PD4 D;  1URQ C;  3F89 A;  1YBK A;  2M0B A;  3LW5 H;  1FE6 A;  4RO0 A;  3CCM P;  2OYH C;  1VQ6 P;  1X22 A;  4H44 D;  3Q5S A;  4JF7 A;  5M1B A;  5KKZ C;  4D6T G;  1IFP A;  2M5A A;  2R5B A;  3PRJ A;  4H44 C;  4UB8 H;  1GU4 A;  3L71 D;  1UII A;  1NU1 J;  3HTK B;  3L75 D;  1AVO A;  3O6Q B;  1GU5 A;  1DIP A;  1GL2 C;  5AW7 B;  2QRX A;  4DT0 A;  3CCE P;  4L73 A;  2HOD B;  3MD0 A;  3SWF A;  3TGU D;  1CW5 A;  1G1I A;  5K5G B;  3VMA A;  1HWT C;  1K05 A;  4OVN F;  4BRY B;  3Q1M A;  1GW4 A;  3HD7 D;  2BCC D;  2ZJS E;  1JM0 A;  2OYH A;  2FY8 A;  3AEG C;  1YHQ P;  1EDJ A;  1URQ A;  1S5L X;  1IZN B;  1NU1 K;  1SFC B;  5CCH A;  2WSF J;  2H88 C;  3JC2 2;  1P84 D;  3GW6 A;  1T8Z A;  2ZVO B;  5CBN A;  3L71 G;  4LLH A;  1X9V A;  3CX5 E;  4JYC A;  1SQQ D;  3V4W A;  5BU5 A;  1JCD A;  3WU2 H;  1IC2 A;  1KZU B;  1JY3 N;  1SQP E;  4PD4 H;  1BCC D;  4PJ0 H;  3T97 A;  4AUW A;  1ZOY C;  1N7L A;  3H1J J;  3U1C A;  2ZT9 C;  1NYH A;  3G4S P;  1OX3 A;  2OYI B;  1HGZ A;  3L72 E;  3TGU J;  1OXZ A;  3N4X A;  2YIU C;  3A5T A;  1QL1 A;  3M06 A;  1M1K Q;  1OVV A;  3WUT A;  1CI6 A;  2E42 A;  3CCR P;  3JCU E;  3KQG A;  3TYY A;  1VQN P;  1EDK A;  4RES B;  3HRN A;  2N1T C;  5CBO A;  2WSF H;  2Y9Y A;  1KIL B;  2GA1 A;  3KZI H;  4HH2 A;  3D71 A;  1RF1 B; 
#chains in the Genus database with same CATH homology
 1FOS E;  3A7O A;  2H7H A;  3VMZ A;  3P32 A;  2HPC A;  2P67 A;  3O8Z A;  1N7S D;  2OYI A;  1JCC A;  5AVZ B;  5AVR B;  1GZL A;  5KJ7 C;  5AW4 B;  2CPB A;  5AW6 B;  5CJ0 A;  3M91 A;  1N73 B;  1IFJ A;  4OH8 B;  2FKW B;  1H8A A;  3M0D A;  2JEE A;  2NPS D;  2ZXE B;  3A3Y B;  1M1J A;  1N7S C;  3BVH A;  1J1D C;  1GW3 A;  2Z5H A;  1FAV A;  1FBM A;  4WBA A;  1NHL A;  1NTZ K;  1N86 A;  1RF1 C;  5CCG A;  2CPS A;  2HG5 D;  1RE3 A;  4WY4 C;  4I6M C;  1J1D B;  2XKM A;  2KLV A;  1YTZ I;  2QM7 A;  3B5N A;  1JTH B;  4IFF A;  1NTM K;  1IO4 A;  1ZV8 A;  3RL0 D;  1ZR2 A;  1KIL C;  2Q9I A;  1N2D C;  1FDM A;  3H6P A;  1HJB A;  3TK1 A;  1YYC A;  1LWU A;  1Z56 A;  3RK2 D;  2YO3 A;  2BAS A;  4N3Y B;  1NTK K;  3M9H A;  3GHG B;  5APQ A;  2WSE H;  2P1J A;  4GIF A;  3PP5 A;  5AVU B;  2J58 A;  3RK3 D;  1SLQ A;  1WRG A;  5APT A;  2C9N Y;  3TNU B;  3H32 B;  3HE4 B;  3A2A A;  3HTK A;  4N78 D;  3HD7 A;  1JY2 P;  5AVT B;  1LT9 A;  2WT7 A;  3P7K A;  1T2K D;  3L36 A;  2W27 A;  5AVY B;  1SFC A;  4O9B A;  3L37 A;  1T3U A;  2KOG A;  3V2P A;  1JOC A;  1LGH B;  2O01 H;  2L5G B;  4LC1 A;  1CZQ A;  1HUC A;  1EQ7 A;  2XV5 A;  1MZ9 A;  3IFM A;  1G2C A;  4KHX A;  2E43 A;  1XTC C;  3C9I A;  4W80 A;  2O1K A;  1FJP A;  1JO5 A;  1FZC A;  2FYZ A;  5KLV K;  1L4A B;  2YKQ A;  1LTJ A;  3B8E B;  3TSI A;  1SQQ K;  3RK2 C;  4EIJ A;  1L4A D;  5APV A;  1DH3 A;  2HPC B;  1JY3 P;  1ZLL A;  4C7N B;  3HUS A;  1IFN A;  2W6A A;  1SVF A;  2GM4 A;  4B86 A;  2N1T B;  1N73 A;  1FZC C;  3RL0 B;  1PFI A;  1L4A C;  1GK6 A;  5AVV B;  3P8C E;  2I1J A;  1A02 J;  1IJD B;  4DOJ A;  2OAR A;  2YKP A;  1HVV A;  1JY3 O;  1JY2 O;  3V4Q A;  5CCG D;  1NOH A;  2W6B A;  1JUN A;  3II6 A;  2KB7 P;  2HOD A;  5AW9 B;  4W7Y A;  1SQB K;  3NTN A;  4N6J A;  1LTI C;  2OYH B;  1JMM A;  1JTH A;  2C9L Y;  1MUU A;  1IFD A;  1GL2 B;  1VDF A;  2WSC H;  3NMD A;  1GL2 D;  5BU8 B;  1SQV K;  1T2K C;  1LTJ C;  1LWU B;  1DX7 A;  4HYT B;  3OA7 A;  3CLQ A;  2IFM A;  3MUD A;  2WPR A;  5APS A;  1S9K E;  2PP6 A;  4WB4 A;  2IPP A;  1MV8 A;  5AW1 B;  3R2P A;  1RE4 A;  1KIL A;  2LKM A;  3H32 A;  1DEB A;  2YMY A;  1M7L A;  3I5C A;  5CHX A;  2N9B A;  3V2Q A;  1SFC D;  2R5D A;  3CL3 D;  3VN0 A;  2FFD C;  4XA4 A;  1GTW A;  3BRV B;  5CCG C;  3LID A;  2FYU K;  2KP8 A;  2Z5I A;  2XDJ A;  2WPS A;  2NPS B;  4WY4 B;  3HD7 C;  2IX7 C;  2FFD A;  1LTS C;  4ZKU A;  3VOP A;  1GD2 E;  1J1E B;  1RE4 C;  4EOT A;  1RY3 A;  3LIE A;  1FZC B;  1AQ5 A;  1L4A A;  1LWU C;  4IFM A;  1FJK A;  1AFO A;  3KYQ A;  3MGN A;  4Y99 C;  1S9K D;  3B5N B;  3HUS C;  3L4F A;  4C7N A;  2GUV A;  5KJ7 D;  4XE5 B;  2XZR A;  2FXM A;  5AW8 B;  1GK4 A;  2N1T A;  1HBW A;  1FZA A;  1OWA A;  5AW2 B;  2C0W A;  2H8P D;  1L0L K;  1X79 B;  1J2J B;  2XU6 A;  3RK3 B;  3V2R A;  1HH0 A;  1SQX K;  2J59 M;  4ZKP A;  1KQL A;  3TNU A;  3VTP C;  1H88 A;  3HE4 A;  1M1J C;  3HD7 B;  1LT9 B;  2PAJ A;  1N7S B;  2WT7 B;  2Q3I A;  2YKO A;  3KDP B;  1NAF A;  5AVQ B;  5BVZ A;  3HE5 A;  1N73 C;  4JYB A;  1GL2 A;  5APY A;  1LT9 C;  1FZB A;  2IFN A;  2M8R A;  2ZFC A;  4Y99 B;  3EQ2 A;  3GHG C;  1HGV A;  1LTA C;  4I1L A;  3V2N A;  1G2C B;  2WIT A;  3M9Q A;  1KIL D;  1T3J A;  1ZN5 A;  1LTT C;  3RL0 C;  1HTL C;  1KFM A;  3L35 A;  2O1J A;  1LTJ B;  3M0A A;  2OYI B;  2Q5U A;  1H89 A;  5AW0 B;  1FZG A;  1IK9 A;  5AW3 B;  1GDT A;  3VP8 A;  3VMX A;  5CCH C;  3B5N C;  2POH A;  2R32 A;  5AVS B;  2MJZ A;  1FU1 A;  1M1J B;  3NXS A;  1NKZ B;  3EFG A;  1SFC C;  1FOS F;  1L0N K;  3G3Z A;  1RE3 C;  2WPQ A;  2P7J A;  4WY4 A;  1FZE A;  5KTB A;  3RK3 C;  1J1E C;  5CMZ A;  1A02 F;  3U59 A;  1JNM A;  2HFE D;  3VP9 A;  1WT6 A;  4N78 E;  1ZR4 A;  2QM8 A;  1URQ B;  3M9B A;  3WMM 0;  1E5W A;  1IFM A;  1URQ D;  1RF0 C;  5CCH D;  1QL2 A;  3VMY A;  5CJ4 A;  5KJ7 A;  4LGD E;  1NH4 A;  1IFI A;  3BAS A;  3IR9 A;  3OAK A;  2N1T D;  4C46 A;  2Z4E A;  4I2L C;  4AYC A;  3CI9 A;  3RK2 B;  3OJA B;  2I1K A;  2WZ7 A;  1LTB C;  1CI6 B;  4AQR D;  2P2U A;  1KFN A;  3N7N A;  5AVX B;  4M3L A;  1X8Y A;  3MIW A;  1G1J A;  1RF1 A;  4DZO A;  2M3B A;  2NPS C;  2WTY A;  1RF0 A;  2H43 A;  1NWQ A;  1N7S A;  1NKN A;  2KYV A;  1YTZ T;  2XNX A;  3E1I A;  3M0D C;  2C0X A;  3V5B A;  1SQP K;  2A45 H;  1W2E A;  3HE5 B;  1JY2 N;  5AW5 B;  4GT1 A;  2HYN A;  4GKG A;  2A45 G;  2NPS A;  1SP4 A;  2WWW A;  2JJL A;  3P8C D;  2FFD B;  2OYI C;  2KSJ A;  3BAT A;  4IFD K;  2Q7C A;  1VPC A;  5APX A;  4W7Z A;  3P8M C;  3VYI A;  3UIA A;  5APU A;  1MFZ A;  1XTG B;  3BRT B;  3NFQ A;  3KPE A;  2YO2 A;  1NO4 A;  2R3C A;  3SWY A;  3B5N D;  3HUS B;  2VRS A;  3MTU E;  1LTG C;  1FZF A;  5APW A;  2YNY A;  1CSB A;  3U1A A;  5AVW B;  4WY4 D;  4C7R A;  2HLO A;  2A45 I;  2GUS A;  3GHG A;  1URQ C;  3LW5 H;  2OYH C;  4JF7 A;  1GU4 A;  2R5B A;  3HTK B;  1GU5 A;  1GL2 C;  5AW7 B;  2HOD B;  3MD0 A;  3SWF A;  1CW5 A;  1G1I A;  1HWT C;  1GW4 A;  3HD7 D;  2OYH A;  1URQ A;  1SFC B;  1NU1 K;  5CCH A;  1T8Z A;  4LLH A;  1X9V A;  4JYC A;  5BU5 A;  3V4W A;  1JCD A;  1IC2 A;  1KZU B;  1JY3 N;  4AUW A;  3T97 A;  3U1C A;  1N7L A;  1HGZ A;  1OXZ A;  3N4X A;  3A5T A;  1QL1 A;  3M06 A;  1CI6 A;  2E42 A;  3KQG A;  3TYY A;  4RES B;  3HRN A;  2N1T C;  2WSF H;  1KIL B;  4HH2 A;  1RF1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...