3HTKA

Crystal structure of mms21 and smc5 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
60
structure length
60
Chain Sequence
KPFANTKKTLENQVEELTEKCSLKTDEFLKAKEKINEIFEKLNTIRDEVIKKKNQNEYYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional insights into the roles of the Mms21 subunit of the Smc5/6 complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Recombination/replication/ligase
molecule keywords Structural maintenance of chromosomes protein 5
total genus 28
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2009-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3htkA00
2Z5HA 1CZQA 4AYCA 4B86A 5AW0B 5AVZB 2QM7A 3P8MC 5AVRB 3VMXA 3VN0A 1GK4A 3HE4B 2ZXEB 5AVTB 2H7HA 4C7NA 2QM8A 2WPSA 3L36A 3OAKA 3M0AA 5APWA 3KDPB 3TK1A 3P7KA 2BASA 5APTA 3VTPC 4I6MC 5AVSB 5APXA 2R32A 3HTKA 2Q7CA 3MD0A 2E42A 5AVUB 3A3YB 1IO4A 2WTYA 4HYTB 5AVWB 2XZRA 1JNMA 2WT7B 3UIAA 1FAVA 3V5BA 1HWTC 3NTNA 1GU4A 2WWWA 5APVA 1NWQA 1NAFA 1FOSF 5AW4B 3VYIA 4RESB 3T97A 1MFZA 1H88A 3M9HA 3IR9A 4C7NB 1T2KD 2P7JA 3HE5B 2W27A 4KHXA 2WT7A 3L37A 2C9NY 2W6AA 3M91A 1SP4A 2N9BA 2WPRA 4JYBA 5AVXB 3V4WA 3M9BA 1A02J 3P32A 2YO2A 1CI6B 1OXZA 2WPQA 3HE5A 5APSA 3LIEA 3VMZA 2YO3A 4DZOA 1JUNA 3A2AA 4LC1A 4XE5B 5APUA 1CI6A 5AW8B 1S9KD 1GZLA 5AW5B 3I5CA 4C46A 2C9LY 1H8AA 1GU5A 1H89A 3L35A 4AQRD 3NMDA 4EOTA 3HE4A 1G2CB 1HJBA 5AW6B 3V4QA 1FOSE 3O8ZA 5AW9B 3TNUA 3LIDA 3MGNA 1HBWA 1A02F 4M3LA 3M0DA 1MUUA 5AW1B 3NFQA 2R5BA 1GTWA 5CMZA 1OWAA 2XU6A 5AW2B 1GK6A 1MV8A 4JYCA 5AVQB 5AW7B 3SWFA 2IPPA 5AVVB 1DH3A 1T2KC 2R3CA 2ZFCA 1KQLA 1S9KE 2Q3IA 1YYCA 3A7OA 3B8EB 3M06A 1J2JB 1CSBA 4GT1A 1X8YA 4I2LC 2P67A 2R5DA 3A5TA 4GKGA 4AUWA 2P2UA 3NXSA 1GD2E 2KP8A 5AW3B 3TYYA 3VMYA 5APYA 1HUCA 1SLQA 2XV5A 2JJLA 2Q5UA 2VRSA 3KQGA 5APQA 3TNUB 5AVYB 2YNYA 2E43A 2Z5IA
chains in the Genus database with same CATH superfamily
1NHLA 2Z5HA 4AYCA 1OW8A 2V7QJ 1NYHA 1RHZB 3L71J 1ZV8A 1KB9H 2IFNA 1NOHA 2CPBA 3AE2C 1VQ5P 1SQVD 2NPSD 2WPVB 4WVZA 2KNCB 3Q3DA 2A45H 2H7HA 1WRGA 1MFTA 4WY4C 4C7NA 1D7MA 3OJAB 1JTHB 3MUDA 3OAKA 1L0LE 1U7JA 1RQUA 3H6PA 1BE3J 1VF5D 3M0AA 1EQ7A 1PP9G 5APWA 1PZQA 1SQBD 2IX7C 1IK9A 1VQPP 4PD4I 4Y28J 5EFWB 3RGUA 4H0LC 2FYZA 4KT0J 1URQB 2POHA 3FWNA 5CBNA 1LJ2A 3L73G 2CPSA 3LW5H 1IFIA 2KOGA 1PPJE 1PPJD 1AQTA 2FYNC 2ITAA 2XNDH 1RH5B 2GUSA 3AEDC 1KD1Q 4TT3H 5AVUB 2HLOA 1BE3D 5BVZA 2O1KA 1EDIA 3B5NA 3W67A 1M7LA 4ASVA 1G2CA 3HD7B 1IJDB 4HH2A 3L73J 3WU2E 1J1EC 1EXIA 1EZVE 1L0LK 2NPSA 2OTLP 1FJPA 3B71A 1FAVA 1AV1A 1USDA 1Y47A 3NTNA 4UB6E 3V5BA 2QVAA 4N78E 1S1CX 3KHUA 1RF1B 2RKLA 1NTKG 1RQVA 3H1KJ 1NWQA 1NAFA 2HPCB 3CCUP 4K35A 2QJPC 2W6JH 1GL2C 2OARA 2JR8A 2ZJSE 2ZT9B 4D6TD 1QVFO 1KV4A 2BEZF 1GW4A 1KYOH 1MFZA 2PFXA 1H88A 1L0NK 3CX5H 4C7NB 5GTHE 2B9BA 1PFIA 1T2KD 1SQPG 2FXPA 2G3AA 4KHXA 5CCGD 1IK7A 3M91A 1YJWP 2IBZD 2N9BA 4JYBA 5AVXB 2UWJE 1DX7A 4WY4A 1A02J 3BCCE 2QJYC 3H1JE 4R4LA 5KLVD 1SQXG 2IDBA 3RK3C 4PV1B 3IAOA 4RJTA 3U1CA 4EI2A 3Q1MA 4U3FG 3CC7P 2E76D 4DZOA 2BCCD 1RE3C 5CHXA 2QJKC 2K37A 1KYOD 3CI9A 3ITKA 4KJMA 1AVYA 4LC1A 2N9YB 1L4AD 5AW5B 1SFCA 1KB9I 1SQXJ 2KLVA 2OGUA 3E1IA 5CCHC 3V2RA 3D6ZA 1FZAA 2C9LY 1R5SA 1NO4A 2E75D 3GHGA 3HD7C 3II6A 3B4SA 1H8AA 2YIUC 4AQRD 3NMDA 4ZMDA 1ZMEC 4EOTA 2PAJA 2WZ7A 3GMAA 3A0BE 3HE4A 4YXDC 1FDIA 5H2FE 4ASWA 5AW6B 3RBXA 5AW9B 4N78D 1FZEA 1M1KQ 4YXWH 3LIDA 3MGNA 1SQPK 1JY2N 4L73A 4PJ0H 2QEXP 2B89A 1A02F 1YJNP 3I56P 1HF9A 1N8RQ 3FGAD 2PGDA 4I7ZC 5AW1B 1AA0A 2O01J 1IC2A 4EDFA 2KB7P 1T6AA 1T8ZA 3L72E 1OIPA 5CMZA 3C1LA 4TLFA 5AW2B 5GTIE 1GK6A 4BWNA 2Q3EA 1SQXK 2K3RA 3HUSB 4EYYQ 3SWFA 2KS1A 3MHVA 1DH3A 1JTHA 1YIJP 3O6QB 4H0LD 1ZW0A 1LTTC 2IFMA 3QWOC 1LT1A 1P84I 1QVGO 5L8RJ 2XDJA 2XNXA 4H13B 1S9KE 2GM4A 2OYOA 1YYCA 1XTGB 1VQ6P 1JMBA 5KAIE 1L2PA 1NTMD 1TU3F 1J2JB 4BRYA 1CSBA 1FDMA 5KLIB 1S4XA 2C0WA 1SQQD 2I1KA 3CWBD 3G4SP 1KZUB 3A0BH 1JOCA 3H25A 1R8EA 3L4FA 2FFDB 3TGUG 1PPJG 4OGQD 2P2UA 1AVOA 3CXHD 3E7KA 4UB8E 3HUSA 5AW3B 4YTPC 1GD2E 1BCCJ 3F5HA 1BE3G 3VMYA 5CCHA 3V6IA 1N7SB 3L74D 1RE4A 2H8PD 1NTZK 3CC4P 4IFDK 5KJ7A 2KLUA 1N7SC 3CL3D 1K05A 1VDFA 3FWLA 5DJUB 5AVYB 1BSNA 2OTKE 3TNUB 2AEMA 1NTZE 4DT0A 1YJ9P 3K5BA 5AW0B 3M9QA 1E79H 2E74B 2QSIA 1FBMA 2O3JA 3VN0A 1KC8Q 3GG2A 3PJSK 1KILB 1GK4A 2N1TB 2ZYDA 3CXHE 3HE4B 3L75J 3PTZA 1RE3A 2MKVA 4IL6E 3RL0g 3CCEP 1FJKA 3M0DC 2WPSA 3SFEC 3ZDMA 1NH4A 1RF1C 3CCMP 3VMAA 3KDPB 2Y9ZA 2KYVA 3P7KA 4XA4A 1SQBK 5APTA 1QL1A 5CCGA 3MTUE 5KTBA 1YTZI 5E79E 1YHQP 2A06G 1Q86Q 2HYNA 1LWUB 2WSEH 3CLQA 5B5EE 3CCQP 1FZGA 3CC2P 3AEAC 3H1LG 1USEA 2HFED 3HTKA 4PD4E 1FU1A 1SQXE 1K8AQ 3A3YB 3RK2B 4OGQC 2Q1KA 3HD7D 2BCCJ 1KORA 4WY4B 1LWUC 1PGOA 2YKOA 1IFMA 4QMAA 4HYTB 3TGUE 3CCSP 2XZRA 1PIXA 1GMJA 3MP7B 1X22A 3H1JJ 1QX8A 3BCCJ 4DJGA 3CMAP 1FZFA 1M57D 2NZ2A 4OWFA 1KFMA 1LT9A 2YIUB 3V2PA 2W83C 5CJ0A 1ZP0C 2FFDC 3BASA 1Y9BA 3VYIA 2HPCA 1M56D 2FY8A 2OYIA 3PP5A 4OH8B 5TJHA 1L0ND 1JMMA 3TF5A 1NU1D 2P7JA 3HE5B 2J5UA 2P1JA 2W27A 1LTJC 2WQYC 2Y0CA 1SFCC 2NPSB 3L37A 3L72G 3OW2O 3AE3C 2E76C 3CX5E 3CX5D 2FYUD 3KPEA 3L70J 2KSEA 2LXBA 2WSFH 3GHGC 1KILC 2N1TC 2SPZA 3HD7A 3B5NB 3M9BA 4I1LA 1AFOA 2YO2A 1CI6B 1OXZA 2R44A 1LWUA 2H88C 1IFDA 2A06E 2E76B 3H1JD 3V2QA 2QIWA 2Y9YA 3L73E 2Z4EA 1FZBA 1N7LA 1URQA 4NPDA 1JUNA 2OYIB 1L4AB 1IZNB 1LTIC 2E75C 1PV3A 3AE8C 1UIIA 3G71P 1YITP 2QJYB 1S3JA 2HG5D 1NTMG 3FXDA 1OVUA 2E75B 1VQNP 1SQBG 1IFNA 1SQQG 1BCCG 3CWBG 5B66E 2L91A 1DEBA 1JEKA 3RK2C 1Q90D 5DJTB 4A7PA 4LGDE 3TGUD 4ZKUA 1HJBA 1JY2P 2IBZI 1BE3E 5KKZB 1SQVJ 2HODA 1DEEG 1L0LJ 3E1RA 4H44C 5TISE 1MZ9A 3KYQA 3N4XA 1HVVA 3ABVC 3AE6C 5KJ7D 3H32A 3V2NA 2YMYA 1S2EA 3BRVB 1SFCD 1GTWA 2WSCH 1U7MA 4ZNCA 1HH0A 4H44B 4HJGH 4PJ0E 1OZHA 1KTMA 2P10A 5GTHH 1MV8A 5AVQB 3EFFK 5KAFE 5K5GB 1JCCA 1IFPA 3D71A 5AVVB 2OYHA 1RF0A 1EC5A 4BRYB 2W90A 2E74C 2IYPA 2R3CA 3F89A 1DIPA 1W2BO 2M5AB 4D6TG 1Q81Q 1LNQA 2K88A 2O1JA 3A7OA 3MZWB 1NTMK 3B8EB 1YI2P 1NTKK 2QE7H 1X8YA 1Q82Q 3RL0D 2A06D 1SQQK 2HR3A 3GLMA 1H0TB 4AUWA 1YQ3C 2H89C 1JM0A 1P84E 3H1KG 1SQVE 2KS1B 3L74E 1KYOE 4U3FJ 1S72P 3R4YA 1HUCA 2AXTH 1SLQA 4L75A 1HJ0A 2K9JB 5APQA 1NKNA 4C7RA 3VOPA 1EZVI 1KQGB 1IO4A 2IYOA 2AEFA 1L0NE 2Z5IA 4UB8H 3AE7C 2GUVA 2KK7A 3BCCD 2WSFJ 4PD4H 3TDKA 3EQ2A 5AVZB 2QM7A 3U59A 4B86A 2FYUE 3RK3D 1KN7A 5AVRB 1ZN5A 3G3ZA 3RBZA 2LKMA 4GIFA 3VMXA 3CCJP 2ZXEB 5KLIC 2V7QH 3HUSC 1JY3P 4DCKA 4O9BA 4IFMA 2QM8A 1L0NG 2OYHB 3JSVC 3H1IJ 1Z56A 2D2CD 4EIJA 3L72D 2JKVA 3L70E 1VPCA 2J58A 3A0HE 2FXMA 2R3SA 1NTKJ 2ZAEB 3H1LE 1GL2D 2JO1A 1CW5A 2PP6A 1NU1J 2LR2A 3JC22 4MN4C 3MD0A 2RN0A 3H1ID 2WTYA 4IOIH 4JF7A 1S5LX 3AEFC 2Q6QA 1EDKA 3P8CD 2W8ZA 4HKZH 5AVWB 1J1DB 2QA4P 1SQQJ 3IFMA 1RY3A 1UIXA 1HWTC 1SQPE 4H13C 5GTIH 2WWWA 1VQ4P 2XKMA 1RF0C 1BCCD 3WMM0 3TGUJ 1QL2A 1BGYG 1X9VA 1FZCA 1L4AA 2BCCE 5AW4B 3OA7A 3PH0A 5B5EH 1AQ5A 4K3AA 1GDTA 3T97A 1SS1A 2I1JA 3IR9A 4BXLA 1NU1K 2FBWC 1JO5A 2PRRA 3AECC 3SSUA 3C9IA 4CPGA 2WT7A 1K73Q 3L74G 1YQ4C 2KIKA 2W6AA 1HGZA 2IBZE 2FYUK 1ZR4A 4NPEA 3B5ND 2OTJP 2WVRA 3RL0C 2QG4A 1FE6A 2WPQA 1QEXA 5APSA 1LTBC 2QJKB 3CWBE 3LIEA 3VP9A 1NTZG 1Q7YQ 2JDIH 1OVRA 1OVVA 2NPSC 1SQBJ 3AE1C 2YKQA 3L75E 4GDOA 1NTME 4IL6X 3SWYA 3T97B 3Q5RA 3A2AA 1KFNA 3W68A 1W2EA 3QH9A 4JBZA 4W80A 1BDDA 1WMKA 4XE5B 5AW8B 5M1BA 1S9KD 1N73A 1NTZJ 1YBKA 3RK2D 1FZCC 1SQVG 3IF4A 2IZ1A 2B88A 4XFJA 5CCGC 3L71G 1KILA 2N1TA 4PV1D 3L35A 1VQOP 1GU5A 1EDJA 2ZT9D 2KNCA 3H1KD 3MUDC 4N3YB 1BCCE 2Y0EA 2M3EA 1FOSE 4RKUJ 4D6TJ 1EDLA 1NGMB 1HGVA 3TNUA 4WWIA 4H0LB 4LLHA 4M3LA 1PP9J 2V4HA 3CPWO 1ZOYC 2KZJA 1LTJB 1OW7A 1U57A 3LW5J 3M0DA 3P8CE 3VP8A 2KZIA 3CMEP 3AE9C 3BCCG 1JY3O 2A45G 4DOJA 1M90Q 1OWAA 1VF5B 1X79B 2XU6A 4IL6H 5KKZC 3GF7A 3B5NC 2E74D 1PGQA 3H32B 4JYCA 3Q2YA 3BVHA 2E5YA 2IPPA 3I55P 1LT9C 2G8YA 4HB1A 4WB4A 1PGPA 2K1AA 2HODB 4OGQB 1URQD 2LXCB 3KZIH 3L72J 1N7SD 2E43A 1BDCA 3H1HG 1GW3A 3JCUE 3M06A 1NU1G 1NTKD 2YKPA 4W7YA 3S9OA 5CJ4A 2P67A 3TSIA 2QJPB 4GODA 1IFJA 1R5LA 5H2FH 1T3JA 3A0HH 1T3UA 1G1JA 2KUBA 2R5DA 4GKGA 1N73B 1H0TA 1QLED 2FYUG 2K9JA 4PV1C 3FX0A 2KP8A 3AEGC 2ZYGA 3TYYA 3H1IG 2L5GB 3Q5PA 2NRGA 1N73C 3C8VA 1LGHB 1FC2C 1Q2NA 2O01N 3WUVA 1NVOA 2JJLA 2RH0A 3JCUH 2VRSA 3H1JG 3KQGA 4L74A 5KAIH 1VQMP 4JPZB 3PHLA 5C39A 1CI6A 2YNYA 1N86A 3BATA 4RO0A 1CZQA 3SFDC 2Q9IA 4JQ0D 5KLVG 3RK3B 3L70G 4GOFA 3Q5SA 2WSSH 2AXCA 2D2CC 2C0XA 1ZRTE 3P8MC 4U3FD 4N6JA 1OFCX 1NAYA 1ZLLA 2M5AA 1SQVK 1J1EB 4YPCA 2BCCG 1PP9E 5AVTB 3CCVP 1OW6A 2AXTE 1SFCB 3O6QA 3L36A 4D6TE 1MKMA 3GW6A 3TK1A 2H43A 2BASA 4WY4D 2YXQB 3VTPC 4I6MC 1LT9B 5AVSB 3R2PA 5KAFH 1JY2O 1GL2B 1KMIZ 1PGJA 3BRTB 3MIWA 2IZ0A 3SWKA 2A45I 2B87B 4PD4D 5APXA 2R32A 4OVNF 1YTZT 1EZVD 1RE4C 2FXOA 4L76A 2Q7CA 5BU8B 2E42A 3WUTA 4Z1MH 3U1AA 4UB6H 3L75G 1NTMJ 1S5LE 4R4MA 2YMKA 3CXHH 1SQBE 2WMMA 3EWKA 3H1KE 3CCLP 1VQLP 1PL5A 1E5WA 1WT6A 3HTKB 1JNMA 1FDOA 1L0LD 2I8DA 3CWBJ 2WT7B 3UIAA 3FXEA 2YXRB 1P84H 3PRJA 1GU4A 2KXPB 1LP1A 5B66H 1ZR2A 3KZIE 1KILD 2N1TD 3L71D 1KYOI 2CK3H 2J59M 5APVA 1RF1A 1FOSF 2GA1A 3D70A 1LP1B 1LTAC 1FZCB 1VL2A 3AEBC 4RESB 1QGKB 1K9MQ 2JP3A 2JWAA 2WITA 3M9HA 4Y99B 1PP9D 2P58A 3WUUA 4IFFA 1JB0J 2OYHC 3AEEC 4W7ZA 1LTSC 2C9NY 1N2DC 1DD3A 1VQ8P 1SP4A 1ZRTD 1HTLC 2DW3A 1ZXGA 2WPRA 2ZVOB 3N7NA 2K9YA 2E5TA 3L73D 3P32A 3HRNA 1VF5C 1SQPJ 2D2CB 2ZXXA 3HE5A 1KQFB 5KLVK 2OYIC 1VQKP 3VMZA 1SQQE 2FKWB 2KI7B 1GL2A 2M0BA 2YO3A 1M8OB 1N7SA 4I7ZB 1VQ7P 2B87A 2M3BA 5TISH 5CBOA 2WSEJ 5APUA 1M1JC 2JEEA 2QRXA 1KILE 1GZLA 3EFGA 3KXDA 3L71E 3H1HD 1J1DC 3I5CA 1X0TA 3WU2H 2ZT9C 1NU1E 4C46A 2FFDA 1BSHA 1EXJA 1KB9D 1H89A 1AJYA 1NTKE 1OMIA 3USSA 3H1LJ 3V4WA 3CCRP 1G2CB 5CCHD 3V4QA 3H1IE 3O8ZA 1BGYE 2ZVNB 1S5LH 3S4RA 2MJZA 3AE4C 1SQPD 2Y0DA 5KLVJ 2JWDA 1VQ9P 1JCDA 1MUUA 3NFQA 1Y8AA 2IBZG 2R5BA 3CX5I 2M8RA 3H1LD 1NJIQ 3PLNA 2BEQD 5BU5A 2FYUJ 3L70D 2FYNB 2RMZA 2AEJA 1SVFA 1K04A 3IN6A 1SQXD 1URQC 5E79H 3H1HJ 1L0NJ 5AW7B 3RL0B 4NPFX 1KB9E 3G6EP 1HBWA 3G9RA 1BGYD 1T2KC 3H1HE 2ZFCA 1KQLA 3GF3A 1NKZB 2Q3IA 5KJ7C 4Y99C 4H13D 4U3FE 3RK3E 3L74J 4H44D 2W6BA 4GT1A 1LTGC 2KSJA 4I2LC 3GHGB 1G1IA 1JY3N 4GOEA 1DD4A 5KLVE 3A5TA 1KQSO 4U7JA 1BGYJ 1XTCC 3NXSA 1FS0E 1EZVG 1M1JA 3CD6P 2OQQA 1LTJA 3CXHI 5APYA 1M1JB 3L75D 2XV5A 1P84D 1L4AC 1NTZD 1OX3A 2Q5UA 3AE5C 2WSCJ 2ZYAA 4WBAA 3S1KA 4ZKPA 3D6YA 1L0LG 2O01H 1W5CE
chains in the Genus database with same CATH topology
1NHLA 2Z5HA 4AYCA 1ZV8A 2IFNA 1NOHA 2CPBA 2NPSD 2A45H 2H7HA 1WRGA 4WY4C 4C7NA 3OJAB 1JTHB 3MUDA 3OAKA 3H6PA 3M0AA 5APWA 1EQ7A 2IX7C 1IK9A 2FYZA 1URQB 2POHA 3LW5H 4N3YB 2CPSA 1IFIA 2KOGA 2GUSA 5AVUB 2HLOA 5BVZA 2O1KA 3B5NA 1M7LA 1G2CA 3HD7B 1IJDB 4HH2A 1J1EC 1L0LK 2NPSA 1FJPA 1FAVA 3V5BA 3NTNA 4N78E 1RF1B 1NWQA 1NAFA 2HPCB 1GL2C 2OARA 1GW4A 1MFZA 1H88A 1L0NK 4C7NB 1PFIA 1T2KD 4KHXA 5CCGD 3M91A 2N9BA 4JYBA 5AVXB 1DX7A 4WY4A 1A02J 3RK3C 3U1CA 4DZOA 5CHXA 1RE3C 3V2PA 3CI9A 4LC1A 1L4AD 5AW5B 1SFCA 2KLVA 5CCHC 3E1IA 3V2RA 1FZAA 2C9LY 1NO4A 3GHGA 3HD7C 1H8AA 3II6A 4AQRD 3NMDA 4EOTA 2PAJA 2WZ7A 3HE4A 5AW6B 5AW9B 4N78D 1FZEA 3LIDA 3MGNA 1SQPK 1JY2N 1A02F 1HBWA 5AW1B 1IC2A 2KB7P 1T8ZA 5CMZA 5AW2B 1GK6A 1SQXK 3HUSB 3SWFA 1DH3A 1JTHA 1LTTC 2IFMA 2XDJA 2XNXA 1S9KE 2GM4A 1YYCA 1XTGB 1J2JB 1CSBA 1FDMA 2C0WA 2I1KA 2FFDB 1KZUB 1JOCA 3L4FA 2P2UA 1GD2E 3HUSA 5AW3B 5CCHA 3VMYA 1N7SB 1RE4A 2H8PD 1NTZK 4IFDK 5KJ7A 1N7SC 3CL3D 1VDFA 5AVYB 3TNUB 5AW0B 3M9QA 1FBMA 3VN0A 1KILB 1GK4A 2N1TB 3HE4B 1RE3A 1FJKA 3M0DC 2WPSA 1RF1C 1NH4A 2OYIA 3KDPB 2KYVA 3P7KA 4XA4A 1SQBK 5APTA 1QL1A 5CCGA 3MTUE 5KTBA 1YTZI 2HYNA 2WSEH 1LWUB 3CLQA 1FZGA 2HFED 3HTKA 1FU1A 3A3YB 3RK2B 3HD7D 4WY4B 1LWUC 2YKOA 1IFMA 4HYTB 2XZRA 1FZFA 1KFMA 1LT9A 2FFDC 5CJ0A 3BASA 2HPCA 3VYIA 3PP5A 4OH8B 1JMMA 2P7JA 3HE5B 2P1JA 2W27A 1LTJC 1SFCC 2NPSB 3L37A 3KPEA 3V4WA 3GHGC 3HD7A 2WSFH 3M9BA 1KILC 2N1TC 4I1LA 1AFOA 3B5NB 2YO2A 1CI6B 1OXZA 1LWUA 1IFDA 3V2QA 2Z4EA 1FZBA 1N7LA 1URQA 1JUNA 2OYIB 1L4AB 1LTIC 2HG5D 1IFNA 1DEBA 3RK2C 4LGDE 4ZKUA 1HJBA 1JY2P 2HODA 1MZ9A 3KYQA 3N4XA 1HVVA 5KJ7D 3H32A 3V2NA 2YMYA 3BRVB 1SFCD 1GTWA 2WSCH 1HH0A 1MV8A 5AVQB 1JCCA 2OYHA 5AVVB 1RF0A 2R3CA 3A7OA 2O1JA 1NTMK 3B8EB 1NTKK 1X8YA 3RL0D 1SQQK 4AUWA 1HUCA 1SLQA 5APQA 1NKNA 4C7RA 3VOPA 1IO4A 2GUVA 4B86A 3U59A 3EQ2A 5AVZB 2QM7A 3RK3D 5AVRB 1ZN5A 3G3ZA 3VMXA 2LKMA 4GIFA 2ZXEB 3HUSC 1JY3P 4O9BA 4IFMA 2QM8A 2OYHB 1Z56A 4EIJA 1VPCA 2J58A 2FXMA 1GL2D 1CW5A 2PP6A 3MD0A 2WTYA 4JF7A 5AVWB 3P8CD 1J1DB 3IFMA 1RY3A 1HWTC 2WWWA 2XKMA 1RF0C 3WMM0 1QL2A 1X9VA 1FZCA 1L4AA 5AW4B 3OA7A 1AQ5A 1GDTA 3T97A 2I1JA 3IR9A 1NU1K 1JO5A 3C9IA 2WT7A 2W6AA 1HGZA 2FYUK 1ZR4A 3B5ND 3RL0C 2WPQA 5APSA 1LTBC 3LIEA 3VP9A 2NPSC 2YKQA 3SWYA 3A2AA 1KFNA 1W2EA 4W80A 4XE5B 5AW8B 1S9KD 1N73A 3RK2D 1FZCC 5CCGC 1GU5A 1KILA 2N1TA 3L35A 1FOSE 1HGVA 3TNUA 4LLHA 4M3LA 3M0DA 1LTJB 3P8CE 3VP8A 4DOJA 1JY3O 2A45G 1OWAA 2XU6A 1X79B 3B5NC 3H32B 4JYCA 3BVHA 2IPPA 1LT9C 4WB4A 2HODB 1URQD 1N7SD 3M06A 1GW3A 2YKPA 4W7YA 5CJ4A 2P67A 3TSIA 1IFJA 1T3JA 1T3UA 1G1JA 2R5DA 4GKGA 1N73B 2KP8A 1N73C 3TYYA 2L5GB 1LGHB 2JJLA 2VRSA 3KQGA 3BATA 2YNYA 1CI6A 1N86A 1CZQA 3RK3B 2C0XA 3P8MC 4N6JA 1ZLLA 1SQVK 1J1EB 5AVTB 1SFCB 3L36A 3TK1A 2H43A 2BASA 4WY4D 3VTPC 4I6MC 1LT9B 5AVSB 3R2PA 1JY2O 1GL2B 3BRTB 3MIWA 2A45I 5APXA 2R32A 1YTZT 1RE4C 2Q7CA 2E42A 5BU8B 3U1AA 1WT6A 1E5WA 1JNMA 3HTKB 2WT7B 3UIAA 1GU4A 1ZR2A 1KILD 2N1TD 5APVA 2J59M 1RF1A 1FOSF 1LTAC 1FZCB 4RESB 2WITA 3M9HA 4Y99B 4IFFA 2OYHC 4W7ZA 1LTSC 2C9NY 1N2DC 1SP4A 1HTLC 2WPRA 3N7NA 3P32A 3HRNA 3HE5A 5KLVK 2OYIC 3VMZA 2FKWB 1GL2A 2YO3A 1N7SA 2M3BA 5APUA 1M1JC 2JEEA 2Q9IA 1GZLA 3EFGA 1J1DC 3I5CA 2FFDA 4C46A 1H89A 1G2CB 5CCHD 3V4QA 3O8ZA 2MJZA 1JCDA 1MUUA 3NFQA 2R5BA 2M8RA 5BU5A 1SVFA 3RL0B 1URQC 5AW7B 1T2KC 2ZFCA 1KQLA 1NKZB 2Q3IA 5KJ7C 4Y99C 2W6BA 4GT1A 1LTGC 2KSJA 4I2LC 3GHGB 1G1IA 1JY3N 3A5TA 1XTCC 3NXSA 1M1JA 1LTJA 5APYA 1M1JB 2XV5A 1L4AC 4ZKPA 2Q5UA 4WBAA 2E43A 2O01H 2Z5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5H A;  1CZQ A;  4AYC A;  4B86 A;  5AW0 B;  5AVZ B;  2QM7 A;  3P8M C;  5AVR B;  3VMX A;  3VN0 A;  1GK4 A;  3HE4 B;  2ZXE B;  5AVT B;  2H7H A;  4C7N A;  2QM8 A;  2WPS A;  3L36 A;  3OAK A;  3M0A A;  5APW A;  3KDP B;  3TK1 A;  3P7K A;  2BAS A;  5APT A;  3VTP C;  4I6M C;  5AVS B;  5APX A;  2R32 A;  3HTK A;  2Q7C A;  3MD0 A;  2E42 A;  5AVU B;  3A3Y B;  1IO4 A;  2WTY A;  4HYT B;  5AVW B;  2XZR A;  1JNM A;  2WT7 B;  3UIA A;  1FAV A;  3V5B A;  1HWT C;  3NTN A;  1GU4 A;  2WWW A;  5APV A;  1NWQ A;  1NAF A;  1FOS F;  5AW4 B;  3VYI A;  4RES B;  3T97 A;  1MFZ A;  1H88 A;  3M9H A;  3IR9 A;  4C7N B;  1T2K D;  2P7J A;  3HE5 B;  2W27 A;  4KHX A;  2WT7 A;  3L37 A;  2C9N Y;  2W6A A;  3M91 A;  1SP4 A;  2N9B A;  2WPR A;  4JYB A;  5AVX B;  3V4W A;  3M9B A;  1A02 J;  3P32 A;  2YO2 A;  1CI6 B;  1OXZ A;  2WPQ A;  3HE5 A;  5APS A;  3LIE A;  3VMZ A;  2YO3 A;  4DZO A;  1JUN A;  3A2A A;  4LC1 A;  4XE5 B;  5APU A;  1CI6 A;  5AW8 B;  1S9K D;  1GZL A;  5AW5 B;  3I5C A;  4C46 A;  2C9L Y;  1H8A A;  1GU5 A;  1H89 A;  3L35 A;  4AQR D;  3NMD A;  4EOT A;  3HE4 A;  1G2C B;  1HJB A;  5AW6 B;  3V4Q A;  1FOS E;  3O8Z A;  5AW9 B;  3TNU A;  3LID A;  3MGN A;  1HBW A;  1A02 F;  4M3L A;  3M0D A;  1MUU A;  5AW1 B;  3NFQ A;  2R5B A;  1GTW A;  5CMZ A;  1OWA A;  2XU6 A;  5AW2 B;  1GK6 A;  1MV8 A;  4JYC A;  5AVQ B;  5AW7 B;  3SWF A;  2IPP A;  5AVV B;  1DH3 A;  1T2K C;  2R3C A;  2ZFC A;  1KQL A;  1S9K E;  2Q3I A;  1YYC A;  3A7O A;  3B8E B;  3M06 A;  1J2J B;  1CSB A;  4GT1 A;  1X8Y A;  4I2L C;  2P67 A;  2R5D A;  3A5T A;  4GKG A;  4AUW A;  2P2U A;  3NXS A;  1GD2 E;  2KP8 A;  5AW3 B;  3TYY A;  3VMY A;  5APY A;  1HUC A;  1SLQ A;  2XV5 A;  2JJL A;  2Q5U A;  2VRS A;  3KQG A;  5APQ A;  3TNU B;  5AVY B;  2YNY A;  2E43 A;  2Z5I A; 
#chains in the Genus database with same CATH topology
 1NHL A;  2Z5H A;  4AYC A;  1OW8 A;  2V7Q J;  1NYH A;  1RHZ B;  3L71 J;  1ZV8 A;  1KB9 H;  2IFN A;  1NOH A;  2CPB A;  3AE2 C;  1VQ5 P;  1SQV D;  2NPS D;  2WPV B;  4WVZ A;  2KNC B;  3Q3D A;  2A45 H;  2H7H A;  1WRG A;  1MFT A;  4WY4 C;  4C7N A;  1D7M A;  3OJA B;  1JTH B;  3MUD A;  3OAK A;  1L0L E;  1U7J A;  1RQU A;  3H6P A;  1BE3 J;  1VF5 D;  3M0A A;  1EQ7 A;  1PP9 G;  5APW A;  1PZQ A;  1SQB D;  2IX7 C;  1IK9 A;  1VQP P;  4PD4 I;  4Y28 J;  5EFW B;  3RGU A;  4H0L C;  2FYZ A;  4KT0 J;  1URQ B;  2POH A;  3FWN A;  5CBN A;  1LJ2 A;  3L73 G;  2CPS A;  3LW5 H;  1IFI A;  2KOG A;  1PPJ E;  1PPJ D;  1AQT A;  2FYN C;  2ITA A;  2XND H;  1RH5 B;  2GUS A;  3AED C;  1KD1 Q;  4TT3 H;  5AVU B;  2HLO A;  1BE3 D;  5BVZ A;  2O1K A;  1EDI A;  3B5N A;  3W67 A;  1M7L A;  4ASV A;  1G2C A;  3HD7 B;  1IJD B;  4HH2 A;  3L73 J;  3WU2 E;  1J1E C;  1EXI A;  1EZV E;  1L0L K;  2NPS A;  2OTL P;  1FJP A;  3B71 A;  1FAV A;  1AV1 A;  1USD A;  1Y47 A;  3NTN A;  4UB6 E;  3V5B A;  2QVA A;  4N78 E;  1S1C X;  3KHU A;  1RF1 B;  2RKL A;  1NTK G;  1RQV A;  3H1K J;  1NWQ A;  1NAF A;  2HPC B;  3CCU P;  4K35 A;  2QJP C;  2W6J H;  1GL2 C;  2OAR A;  2JR8 A;  2ZJS E;  2ZT9 B;  4D6T D;  1QVF O;  1KV4 A;  2BEZ F;  1GW4 A;  1KYO H;  1MFZ A;  2PFX A;  1H88 A;  1L0N K;  3CX5 H;  4C7N B;  5GTH E;  2B9B A;  1PFI A;  1T2K D;  1SQP G;  2FXP A;  2G3A A;  4KHX A;  5CCG D;  1IK7 A;  3M91 A;  1YJW P;  2IBZ D;  2N9B A;  4JYB A;  5AVX B;  2UWJ E;  1DX7 A;  4WY4 A;  1A02 J;  3BCC E;  2QJY C;  3H1J E;  4R4L A;  5KLV D;  1SQX G;  2IDB A;  3RK3 C;  4PV1 B;  3IAO A;  4RJT A;  3U1C A;  4EI2 A;  3Q1M A;  4U3F G;  3CC7 P;  2E76 D;  4DZO A;  2BCC D;  1RE3 C;  5CHX A;  2QJK C;  2K37 A;  1KYO D;  3CI9 A;  3ITK A;  4KJM A;  1AVY A;  4LC1 A;  2N9Y B;  1L4A D;  5AW5 B;  1SFC A;  1KB9 I;  1SQX J;  2KLV A;  2OGU A;  3E1I A;  5CCH C;  3V2R A;  3D6Z A;  1FZA A;  2C9L Y;  1R5S A;  1NO4 A;  2E75 D;  3GHG A;  3HD7 C;  3II6 A;  3B4S A;  1H8A A;  2YIU C;  4AQR D;  3NMD A;  4ZMD A;  1ZME C;  4EOT A;  2PAJ A;  2WZ7 A;  3GMA A;  3A0B E;  3HE4 A;  4YXD C;  1FDI A;  5H2F E;  4ASW A;  5AW6 B;  3RBX A;  5AW9 B;  4N78 D;  1FZE A;  1M1K Q;  4YXW H;  3LID A;  3MGN A;  1SQP K;  1JY2 N;  4L73 A;  4PJ0 H;  2QEX P;  2B89 A;  1A02 F;  1YJN P;  3I56 P;  1HF9 A;  1N8R Q;  3FGA D;  2PGD A;  4I7Z C;  5AW1 B;  1AA0 A;  2O01 J;  1IC2 A;  4EDF A;  2KB7 P;  1T6A A;  1T8Z A;  3L72 E;  1OIP A;  5CMZ A;  3C1L A;  4TLF A;  5AW2 B;  5GTI E;  1GK6 A;  4BWN A;  2Q3E A;  1SQX K;  2K3R A;  3HUS B;  4EYY Q;  3SWF A;  2KS1 A;  3MHV A;  1DH3 A;  1JTH A;  1YIJ P;  3O6Q B;  4H0L D;  1ZW0 A;  1LTT C;  2IFM A;  3QWO C;  1LT1 A;  1P84 I;  1QVG O;  5L8R J;  2XDJ A;  2XNX A;  4H13 B;  1S9K E;  2GM4 A;  2OYO A;  1YYC A;  1XTG B;  1VQ6 P;  1JMB A;  5KAI E;  1L2P A;  1NTM D;  1TU3 F;  1J2J B;  4BRY A;  1CSB A;  1FDM A;  5KLI B;  1S4X A;  2C0W A;  1SQQ D;  2I1K A;  3CWB D;  3G4S P;  1KZU B;  3A0B H;  1JOC A;  3H25 A;  1R8E A;  3L4F A;  2FFD B;  3TGU G;  1PPJ G;  4OGQ D;  2P2U A;  1AVO A;  3CXH D;  3E7K A;  4UB8 E;  3HUS A;  5AW3 B;  4YTP C;  1GD2 E;  1BCC J;  3F5H A;  1BE3 G;  3VMY A;  5CCH A;  3V6I A;  1N7S B;  3L74 D;  1RE4 A;  2H8P D;  1NTZ K;  3CC4 P;  4IFD K;  5KJ7 A;  2KLU A;  1N7S C;  3CL3 D;  1K05 A;  1VDF A;  3FWL A;  5DJU B;  5AVY B;  1BSN A;  2OTK E;  3TNU B;  2AEM A;  1NTZ E;  4DT0 A;  1YJ9 P;  3K5B A;  5AW0 B;  3M9Q A;  1E79 H;  2E74 B;  2QSI A;  1FBM A;  2O3J A;  3VN0 A;  1KC8 Q;  3GG2 A;  3PJS K;  1KIL B;  1GK4 A;  2N1T B;  2ZYD A;  3CXH E;  3HE4 B;  3L75 J;  3PTZ A;  1RE3 A;  2MKV A;  4IL6 E;  3RL0 g;  3CCE P;  1FJK A;  3M0D C;  2WPS A;  3SFE C;  3ZDM A;  1NH4 A;  1RF1 C;  3CCM P;  3VMA A;  3KDP B;  2Y9Z A;  2KYV A;  3P7K A;  4XA4 A;  1SQB K;  5APT A;  1QL1 A;  5CCG A;  3MTU E;  5KTB A;  1YTZ I;  5E79 E;  1YHQ P;  2A06 G;  1Q86 Q;  2HYN A;  1LWU B;  2WSE H;  3CLQ A;  5B5E E;  3CCQ P;  1FZG A;  3CC2 P;  3AEA C;  3H1L G;  1USE A;  2HFE D;  3HTK A;  4PD4 E;  1FU1 A;  1SQX E;  1K8A Q;  3A3Y B;  3RK2 B;  4OGQ C;  2Q1K A;  3HD7 D;  2BCC J;  1KOR A;  4WY4 B;  1LWU C;  1PGO A;  2YKO A;  1IFM A;  4QMA A;  4HYT B;  3TGU E;  3CCS P;  2XZR A;  1PIX A;  1GMJ A;  3MP7 B;  1X22 A;  3H1J J;  1QX8 A;  3BCC J;  4DJG A;  3CMA P;  1FZF A;  1M57 D;  2NZ2 A;  4OWF A;  1KFM A;  1LT9 A;  2YIU B;  3V2P A;  2W83 C;  5CJ0 A;  1ZP0 C;  2FFD C;  3BAS A;  1Y9B A;  3VYI A;  2HPC A;  1M56 D;  2FY8 A;  2OYI A;  3PP5 A;  4OH8 B;  5TJH A;  1L0N D;  1JMM A;  3TF5 A;  1NU1 D;  2P7J A;  3HE5 B;  2J5U A;  2P1J A;  2W27 A;  1LTJ C;  2WQY C;  2Y0C A;  1SFC C;  2NPS B;  3L37 A;  3L72 G;  3OW2 O;  3AE3 C;  2E76 C;  3CX5 E;  3CX5 D;  2FYU D;  3KPE A;  3L70 J;  2KSE A;  2LXB A;  2WSF H;  3GHG C;  1KIL C;  2N1T C;  2SPZ A;  3HD7 A;  3B5N B;  3M9B A;  4I1L A;  1AFO A;  2YO2 A;  1CI6 B;  1OXZ A;  2R44 A;  1LWU A;  2H88 C;  1IFD A;  2A06 E;  2E76 B;  3H1J D;  3V2Q A;  2QIW A;  2Y9Y A;  3L73 E;  2Z4E A;  1FZB A;  1N7L A;  1URQ A;  4NPD A;  1JUN A;  2OYI B;  1L4A B;  1IZN B;  1LTI C;  2E75 C;  1PV3 A;  3AE8 C;  1UII A;  3G71 P;  1YIT P;  2QJY B;  1S3J A;  2HG5 D;  1NTM G;  3FXD A;  1OVU A;  2E75 B;  1VQN P;  1SQB G;  1IFN A;  1SQQ G;  1BCC G;  3CWB G;  5B66 E;  2L91 A;  1DEB A;  1JEK A;  3RK2 C;  1Q90 D;  5DJT B;  4A7P A;  4LGD E;  3TGU D;  4ZKU A;  1HJB A;  1JY2 P;  2IBZ I;  1BE3 E;  5KKZ B;  1SQV J;  2HOD A;  1DEE G;  1L0L J;  3E1R A;  4H44 C;  5TIS E;  1MZ9 A;  3KYQ A;  3N4X A;  1HVV A;  3ABV C;  3AE6 C;  5KJ7 D;  3H32 A;  3V2N A;  2YMY A;  1S2E A;  3BRV B;  1SFC D;  1GTW A;  2WSC H;  1U7M A;  4ZNC A;  1HH0 A;  4H44 B;  4HJG H;  4PJ0 E;  1OZH A;  1KTM A;  2P10 A;  5GTH H;  1MV8 A;  5AVQ B;  3EFF K;  5KAF E;  5K5G B;  1JCC A;  1IFP A;  3D71 A;  5AVV B;  2OYH A;  1RF0 A;  1EC5 A;  4BRY B;  2W90 A;  2E74 C;  2IYP A;  2R3C A;  3F89 A;  1DIP A;  1W2B O;  2M5A B;  4D6T G;  1Q81 Q;  1LNQ A;  2K88 A;  2O1J A;  3A7O A;  3MZW B;  1NTM K;  3B8E B;  1YI2 P;  1NTK K;  2QE7 H;  1X8Y A;  1Q82 Q;  3RL0 D;  2A06 D;  1SQQ K;  2HR3 A;  3GLM A;  1H0T B;  4AUW A;  1YQ3 C;  2H89 C;  1JM0 A;  1P84 E;  3H1K G;  1SQV E;  2KS1 B;  3L74 E;  1KYO E;  4U3F J;  1S72 P;  3R4Y A;  1HUC A;  2AXT H;  1SLQ A;  4L75 A;  1HJ0 A;  2K9J B;  5APQ A;  1NKN A;  4C7R A;  3VOP A;  1EZV I;  1KQG B;  1IO4 A;  2IYO A;  2AEF A;  1L0N E;  2Z5I A;  4UB8 H;  3AE7 C;  2GUV A;  2KK7 A;  3BCC D;  2WSF J;  4PD4 H;  3TDK A;  3EQ2 A;  5AVZ B;  2QM7 A;  3U59 A;  4B86 A;  2FYU E;  3RK3 D;  1KN7 A;  5AVR B;  1ZN5 A;  3G3Z A;  3RBZ A;  2LKM A;  4GIF A;  3VMX A;  3CCJ P;  2ZXE B;  5KLI C;  2V7Q H;  3HUS C;  1JY3 P;  4DCK A;  4O9B A;  4IFM A;  2QM8 A;  1L0N G;  2OYH B;  3JSV C;  3H1I J;  1Z56 A;  2D2C D;  4EIJ A;  3L72 D;  2JKV A;  3L70 E;  1VPC A;  2J58 A;  3A0H E;  2FXM A;  2R3S A;  1NTK J;  2ZAE B;  3H1L E;  1GL2 D;  2JO1 A;  1CW5 A;  2PP6 A;  1NU1 J;  2LR2 A;  3JC2 2;  4MN4 C;  3MD0 A;  2RN0 A;  3H1I D;  2WTY A;  4IOI H;  4JF7 A;  1S5L X;  3AEF C;  2Q6Q A;  1EDK A;  3P8C D;  2W8Z A;  4HKZ H;  5AVW B;  1J1D B;  2QA4 P;  1SQQ J;  3IFM A;  1RY3 A;  1UIX A;  1HWT C;  1SQP E;  4H13 C;  5GTI H;  2WWW A;  1VQ4 P;  2XKM A;  1RF0 C;  1BCC D;  3WMM 0;  3TGU J;  1QL2 A;  1BGY G;  1X9V A;  1FZC A;  1L4A A;  2BCC E;  5AW4 B;  3OA7 A;  3PH0 A;  5B5E H;  1AQ5 A;  4K3A A;  1GDT A;  3T97 A;  1SS1 A;  2I1J A;  3IR9 A;  4BXL A;  1NU1 K;  2FBW C;  1JO5 A;  2PRR A;  3AEC C;  3SSU A;  3C9I A;  4CPG A;  2WT7 A;  1K73 Q;  3L74 G;  1YQ4 C;  2KIK A;  2W6A A;  1HGZ A;  2IBZ E;  2FYU K;  1ZR4 A;  4NPE A;  3B5N D;  2OTJ P;  2WVR A;  3RL0 C;  2QG4 A;  1FE6 A;  2WPQ A;  1QEX A;  5APS A;  1LTB C;  2QJK B;  3CWB E;  3LIE A;  3VP9 A;  1NTZ G;  1Q7Y Q;  2JDI H;  1OVR A;  1OVV A;  2NPS C;  1SQB J;  3AE1 C;  2YKQ A;  3L75 E;  4GDO A;  1NTM E;  4IL6 X;  3SWY A;  3T97 B;  3Q5R A;  3A2A A;  1KFN A;  3W68 A;  1W2E A;  3QH9 A;  4JBZ A;  4W80 A;  1BDD A;  1WMK A;  4XE5 B;  5AW8 B;  5M1B A;  1S9K D;  1N73 A;  1NTZ J;  1YBK A;  3RK2 D;  1FZC C;  1SQV G;  3IF4 A;  2IZ1 A;  2B88 A;  4XFJ A;  5CCG C;  3L71 G;  1KIL A;  2N1T A;  4PV1 D;  3L35 A;  1VQO P;  1GU5 A;  1EDJ A;  2ZT9 D;  2KNC A;  3H1K D;  3MUD C;  4N3Y B;  1BCC E;  2Y0E A;  2M3E A;  1FOS E;  4RKU J;  4D6T J;  1EDL A;  1NGM B;  1HGV A;  3TNU A;  4WWI A;  4H0L B;  4LLH A;  4M3L A;  1PP9 J;  2V4H A;  3CPW O;  1ZOY C;  2KZJ A;  1LTJ B;  1OW7 A;  1U57 A;  3LW5 J;  3M0D A;  3P8C E;  3VP8 A;  2KZI A;  3CME P;  3AE9 C;  3BCC G;  1JY3 O;  2A45 G;  4DOJ A;  1M90 Q;  1OWA A;  1VF5 B;  1X79 B;  2XU6 A;  4IL6 H;  5KKZ C;  3GF7 A;  3B5N C;  2E74 D;  1PGQ A;  3H32 B;  4JYC A;  3Q2Y A;  3BVH A;  2E5Y A;  2IPP A;  3I55 P;  1LT9 C;  2G8Y A;  4HB1 A;  4WB4 A;  1PGP A;  2K1A A;  2HOD B;  4OGQ B;  1URQ D;  2LXC B;  3KZI H;  3L72 J;  1N7S D;  2E43 A;  1BDC A;  3H1H G;  1GW3 A;  3JCU E;  3M06 A;  1NU1 G;  1NTK D;  2YKP A;  4W7Y A;  3S9O A;  5CJ4 A;  2P67 A;  3TSI A;  2QJP B;  4GOD A;  1IFJ A;  1R5L A;  5H2F H;  1T3J A;  3A0H H;  1T3U A;  1G1J A;  2KUB A;  2R5D A;  4GKG A;  1N73 B;  1H0T A;  1QLE D;  2FYU G;  2K9J A;  4PV1 C;  3FX0 A;  2KP8 A;  3AEG C;  2ZYG A;  3TYY A;  3H1I G;  2L5G B;  3Q5P A;  2NRG A;  1N73 C;  3C8V A;  1LGH B;  1FC2 C;  1Q2N A;  2O01 N;  3WUV A;  1NVO A;  2JJL A;  2RH0 A;  3JCU H;  2VRS A;  3H1J G;  3KQG A;  4L74 A;  5KAI H;  1VQM P;  4JPZ B;  3PHL A;  5C39 A;  1CI6 A;  2YNY A;  1N86 A;  3BAT A;  4RO0 A;  1CZQ A;  3SFD C;  2Q9I A;  4JQ0 D;  5KLV G;  3RK3 B;  3L70 G;  4GOF A;  3Q5S A;  2WSS H;  2AXC A;  2D2C C;  2C0X A;  1ZRT E;  3P8M C;  4U3F D;  4N6J A;  1OFC X;  1NAY A;  1ZLL A;  2M5A A;  1SQV K;  1J1E B;  4YPC A;  2BCC G;  1PP9 E;  5AVT B;  3CCV P;  1OW6 A;  2AXT E;  1SFC B;  3O6Q A;  3L36 A;  4D6T E;  1MKM A;  3GW6 A;  3TK1 A;  2H43 A;  2BAS A;  4WY4 D;  2YXQ B;  3VTP C;  4I6M C;  1LT9 B;  5AVS B;  3R2P A;  5KAF H;  1JY2 O;  1GL2 B;  1KMI Z;  1PGJ A;  3BRT B;  3MIW A;  2IZ0 A;  3SWK A;  2A45 I;  2B87 B;  4PD4 D;  5APX A;  2R32 A;  4OVN F;  1YTZ T;  1EZV D;  1RE4 C;  2FXO A;  4L76 A;  2Q7C A;  5BU8 B;  2E42 A;  3WUT A;  4Z1M H;  3U1A A;  4UB6 H;  3L75 G;  1NTM J;  1S5L E;  4R4M A;  2YMK A;  3CXH H;  1SQB E;  2WMM A;  3EWK A;  3H1K E;  3CCL P;  1VQL P;  1PL5 A;  1E5W A;  1WT6 A;  3HTK B;  1JNM A;  1FDO A;  1L0L D;  2I8D A;  3CWB J;  2WT7 B;  3UIA A;  3FXE A;  2YXR B;  1P84 H;  3PRJ A;  1GU4 A;  2KXP B;  1LP1 A;  5B66 H;  1ZR2 A;  3KZI E;  1KIL D;  2N1T D;  3L71 D;  1KYO I;  2CK3 H;  2J59 M;  5APV A;  1RF1 A;  1FOS F;  2GA1 A;  3D70 A;  1LP1 B;  1LTA C;  1FZC B;  1VL2 A;  3AEB C;  4RES B;  1QGK B;  1K9M Q;  2JP3 A;  2JWA A;  2WIT A;  3M9H A;  4Y99 B;  1PP9 D;  2P58 A;  3WUU A;  4IFF A;  1JB0 J;  2OYH C;  3AEE C;  4W7Z A;  1LTS C;  2C9N Y;  1N2D C;  1DD3 A;  1VQ8 P;  1SP4 A;  1ZRT D;  1HTL C;  2DW3 A;  1ZXG A;  2WPR A;  2ZVO B;  3N7N A;  2K9Y A;  2E5T A;  3L73 D;  3P32 A;  3HRN A;  1VF5 C;  1SQP J;  2D2C B;  2ZXX A;  3HE5 A;  1KQF B;  5KLV K;  2OYI C;  1VQK P;  3VMZ A;  1SQQ E;  2FKW B;  2KI7 B;  1GL2 A;  2M0B A;  2YO3 A;  1M8O B;  1N7S A;  4I7Z B;  1VQ7 P;  2B87 A;  2M3B A;  5TIS H;  5CBO A;  2WSE J;  5APU A;  1M1J C;  2JEE A;  2QRX A;  1KIL E;  1GZL A;  3EFG A;  3KXD A;  3L71 E;  3H1H D;  1J1D C;  3I5C A;  1X0T A;  3WU2 H;  2ZT9 C;  1NU1 E;  4C46 A;  2FFD A;  1BSH A;  1EXJ A;  1KB9 D;  1H89 A;  1AJY A;  1NTK E;  1OMI A;  3USS A;  3H1L J;  3V4W A;  3CCR P;  1G2C B;  5CCH D;  3V4Q A;  3H1I E;  3O8Z A;  1BGY E;  2ZVN B;  1S5L H;  3S4R A;  2MJZ A;  3AE4 C;  1SQP D;  2Y0D A;  5KLV J;  2JWD A;  1VQ9 P;  1JCD A;  1MUU A;  3NFQ A;  1Y8A A;  2IBZ G;  2R5B A;  3CX5 I;  2M8R A;  3H1L D;  1NJI Q;  3PLN A;  2BEQ D;  5BU5 A;  2FYU J;  3L70 D;  2FYN B;  2RMZ A;  2AEJ A;  1SVF A;  1K04 A;  3IN6 A;  1SQX D;  1URQ C;  5E79 H;  3H1H J;  1L0N J;  5AW7 B;  3RL0 B;  4NPF X;  1KB9 E;  3G6E P;  1HBW A;  3G9R A;  1BGY D;  1T2K C;  3H1H E;  2ZFC A;  1KQL A;  3GF3 A;  1NKZ B;  2Q3I A;  5KJ7 C;  4Y99 C;  4H13 D;  4U3F E;  3RK3 E;  3L74 J;  4H44 D;  2W6B A;  4GT1 A;  1LTG C;  2KSJ A;  4I2L C;  3GHG B;  1G1I A;  1JY3 N;  4GOE A;  1DD4 A;  5KLV E;  3A5T A;  1KQS O;  4U7J A;  1BGY J;  1XTC C;  3NXS A;  1FS0 E;  1EZV G;  1M1J A;  3CD6 P;  2OQQ A;  1LTJ A;  3CXH I;  5APY A;  1M1J B;  3L75 D;  2XV5 A;  1P84 D;  1L4A C;  1NTZ D;  1OX3 A;  2Q5U A;  3AE5 C;  2WSC J;  2ZYA A;  4WBA A;  3S1K A;  4ZKP A;  3D6Y A;  1L0L G;  2O01 H;  1W5C E; 
#chains in the Genus database with same CATH homology
 1NHL A;  2Z5H A;  4AYC A;  1ZV8 A;  2IFN A;  1NOH A;  2CPB A;  2NPS D;  2A45 H;  2H7H A;  1WRG A;  4WY4 C;  4C7N A;  3OJA B;  1JTH B;  3MUD A;  3OAK A;  3H6P A;  3M0A A;  5APW A;  1EQ7 A;  2IX7 C;  1IK9 A;  2FYZ A;  1URQ B;  2POH A;  3LW5 H;  4N3Y B;  2CPS A;  1IFI A;  2KOG A;  2GUS A;  5AVU B;  2HLO A;  5BVZ A;  2O1K A;  3B5N A;  1M7L A;  1G2C A;  3HD7 B;  1IJD B;  4HH2 A;  1J1E C;  1L0L K;  2NPS A;  1FJP A;  1FAV A;  3V5B A;  3NTN A;  4N78 E;  1RF1 B;  1NWQ A;  1NAF A;  2HPC B;  1GL2 C;  2OAR A;  1GW4 A;  1MFZ A;  1H88 A;  1L0N K;  4C7N B;  1PFI A;  1T2K D;  4KHX A;  5CCG D;  3M91 A;  2N9B A;  4JYB A;  5AVX B;  1DX7 A;  4WY4 A;  1A02 J;  3RK3 C;  3U1C A;  4DZO A;  5CHX A;  1RE3 C;  3V2P A;  3CI9 A;  4LC1 A;  1L4A D;  5AW5 B;  1SFC A;  2KLV A;  5CCH C;  3E1I A;  3V2R A;  1FZA A;  2C9L Y;  1NO4 A;  3GHG A;  3HD7 C;  1H8A A;  3II6 A;  4AQR D;  3NMD A;  4EOT A;  2PAJ A;  2WZ7 A;  3HE4 A;  5AW6 B;  5AW9 B;  4N78 D;  1FZE A;  3LID A;  3MGN A;  1SQP K;  1JY2 N;  1A02 F;  1HBW A;  5AW1 B;  1IC2 A;  2KB7 P;  1T8Z A;  5CMZ A;  5AW2 B;  1GK6 A;  1SQX K;  3HUS B;  3SWF A;  1DH3 A;  1JTH A;  1LTT C;  2IFM A;  2XDJ A;  2XNX A;  1S9K E;  2GM4 A;  1YYC A;  1XTG B;  1J2J B;  1CSB A;  1FDM A;  2C0W A;  2I1K A;  2FFD B;  1KZU B;  1JOC A;  3L4F A;  2P2U A;  1GD2 E;  3HUS A;  5AW3 B;  5CCH A;  3VMY A;  1N7S B;  1RE4 A;  2H8P D;  1NTZ K;  4IFD K;  5KJ7 A;  1N7S C;  3CL3 D;  1VDF A;  5AVY B;  3TNU B;  5AW0 B;  3M9Q A;  1FBM A;  3VN0 A;  1KIL B;  1GK4 A;  2N1T B;  3HE4 B;  1RE3 A;  1FJK A;  3M0D C;  2WPS A;  1RF1 C;  1NH4 A;  2OYI A;  3KDP B;  2KYV A;  3P7K A;  4XA4 A;  1SQB K;  5APT A;  1QL1 A;  5CCG A;  3MTU E;  5KTB A;  1YTZ I;  2HYN A;  2WSE H;  1LWU B;  3CLQ A;  1FZG A;  2HFE D;  3HTK A;  1FU1 A;  3A3Y B;  3RK2 B;  3HD7 D;  4WY4 B;  1LWU C;  2YKO A;  1IFM A;  4HYT B;  2XZR A;  1FZF A;  1KFM A;  1LT9 A;  2FFD C;  5CJ0 A;  3BAS A;  2HPC A;  3VYI A;  3PP5 A;  4OH8 B;  1JMM A;  2P7J A;  3HE5 B;  2P1J A;  2W27 A;  1LTJ C;  1SFC C;  2NPS B;  3L37 A;  3KPE A;  3V4W A;  3GHG C;  3HD7 A;  2WSF H;  3M9B A;  1KIL C;  2N1T C;  4I1L A;  1AFO A;  3B5N B;  2YO2 A;  1CI6 B;  1OXZ A;  1LWU A;  1IFD A;  3V2Q A;  2Z4E A;  1FZB A;  1N7L A;  1URQ A;  1JUN A;  2OYI B;  1L4A B;  1LTI C;  2HG5 D;  1IFN A;  1DEB A;  3RK2 C;  4LGD E;  4ZKU A;  1HJB A;  1JY2 P;  2HOD A;  1MZ9 A;  3KYQ A;  3N4X A;  1HVV A;  5KJ7 D;  3H32 A;  3V2N A;  2YMY A;  3BRV B;  1SFC D;  1GTW A;  2WSC H;  1HH0 A;  1MV8 A;  5AVQ B;  1JCC A;  2OYH A;  5AVV B;  1RF0 A;  2R3C A;  3A7O A;  2O1J A;  1NTM K;  3B8E B;  1NTK K;  1X8Y A;  3RL0 D;  1SQQ K;  4AUW A;  1HUC A;  1SLQ A;  5APQ A;  1NKN A;  4C7R A;  3VOP A;  1IO4 A;  2GUV A;  4B86 A;  3U59 A;  3EQ2 A;  5AVZ B;  2QM7 A;  3RK3 D;  5AVR B;  1ZN5 A;  3G3Z A;  3VMX A;  2LKM A;  4GIF A;  2ZXE B;  3HUS C;  1JY3 P;  4O9B A;  4IFM A;  2QM8 A;  2OYH B;  1Z56 A;  4EIJ A;  1VPC A;  2J58 A;  2FXM A;  1GL2 D;  1CW5 A;  2PP6 A;  3MD0 A;  2WTY A;  4JF7 A;  5AVW B;  3P8C D;  1J1D B;  3IFM A;  1RY3 A;  1HWT C;  2WWW A;  2XKM A;  1RF0 C;  3WMM 0;  1QL2 A;  1X9V A;  1FZC A;  1L4A A;  5AW4 B;  3OA7 A;  1AQ5 A;  1GDT A;  3T97 A;  2I1J A;  3IR9 A;  1NU1 K;  1JO5 A;  3C9I A;  2WT7 A;  2W6A A;  1HGZ A;  2FYU K;  1ZR4 A;  3B5N D;  3RL0 C;  2WPQ A;  5APS A;  1LTB C;  3LIE A;  3VP9 A;  2NPS C;  2YKQ A;  3SWY A;  3A2A A;  1KFN A;  1W2E A;  4W80 A;  4XE5 B;  5AW8 B;  1S9K D;  1N73 A;  3RK2 D;  1FZC C;  5CCG C;  1GU5 A;  1KIL A;  2N1T A;  3L35 A;  1FOS E;  1HGV A;  3TNU A;  4LLH A;  4M3L A;  3M0D A;  1LTJ B;  3P8C E;  3VP8 A;  4DOJ A;  1JY3 O;  2A45 G;  1OWA A;  2XU6 A;  1X79 B;  3B5N C;  3H32 B;  4JYC A;  3BVH A;  2IPP A;  1LT9 C;  4WB4 A;  2HOD B;  1URQ D;  1N7S D;  3M06 A;  1GW3 A;  2YKP A;  4W7Y A;  5CJ4 A;  2P67 A;  3TSI A;  1IFJ A;  1T3J A;  1T3U A;  1G1J A;  2R5D A;  4GKG A;  1N73 B;  2KP8 A;  1N73 C;  3TYY A;  2L5G B;  1LGH B;  2JJL A;  2VRS A;  3KQG A;  3BAT A;  2YNY A;  1CI6 A;  1N86 A;  1CZQ A;  3RK3 B;  2C0X A;  3P8M C;  4N6J A;  1ZLL A;  1SQV K;  1J1E B;  5AVT B;  1SFC B;  3L36 A;  3TK1 A;  2H43 A;  2BAS A;  4WY4 D;  3VTP C;  4I6M C;  1LT9 B;  5AVS B;  3R2P A;  1JY2 O;  1GL2 B;  3BRT B;  3MIW A;  2A45 I;  5APX A;  2R32 A;  1YTZ T;  1RE4 C;  2Q7C A;  2E42 A;  5BU8 B;  3U1A A;  1WT6 A;  1E5W A;  1JNM A;  3HTK B;  2WT7 B;  3UIA A;  1GU4 A;  1ZR2 A;  1KIL D;  2N1T D;  5APV A;  2J59 M;  1RF1 A;  1FOS F;  1LTA C;  1FZC B;  4RES B;  2WIT A;  3M9H A;  4Y99 B;  4IFF A;  2OYH C;  4W7Z A;  1LTS C;  2C9N Y;  1N2D C;  1SP4 A;  1HTL C;  2WPR A;  3N7N A;  3P32 A;  3HRN A;  3HE5 A;  5KLV K;  2OYI C;  3VMZ A;  2FKW B;  1GL2 A;  2YO3 A;  1N7S A;  2M3B A;  5APU A;  1M1J C;  2JEE A;  2Q9I A;  1GZL A;  3EFG A;  1J1D C;  3I5C A;  2FFD A;  4C46 A;  1H89 A;  1G2C B;  5CCH D;  3V4Q A;  3O8Z A;  2MJZ A;  1JCD A;  1MUU A;  3NFQ A;  2R5B A;  2M8R A;  5BU5 A;  1SVF A;  3RL0 B;  1URQ C;  5AW7 B;  1T2K C;  2ZFC A;  1KQL A;  1NKZ B;  2Q3I A;  5KJ7 C;  4Y99 C;  2W6B A;  4GT1 A;  1LTG C;  2KSJ A;  4I2L C;  3GHG B;  1G1I A;  1JY3 N;  3A5T A;  1XTC C;  3NXS A;  1M1J A;  1LTJ A;  5APY A;  1M1J B;  2XV5 A;  1L4A C;  4ZKP A;  2Q5U A;  4WBA A;  2E43 A;  2O01 H;  2Z5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...