3VTPC

Hiv fusion inhibitor mt-c34
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
41
structure length
41
Chain Sequence
QQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein/antiviral protein
molecule keywords Transmembrane protein gp41
publication title The M-T hook structure is critical for design of HIV-1 fusion inhibitors.
pubmed doi rcsb
total genus 19
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2012-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3vtpC00
5APWA 1FAVA 1GU5A 3V4QA 1H8AA 1MFZA 3MD0A 2WPRA 3TYYA 1H88A 3M9BA 1FOSF 5AW4B 2KP8A 2C9NY 2E43A 3O8ZA 5CMZA 5APUA 2YNYA 1OWAA 2IPPA 3NTNA 1GK4A 5AVTB 4JYCA 5AVQB 4KHXA 5AW1B 5AW6B 1H89A 2Z5HA 1IO4A 5AVVB 3TK1A 4XE5B 2W27A 1S9KE 5AVRB 2C9LY 4RESB 2P2UA 3KDPB 5AW9B 4B86A 2YO3A 1T2KD 5AW7B 3A7OA 2P67A 5APXA 2N9BA 3HE5B 3OAKA 3V5BA 2R32A 5AVZB 5AVUB 2BASA 3L36A 4I2LC 3TNUA 3VTPC 2R3CA 2WT7B 3L37A 3I5CA 3UIAA 4HYTB 1A02J 5APSA 3HTKA 3LIEA 1X8YA 2Z5IA 3LIDA 1JNMA 1NWQA 1GK6A 5AVSB 1JUNA 3V4WA 2Q5UA 5AW3B 1CZQA 1FOSE 4DZOA 3VMYA 4M3LA 1HWTC 3L35A 2QM7A 1T2KC 1HJBA 2P7JA 2WWWA 2XZRA 3A2AA 4JYBA 3VN0A 4I6MC 3TNUB 5AW8B 3VMZA 1NAFA 2VRSA 3M06A 1GTWA 1SP4A 1HUCA 1CSBA 5APQA 5AVWB 4EOTA 4C46A 3A5TA 3M9HA 4C7NA 2XU6A 2ZXEB 2QM8A 1GU4A 3HE4A 2ZFCA 1GD2E 3M91A 2WPQA 1G2CB 3M0AA 4AUWA 3M0DA 1CI6A 2Q7CA 4GKGA 3VYIA 5AW2B 2R5BA 3IR9A 1GZLA 2WTYA 3NMDA 2XV5A 1MV8A 3B8EB 4LC1A 3KQGA 3NFQA 3P8MC 2WPSA 3VMXA 1S9KD 5AW5B 2E42A 2WT7A 4C7NB 1MUUA 2Q3IA 5APTA 3HE4B 1HBWA 3A3YB 3T97A 1DH3A 5APVA 1J2JB 4AQRD 5AW0B 1CI6B 1A02F 2W6AA 3MGNA 3NXSA 5AVYB 2JJLA 4AYCA 5APYA 2R5DA 1YYCA 3P7KA 2YO2A 4GT1A 1OXZA 1KQLA 1SLQA 3P32A 3SWFA 2H7HA 5AVXB 3HE5A
chains in the Genus database with same CATH superfamily
1KQFB 4WB4A 3EWKA 2NPSD 2WPRA 3HD7B 1H88A 5AW4B 3TGUG 5CBOA 1EXIA 5AVTB 3KPEA 5AVVB 4PJ0E 5KLVD 2O01H 2A06E 1BCCG 3AE4C 1GL2C 5AW7B 5BU8B 1L4AD 2WSEH 1Q82Q 1SQVD 2R32A 3BCCD 4OGQC 5KLVE 1GL2A 4BXLA 1KYOE 2RH0A 4QMAA 2PAJA 4ZKPA 2XNDH 3A0HE 1OX3A 1OW7A 1M1JC 3H1IG 3L70J 1HWTC 1VQOP 2OYIC 1HJBA 1FZEA 2E74D 1LT1A 3AE7C 3TNUB 2K3RA 2OYIA 1SP4A 3AE3C 2L5GB 4C46A 2N1TA 2XNXA 2LXBA 1L0LJ 1SQVG 1W2EA 3Q5RA 2ZAEB 2YMKA 1VQ4P 1EQ7A 2IX7C 1J1EB 4R4MA 1EZVD 4RO0A 2BEQD 3AEDC 1E5WA 2M5AA 1VQPP 5TISH 3OJAB 2XDJA 3CXHE 2N9YB 4LLHA 2R3SA 1OIPA 3CLQA 2O1JA 5GTHH 1FOSF 3B5NB 1GK4A 1EDJA 2KYVA 2MJZA 2E76B 4NPDA 1LWUB 2D2CC 3RBZA 1H0TB 3L74G 2OYHB 1S3JA 2HPCB 3A7OA 1P84E 1URQB 1KFMA 1SQVK 3WU2E 2OTLP 3H32B 1EZVG 3L37A 3MUDC 2V4HA 1OZHA 2NRGA 2ZVOB 2AXTE 3CCQP 1VQ6P 1X8YA 1JTHA 3E1IA 1RHZB 4L73A 3MUDA 4GOEA 2A45H 3HD7C 1JM0A 1NTME 2RKLA 2VRSA 1SQBG 1FZAA 5C39A 4DCKA 3ABVC 1AFOA 2ZXEB 4NPEA 1SQXD 1Q2NA 2M3BA 2FXOA 1PPJD 4WWIA 5M1BA 3AE9C 1RQUA 3KQGA 3NFQA 3GG2A 2C0XA 1PPJE 3QWOC 2JWAA 1L0ND 3AE8C 3P8CD 3L71J 3RK2D 1KB9I 4XFJA 1BGYE 3H1HJ 3II6A 5BU5A 3SWFA 2W8ZA 5APWA 3L75G 2Q6QA 3U1AA 1OW8A 1SQPG 1S2EA 1LT9B 2BCCD 4JYCA 1LJ2A 1SQBK 1IFIA 4H0LB 4IL6E 1PZQA 5BVZA 1ZLLA 1J1EC 4TLFA 3L36A 3RGUA 3CX5H 2HLOA 4U3FE 3AE1C 3AECC 2Q9IA 1YJNP 3LIEA 3D6YA 2GA1A 3RBXA 3JSVC 1YI2P 1K9MQ 1PFIA 2IFMA 4DZOA 1EDLA 3C1LA 1BCCJ 2PRRA 3B5NC 1VQ9P 1PP9D 1KN7A 4I6MC 1HVVA 1RF1A 1LWUC 1SQXK 4IFMA 2OYHC 2ZYDA 1RH5B 1SFCB 1SQPK 3H1IJ 1URQC 2KB7P 1H0TA 2IYPA 3MZWB 2OYHA 1RQVA 1OVRA 1IFPA 1S72P 2E75B 3H32A 3JC22 1S9KD 1HGZA 3Q5SA 5H2FE 1ZMEC 3U1CA 3H1KG 1W2BO 5KLVJ 1L0NK 2ZVNB 4BRYB 3C8VA 2JJLA 1SQVJ 4KT0J 3BCCJ 3GLMA 1TU3F 1XTCC 1RY3A 4UB8E 2ZXXA 1JY2P 1NGMB 1MFZA 4PD4D 1JEKA 1X79B 1IK7A 3L70E 1FC2C 1N7SB 3IAOA 3FXDA 1EDIA 5E79E 2Q1KA 4PD4E 1FZFA 3PLNA 4WY4B 1DD3A 3D70A 2Y9YA 3CCSP 2FYUD 3TF5A 1Y8AA 1EZVI 2IDBA 1L0LE 3E1RA 2HODB 4YTPC 3VMAA 1DEEG 3PP5A 3L74J 5CCHC 4EIJA 2FFDB 1LT9C 1CSBA 5CCHA 3LW5H 2WSCH 1LNQA 4DOJA 4H0LC 2AEMA 3FGAD 5CHXA 5KJ7C 1CI6A 4EDFA 2W6JH 1M56D 3H1LG 2FYUG 1GW4A 2FXMA 1VL2A 4H44D 1KILB 1LTJB 2JR8A 2OTKE 3RK3B 2ZYAA 2WQYC 1NKNA 5B5EE 1QVFO 2Y0DA 3CCUP 5AVXB 1VDFA 3HE5A 1ZP0C 1H8AA 3SFEC 2O1KA 1AQTA 1SFCC 2IPPA 1HH0A 3W68A 1MKMA 5GTIE 3SWKA 1HF9A 2E75C 1IFMA 2QA4P 1PGPA 1HJ0A 3GF7A 5AVUB 3CC4P 3B71A 1VF5B 5KAIE 1SQXJ 2R3CA 2WT7B 2FYUK 3UIAA 3GHGB 4H13B 4BRYA 2FXPA 1FDOA 4D6TG 2Q5UA 3VP9A 3VMYA 2B9BA 2KZIA 3CCVP 3CWBD 2QM7A 3MP7B 3VN0A 1RE4A 1NAFA 1N7SC 1BE3D 1L0NJ 3L73D 3L71E 3Q2YA 3A5TA 4OWFA 2NPSB 4WY4C 2W83C 3AE5C 1KILE 3RK3E 3H1HE 4WY4A 1NU1G 2V7QH 2ZT9C 1Z56A 1T8ZA 1PGOA 2BCCJ 1L4AB 3R4YA 1KB9E 3T97A 1KORA 1DD4A 2WSFH 1ZXGA 4K35A 3CC2P 3TGUD 4IL6H 3CX5D 2FFDC 1GL2D 3I56P 1R5SA 1JY3P 1FJKA 3P32A 4OGQD 4JBZA 1FAVA 2FFDA 2WITA 5APUA 3VP8A 1X22A 4KHXA 1BCCE 4R4LA 1IZNB 2HR3A 1QX8A 4IL6X 1PP9J 3S9OA 1JY2N 1NTKD 3V5BA 1MZ9A 1KILC 1LTJC 3RK3C 2BASA 1NU1K 3WUUA 3V2RA 3H1IE 2HYNA 4L76A 1ZRTE 3G4SP 2WPVB 1G1JA 4ZNCA 4W7YA 2XZRA 4PD4I 2O01J 2RMZA 3EFGA 1FDIA 3AEFC 2ZFCA 1QVGO 1SQVE 1ZW0A 3BCCE 2FY8A 2Y0EA 1VQMP 4L75A 1NTKG 1IC2A 3CCJP 2W90A 1VF5C 2NZ2A 1FZCB 2WTYA 1M1JA 3CL3D 2K9YA 3B8EB 3GHGC 4L74A 4H13C 2WT7A 4C7NB 5K5GB 3GHGA 5E79H 1DH3A 1KV4A 1S4XA 5CJ0A 1YQ4C 1IFNA 2D2CD 2G3AA 1USEA 5AVYB 4PV1D 2B88A 1VQLP 2M0BA 3B4SA 2GUVA 2FYUJ 3VOPA 2NPSC 3L74D 4W7ZA 5CMZA 4I7ZB 1FZBA 4RKUJ 3L74E 4O9BA 3KYQA 1ZOYC 1ZR4A 1L4AC 1S5LH 2KNCA 3OAKA 1EZVE 1NTKK 4MN4C 1J1DB 5TJHA 3JCUH 2HFED 3I5CA 2H88C 1SQBD 3AEEC 3G3ZA 1NO4A 2O01N 3N7NA 2YMYA 3C9IA 1S5LX 2OARA 4I1LA 2A45I 3H1JG 5AVWB 2KS1B 4BWNA 2Q7CA 3VYIA 1KMIZ 2K1AA 3IR9A 3RL0B 1U7MA 3HD7A 3HE4B 1NTZD 1LTGC 2C0WA 3L75D 2LXCB 2ITAA 1SQPD 2PGDA 3AEGC 1YYCA 2Y0CA 3M9QA 3FWLA 1NU1J 1SQXE 1VQ7P 3L75E 3V4QA 1SQPE 4HJGH 2E43A 3R2PA 2CPSA 3CWBJ 1KZUB 4XE5B 4TT3H 3KZIE 1FZCC 1AJYA 1JY3N 2W27A 4JQ0D 5KAFE 2LR2A 3B5ND 2I8DA 1L0NE 2J5UA 1BE3J 1LTBC 2KXPB 1FZCA 3P8CE 3L73J 4JPZB 4NPFX 1NTMG 3S1KA 1NTZG 3TNUA 2OYOA 1NHLA 4HYTB 1NVOA 2OQQA 5KTBA 1OFCX 2JP3A 3CX5I 1URQD 4GOFA 3Q1MA 1GDTA 3V2PA 4EI2A 2BCCE 2WWWA 3MTUE 4I7ZC 1GTWA 2JO1A 1D7MA 1OVVA 5APQA 3HTKB 2POHA 3TGUJ 1JMMA 1G2CB 3H1KD 4ZKUA 2QEXP 1SQQG 3U59A 1J1DC 3MIWA 3IF4A 2E5TA 2ZJSE 1BGYG 3KHUA 3BRVB 2QJPB 2WMMA 2E76C 3OW2O 3A3YB 3B5NA 2JWDA 1Q7YQ 2K9JB 3PH0A 1NTZK 1PP9E 5B66H 1NAYA 1NTKJ 4UB6E 1LWUA 3CD6P 2FYZA 1FS0E 2R5DA 1KQLA 2HPCA 2H43A 1URQA 2J58A 3TYYA 1AA0A 3M9BA 3O8ZA 4PJ0H 2KS1A 1S9KE 2YO3A 3RL0C 5CCHD 4N3YB 2W6BA 1SQQK 1KYOH 1JY3O 2FYNB 2YKPA 4GIFA 3A0HH 4H0LD 5L8RJ 1N73B 3AE2C 3G9RA 5KLIB 1JO5A 1BDCA 2HG5D 1HUCA 2OTJP 3H1LD 1JMBA 2XU6A 5CJ4A 3F89A 2AEFA 2Y9ZA 2GUSA 2FYUE 3A0BE 5DJUB 3D6ZA 3WMM0 1GZLA 3P8MC 2WPSA 2E42A 1Q81Q 3H1JJ 1VPCA 1LT9A 5APVA 3BATA 3PTZA 4KJMA 2B87B 5AW0B 1A02F 1NOHA 3CXHH 2E75D 2WSCJ 5TISE 1SLQA 1DX7A 5KJ7A 2KUBA 5GTHE 1SQBJ 1WMKA 1T3UA 1L0LG 2BEZF 5AVQB 2QJKB 2QRXA 1NYHA 1P84H 2QJPC 4D6TD 2KIKA 2N9BA 3WU2H 1YJWP 2IZ0A 1N7SD 1HGVA 2GM4A 4HKZH 2AXTH 4D6TE 1XTGB 2IBZD 4WY4D 1JNMA 3WUTA 3V4WA 3KXDA 2QJYB 1SFCA 1IK9A 1T2KC 2ZT9D 3VMZA 1IJDB 1NU1D 1NTZJ 1EC5A 3AE6C 4OGQB 3L75J 4EYYQ 4ASWA 1SQPJ 3M0AA 1NU1E 2FYNC 1M8OB 1IFDA 1JCCA 4ZMDA 2IBZG 2KK7A 2N1TB 3CWBE 3OA7A 3KZIH 3V2NA 1N7SA 2Q3EA 5KLIC 2Z4EA 4DJGA 1BE3E 3N4XA 1M90Q 3L73E 1AV1A 1SQQJ 3CMAP 2R44A 1KTMA 3L72D 2V7QJ 2C9NY 1FDMA 3PJSK 2CPBA 1E79H 1T3JA 4C7RA 3SFDC 1BSNA 4DT0A 2O3JA 2HODA 2WSFJ 1OW6A 5APXA 2OGUA 1SVFA 2RN0A 4GDOA 2XKMA 3TGUE 3CCEP 3CX5E 2E74B 3H1KJ 3L71G 2B87A 5CCGC 1CZQA 3H1HG 4GODA 3L72G 2G8YA 5CCGA 4PV1B 1GMJA 1PIXA 4H13D 5EFWB 1Y47A 2E5YA 3M9HA 3CCMP 1KILA 1LTJA 1FZGA 1JTHB 2QJKC 1GD2E 2YXQB 1NTKE 2DW3A 3FXEA 1ZR2A 4GKGA 3W67A 3ZDMA 1PGJA 2XV5A 5H2FH 2A06D 3BVHA 2H89C 2WSEJ 2QJYC 4AQRD 3D71A 1KYOD 1K05A 4UB8H 4OH8B 2JDIH 2JEEA 3MD0A 3F5HA 1FBMA 3WUVA 1LTIC 2CK3H 4PD4H 1H89A 3TK1A 1YQ3C 3Q3DA 2B89A 3FWNA 1USDA 5AW9B 4B86A 2A06G 1YITP 2N1TC 3H1LJ 1RF0C 4YPCA 4I2LC 3G6EP 1U57A 1RE3C 3PHLA 5KLVG 1RF0A 1GW3A 2NPSA 1NWQA 1JUNA 3H1JD 4WVZA 1RE3A 3BCCG 3A0BH 2LKMA 3HD7D 2P7JA 1N2DC 3H1JE 4JYBA 1PL5A 1BDDA 3CXHD 4EOTA 1L4AA 3HUSB 3M0DC 2KOGA 1JY2O 3M0DA 2KSJA 3RK2B 2M3EA 2E74C 1SQBE 3HRNA 1BSHA 4K3AA 1RF1B 1MUUA 2IBZI 1OMIA 2SPZA 1X9VA 1P84D 5B5EH 3I55P 5KLVK 2JKVA 4D6TJ 4PV1C 4AYCA 5APYA 1FJPA 2YO2A 3AEBC 1LTTC 4RJTA 2FBWC 1GU5A 4Y99B 2KP8A 3NTNA 1NTMD 3CI9A 5GTIH 3EQ2A 5KKZB 4IOIH 5AW1B 2Z5HA 1IO4A 3S4RA 1NTZE 1YJ9P 4IFDK 2QG4A 5AVZB 5KAIH 3CCRP 2YIUB 1W5CE 3A2AA 1SQQD 3M06A 2KLVA 2E76D 4C7NA 1K04A 2QM8A 1BGYD 3IN6A 1PV3A 2IFNA 1SQQE 3Q5PA 1R5LA 2MKVA 1Q86Q 1L2PA 3L72J 1SQXG 1K8AQ 3VMXA 1KB9H 3GW6A 1HBWA 3FX0A 1UIXA 2AXCA 1PPJG 3H25A 3RL0g 2FKWB 1J2JB 1CI6B 4U3FD 2J59M 3RL0D 4ASVA 1QEXA 1OXZA 2I1JA 3BRTB 3HUSC 1L0NG 3CPWO 1YHQP 3H1KE 1N7LA 4HB1A 3O6QB 3CC7P 3HUSA 4IFFA 1YTZI 1EDKA 1NTMK 2KI7B 3E7KA 3RK2C 1AVYA 2C9LY 4YXWH 1JOCA 1RF1C 3HE5B 2BCCG 1CW5A 3VTPC 1VQKP 1QLED 3PRJA 4U3FG 1AVOA 1GK6A 3K5BA 1KYOI 1U7JA 5AW3B 4M3LA 1NJIQ 3H6PA 3L35A 4Y99C 1T6AA 3TSIA 5KKZC 3QH9A 3IFMA 1N8RQ 1ZN5A 3HE4A 1NKZB 4H44B 5CBNA 1Y9BA 5KJ7D 4AUWA 1PP9G 2WSSH 1HTLC 3L70D 2R5BA 1OVUA 5DJTB 1MV8A 2P10A 1ZV8A 5AW5B 1FE6A 4W80A 2Q3IA 5APTA 3GMAA 2I1KA 2YIUC 3NXSA 3H1LE 1L0LD 1AQ5A 2H7HA 3CXHI 2ZT9B 3T97B 1UIIA 1YTZT 1SFCD 1QL1A 4CPGA 2QVAA 3BASA 3L70G 3AEAC 1KQGB 5AVRB 1G1IA 3KDPB 3LW5J 1PGQA 1T2KD 2P67A 1S5LE 1KQSO 1LP1B 4LGDE 1P84I 4OVNF 3MHVA 3SWYA 1KFNA 1A02J 3JCUE 4N78D 3HTKA 3LIDA 2PP6A 1N86A 1FOSE 1G2CA 2IZ1A 2AEJA 1WRGA 1KD1Q 4JF7A 4N78E 1JB0J 3SSUA 1YIJP 4Y28J 5AW8B 3O6QA 1EXJA 1MFTA 2K9JA 3V2QA 2IYOA 2YKQA 5AW2B 1WT6A 1FU1A 2IBZE 1LTSC 3NMDA 4LC1A 1GL2B 4YXDC 1NTMJ 3L4FA 1Q90D 3EFFK 3USSA 1KC8Q 2KLUA 1LTAC 2W6AA 2WVRA 3MGNA 3P7KA 2P58A 1L0LK 2UWJE 1M1JB 1YBKA 3V6IA 4A7PA 4Z1MH 4U7JA 1QGKB 2OYIB 2L91A 4H44C 2YNYA 1OWAA 1N73C 5AW6B 1JCDA 5CCGD 1SS1A 2YKOA 2K37A 3GF3A 1RE4C 4RESB 2P2UA 2WZ7A 3L71D 1N73A 5KAFH 2M8RA 3CMEP 2YXRB 2A45G 1KILD 2QSIA 2QE7H 3RK3D 1BGYJ 3H1HD 1VQ8P 2K88A 4XA4A 5APSA 2Z5IA 5AVSB 1DIPA 1X0TA 2M5AB 1R8EA 1M1KQ 3L72E 1KB9D 2KNCB 2H8PD 1IFJA 1M7LA 2KZJA 3TDKA 1VQNP 1NH4A 1QL2A 1DEBA 1GU4A 4WBAA 3CCLP 2PFXA 3CWBG 4U3FJ 3M91A 2WPQA 1M57D 2KSEA 1BE3G 1VF5D 3L73G 1BCCD 2D2CB 1K73Q 3ITKA 1LP1A 4HH2A 2ZYGA 1S1CX 1LGHB 2QIWA 2P1JA 5B66E 4UB6H 3G71P 4N6JA 1VQ5P 4GT1A 3H1ID 2N1TD 1ZRTD
chains in the Genus database with same CATH topology
1URQA 1GU5A 2J58A 1H8AA 4WB4A 3TYYA 2NPSD 2WPRA 3HD7B 4Y99B 1H88A 3M9BA 5AW4B 2O1KA 2KP8A 3O8ZA 1SFCC 2IPPA 3NTNA 5AVTB 3CI9A 1HH0A 3EQ2A 3KPEA 5AW1B 2Z5HA 1IO4A 5AVVB 2O01H 1S9KE 1GL2C 2YO3A 1IFMA 3RL0C 5AW7B 5CCHD 5BU8B 1L4AD 2WSEH 4IFDK 2R32A 4N3YB 5AVZB 5AVUB 2W6BA 1SQQK 1GL2A 2R3CA 1JY3O 2WT7B 2YKPA 4GIFA 2FYUK 2PAJA 4ZKPA 3UIAA 3GHGB 1M1JC 2Q5UA 3VP9A 1N73B 3VMYA 1HWTC 2OYIC 2QM7A 1HJBA 1FZEA 1JO5A 2HG5D 3A2AA 3VN0A 3TNUB 1RE4A 1NAFA 3M06A 1N7SC 2OYIA 2KLVA 1SP4A 1HUCA 2L5GB 4C46A 3A5TA 4C7NA 2XU6A 2N1TA 2QM8A 5CJ4A 2NPSB 2XNXA 4WY4C 2IFNA 2GUSA 1W2EA 4WY4A 1Z56A 1GZLA 3WMM0 1T8ZA 3P8MC 2WPSA 3VMXA 2E42A 1EQ7A 1L4AB 1HBWA 2IX7C 1J1EB 3T97A 1VPCA 1LT9A 2WSFH 5APVA 3BATA 2FKWB 1J2JB 1E5WA 5AW0B 1CI6B 1A02F 1NOHA 3OJAB 2J59M 2XDJA 2FFDC 1GL2D 3RL0D 4LLHA 1JY3P 1FJKA 1OXZA 2I1JA 3P32A 1SLQA 3BRTB 3CLQA 2O1JA 1DX7A 5KJ7A 3HUSC 1FAVA 2FFDA 2WITA 1FOSF 3B5NB 1N7LA 1T3UA 5APUA 1GK4A 3VP8A 3HUSA 4IFFA 1YTZI 2KYVA 1NTMK 2MJZA 4KHXA 5AVQB 3RK2C 1LWUB 2C9LY 2OYHB 2HPCB 1JOCA 1JY2N 3A7OA 2N9BA 1RF1C 3HE5B 3V5BA 1URQB 1MZ9A 1KILC 1LTJC 1KFMA 1SQVK 3RK3C 3H32B 2BASA 1N7SD 1CW5A 1NU1K 3VTPC 1HGVA 2GM4A 3L37A 3V2RA 1XTGB 4WY4D 1X8YA 1JNMA 1JTHA 2HYNA 1GK6A 3V4WA 3E1IA 5AW3B 3MUDA 4M3LA 1SFCA 2A45H 3H6PA 1IK9A 3L35A 3HD7C 1G1JA 4Y99C 1T2KC 4W7YA 2XZRA 3VMZA 2VRSA 3TSIA 1IJDB 1FZAA 3EFGA 3IFMA 1AFOA 2ZXEB 1ZN5A 3HE4A 2ZFCA 1NKZB 3M0AA 2M3BA 5KJ7D 4AUWA 1IC2A 1HTLC 2R5BA 1FZCB 2WTYA 1M1JA 3CL3D 1IFDA 1MV8A 1JCCA 3B8EB 3GHGC 3KQGA 3NFQA 2C0XA 1ZV8A 5AW5B 2WT7A 4C7NB 4W80A 2N1TB 2Q3IA 5APTA 3GHGA 1DH3A 3OA7A 3P8CD 3V2NA 1N7SA 2I1KA 3RK2D 2Z4EA 5CJ0A 1IFNA 3NXSA 5AVYB 3N4XA 1AQ5A 3II6A 5BU5A 3SWFA 2H7HA 2GUVA 3VOPA 5APWA 2NPSC 2C9NY 4W7ZA 1FDMA 3U1AA 5CMZA 1YTZT 2CPBA 1LT9B 1SFCD 1QL1A 4JYCA 1T3JA 1SQBK 4C7RA 1FZBA 3BASA 1IFIA 4O9BA 3KYQA 5AVRB 1ZR4A 1G1IA 3KDPB 2HODA 1T2KD 5BVZA 2P67A 5APXA 1L4AC 3OAKA 1ZLLA 1J1EC 1NTKK 1SVFA 3L36A 2XKMA 1J1DB 2HLOA 4LGDE 2HFED 3I5CA 3SWYA 1KFNA 1A02J 2Q9IA 4N78D 3HTKA 3LIEA 3LIDA 2PP6A 3G3ZA 1NO4A 3N7NA 1N86A 1PFIA 5CCGC 1CZQA 2IFMA 4DZOA 1G2CA 1FOSE 2YMYA 3C9IA 1WRGA 4JF7A 4N78E 3B5NC 2OARA 5CCGA 4I1LA 4I6MC 5AW8B 2A45I 1HVVA 5AVWB 3M9HA 1RF1A 1LWUC 1KILA 1LTJA 1FZGA 1JTHB 1GD2E 1SQXK 4IFMA 2OYHC 3V2QA 1SFCB 1SQPK 1URQC 1ZR2A 2Q7CA 3VYIA 4GKGA 2KB7P 2YKQA 5AW2B 1WT6A 2OYHA 1FU1A 3IR9A 1LTSC 3NMDA 2XV5A 4LC1A 1GL2B 3H32A 3RL0B 1S9KD 1HGZA 3HD7A 3BVHA 3HE4B 3U1CA 3L4FA 1L0NK 1LTGC 2C0WA 4AQRD 1LTAC 2W6AA 3MGNA 2JJLA 3P7KA 1YYCA 3M9QA 1L0LK 1M1JB 1XTCC 4OH8B 1RY3A 2JEEA 1JY2P 3V4QA 1MFZA 3MD0A 2OYIB 2E43A 3R2PA 1FBMA 2YNYA 1OWAA 2CPSA 1X79B 1N7SB 1N73C 1LTIC 1H89A 5AW6B 1JCDA 1KZUB 3TK1A 5CCGD 4XE5B 2YKOA 1FZCC 1JY3N 2W27A 1RE4C 1FZFA 4RESB 2P2UA 2WZ7A 1N73A 4WY4B 5AW9B 4B86A 2M8RA 3B5ND 1LTBC 2N1TC 1FZCA 2A45G 1KILD 3P8CE 3RK3D 1RF0C 4I2LC 3TNUA 1NHLA 4XA4A 1RE3C 4HYTB 5APSA 1RF0A 5KTBA 1GW3A 2Z5IA 2NPSA 1NWQA 1JUNA 5AVSB 1RE3A 1URQD 2HODB 3PP5A 2LKMA 3V2PA 1GDTA 3HD7D 2H8PD 1IFJA 1M7LA 2P7JA 2WWWA 3MTUE 5CCHC 4EIJA 1N2DC 4JYBA 2FFDB 1LT9C 1GTWA 1NH4A 1QL2A 1CSBA 5APQA 4EOTA 1DEBA 5CCHA 1L4AA 1GU4A 3HTKB 3HUSB 4WBAA 3M0DC 3LW5H 2WSCH 2POHA 4DOJA 2KOGA 1JY2O 3M91A 2WPQA 1JMMA 1G2CB 5CHXA 5KJ7C 3M0DA 1CI6A 4ZKUA 3U59A 2KSJA 1J1DC 3MIWA 3RK2B 3HRNA 1GW4A 3BRVB 2FXMA 1RF1B 4HH2A 1MUUA 1KILB 1LTJB 3A3YB 3B5NA 3RK3B 1X9VA 1LGHB 1NTZK 1NKNA 2P1JA 5KLVK 4N6JA 1LWUA 4AYCA 5APYA 2FYZA 2R5DA 1FJPA 2YO2A 4GT1A 1KQLA 2N1TD 2H43A 2HPCA 1LTTC 5AVXB 1VDFA 3HE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5APW A;  1FAV A;  1GU5 A;  3V4Q A;  1H8A A;  1MFZ A;  3MD0 A;  2WPR A;  3TYY A;  1H88 A;  3M9B A;  1FOS F;  5AW4 B;  2KP8 A;  2C9N Y;  2E43 A;  3O8Z A;  5CMZ A;  5APU A;  2YNY A;  1OWA A;  2IPP A;  3NTN A;  1GK4 A;  5AVT B;  4JYC A;  5AVQ B;  4KHX A;  5AW1 B;  5AW6 B;  1H89 A;  2Z5H A;  1IO4 A;  5AVV B;  3TK1 A;  4XE5 B;  2W27 A;  1S9K E;  5AVR B;  2C9L Y;  4RES B;  2P2U A;  3KDP B;  5AW9 B;  4B86 A;  2YO3 A;  1T2K D;  5AW7 B;  3A7O A;  2P67 A;  5APX A;  2N9B A;  3HE5 B;  3OAK A;  3V5B A;  2R32 A;  5AVZ B;  5AVU B;  2BAS A;  3L36 A;  4I2L C;  3TNU A;  3VTP C;  2R3C A;  2WT7 B;  3L37 A;  3I5C A;  3UIA A;  4HYT B;  1A02 J;  5APS A;  3HTK A;  3LIE A;  1X8Y A;  2Z5I A;  3LID A;  1JNM A;  1NWQ A;  1GK6 A;  5AVS B;  1JUN A;  3V4W A;  2Q5U A;  5AW3 B;  1CZQ A;  1FOS E;  4DZO A;  3VMY A;  4M3L A;  1HWT C;  3L35 A;  2QM7 A;  1T2K C;  1HJB A;  2P7J A;  2WWW A;  2XZR A;  3A2A A;  4JYB A;  3VN0 A;  4I6M C;  3TNU B;  5AW8 B;  3VMZ A;  1NAF A;  2VRS A;  3M06 A;  1GTW A;  1SP4 A;  1HUC A;  1CSB A;  5APQ A;  5AVW B;  4EOT A;  4C46 A;  3A5T A;  3M9H A;  4C7N A;  2XU6 A;  2ZXE B;  2QM8 A;  1GU4 A;  3HE4 A;  2ZFC A;  1GD2 E;  3M91 A;  2WPQ A;  1G2C B;  3M0A A;  4AUW A;  3M0D A;  1CI6 A;  2Q7C A;  4GKG A;  3VYI A;  5AW2 B;  2R5B A;  3IR9 A;  1GZL A;  2WTY A;  3NMD A;  2XV5 A;  1MV8 A;  3B8E B;  4LC1 A;  3KQG A;  3NFQ A;  3P8M C;  2WPS A;  3VMX A;  1S9K D;  5AW5 B;  2E42 A;  2WT7 A;  4C7N B;  1MUU A;  2Q3I A;  5APT A;  3HE4 B;  1HBW A;  3A3Y B;  3T97 A;  1DH3 A;  5APV A;  1J2J B;  4AQR D;  5AW0 B;  1CI6 B;  1A02 F;  2W6A A;  3MGN A;  3NXS A;  5AVY B;  2JJL A;  4AYC A;  5APY A;  2R5D A;  1YYC A;  3P7K A;  2YO2 A;  4GT1 A;  1OXZ A;  1KQL A;  1SLQ A;  3P32 A;  3SWF A;  2H7H A;  5AVX B;  3HE5 A; 
#chains in the Genus database with same CATH topology
 1KQF B;  4WB4 A;  3EWK A;  2NPS D;  2WPR A;  3HD7 B;  1H88 A;  5AW4 B;  3TGU G;  5CBO A;  1EXI A;  5AVT B;  3KPE A;  5AVV B;  4PJ0 E;  5KLV D;  2O01 H;  2A06 E;  1BCC G;  3AE4 C;  1GL2 C;  5AW7 B;  5BU8 B;  1L4A D;  2WSE H;  1Q82 Q;  1SQV D;  2R32 A;  3BCC D;  4OGQ C;  5KLV E;  1GL2 A;  4BXL A;  1KYO E;  2RH0 A;  4QMA A;  2PAJ A;  4ZKP A;  2XND H;  3A0H E;  1OX3 A;  1OW7 A;  1M1J C;  3H1I G;  3L70 J;  1HWT C;  1VQO P;  2OYI C;  1HJB A;  1FZE A;  2E74 D;  1LT1 A;  3AE7 C;  3TNU B;  2K3R A;  2OYI A;  1SP4 A;  3AE3 C;  2L5G B;  4C46 A;  2N1T A;  2XNX A;  2LXB A;  1L0L J;  1SQV G;  1W2E A;  3Q5R A;  2ZAE B;  2YMK A;  1VQ4 P;  1EQ7 A;  2IX7 C;  1J1E B;  4R4M A;  1EZV D;  4RO0 A;  2BEQ D;  3AED C;  1E5W A;  2M5A A;  1VQP P;  5TIS H;  3OJA B;  2XDJ A;  3CXH E;  2N9Y B;  4LLH A;  2R3S A;  1OIP A;  3CLQ A;  2O1J A;  5GTH H;  1FOS F;  3B5N B;  1GK4 A;  1EDJ A;  2KYV A;  2MJZ A;  2E76 B;  4NPD A;  1LWU B;  2D2C C;  3RBZ A;  1H0T B;  3L74 G;  2OYH B;  1S3J A;  2HPC B;  3A7O A;  1P84 E;  1URQ B;  1KFM A;  1SQV K;  3WU2 E;  2OTL P;  3H32 B;  1EZV G;  3L37 A;  3MUD C;  2V4H A;  1OZH A;  2NRG A;  2ZVO B;  2AXT E;  3CCQ P;  1VQ6 P;  1X8Y A;  1JTH A;  3E1I A;  1RHZ B;  4L73 A;  3MUD A;  4GOE A;  2A45 H;  3HD7 C;  1JM0 A;  1NTM E;  2RKL A;  2VRS A;  1SQB G;  1FZA A;  5C39 A;  4DCK A;  3ABV C;  1AFO A;  2ZXE B;  4NPE A;  1SQX D;  1Q2N A;  2M3B A;  2FXO A;  1PPJ D;  4WWI A;  5M1B A;  3AE9 C;  1RQU A;  3KQG A;  3NFQ A;  3GG2 A;  2C0X A;  1PPJ E;  3QWO C;  2JWA A;  1L0N D;  3AE8 C;  3P8C D;  3L71 J;  3RK2 D;  1KB9 I;  4XFJ A;  1BGY E;  3H1H J;  3II6 A;  5BU5 A;  3SWF A;  2W8Z A;  5APW A;  3L75 G;  2Q6Q A;  3U1A A;  1OW8 A;  1SQP G;  1S2E A;  1LT9 B;  2BCC D;  4JYC A;  1LJ2 A;  1SQB K;  1IFI A;  4H0L B;  4IL6 E;  1PZQ A;  5BVZ A;  1ZLL A;  1J1E C;  4TLF A;  3L36 A;  3RGU A;  3CX5 H;  2HLO A;  4U3F E;  3AE1 C;  3AEC C;  2Q9I A;  1YJN P;  3LIE A;  3D6Y A;  2GA1 A;  3RBX A;  3JSV C;  1YI2 P;  1K9M Q;  1PFI A;  2IFM A;  4DZO A;  1EDL A;  3C1L A;  1BCC J;  2PRR A;  3B5N C;  1VQ9 P;  1PP9 D;  1KN7 A;  4I6M C;  1HVV A;  1RF1 A;  1LWU C;  1SQX K;  4IFM A;  2OYH C;  2ZYD A;  1RH5 B;  1SFC B;  1SQP K;  3H1I J;  1URQ C;  2KB7 P;  1H0T A;  2IYP A;  3MZW B;  2OYH A;  1RQV A;  1OVR A;  1IFP A;  1S72 P;  2E75 B;  3H32 A;  3JC2 2;  1S9K D;  1HGZ A;  3Q5S A;  5H2F E;  1ZME C;  3U1C A;  3H1K G;  1W2B O;  5KLV J;  1L0N K;  2ZVN B;  4BRY B;  3C8V A;  2JJL A;  1SQV J;  4KT0 J;  3BCC J;  3GLM A;  1TU3 F;  1XTC C;  1RY3 A;  4UB8 E;  2ZXX A;  1JY2 P;  1NGM B;  1MFZ A;  4PD4 D;  1JEK A;  1X79 B;  1IK7 A;  3L70 E;  1FC2 C;  1N7S B;  3IAO A;  3FXD A;  1EDI A;  5E79 E;  2Q1K A;  4PD4 E;  1FZF A;  3PLN A;  4WY4 B;  1DD3 A;  3D70 A;  2Y9Y A;  3CCS P;  2FYU D;  3TF5 A;  1Y8A A;  1EZV I;  2IDB A;  1L0L E;  3E1R A;  2HOD B;  4YTP C;  3VMA A;  1DEE G;  3PP5 A;  3L74 J;  5CCH C;  4EIJ A;  2FFD B;  1LT9 C;  1CSB A;  5CCH A;  3LW5 H;  2WSC H;  1LNQ A;  4DOJ A;  4H0L C;  2AEM A;  3FGA D;  5CHX A;  5KJ7 C;  1CI6 A;  4EDF A;  2W6J H;  1M56 D;  3H1L G;  2FYU G;  1GW4 A;  2FXM A;  1VL2 A;  4H44 D;  1KIL B;  1LTJ B;  2JR8 A;  2OTK E;  3RK3 B;  2ZYA A;  2WQY C;  1NKN A;  5B5E E;  1QVF O;  2Y0D A;  3CCU P;  5AVX B;  1VDF A;  3HE5 A;  1ZP0 C;  1H8A A;  3SFE C;  2O1K A;  1AQT A;  1SFC C;  2IPP A;  1HH0 A;  3W68 A;  1MKM A;  5GTI E;  3SWK A;  1HF9 A;  2E75 C;  1IFM A;  2QA4 P;  1PGP A;  1HJ0 A;  3GF7 A;  5AVU B;  3CC4 P;  3B71 A;  1VF5 B;  5KAI E;  1SQX J;  2R3C A;  2WT7 B;  2FYU K;  3UIA A;  3GHG B;  4H13 B;  4BRY A;  2FXP A;  1FDO A;  4D6T G;  2Q5U A;  3VP9 A;  3VMY A;  2B9B A;  2KZI A;  3CCV P;  3CWB D;  2QM7 A;  3MP7 B;  3VN0 A;  1RE4 A;  1NAF A;  1N7S C;  1BE3 D;  1L0N J;  3L73 D;  3L71 E;  3Q2Y A;  3A5T A;  4OWF A;  2NPS B;  4WY4 C;  2W83 C;  3AE5 C;  1KIL E;  3RK3 E;  3H1H E;  4WY4 A;  1NU1 G;  2V7Q H;  2ZT9 C;  1Z56 A;  1T8Z A;  1PGO A;  2BCC J;  1L4A B;  3R4Y A;  1KB9 E;  3T97 A;  1KOR A;  1DD4 A;  2WSF H;  1ZXG A;  4K35 A;  3CC2 P;  3TGU D;  4IL6 H;  3CX5 D;  2FFD C;  1GL2 D;  3I56 P;  1R5S A;  1JY3 P;  1FJK A;  3P32 A;  4OGQ D;  4JBZ A;  1FAV A;  2FFD A;  2WIT A;  5APU A;  3VP8 A;  1X22 A;  4KHX A;  1BCC E;  4R4L A;  1IZN B;  2HR3 A;  1QX8 A;  4IL6 X;  1PP9 J;  3S9O A;  1JY2 N;  1NTK D;  3V5B A;  1MZ9 A;  1KIL C;  1LTJ C;  3RK3 C;  2BAS A;  1NU1 K;  3WUU A;  3V2R A;  3H1I E;  2HYN A;  4L76 A;  1ZRT E;  3G4S P;  2WPV B;  1G1J A;  4ZNC A;  4W7Y A;  2XZR A;  4PD4 I;  2O01 J;  2RMZ A;  3EFG A;  1FDI A;  3AEF C;  2ZFC A;  1QVG O;  1SQV E;  1ZW0 A;  3BCC E;  2FY8 A;  2Y0E A;  1VQM P;  4L75 A;  1NTK G;  1IC2 A;  3CCJ P;  2W90 A;  1VF5 C;  2NZ2 A;  1FZC B;  2WTY A;  1M1J A;  3CL3 D;  2K9Y A;  3B8E B;  3GHG C;  4L74 A;  4H13 C;  2WT7 A;  4C7N B;  5K5G B;  3GHG A;  5E79 H;  1DH3 A;  1KV4 A;  1S4X A;  5CJ0 A;  1YQ4 C;  1IFN A;  2D2C D;  2G3A A;  1USE A;  5AVY B;  4PV1 D;  2B88 A;  1VQL P;  2M0B A;  3B4S A;  2GUV A;  2FYU J;  3VOP A;  2NPS C;  3L74 D;  4W7Z A;  5CMZ A;  4I7Z B;  1FZB A;  4RKU J;  3L74 E;  4O9B A;  3KYQ A;  1ZOY C;  1ZR4 A;  1L4A C;  1S5L H;  2KNC A;  3OAK A;  1EZV E;  1NTK K;  4MN4 C;  1J1D B;  5TJH A;  3JCU H;  2HFE D;  3I5C A;  2H88 C;  1SQB D;  3AEE C;  3G3Z A;  1NO4 A;  2O01 N;  3N7N A;  2YMY A;  3C9I A;  1S5L X;  2OAR A;  4I1L A;  2A45 I;  3H1J G;  5AVW B;  2KS1 B;  4BWN A;  2Q7C A;  3VYI A;  1KMI Z;  2K1A A;  3IR9 A;  3RL0 B;  1U7M A;  3HD7 A;  3HE4 B;  1NTZ D;  1LTG C;  2C0W A;  3L75 D;  2LXC B;  2ITA A;  1SQP D;  2PGD A;  3AEG C;  1YYC A;  2Y0C A;  3M9Q A;  3FWL A;  1NU1 J;  1SQX E;  1VQ7 P;  3L75 E;  3V4Q A;  1SQP E;  4HJG H;  2E43 A;  3R2P A;  2CPS A;  3CWB J;  1KZU B;  4XE5 B;  4TT3 H;  3KZI E;  1FZC C;  1AJY A;  1JY3 N;  2W27 A;  4JQ0 D;  5KAF E;  2LR2 A;  3B5N D;  2I8D A;  1L0N E;  2J5U A;  1BE3 J;  1LTB C;  2KXP B;  1FZC A;  3P8C E;  3L73 J;  4JPZ B;  4NPF X;  1NTM G;  3S1K A;  1NTZ G;  3TNU A;  2OYO A;  1NHL A;  4HYT B;  1NVO A;  2OQQ A;  5KTB A;  1OFC X;  2JP3 A;  3CX5 I;  1URQ D;  4GOF A;  3Q1M A;  1GDT A;  3V2P A;  4EI2 A;  2BCC E;  2WWW A;  3MTU E;  4I7Z C;  1GTW A;  2JO1 A;  1D7M A;  1OVV A;  5APQ A;  3HTK B;  2POH A;  3TGU J;  1JMM A;  1G2C B;  3H1K D;  4ZKU A;  2QEX P;  1SQQ G;  3U59 A;  1J1D C;  3MIW A;  3IF4 A;  2E5T A;  2ZJS E;  1BGY G;  3KHU A;  3BRV B;  2QJP B;  2WMM A;  2E76 C;  3OW2 O;  3A3Y B;  3B5N A;  2JWD A;  1Q7Y Q;  2K9J B;  3PH0 A;  1NTZ K;  1PP9 E;  5B66 H;  1NAY A;  1NTK J;  4UB6 E;  1LWU A;  3CD6 P;  2FYZ A;  1FS0 E;  2R5D A;  1KQL A;  2HPC A;  2H43 A;  1URQ A;  2J58 A;  3TYY A;  1AA0 A;  3M9B A;  3O8Z A;  4PJ0 H;  2KS1 A;  1S9K E;  2YO3 A;  3RL0 C;  5CCH D;  4N3Y B;  2W6B A;  1SQQ K;  1KYO H;  1JY3 O;  2FYN B;  2YKP A;  4GIF A;  3A0H H;  4H0L D;  5L8R J;  1N73 B;  3AE2 C;  3G9R A;  5KLI B;  1JO5 A;  1BDC A;  2HG5 D;  1HUC A;  2OTJ P;  3H1L D;  1JMB A;  2XU6 A;  5CJ4 A;  3F89 A;  2AEF A;  2Y9Z A;  2GUS A;  2FYU E;  3A0B E;  5DJU B;  3D6Z A;  3WMM 0;  1GZL A;  3P8M C;  2WPS A;  2E42 A;  1Q81 Q;  3H1J J;  1VPC A;  1LT9 A;  5APV A;  3BAT A;  3PTZ A;  4KJM A;  2B87 B;  5AW0 B;  1A02 F;  1NOH A;  3CXH H;  2E75 D;  2WSC J;  5TIS E;  1SLQ A;  1DX7 A;  5KJ7 A;  2KUB A;  5GTH E;  1SQB J;  1WMK A;  1T3U A;  1L0L G;  2BEZ F;  5AVQ B;  2QJK B;  2QRX A;  1NYH A;  1P84 H;  2QJP C;  4D6T D;  2KIK A;  2N9B A;  3WU2 H;  1YJW P;  2IZ0 A;  1N7S D;  1HGV A;  2GM4 A;  4HKZ H;  2AXT H;  4D6T E;  1XTG B;  2IBZ D;  4WY4 D;  1JNM A;  3WUT A;  3V4W A;  3KXD A;  2QJY B;  1SFC A;  1IK9 A;  1T2K C;  2ZT9 D;  3VMZ A;  1IJD B;  1NU1 D;  1NTZ J;  1EC5 A;  3AE6 C;  4OGQ B;  3L75 J;  4EYY Q;  4ASW A;  1SQP J;  3M0A A;  1NU1 E;  2FYN C;  1M8O B;  1IFD A;  1JCC A;  4ZMD A;  2IBZ G;  2KK7 A;  2N1T B;  3CWB E;  3OA7 A;  3KZI H;  3V2N A;  1N7S A;  2Q3E A;  5KLI C;  2Z4E A;  4DJG A;  1BE3 E;  3N4X A;  1M90 Q;  3L73 E;  1AV1 A;  1SQQ J;  3CMA P;  2R44 A;  1KTM A;  3L72 D;  2V7Q J;  2C9N Y;  1FDM A;  3PJS K;  2CPB A;  1E79 H;  1T3J A;  4C7R A;  3SFD C;  1BSN A;  4DT0 A;  2O3J A;  2HOD A;  2WSF J;  1OW6 A;  5APX A;  2OGU A;  1SVF A;  2RN0 A;  4GDO A;  2XKM A;  3TGU E;  3CCE P;  3CX5 E;  2E74 B;  3H1K J;  3L71 G;  2B87 A;  5CCG C;  1CZQ A;  3H1H G;  4GOD A;  3L72 G;  2G8Y A;  5CCG A;  4PV1 B;  1GMJ A;  1PIX A;  4H13 D;  5EFW B;  1Y47 A;  2E5Y A;  3M9H A;  3CCM P;  1KIL A;  1LTJ A;  1FZG A;  1JTH B;  2QJK C;  1GD2 E;  2YXQ B;  1NTK E;  2DW3 A;  3FXE A;  1ZR2 A;  4GKG A;  3W67 A;  3ZDM A;  1PGJ A;  2XV5 A;  5H2F H;  2A06 D;  3BVH A;  2H89 C;  2WSE J;  2QJY C;  4AQR D;  3D71 A;  1KYO D;  1K05 A;  4UB8 H;  4OH8 B;  2JDI H;  2JEE A;  3MD0 A;  3F5H A;  1FBM A;  3WUV A;  1LTI C;  2CK3 H;  4PD4 H;  1H89 A;  3TK1 A;  1YQ3 C;  3Q3D A;  2B89 A;  3FWN A;  1USD A;  5AW9 B;  4B86 A;  2A06 G;  1YIT P;  2N1T C;  3H1L J;  1RF0 C;  4YPC A;  4I2L C;  3G6E P;  1U57 A;  1RE3 C;  3PHL A;  5KLV G;  1RF0 A;  1GW3 A;  2NPS A;  1NWQ A;  1JUN A;  3H1J D;  4WVZ A;  1RE3 A;  3BCC G;  3A0B H;  2LKM A;  3HD7 D;  2P7J A;  1N2D C;  3H1J E;  4JYB A;  1PL5 A;  1BDD A;  3CXH D;  4EOT A;  1L4A A;  3HUS B;  3M0D C;  2KOG A;  1JY2 O;  3M0D A;  2KSJ A;  3RK2 B;  2M3E A;  2E74 C;  1SQB E;  3HRN A;  1BSH A;  4K3A A;  1RF1 B;  1MUU A;  2IBZ I;  1OMI A;  2SPZ A;  1X9V A;  1P84 D;  5B5E H;  3I55 P;  5KLV K;  2JKV A;  4D6T J;  4PV1 C;  4AYC A;  5APY A;  1FJP A;  2YO2 A;  3AEB C;  1LTT C;  4RJT A;  2FBW C;  1GU5 A;  4Y99 B;  2KP8 A;  3NTN A;  1NTM D;  3CI9 A;  5GTI H;  3EQ2 A;  5KKZ B;  4IOI H;  5AW1 B;  2Z5H A;  1IO4 A;  3S4R A;  1NTZ E;  1YJ9 P;  4IFD K;  2QG4 A;  5AVZ B;  5KAI H;  3CCR P;  2YIU B;  1W5C E;  3A2A A;  1SQQ D;  3M06 A;  2KLV A;  2E76 D;  4C7N A;  1K04 A;  2QM8 A;  1BGY D;  3IN6 A;  1PV3 A;  2IFN A;  1SQQ E;  3Q5P A;  1R5L A;  2MKV A;  1Q86 Q;  1L2P A;  3L72 J;  1SQX G;  1K8A Q;  3VMX A;  1KB9 H;  3GW6 A;  1HBW A;  3FX0 A;  1UIX A;  2AXC A;  1PPJ G;  3H25 A;  3RL0 g;  2FKW B;  1J2J B;  1CI6 B;  4U3F D;  2J59 M;  3RL0 D;  4ASV A;  1QEX A;  1OXZ A;  2I1J A;  3BRT B;  3HUS C;  1L0N G;  3CPW O;  1YHQ P;  3H1K E;  1N7L A;  4HB1 A;  3O6Q B;  3CC7 P;  3HUS A;  4IFF A;  1YTZ I;  1EDK A;  1NTM K;  2KI7 B;  3E7K A;  3RK2 C;  1AVY A;  2C9L Y;  4YXW H;  1JOC A;  1RF1 C;  3HE5 B;  2BCC G;  1CW5 A;  3VTP C;  1VQK P;  1QLE D;  3PRJ A;  4U3F G;  1AVO A;  1GK6 A;  3K5B A;  1KYO I;  1U7J A;  5AW3 B;  4M3L A;  1NJI Q;  3H6P A;  3L35 A;  4Y99 C;  1T6A A;  3TSI A;  5KKZ C;  3QH9 A;  3IFM A;  1N8R Q;  1ZN5 A;  3HE4 A;  1NKZ B;  4H44 B;  5CBN A;  1Y9B A;  5KJ7 D;  4AUW A;  1PP9 G;  2WSS H;  1HTL C;  3L70 D;  2R5B A;  1OVU A;  5DJT B;  1MV8 A;  2P10 A;  1ZV8 A;  5AW5 B;  1FE6 A;  4W80 A;  2Q3I A;  5APT A;  3GMA A;  2I1K A;  2YIU C;  3NXS A;  3H1L E;  1L0L D;  1AQ5 A;  2H7H A;  3CXH I;  2ZT9 B;  3T97 B;  1UII A;  1YTZ T;  1SFC D;  1QL1 A;  4CPG A;  2QVA A;  3BAS A;  3L70 G;  3AEA C;  1KQG B;  5AVR B;  1G1I A;  3KDP B;  3LW5 J;  1PGQ A;  1T2K D;  2P67 A;  1S5L E;  1KQS O;  1LP1 B;  4LGD E;  1P84 I;  4OVN F;  3MHV A;  3SWY A;  1KFN A;  1A02 J;  3JCU E;  4N78 D;  3HTK A;  3LID A;  2PP6 A;  1N86 A;  1FOS E;  1G2C A;  2IZ1 A;  2AEJ A;  1WRG A;  1KD1 Q;  4JF7 A;  4N78 E;  1JB0 J;  3SSU A;  1YIJ P;  4Y28 J;  5AW8 B;  3O6Q A;  1EXJ A;  1MFT A;  2K9J A;  3V2Q A;  2IYO A;  2YKQ A;  5AW2 B;  1WT6 A;  1FU1 A;  2IBZ E;  1LTS C;  3NMD A;  4LC1 A;  1GL2 B;  4YXD C;  1NTM J;  3L4F A;  1Q90 D;  3EFF K;  3USS A;  1KC8 Q;  2KLU A;  1LTA C;  2W6A A;  2WVR A;  3MGN A;  3P7K A;  2P58 A;  1L0L K;  2UWJ E;  1M1J B;  1YBK A;  3V6I A;  4A7P A;  4Z1M H;  4U7J A;  1QGK B;  2OYI B;  2L91 A;  4H44 C;  2YNY A;  1OWA A;  1N73 C;  5AW6 B;  1JCD A;  5CCG D;  1SS1 A;  2YKO A;  2K37 A;  3GF3 A;  1RE4 C;  4RES B;  2P2U A;  2WZ7 A;  3L71 D;  1N73 A;  5KAF H;  2M8R A;  3CME P;  2YXR B;  2A45 G;  1KIL D;  2QSI A;  2QE7 H;  3RK3 D;  1BGY J;  3H1H D;  1VQ8 P;  2K88 A;  4XA4 A;  5APS A;  2Z5I A;  5AVS B;  1DIP A;  1X0T A;  2M5A B;  1R8E A;  1M1K Q;  3L72 E;  1KB9 D;  2KNC B;  2H8P D;  1IFJ A;  1M7L A;  2KZJ A;  3TDK A;  1VQN P;  1NH4 A;  1QL2 A;  1DEB A;  1GU4 A;  4WBA A;  3CCL P;  2PFX A;  3CWB G;  4U3F J;  3M91 A;  2WPQ A;  1M57 D;  2KSE A;  1BE3 G;  1VF5 D;  3L73 G;  1BCC D;  2D2C B;  1K73 Q;  3ITK A;  1LP1 A;  4HH2 A;  2ZYG A;  1S1C X;  1LGH B;  2QIW A;  2P1J A;  5B66 E;  4UB6 H;  3G71 P;  4N6J A;  1VQ5 P;  4GT1 A;  3H1I D;  2N1T D;  1ZRT D; 
#chains in the Genus database with same CATH homology
 1URQ A;  1GU5 A;  2J58 A;  1H8A A;  4WB4 A;  3TYY A;  2NPS D;  2WPR A;  3HD7 B;  4Y99 B;  1H88 A;  3M9B A;  5AW4 B;  2O1K A;  2KP8 A;  3O8Z A;  1SFC C;  2IPP A;  3NTN A;  5AVT B;  3CI9 A;  1HH0 A;  3EQ2 A;  3KPE A;  5AW1 B;  2Z5H A;  1IO4 A;  5AVV B;  2O01 H;  1S9K E;  1GL2 C;  2YO3 A;  1IFM A;  3RL0 C;  5AW7 B;  5CCH D;  5BU8 B;  1L4A D;  2WSE H;  4IFD K;  2R32 A;  4N3Y B;  5AVZ B;  5AVU B;  2W6B A;  1SQQ K;  1GL2 A;  2R3C A;  1JY3 O;  2WT7 B;  2YKP A;  4GIF A;  2FYU K;  2PAJ A;  4ZKP A;  3UIA A;  3GHG B;  1M1J C;  2Q5U A;  3VP9 A;  1N73 B;  3VMY A;  1HWT C;  2OYI C;  2QM7 A;  1HJB A;  1FZE A;  1JO5 A;  2HG5 D;  3A2A A;  3VN0 A;  3TNU B;  1RE4 A;  1NAF A;  3M06 A;  1N7S C;  2OYI A;  2KLV A;  1SP4 A;  1HUC A;  2L5G B;  4C46 A;  3A5T A;  4C7N A;  2XU6 A;  2N1T A;  2QM8 A;  5CJ4 A;  2NPS B;  2XNX A;  4WY4 C;  2IFN A;  2GUS A;  1W2E A;  4WY4 A;  1Z56 A;  1GZL A;  3WMM 0;  1T8Z A;  3P8M C;  2WPS A;  3VMX A;  2E42 A;  1EQ7 A;  1L4A B;  1HBW A;  2IX7 C;  1J1E B;  3T97 A;  1VPC A;  1LT9 A;  2WSF H;  5APV A;  3BAT A;  2FKW B;  1J2J B;  1E5W A;  5AW0 B;  1CI6 B;  1A02 F;  1NOH A;  3OJA B;  2J59 M;  2XDJ A;  2FFD C;  1GL2 D;  3RL0 D;  4LLH A;  1JY3 P;  1FJK A;  1OXZ A;  2I1J A;  3P32 A;  1SLQ A;  3BRT B;  3CLQ A;  2O1J A;  1DX7 A;  5KJ7 A;  3HUS C;  1FAV A;  2FFD A;  2WIT A;  1FOS F;  3B5N B;  1N7L A;  1T3U A;  5APU A;  1GK4 A;  3VP8 A;  3HUS A;  4IFF A;  1YTZ I;  2KYV A;  1NTM K;  2MJZ A;  4KHX A;  5AVQ B;  3RK2 C;  1LWU B;  2C9L Y;  2OYH B;  2HPC B;  1JOC A;  1JY2 N;  3A7O A;  2N9B A;  1RF1 C;  3HE5 B;  3V5B A;  1URQ B;  1MZ9 A;  1KIL C;  1LTJ C;  1KFM A;  1SQV K;  3RK3 C;  3H32 B;  2BAS A;  1N7S D;  1CW5 A;  1NU1 K;  3VTP C;  1HGV A;  2GM4 A;  3L37 A;  3V2R A;  1XTG B;  4WY4 D;  1X8Y A;  1JNM A;  1JTH A;  2HYN A;  1GK6 A;  3V4W A;  3E1I A;  5AW3 B;  3MUD A;  4M3L A;  1SFC A;  2A45 H;  3H6P A;  1IK9 A;  3L35 A;  3HD7 C;  1G1J A;  4Y99 C;  1T2K C;  4W7Y A;  2XZR A;  3VMZ A;  2VRS A;  3TSI A;  1IJD B;  1FZA A;  3EFG A;  3IFM A;  1AFO A;  2ZXE B;  1ZN5 A;  3HE4 A;  2ZFC A;  1NKZ B;  3M0A A;  2M3B A;  5KJ7 D;  4AUW A;  1IC2 A;  1HTL C;  2R5B A;  1FZC B;  2WTY A;  1M1J A;  3CL3 D;  1IFD A;  1MV8 A;  1JCC A;  3B8E B;  3GHG C;  3KQG A;  3NFQ A;  2C0X A;  1ZV8 A;  5AW5 B;  2WT7 A;  4C7N B;  4W80 A;  2N1T B;  2Q3I A;  5APT A;  3GHG A;  1DH3 A;  3OA7 A;  3P8C D;  3V2N A;  1N7S A;  2I1K A;  3RK2 D;  2Z4E A;  5CJ0 A;  1IFN A;  3NXS A;  5AVY B;  3N4X A;  1AQ5 A;  3II6 A;  5BU5 A;  3SWF A;  2H7H A;  2GUV A;  3VOP A;  5APW A;  2NPS C;  2C9N Y;  4W7Z A;  1FDM A;  3U1A A;  5CMZ A;  1YTZ T;  2CPB A;  1LT9 B;  1SFC D;  1QL1 A;  4JYC A;  1T3J A;  1SQB K;  4C7R A;  1FZB A;  3BAS A;  1IFI A;  4O9B A;  3KYQ A;  5AVR B;  1ZR4 A;  1G1I A;  3KDP B;  2HOD A;  1T2K D;  5BVZ A;  2P67 A;  5APX A;  1L4A C;  3OAK A;  1ZLL A;  1J1E C;  1NTK K;  1SVF A;  3L36 A;  2XKM A;  1J1D B;  2HLO A;  4LGD E;  2HFE D;  3I5C A;  3SWY A;  1KFN A;  1A02 J;  2Q9I A;  4N78 D;  3HTK A;  3LIE A;  3LID A;  2PP6 A;  3G3Z A;  1NO4 A;  3N7N A;  1N86 A;  1PFI A;  5CCG C;  1CZQ A;  2IFM A;  4DZO A;  1G2C A;  1FOS E;  2YMY A;  3C9I A;  1WRG A;  4JF7 A;  4N78 E;  3B5N C;  2OAR A;  5CCG A;  4I1L A;  4I6M C;  5AW8 B;  2A45 I;  1HVV A;  5AVW B;  3M9H A;  1RF1 A;  1LWU C;  1KIL A;  1LTJ A;  1FZG A;  1JTH B;  1GD2 E;  1SQX K;  4IFM A;  2OYH C;  3V2Q A;  1SFC B;  1SQP K;  1URQ C;  1ZR2 A;  2Q7C A;  3VYI A;  4GKG A;  2KB7 P;  2YKQ A;  5AW2 B;  1WT6 A;  2OYH A;  1FU1 A;  3IR9 A;  1LTS C;  3NMD A;  2XV5 A;  4LC1 A;  1GL2 B;  3H32 A;  3RL0 B;  1S9K D;  1HGZ A;  3HD7 A;  3BVH A;  3HE4 B;  3U1C A;  3L4F A;  1L0N K;  1LTG C;  2C0W A;  4AQR D;  1LTA C;  2W6A A;  3MGN A;  2JJL A;  3P7K A;  1YYC A;  3M9Q A;  1L0L K;  1M1J B;  1XTC C;  4OH8 B;  1RY3 A;  2JEE A;  1JY2 P;  3V4Q A;  1MFZ A;  3MD0 A;  2OYI B;  2E43 A;  3R2P A;  1FBM A;  2YNY A;  1OWA A;  2CPS A;  1X79 B;  1N7S B;  1N73 C;  1LTI C;  1H89 A;  5AW6 B;  1JCD A;  1KZU B;  3TK1 A;  5CCG D;  4XE5 B;  2YKO A;  1FZC C;  1JY3 N;  2W27 A;  1RE4 C;  1FZF A;  4RES B;  2P2U A;  2WZ7 A;  1N73 A;  4WY4 B;  5AW9 B;  4B86 A;  2M8R A;  3B5N D;  1LTB C;  2N1T C;  1FZC A;  2A45 G;  1KIL D;  3P8C E;  3RK3 D;  1RF0 C;  4I2L C;  3TNU A;  1NHL A;  4XA4 A;  1RE3 C;  4HYT B;  5APS A;  1RF0 A;  5KTB A;  1GW3 A;  2Z5I A;  2NPS A;  1NWQ A;  1JUN A;  5AVS B;  1RE3 A;  1URQ D;  2HOD B;  3PP5 A;  2LKM A;  3V2P A;  1GDT A;  3HD7 D;  2H8P D;  1IFJ A;  1M7L A;  2P7J A;  2WWW A;  3MTU E;  5CCH C;  4EIJ A;  1N2D C;  4JYB A;  2FFD B;  1LT9 C;  1GTW A;  1NH4 A;  1QL2 A;  1CSB A;  5APQ A;  4EOT A;  1DEB A;  5CCH A;  1L4A A;  1GU4 A;  3HTK B;  3HUS B;  4WBA A;  3M0D C;  3LW5 H;  2WSC H;  2POH A;  4DOJ A;  2KOG A;  1JY2 O;  3M91 A;  2WPQ A;  1JMM A;  1G2C B;  5CHX A;  5KJ7 C;  3M0D A;  1CI6 A;  4ZKU A;  3U59 A;  2KSJ A;  1J1D C;  3MIW A;  3RK2 B;  3HRN A;  1GW4 A;  3BRV B;  2FXM A;  1RF1 B;  4HH2 A;  1MUU A;  1KIL B;  1LTJ B;  3A3Y B;  3B5N A;  3RK3 B;  1X9V A;  1LGH B;  1NTZ K;  1NKN A;  2P1J A;  5KLV K;  4N6J A;  1LWU A;  4AYC A;  5APY A;  2FYZ A;  2R5D A;  1FJP A;  2YO2 A;  4GT1 A;  1KQL A;  2N1T D;  2H43 A;  2HPC A;  1LTT C;  5AVX B;  1VDF A;  3HE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...