3VTPC

Hiv fusion inhibitor mt-c34
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
41
structure length
41
Chain Sequence
QQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transmembrane protein gp41
publication title The M-T hook structure is critical for design of HIV-1 fusion inhibitors.
pubmed doi rcsb
molecule tags Viral protein/antiviral protein
total genus 19
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2012-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3vtpC00
1OWAA 3HTKA 5AVSB 4EOTA 3M9HA 1MUUA 5AW4B 1DH3A 3OAKA 3KQGA 3SWFA 5AW2B 2VRSA 5AVQB 5AW9B 3P8MC 1J2JB 1H89A 3TNUA 2N9BA 1GU5A 2QM7A 5APSA 5AW1B 3MD0A 3HE4A 3MGNA 1NWQA 2ZXEB 4M3LA 5APTA 1HWTC 3M0DA 5AVTB 5AVVB 1KQLA 3P32A 2WPSA 4JYCA 5AVYB 1HJBA 1FAVA 3M06A 5AW5B 3HE5A 4B86A 3A7OA 3VMYA 2Q7CA 2Q3IA 3NXSA 1HBWA 2Q5UA 1GK6A 4GT1A 3NTNA 3V5BA 1MFZA 3VMXA 1HUCA 1IO4A 5APYA 4RESB 5AVWB 2C9NY 2W27A 4AQRD 5APXA 1CZQA 4I2LC 2XV5A 1YYCA 3VTPC 3I5CA 3TYYA 1T2KD 3M0AA 1FOSF 4GKGA 2W6AA 3L36A 2WPRA 1GZLA 2P7JA 5AW7B 3TNUB 1FOSE 1SP4A 2WPQA 1T2KC 3KDPB 2C9LY 2H7HA 2XZRA 4C7NA 2Z5HA 2E43A 5AW8B 1CI6B 5APVA 2P67A 5AW3B 4HYTB 3VMZA 3B8EB 5APQA 3O8ZA 3HE5B 3NMDA 4C46A 3LIEA 3VYIA 4JYBA 1A02J 2JJLA 3IR9A 5APUA 1GTWA 1OXZA 1GU4A 1JNMA 4XE5B 1X8YA 5AVRB 2IPPA 4DZOA 3L35A 1MV8A 2BASA 2R3CA 2R32A 4KHXA 1CSBA 2Z5IA 4LC1A 2P2UA 2WT7A 2WTYA 2WWWA 3VN0A 3M91A 1H88A 3HE4B 2ZFCA 3V4QA 3LIDA 3P7KA 4C7NB 2QM8A 3M9BA 2YNYA 3NFQA 3L37A 3UIAA 1G2CB 1S9KE 2R5BA 5AW6B 5CMZA 5AVZB 1SLQA 4AUWA 1A02F 2YO3A 3A3YB 2E42A 3V4WA 2XU6A 4AYCA 1H8AA 2R5DA 3T97A 5APWA 5AVXB 1CI6A 1GD2E 5AVUB 1JUNA 3A2AA 1S9KD 3TK1A 1NAFA 4I6MC 2KP8A 2WT7B 2YO2A 1GK4A 5AW0B 3A5TA
chains in the Genus database with same CATH superfamily
2HODB 1DH3A 4DOJA 1J1EB 3CWBG 3HRNA 1AV1A 1FZCA 2GA1A 2KSJA 3SFDC 1NU1G 3BATA 3M0DC 4A7PA 1HGZA 3VMYA 1VDFA 2FYUD 2YKPA 3IFMA 4GT1A 3V2NA 3CCMP 3CCRP 5BVZA 1RE4A 3L72G 5KLVE 5AW7B 2ZT9D 1URQB 2LXBA 4PV1C 3H6PA 2CK3H 5AW8B 2M5AA 3CCUP 2PGDA 3VP9A 1OVUA 3RK3E 5GTHH 1E5WA 4UB8E 5AVRB 3N4XA 1FJPA 3H1HE 2IYPA 3RK2B 3MIWA 1G1JA 5TISH 3UIAA 2J5UA 2QG4A 5KLVJ 3B5NA 1QVGO 5DJTB 3V2PA 4Y28J 4GODA 1GL2B 2BCCE 1IFPA 4D6TJ 3BVHA 2FFDB 5B5EH 1OMIA 4EOTA 1SQBD 3PTZA 1U57A 2OYIA 3RL0B 3D71A 1X79B 4JYCA 4Y99C 3M06A 5KKZC 5AW5B 1HBWA 3C1LA 1KILD 1IO4A 5APYA 4RESB 4ZKPA 1DX7A 5H2FH 1YI2P 1FOSF 4GKGA 3KYQA 3H1LG 3IAOA 1XTCC 3H1KJ 1IFJA 1S5LH 4WY4D 3KZIE 1BE3D 2P67A 2RN0A 2O1JA 1RF0A 1FJKA 1BCCD 3RGUA 3L70D 1M1JA 1FZAA 2WSFH 1SQXE 4HB1A 1SFCD 5E79H 2P2UA 1BDCA 3AE7C 1R8EA 5KLVK 3SWYA 2YNYA 3CL3D 1YHQP 2R5BA 5AVZB 1UIXA 2YMYA 3HUSC 5APWA 2NPSB 3JCUE 4L76A 1L0LE 1VQKP 1NAFA 3MTUE 2KXPB 4DCKA 1YITP 1W5CE 3A5TA 3L74E 2KLUA 1SQXJ 3OAKA 2KS1B 4H0LB 2QJYB 2P10A 2C0XA 3L73E 5AW9B 1KYOI 2QM7A 1ZRTD 1M90Q 3GHGC 1HWTC 3GF3A 1KD1Q 2AEFA 3HE5A 3WUTA 2ZT9C 3Q2YA 3L71E 1H0TA 1NTZE 1IK9A 1L0LJ 4UB6H 3D70A 1SQPG 3CCLP 2FBWC 1FZCB 2G3AA 2H8PD 1K9MQ 3TSIA 2OQQA 3L74J 4JBZA 3B8EB 1IK7A 3O8ZA 4WY4A 3IF4A 1FZGA 1LTJB 3VYIA 4L73A 4L75A 3FGAD 5KJ7C 1LT9C 4K3AA 3RK2D 2OYHC 1EZVD 2Q6QA 2E76C 2M5AB 1J1DC 1FDIA 1NH4A 3A3YB 2E42A 3LW5H 1KV4A 4AYCA 1LTBC 4HKZH 2PP6A 1JUNA 1IFMA 1DD3A 1SQXK 4YTPC 1AA0A 3AEFC 3G3ZA 3RL0D 1JEKA 1OX3A 3H1IG 1MFTA 2FYUE 5CCGD 1KILC 1FBMA 2A06G 3B5NB 3Q5RA 1L4AD 2M3EA 2ZVOB 1YBKA 3R4YA 1USEA 2R3SA 1IC2A 2WZ7A 1BSNA 5GTHE 3H1JG 2OTKE 4EIJA 1ZOYC 4UB8H 1NTKJ 1KQGB 1L0LK 1JCDA 3D6ZA 2KK7A 1LJ2A 3TYYA 1FZFA 1VQOP 3M0AA 3V2RA 2OYIB 1HVVA 1KYOD 3EQ2A 3CD6P 1SFCC 1AVOA 1GDTA 1ZN5A 1ZR4A 3U59A 3WMM0 2FYUJ 4BRYA 4C46A 1UIIA 1SQVD 3E1RA 1QL2A 2GM4A 3CI9A 1M8OB 5L8RJ 2IFMA 1ZXGA 2K88A 1HJ0A 3FX0A 3HE4B 3PRJA 3CWBD 2E5YA 1BGYD 3G4SP 1NU1D 2O01H 1WRGA 2WQYC 2NPSD 1J1EC 2L91A 3I56P 1N73A 3PHLA 3A0HE 1KN7A 1SQBE 1M1JB 3WUUA 1GD2E 1EDLA 2M8RA 2GUVA 1PL5A 3KHUA 4ZMDA 5AW4B 1IFIA 2J59M 3I55P 3KZIH 1GU5A 1KILE 4JF7A 3RL0g 3AE9C 1N8RQ 1URQC 1NTKK 1OFCX 2B9BA 4I7ZB 5KTBA 3B4SA 2HLOA 1Q81Q 1LT1A 1KORA 1VQ5P 1SQBJ 2C9NY 3CXHI 4AQRD 1JY2P 1T2KD 1BCCE 1QVFO 3M9QA 3HD7A 3L70E 1JO5A 2C0WA 2FYUK 3RK2C 5AW3B 1L0ND 2B89A 3VMZA 1PFIA 1VQ7P 4GIFA 2N1TA 5KLIB 3HE5B 4ZNCA 1A02J 1PGJA 3CMEP 5KLVG 2R32A 2WSFJ 1GL2C 1LTIC 1RF1A 3CCVP 2FFDC 2A45I 1BE3J 1SQQJ 4Z1MH 1NTMJ 3Q1MA 1BCCJ 2Q1KA 5CMZA 3WU2E 3L70J 1EDKA 4WY4B 3BRVB 3RL0C 3BCCE 5CCGC 2IBZG 1YQ3C 4RO0A 1K8AQ 4I6MC 1ZRTE 5CJ4A 1JY3P 1NHLA 2W83C 4UB6E 2Q9IA 1GK4A 3AE2C 2NRGA 4PJ0H 3V6IA 3B5ND 1PP9J 4NPEA 1LTTC 1S4XA 4WBAA 1JY2O 2OGUA 1LP1A 3MGNA 1OVVA 3FXEA 1KQLA 1HJBA 4R4MA 1SQBK 5CCHC 3H1KG 2FY8A 4I2LC 4IL6E 4KT0J 3L36A 3H25A 4ASVA 1E79H 1RHZB 4EYYQ 1Y47A 2WPQA 3R2PA 4U3FD 1PIXA 3BRTB 1KTMA 1CI6B 3CCSP 1EXIA 1EZVE 1T3JA 4LLHA 2JJLA 3E1IA 1DEBA 3AEBC 3CXHD 4XE5B 3AEEC 2H89C 2NPSC 1RQVA 3GMAA 2I8DA 3S9OA 1SQQK 1NTMK 2XNXA 1JY3O 3OJAB 3G9RA 4H0LC 4BRYB 2QJYC 1S2EA 3OW2O 2I1JA 4W7ZA 3T97A 3LW5J 1SQXG 3A2AA 2AEJA 3VP8A 1FC2C 1IJDB 4GDOA 3AE5C 1SQPD 5B66H 1OW8A 2VRSA 1H89A 2LKMA 1PPJD 5APSA 1FZCC 1N73B 1JY3N 1VQ4P 2KYVA 1BDDA 1L0LG 1KYOE 2A45H 4B86A 1K73Q 2Q3IA 1LTJC 2K1AA 1MFZA 2XKMA 3L74G 1P84I 2AXTE 4GOEA 1Q2NA 1RE4C 1SQVE 1Y9BA 3H1HJ 5C39A 4YXDC 2FXMA 1AJYA 2ZYGA 2E43A 2Z5HA 1L4AB 1G1IA 1NAYA 4XFJA 2QIWA 3A0HH 2ZYAA 4JPZB 5APUA 3CWBE 2WMMA 1BGYE 1X8YA 4BXLA 1NU1E 1KFNA 3MZWB 2BCCJ 4KHXA 3MHVA 2Z5IA 1Q90D 3H1ID 3VN0A 1EZVI 3Q5SA 1VQ6P 2KNCA 4EI2A 2Q3EA 3EWKA 1Q82Q 2N1TB 3CCQP 3AEAC 1SQVJ 2KIKA 3L72E 2QVAA 3V4WA 3B5NC 2O01J 1M56D 2D2CD 3TGUD 3TF5A 2KOGA 2RMZA 1U7JA 2JDIH 2LR2A 5DJUB 1BGYJ 2IZ1A 5TJHA 3P8MC 1J2JB 1NTKG 2OYIC 1ZMEC 1FS0E 2ZXEB 4JQ0D 2WPSA 3GF7A 5AVYB 2W90A 4K35A 5K5GB 2Q7CA 1M57D 3VMXA 3BCCD 1JB0J 3BASA 2JP3A 5AVWB 1LGHB 2E75B 1L0NE 5APXA 1AQTA 2FYUG 1N86A 2OTLP 3GLMA 1FOSE 2G8YA 2RKLA 2C9LY 1JTHA 3WU2H 1LP1B 3K5BA 3CMAP 2OYOA 2Y0EA 1RF0C 3AE3C 1EXJA 1QEXA 1P84D 2IPPA 1M1JC 4PJ0E 3QWOC 2QEXP 4LC1A 1RE3A 5CBNA 3NFQA 1DEEG 1L0NJ 3L73J 3RBZA 1P84H 1JOCA 1FZBA 2R5DA 2CPBA 4I7ZC 2YKOA 2FKWB 3L71J 4W7YA 4IL6H 1PGOA 1EC5A 5AVSB 1NTZJ 3AEGC 1JMBA 3TNUA 1SQBG 4I1LA 4C7RA 3T97B 5AVTB 3EFFK 1VQPP 3A7OA 5KLIC 4U3FE 1NOHA 2ZAEB 3ABVC 1LWUA 4TT3H 1MZ9A 1NGMB 1SP4A 2UWJE 3B71A 2K9YA 3CXHE 3U1AA 2OTJP 4RKUJ 4D6TD 3GG2A 1T8ZA 1JMMA 4N3YB 3L75D 3VMAA 4WY4C 2KZJA 1XTGB 1KQFB 3HD7D 1BE3G 1JNMA 1FDMA 1SQQG 1NTMG 4ZKUA 1BCCG 4R4LA 3L70G 5B66E 1L0NK 1Z56A 4U3FJ 1H88A 1OIPA 2N1TD 1X22A 2ZYDA 1HTLC 1N7SD 1A02F 1IZNB 1KYOH 1QL1A 1SQPE 1EDJA 1URQA 3FWLA 1PP9G 4IOIH 3WUVA 1PPJE 3TK1A 1N2DC 1NTZK 2AXTH 3HTKA 2KNCB 3CC2P 1ZR2A 4LGDE 3PLNA 1S5LX 2FYZA 5AW2B 2WSCH 2KI7B 2FXPA 1NWQA 4GOFA 1FAVA 2E75D 3ZDMA 3L72D 3EFGA 4N78D 2DW3A 3F89A 2Z4EA 3E7KA 1CZQA 1YYCA 2QJKB 3I5CA 3P8CD 3VTPC 2O1KA 1GL2A 3Q5PA 5KAFE 2Y0DA 2XZRA 4C7NA 1AVYA 1USDA 2IZ0A 3H1IE 2KZIA 1GTWA 2YKQA 1GU4A 2MJZA 3MUDC 2HFED 2V7QH 1CSBA 2P1JA 3H1JE 3OA7A 3TGUE 2QM8A 2WSEH 1OVRA 1OW6A 3L37A 2YMKA 2FYNB 1HGVA 1ZW0A 1H0TB 1N7SA 1GMJA 1N73C 2SPZA 1K05A 4IFFA 1FE6A 1M7LA 1S9KD 1OW7A 3CC7P 3ITKA 1OWAA 2HPCA 1NYHA 1YJ9P 2O3JA 4W80A 3TGUJ 5AW1B 2WSSH 1BSHA 3M0DA 2D2CB 1L4AC 3H1HG 2XDJA 1R5SA 3G71P 2M3BA 3H1LD 1T3UA 2XV5A 2O01N 4H44B 1DIPA 1DD4A 1NO4A 3TNUB 1VQ9P 2YXQB 3KDPB 1P84E 2H7HA 5APVA 1IFNA 2BCCG 1VL2A 3NMDA 2N1TC 3S1KA 3BCCJ 1NKNA 5M1BA 1VF5B 5GTIH 1LWUB 4XA4A 2IFNA 1SQVG 2QJPB 3AE1C 2JWDA 2BEZF 1KB9I 2L5GB 4HJGH 1JY2N 1SLQA 4AUWA 4OGQB 2WPVB 3N7NA 2N9YB 1BGYG 2IYOA 3CX5I 3A0BE 1LTJA 2POHA 3C9IA 2HG5D 1SVFA 4OH8B 3M9HA 2E75C 2E74B 4PD4I 3CXHH 4MN4C 1TU3F 1YQ4C 3MD0A 1KZUB 2Y9ZA 2YIUB 3S4RA 2B87A 4D6TE 1GK6A 4WWIA 5KAIE 2E5TA 1VQ8P 3HTKB 1PV3A 3U1CA 1LTAC 2ZJSE 3L75E 2IBZE 4TLFA 2B88A 2PFXA 3SWKA 1T2KC 3SFEC 3W68A 1G2CA 2QE7H 3KXDA 4BWNA 4JYBA 5KJ7D 1L0NG 1OZHA 2QSIA 3L73G 2JWAA 2LXCB 2E76D 2WTYA 2WWWA 1QLED 1NJIQ 2ZFCA 1M1KQ 3P7KA 4C7NB 3H1KE 1QGKB 3L75J 3L71G 3RK3B 2ZXXA 3HUSA 2XU6A 2M0BA 3AE6C 4H13B 2P58A 3IN6A 1NTZG 3HD7B 4U7JA 3USSA 2WITA 1KB9D 2A06D 1YIJP 5KAFH 1W2BO 3H1JD 4DT0A 2W8ZA 1N7SB 3GHGA 3HE4A 4N78E 1WT6A 2WSCJ 3P8CE 1KB9H 3CX5D 3CPWO 1SQQD 1NTMD 3CWBJ 3L4FA 3NXSA 1RF1B 2ITAA 1W2EA 4H44D 1NU1J 2HPCB 4KJMA 4PD4D 1FDOA 2W6AA 3CX5H 3II6A 3G6EP 1RQUA 1PGPA 1SS1A 1S72P 5APQA 3L72J 1PP9D 1VF5D 4PD4H 4U3FG 2IBZI 2YXRB 5KJ7A 1LT9A 3MP7B 3L35A 4DZOA 4EDFA 2BASA 2R3CA 2OYHA 2V7QJ 2QA4P 4PV1B 1R5LA 4OGQD 2JO1A 3D6YA 1S9KE 4WVZA 5AW6B 3O6QA 1KFMA 2WSEJ 1X9VA 2YO3A 2Y9YA 3FXDA 1RH5B 3GW6A 4IFMA 2E74D 3CCJP 2W6BA 1L2PA 1SQVK 2KSEA 1Y8AA 3CC4P 1LNQA 1D7MA 1MUUA 3CCEP 1KILA 2QJKC 3VOPA 1URQD 2A45G 2NZ2A 3H1LE 5APTA 4M3LA 2KLVA 1GW4A 1PPJG 2GUSA 1NU1K 5GTIE 1HUCA 3H32A 1YJWP 2K9JA 4RJTA 2J58A 1SFCA 4DJGA 1RF1C 4Y99B 3PJSK 5KKZB 2KUBA 3C8VA 1JCCA 5KLVD 2B87B 2FYNC 3FWNA 1NTKE 1OXZA 2H88C 3H1LJ 1AFOA 1GL2D 3A0BH 4NPFX 2IX7C 1MV8A 2WT7A 5EFWB 2K3RA 3V4QA 2I1KA 3RK3D 1RE3C 2R44A 5BU5A 1EQ7A 1G2CB 2HODA 1YTZI 2AEMA 4H13D 2IBZD 2PRRA 4YXWH 1ZP0C 3H1HD 5AVXB 1CI6A 5AVUB 2D2CC 4OVNF 5KAIH 1YJNP 3TGUG 1PZQA 2YO2A 1NVOA 1HF9A 1FU1A 1GW3A 3KQGA 4H44C 3SWFA 5AVQB 2BCCD 5TISE 2N9BA 3HUSB 1MKMA 3H1KD 1LTSC 5CCHD 1KQSO 4CPGA 3NTNA 3V5BA 2QRXA 1VF5C 3MUDA 3PP5A 1LWUC 3JSVC 5B5EE 1FZEA 1EDIA 2WPRA 2QJPC 1YTZT 3BCCG 4YPCA 3GHGB 2Y0CA 3TDKA 4N6JA 1NKZB 3F5HA 2WVRA 4HYTB 2ZT9B 4L74A 3AE8C 3LIEA 1SQPJ 2K37A 4OGQC 1U7MA 5BU8B 1ZLLA 3SSUA 3RBXA 3KPEA 4PV1D 1VQLP 5CJ0A 4IFDK 5H2FE 2V4HA 2FFDA 4HH2A 3LIDA 1CW5A 4H0LD 3M9BA 1PGQA 1SQXD 1KC8Q 2E74C 1S5LE 1KB9E 2A06E 2JKVA 4QMAA 5CCGA 1LT9B 2XNDH 1L4AA 1AQ5A 2YIUC 2OYHB 2KP8A 3AE4C 1JTHB 5AW0B 5CBOA 2E76B 5E79E 1S3JA 2W6JH 2AXCA 1BE3E 1J1DB 3CX5E 1SQQE 1EZVG 3O6QB 1NTME 1VQNP 1L0LD 3W67A 2PAJA 1X0TA 4PD4E 4O9BA 5AVVB 3P32A 3L74D 3Q3DA 1S1CX 3H1IJ 5CCHA 1HH0A 3AECC 2ZVNB 1KMIZ 3L73D 2Q5UA 4WB4A 1JM0A 2MKVA 3JCUH 2BEQD 1QX8A 1RY3A 2HYNA 2CPSA 2W27A 1PP9E 1LTGC 1VQMP 3H1JJ 1KILB 1VPCA 1T6AA 1GZLA 2P7JA 1Q86Q 3L71D 1WMKA 1SQPK 2H43A 2KB7P 1NTZD 3JC22 3RK3C 4D6TG 3IR9A 2RH0A 1N7LA 4H13C 2NPSA 3H32B 4OWFA 2IDBA 2OARA 3L75G 4IL6X 3HD7C 2K9JB 3AEDC 1K04A 3M91A 3PH0A 1SFCB 5CHXA 3CLQA 4ASWA 3V2QA 3QH9A 2KS1A 2JEEA 1IFDA 1Q7YQ 1ZV8A 1H8AA 2JR8A 1N7SC 2HR3A 2FXOA 2WT7B 1NTKD 4NPDA
chains in the Genus database with same CATH topology
5AVSB 2HODB 5AW4B 1DH3A 4DOJA 1J1EB 1IFIA 2J59M 3HRNA 3TNUA 1FZCA 1GU5A 4JF7A 2KSJA 1N7SB 3GHGA 3HE4A 4I1LA 4N78E 4C7RA 1WT6A 1URQC 1NTKK 3P8CE 5AVTB 3BATA 3M0DC 5KTBA 1HGZA 3A7OA 2HLOA 3VMYA 1VDFA 3L4FA 3NXSA 2YKPA 1RF1B 1W2EA 3IFMA 4GT1A 1NOHA 3V2NA 2HPCB 1LWUA 2C9NY 4AQRD 1JY2P 5BVZA 1T2KD 1MZ9A 1RE4A 3M9QA 3HD7A 2W6AA 5AW7B 1SP4A 1JO5A 3U1AA 2C0WA 1URQB 2FYUK 3II6A 3H6PA 3RK2C 1T8ZA 1JMMA 5AW8B 5AW3B 4N3YB 3VMZA 1PFIA 4GIFA 2N1TA 5APQA 3HE5B 4WY4C 3VP9A 1A02J 1XTGB 3HD7D 1JNMA 1E5WA 1FDMA 5KJ7A 5AVRB 1LT9A 4DZOA 3L35A 4ZKUA 2BASA 2R3CA 2R32A 2OYHA 1GL2C 3N4XA 1L0NK 1Z56A 1LTIC 1FJPA 1H88A 1RF1A 2N1TD 2FFDC 3RK2B 2A45I 3MIWA 1G1JA 3UIAA 1S9KE 5AW6B 1HTLC 1KFMA 5CMZA 1N7SD 4WY4B 1X9VA 1A02F 2YO3A 3B5NA 3BRVB 3RL0C 1QL1A 1URQA 3V2PA 5CCGC 1GL2B 3TK1A 4I6MC 1N2DC 1NTZK 4IFMA 3BVHA 5CJ4A 1JY3P 1NHLA 2W6BA 2FFDB 1SQVK 2Q9IA 1GK4A 3HTKA 4EOTA 3B5ND 1ZR2A 1MUUA 4LGDE 1KILA 2FYZA 3VOPA 2OYIA 5AW2B 1URQD 1LTTC 4WBAA 3RL0B 2A45G 1JY2O 2WSCH 1X79B 3MGNA 1NWQA 5APTA 4M3LA 2KLVA 1KQLA 4JYCA 1HJBA 1GW4A 4Y99C 1FAVA 2GUSA 3M06A 1NU1K 5AW5B 1SQBK 5CCHC 1HBWA 1KILD 1IO4A 1HUCA 3EFGA 3H32A 5APYA 4RESB 4ZKPA 1DX7A 4N78D 2Z4EA 1CZQA 4I2LC 1YYCA 3VTPC 3I5CA 3P8CD 1FOSF 2O1KA 4GKGA 3L36A 1GL2A 3KYQA 2J58A 2WPQA 3R2PA 3BRTB 1SFCA 1XTCC 2XZRA 4C7NA 1IFJA 4WY4D 1CI6B 4Y99B 2P67A 2O1JA 1RF0A 1JCCA 1FJKA 1T3JA 4LLHA 2JJLA 1GTWA 3E1IA 2YKQA 1OXZA 1DEBA 1GU4A 1AFOA 1GL2D 4XE5B 1M1JA 1FZAA 2WSFH 2IX7C 2MJZA 2NPSC 2HFED 1MV8A 1SFCD 1CSBA 2P1JA 1SQQK 2P2UA 2WT7A 3OA7A 1NTMK 3V4QA 2I1KA 3RK3D 5KLVK 2QM8A 3SWYA 2WSEH 2YNYA 2XNXA 1JY3O 1RE3C 3L37A 5BU5A 1EQ7A 1G2CB 2HODA 3CL3D 3OJAB 1YTZI 2R5BA 5AVZB 1HGVA 2I1JA 1N7SA 2YMYA 4W7ZA 3HUSC 3T97A 5APWA 1N73C 5AVXB 2NPSB 4IFFA 1CI6A 5AVUB 1M7LA 3A2AA 1S9KD 1NAFA 3MTUE 3VP8A 1IJDB 2YO2A 3A5TA 1FU1A 1GW3A 1OWAA 2HPCA 3OAKA 3KQGA 3SWFA 2VRSA 2C0XA 5AVQB 5AW9B 1H89A 2LKMA 4W80A 2N9BA 2QM7A 5APSA 3HUSB 5AW1B 1FZCC 1N73B 3GHGC 1HWTC 1JY3N 1LTSC 3M0DA 5CCHD 2KYVA 1L4AC 2A45H 3HE5A 4B86A 2XDJA 2Q3IA 1LTJC 2M3BA 3NTNA 3V5BA 1MFZA 2XKMA 1T3UA 3MUDA 3PP5A 2XV5A 1LWUC 1IK9A 1FZEA 1RE4C 2WPRA 1NO4A 3TNUB 1YTZT 1FZCB 2H8PD 3TSIA 3KDPB 2H7HA 2FXMA 3GHGB 2E43A 2Z5HA 4N6JA 1NKZB 1L4AB 1G1IA 1IFNA 5APVA 4HYTB 3B8EB 3O8ZA 4WY4A 3NMDA 1FZGA 1LTJB 2N1TC 3LIEA 3VYIA 5APUA 1NKNA 5BU8B 1X8YA 1ZLLA 1LWUB 4XA4A 5KJ7C 1LT9C 3KPEA 1KFNA 2IFNA 3RK2D 4KHXA 5CJ0A 2Z5IA 2OYHC 4IFDK 3VN0A 2FFDA 4HH2A 3LIDA 1CW5A 3M9BA 2L5GB 1J1DC 1JY2N 2N1TB 1SLQA 1NH4A 4AUWA 3A3YB 2E42A 3LW5H 3V4WA 4AYCA 3N7NA 3B5NC 1LTBC 5CCGA 2KOGA 1LT9B 1L4AA 2PP6A 1AQ5A 1JUNA 2OYHB 1IFMA 1SQXK 2KP8A 1LTJA 2POHA 3C9IA 1JTHB 5AW0B 2HG5D 3G3ZA 1SVFA 3RL0D 4OH8B 3M9HA 1J1DB 5CCGD 1KILC 1J2JB 3P8MC 1FBMA 2OYIC 2PAJA 3B5NB 1L4AD 3MD0A 1KZUB 2ZXEB 1IC2A 4O9BA 2WZ7A 5AVVB 3P32A 2WPSA 5AVYB 4EIJA 5CCHA 1HH0A 2Q7CA 2Q5UA 4WB4A 1L0LK 1JCDA 1GK6A 3VMXA 3BASA 1LGHB 5AVWB 1RY3A 3HTKB 2HYNA 2CPSA 2W27A 5APXA 3U1CA 1LTAC 1LTGC 3TYYA 1FZFA 3M0AA 3V2RA 1KILB 1N86A 1VPCA 2OYIB 1HVVA 3EQ2A 1GZLA 2P7JA 1FOSE 1T2KC 2C9LY 1JTHA 1SFCC 1GDTA 1SQPK 1G2CA 2H43A 1ZN5A 2KB7P 1ZR4A 3U59A 3WMM0 4C46A 3RK3C 1RF0C 4JYBA 5KJ7D 3IR9A 1QL2A 1N7LA 2GM4A 3CI9A 2NPSA 3H32B 2IPPA 2OARA 1M1JC 2IFMA 3HD7C 4LC1A 2WTYA 2WWWA 3M91A 3HE4B 2ZFCA 1RE3A 1SFCB 3P7KA 5CHXA 3CLQA 4C7NB 3NFQA 3V2QA 2O01H 3RK3B 1WRGA 2NPSD 1JOCA 2JEEA 1IFDA 1J1EC 1FZBA 1ZV8A 3HUSA 2XU6A 1H8AA 2R5DA 1N73A 2CPBA 1N7SC 1M1JB 2YKOA 1GD2E 3HD7B 2FKWB 2M8RA 2WITA 4W7YA 2WT7B 2GUVA 1RF1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OWA A;  3HTK A;  5AVS B;  4EOT A;  3M9H A;  1MUU A;  5AW4 B;  1DH3 A;  3OAK A;  3KQG A;  3SWF A;  5AW2 B;  2VRS A;  5AVQ B;  5AW9 B;  3P8M C;  1J2J B;  1H89 A;  3TNU A;  2N9B A;  1GU5 A;  2QM7 A;  5APS A;  5AW1 B;  3MD0 A;  3HE4 A;  3MGN A;  1NWQ A;  2ZXE B;  4M3L A;  5APT A;  1HWT C;  3M0D A;  5AVT B;  5AVV B;  1KQL A;  3P32 A;  2WPS A;  4JYC A;  5AVY B;  1HJB A;  1FAV A;  3M06 A;  5AW5 B;  3HE5 A;  4B86 A;  3A7O A;  3VMY A;  2Q7C A;  2Q3I A;  3NXS A;  1HBW A;  2Q5U A;  1GK6 A;  4GT1 A;  3NTN A;  3V5B A;  1MFZ A;  3VMX A;  1HUC A;  1IO4 A;  5APY A;  4RES B;  5AVW B;  2C9N Y;  2W27 A;  4AQR D;  5APX A;  1CZQ A;  4I2L C;  2XV5 A;  1YYC A;  3VTP C;  3I5C A;  3TYY A;  1T2K D;  3M0A A;  1FOS F;  4GKG A;  2W6A A;  3L36 A;  2WPR A;  1GZL A;  2P7J A;  5AW7 B;  3TNU B;  1FOS E;  1SP4 A;  2WPQ A;  1T2K C;  3KDP B;  2C9L Y;  2H7H A;  2XZR A;  4C7N A;  2Z5H A;  2E43 A;  5AW8 B;  1CI6 B;  5APV A;  2P67 A;  5AW3 B;  4HYT B;  3VMZ A;  3B8E B;  5APQ A;  3O8Z A;  3HE5 B;  3NMD A;  4C46 A;  3LIE A;  3VYI A;  4JYB A;  1A02 J;  2JJL A;  3IR9 A;  5APU A;  1GTW A;  1OXZ A;  1GU4 A;  1JNM A;  4XE5 B;  1X8Y A;  5AVR B;  2IPP A;  4DZO A;  3L35 A;  1MV8 A;  2BAS A;  2R3C A;  2R32 A;  4KHX A;  1CSB A;  2Z5I A;  4LC1 A;  2P2U A;  2WT7 A;  2WTY A;  2WWW A;  3VN0 A;  3M91 A;  1H88 A;  3HE4 B;  2ZFC A;  3V4Q A;  3LID A;  3P7K A;  4C7N B;  2QM8 A;  3M9B A;  2YNY A;  3NFQ A;  3L37 A;  3UIA A;  1G2C B;  1S9K E;  2R5B A;  5AW6 B;  5CMZ A;  5AVZ B;  1SLQ A;  4AUW A;  1A02 F;  2YO3 A;  3A3Y B;  2E42 A;  3V4W A;  2XU6 A;  4AYC A;  1H8A A;  2R5D A;  3T97 A;  5APW A;  5AVX B;  1CI6 A;  1GD2 E;  5AVU B;  1JUN A;  3A2A A;  1S9K D;  3TK1 A;  1NAF A;  4I6M C;  2KP8 A;  2WT7 B;  2YO2 A;  1GK4 A;  5AW0 B;  3A5T A; 
#chains in the Genus database with same CATH topology
 2HOD B;  1DH3 A;  4DOJ A;  1J1E B;  3CWB G;  3HRN A;  1AV1 A;  1FZC A;  2GA1 A;  2KSJ A;  3SFD C;  1NU1 G;  3BAT A;  3M0D C;  4A7P A;  1HGZ A;  3VMY A;  1VDF A;  2FYU D;  2YKP A;  3IFM A;  4GT1 A;  3V2N A;  3CCM P;  3CCR P;  5BVZ A;  1RE4 A;  3L72 G;  5KLV E;  5AW7 B;  2ZT9 D;  1URQ B;  2LXB A;  4PV1 C;  3H6P A;  2CK3 H;  5AW8 B;  2M5A A;  3CCU P;  2PGD A;  3VP9 A;  1OVU A;  3RK3 E;  5GTH H;  1E5W A;  4UB8 E;  5AVR B;  3N4X A;  1FJP A;  3H1H E;  2IYP A;  3RK2 B;  3MIW A;  1G1J A;  5TIS H;  3UIA A;  2J5U A;  2QG4 A;  5KLV J;  3B5N A;  1QVG O;  5DJT B;  3V2P A;  4Y28 J;  4GOD A;  1GL2 B;  2BCC E;  1IFP A;  4D6T J;  3BVH A;  2FFD B;  5B5E H;  1OMI A;  4EOT A;  1SQB D;  3PTZ A;  1U57 A;  2OYI A;  3RL0 B;  3D71 A;  1X79 B;  4JYC A;  4Y99 C;  3M06 A;  5KKZ C;  5AW5 B;  1HBW A;  3C1L A;  1KIL D;  1IO4 A;  5APY A;  4RES B;  4ZKP A;  1DX7 A;  5H2F H;  1YI2 P;  1FOS F;  4GKG A;  3KYQ A;  3H1L G;  3IAO A;  1XTC C;  3H1K J;  1IFJ A;  1S5L H;  4WY4 D;  3KZI E;  1BE3 D;  2P67 A;  2RN0 A;  2O1J A;  1RF0 A;  1FJK A;  1BCC D;  3RGU A;  3L70 D;  1M1J A;  1FZA A;  2WSF H;  1SQX E;  4HB1 A;  1SFC D;  5E79 H;  2P2U A;  1BDC A;  3AE7 C;  1R8E A;  5KLV K;  3SWY A;  2YNY A;  3CL3 D;  1YHQ P;  2R5B A;  5AVZ B;  1UIX A;  2YMY A;  3HUS C;  5APW A;  2NPS B;  3JCU E;  4L76 A;  1L0L E;  1VQK P;  1NAF A;  3MTU E;  2KXP B;  4DCK A;  1YIT P;  1W5C E;  3A5T A;  3L74 E;  2KLU A;  1SQX J;  3OAK A;  2KS1 B;  4H0L B;  2QJY B;  2P10 A;  2C0X A;  3L73 E;  5AW9 B;  1KYO I;  2QM7 A;  1ZRT D;  1M90 Q;  3GHG C;  1HWT C;  3GF3 A;  1KD1 Q;  2AEF A;  3HE5 A;  3WUT A;  2ZT9 C;  3Q2Y A;  3L71 E;  1H0T A;  1NTZ E;  1IK9 A;  1L0L J;  4UB6 H;  3D70 A;  1SQP G;  3CCL P;  2FBW C;  1FZC B;  2G3A A;  2H8P D;  1K9M Q;  3TSI A;  2OQQ A;  3L74 J;  4JBZ A;  3B8E B;  1IK7 A;  3O8Z A;  4WY4 A;  3IF4 A;  1FZG A;  1LTJ B;  3VYI A;  4L73 A;  4L75 A;  3FGA D;  5KJ7 C;  1LT9 C;  4K3A A;  3RK2 D;  2OYH C;  1EZV D;  2Q6Q A;  2E76 C;  2M5A B;  1J1D C;  1FDI A;  1NH4 A;  3A3Y B;  2E42 A;  3LW5 H;  1KV4 A;  4AYC A;  1LTB C;  4HKZ H;  2PP6 A;  1JUN A;  1IFM A;  1DD3 A;  1SQX K;  4YTP C;  1AA0 A;  3AEF C;  3G3Z A;  3RL0 D;  1JEK A;  1OX3 A;  3H1I G;  1MFT A;  2FYU E;  5CCG D;  1KIL C;  1FBM A;  2A06 G;  3B5N B;  3Q5R A;  1L4A D;  2M3E A;  2ZVO B;  1YBK A;  3R4Y A;  1USE A;  2R3S A;  1IC2 A;  2WZ7 A;  1BSN A;  5GTH E;  3H1J G;  2OTK E;  4EIJ A;  1ZOY C;  4UB8 H;  1NTK J;  1KQG B;  1L0L K;  1JCD A;  3D6Z A;  2KK7 A;  1LJ2 A;  3TYY A;  1FZF A;  1VQO P;  3M0A A;  3V2R A;  2OYI B;  1HVV A;  1KYO D;  3EQ2 A;  3CD6 P;  1SFC C;  1AVO A;  1GDT A;  1ZN5 A;  1ZR4 A;  3U59 A;  3WMM 0;  2FYU J;  4BRY A;  4C46 A;  1UII A;  1SQV D;  3E1R A;  1QL2 A;  2GM4 A;  3CI9 A;  1M8O B;  5L8R J;  2IFM A;  1ZXG A;  2K88 A;  1HJ0 A;  3FX0 A;  3HE4 B;  3PRJ A;  3CWB D;  2E5Y A;  1BGY D;  3G4S P;  1NU1 D;  2O01 H;  1WRG A;  2WQY C;  2NPS D;  1J1E C;  2L91 A;  3I56 P;  1N73 A;  3PHL A;  3A0H E;  1KN7 A;  1SQB E;  1M1J B;  3WUU A;  1GD2 E;  1EDL A;  2M8R A;  2GUV A;  1PL5 A;  3KHU A;  4ZMD A;  5AW4 B;  1IFI A;  2J59 M;  3I55 P;  3KZI H;  1GU5 A;  1KIL E;  4JF7 A;  3RL0 g;  3AE9 C;  1N8R Q;  1URQ C;  1NTK K;  1OFC X;  2B9B A;  4I7Z B;  5KTB A;  3B4S A;  2HLO A;  1Q81 Q;  1LT1 A;  1KOR A;  1VQ5 P;  1SQB J;  2C9N Y;  3CXH I;  4AQR D;  1JY2 P;  1T2K D;  1BCC E;  1QVF O;  3M9Q A;  3HD7 A;  3L70 E;  1JO5 A;  2C0W A;  2FYU K;  3RK2 C;  5AW3 B;  1L0N D;  2B89 A;  3VMZ A;  1PFI A;  1VQ7 P;  4GIF A;  2N1T A;  5KLI B;  3HE5 B;  4ZNC A;  1A02 J;  1PGJ A;  3CME P;  5KLV G;  2R32 A;  2WSF J;  1GL2 C;  1LTI C;  1RF1 A;  3CCV P;  2FFD C;  2A45 I;  1BE3 J;  1SQQ J;  4Z1M H;  1NTM J;  3Q1M A;  1BCC J;  2Q1K A;  5CMZ A;  3WU2 E;  3L70 J;  1EDK A;  4WY4 B;  3BRV B;  3RL0 C;  3BCC E;  5CCG C;  2IBZ G;  1YQ3 C;  4RO0 A;  1K8A Q;  4I6M C;  1ZRT E;  5CJ4 A;  1JY3 P;  1NHL A;  2W83 C;  4UB6 E;  2Q9I A;  1GK4 A;  3AE2 C;  2NRG A;  4PJ0 H;  3V6I A;  3B5N D;  1PP9 J;  4NPE A;  1LTT C;  1S4X A;  4WBA A;  1JY2 O;  2OGU A;  1LP1 A;  3MGN A;  1OVV A;  3FXE A;  1KQL A;  1HJB A;  4R4M A;  1SQB K;  5CCH C;  3H1K G;  2FY8 A;  4I2L C;  4IL6 E;  4KT0 J;  3L36 A;  3H25 A;  4ASV A;  1E79 H;  1RHZ B;  4EYY Q;  1Y47 A;  2WPQ A;  3R2P A;  4U3F D;  1PIX A;  3BRT B;  1KTM A;  1CI6 B;  3CCS P;  1EXI A;  1EZV E;  1T3J A;  4LLH A;  2JJL A;  3E1I A;  1DEB A;  3AEB C;  3CXH D;  4XE5 B;  3AEE C;  2H89 C;  2NPS C;  1RQV A;  3GMA A;  2I8D A;  3S9O A;  1SQQ K;  1NTM K;  2XNX A;  1JY3 O;  3OJA B;  3G9R A;  4H0L C;  4BRY B;  2QJY C;  1S2E A;  3OW2 O;  2I1J A;  4W7Z A;  3T97 A;  3LW5 J;  1SQX G;  3A2A A;  2AEJ A;  3VP8 A;  1FC2 C;  1IJD B;  4GDO A;  3AE5 C;  1SQP D;  5B66 H;  1OW8 A;  2VRS A;  1H89 A;  2LKM A;  1PPJ D;  5APS A;  1FZC C;  1N73 B;  1JY3 N;  1VQ4 P;  2KYV A;  1BDD A;  1L0L G;  1KYO E;  2A45 H;  4B86 A;  1K73 Q;  2Q3I A;  1LTJ C;  2K1A A;  1MFZ A;  2XKM A;  3L74 G;  1P84 I;  2AXT E;  4GOE A;  1Q2N A;  1RE4 C;  1SQV E;  1Y9B A;  3H1H J;  5C39 A;  4YXD C;  2FXM A;  1AJY A;  2ZYG A;  2E43 A;  2Z5H A;  1L4A B;  1G1I A;  1NAY A;  4XFJ A;  2QIW A;  3A0H H;  2ZYA A;  4JPZ B;  5APU A;  3CWB E;  2WMM A;  1BGY E;  1X8Y A;  4BXL A;  1NU1 E;  1KFN A;  3MZW B;  2BCC J;  4KHX A;  3MHV A;  2Z5I A;  1Q90 D;  3H1I D;  3VN0 A;  1EZV I;  3Q5S A;  1VQ6 P;  2KNC A;  4EI2 A;  2Q3E A;  3EWK A;  1Q82 Q;  2N1T B;  3CCQ P;  3AEA C;  1SQV J;  2KIK A;  3L72 E;  2QVA A;  3V4W A;  3B5N C;  2O01 J;  1M56 D;  2D2C D;  3TGU D;  3TF5 A;  2KOG A;  2RMZ A;  1U7J A;  2JDI H;  2LR2 A;  5DJU B;  1BGY J;  2IZ1 A;  5TJH A;  3P8M C;  1J2J B;  1NTK G;  2OYI C;  1ZME C;  1FS0 E;  2ZXE B;  4JQ0 D;  2WPS A;  3GF7 A;  5AVY B;  2W90 A;  4K35 A;  5K5G B;  2Q7C A;  1M57 D;  3VMX A;  3BCC D;  1JB0 J;  3BAS A;  2JP3 A;  5AVW B;  1LGH B;  2E75 B;  1L0N E;  5APX A;  1AQT A;  2FYU G;  1N86 A;  2OTL P;  3GLM A;  1FOS E;  2G8Y A;  2RKL A;  2C9L Y;  1JTH A;  3WU2 H;  1LP1 B;  3K5B A;  3CMA P;  2OYO A;  2Y0E A;  1RF0 C;  3AE3 C;  1EXJ A;  1QEX A;  1P84 D;  2IPP A;  1M1J C;  4PJ0 E;  3QWO C;  2QEX P;  4LC1 A;  1RE3 A;  5CBN A;  3NFQ A;  1DEE G;  1L0N J;  3L73 J;  3RBZ A;  1P84 H;  1JOC A;  1FZB A;  2R5D A;  2CPB A;  4I7Z C;  2YKO A;  2FKW B;  3L71 J;  4W7Y A;  4IL6 H;  1PGO A;  1EC5 A;  5AVS B;  1NTZ J;  3AEG C;  1JMB A;  3TNU A;  1SQB G;  4I1L A;  4C7R A;  3T97 B;  5AVT B;  3EFF K;  1VQP P;  3A7O A;  5KLI C;  4U3F E;  1NOH A;  2ZAE B;  3ABV C;  1LWU A;  4TT3 H;  1MZ9 A;  1NGM B;  1SP4 A;  2UWJ E;  3B71 A;  2K9Y A;  3CXH E;  3U1A A;  2OTJ P;  4RKU J;  4D6T D;  3GG2 A;  1T8Z A;  1JMM A;  4N3Y B;  3L75 D;  3VMA A;  4WY4 C;  2KZJ A;  1XTG B;  1KQF B;  3HD7 D;  1BE3 G;  1JNM A;  1FDM A;  1SQQ G;  1NTM G;  4ZKU A;  1BCC G;  4R4L A;  3L70 G;  5B66 E;  1L0N K;  1Z56 A;  4U3F J;  1H88 A;  1OIP A;  2N1T D;  1X22 A;  2ZYD A;  1HTL C;  1N7S D;  1A02 F;  1IZN B;  1KYO H;  1QL1 A;  1SQP E;  1EDJ A;  1URQ A;  3FWL A;  1PP9 G;  4IOI H;  3WUV A;  1PPJ E;  3TK1 A;  1N2D C;  1NTZ K;  2AXT H;  3HTK A;  2KNC B;  3CC2 P;  1ZR2 A;  4LGD E;  3PLN A;  1S5L X;  2FYZ A;  5AW2 B;  2WSC H;  2KI7 B;  2FXP A;  1NWQ A;  4GOF A;  1FAV A;  2E75 D;  3ZDM A;  3L72 D;  3EFG A;  4N78 D;  2DW3 A;  3F89 A;  2Z4E A;  3E7K A;  1CZQ A;  1YYC A;  2QJK B;  3I5C A;  3P8C D;  3VTP C;  2O1K A;  1GL2 A;  3Q5P A;  5KAF E;  2Y0D A;  2XZR A;  4C7N A;  1AVY A;  1USD A;  2IZ0 A;  3H1I E;  2KZI A;  1GTW A;  2YKQ A;  1GU4 A;  2MJZ A;  3MUD C;  2HFE D;  2V7Q H;  1CSB A;  2P1J A;  3H1J E;  3OA7 A;  3TGU E;  2QM8 A;  2WSE H;  1OVR A;  1OW6 A;  3L37 A;  2YMK A;  2FYN B;  1HGV A;  1ZW0 A;  1H0T B;  1N7S A;  1GMJ A;  1N73 C;  2SPZ A;  1K05 A;  4IFF A;  1FE6 A;  1M7L A;  1S9K D;  1OW7 A;  3CC7 P;  3ITK A;  1OWA A;  2HPC A;  1NYH A;  1YJ9 P;  2O3J A;  4W80 A;  3TGU J;  5AW1 B;  2WSS H;  1BSH A;  3M0D A;  2D2C B;  1L4A C;  3H1H G;  2XDJ A;  1R5S A;  3G71 P;  2M3B A;  3H1L D;  1T3U A;  2XV5 A;  2O01 N;  4H44 B;  1DIP A;  1DD4 A;  1NO4 A;  3TNU B;  1VQ9 P;  2YXQ B;  3KDP B;  1P84 E;  2H7H A;  5APV A;  1IFN A;  2BCC G;  1VL2 A;  3NMD A;  2N1T C;  3S1K A;  3BCC J;  1NKN A;  5M1B A;  1VF5 B;  5GTI H;  1LWU B;  4XA4 A;  2IFN A;  1SQV G;  2QJP B;  3AE1 C;  2JWD A;  2BEZ F;  1KB9 I;  2L5G B;  4HJG H;  1JY2 N;  1SLQ A;  4AUW A;  4OGQ B;  2WPV B;  3N7N A;  2N9Y B;  1BGY G;  2IYO A;  3CX5 I;  3A0B E;  1LTJ A;  2POH A;  3C9I A;  2HG5 D;  1SVF A;  4OH8 B;  3M9H A;  2E75 C;  2E74 B;  4PD4 I;  3CXH H;  4MN4 C;  1TU3 F;  1YQ4 C;  3MD0 A;  1KZU B;  2Y9Z A;  2YIU B;  3S4R A;  2B87 A;  4D6T E;  1GK6 A;  4WWI A;  5KAI E;  2E5T A;  1VQ8 P;  3HTK B;  1PV3 A;  3U1C A;  1LTA C;  2ZJS E;  3L75 E;  2IBZ E;  4TLF A;  2B88 A;  2PFX A;  3SWK A;  1T2K C;  3SFE C;  3W68 A;  1G2C A;  2QE7 H;  3KXD A;  4BWN A;  4JYB A;  5KJ7 D;  1L0N G;  1OZH A;  2QSI A;  3L73 G;  2JWA A;  2LXC B;  2E76 D;  2WTY A;  2WWW A;  1QLE D;  1NJI Q;  2ZFC A;  1M1K Q;  3P7K A;  4C7N B;  3H1K E;  1QGK B;  3L75 J;  3L71 G;  3RK3 B;  2ZXX A;  3HUS A;  2XU6 A;  2M0B A;  3AE6 C;  4H13 B;  2P58 A;  3IN6 A;  1NTZ G;  3HD7 B;  4U7J A;  3USS A;  2WIT A;  1KB9 D;  2A06 D;  1YIJ P;  5KAF H;  1W2B O;  3H1J D;  4DT0 A;  2W8Z A;  1N7S B;  3GHG A;  3HE4 A;  4N78 E;  1WT6 A;  2WSC J;  3P8C E;  1KB9 H;  3CX5 D;  3CPW O;  1SQQ D;  1NTM D;  3CWB J;  3L4F A;  3NXS A;  1RF1 B;  2ITA A;  1W2E A;  4H44 D;  1NU1 J;  2HPC B;  4KJM A;  4PD4 D;  1FDO A;  2W6A A;  3CX5 H;  3II6 A;  3G6E P;  1RQU A;  1PGP A;  1SS1 A;  1S72 P;  5APQ A;  3L72 J;  1PP9 D;  1VF5 D;  4PD4 H;  4U3F G;  2IBZ I;  2YXR B;  5KJ7 A;  1LT9 A;  3MP7 B;  3L35 A;  4DZO A;  4EDF A;  2BAS A;  2R3C A;  2OYH A;  2V7Q J;  2QA4 P;  4PV1 B;  1R5L A;  4OGQ D;  2JO1 A;  3D6Y A;  1S9K E;  4WVZ A;  5AW6 B;  3O6Q A;  1KFM A;  2WSE J;  1X9V A;  2YO3 A;  2Y9Y A;  3FXD A;  1RH5 B;  3GW6 A;  4IFM A;  2E74 D;  3CCJ P;  2W6B A;  1L2P A;  1SQV K;  2KSE A;  1Y8A A;  3CC4 P;  1LNQ A;  1D7M A;  1MUU A;  3CCE P;  1KIL A;  2QJK C;  3VOP A;  1URQ D;  2A45 G;  2NZ2 A;  3H1L E;  5APT A;  4M3L A;  2KLV A;  1GW4 A;  1PPJ G;  2GUS A;  1NU1 K;  5GTI E;  1HUC A;  3H32 A;  1YJW P;  2K9J A;  4RJT A;  2J58 A;  1SFC A;  4DJG A;  1RF1 C;  4Y99 B;  3PJS K;  5KKZ B;  2KUB A;  3C8V A;  1JCC A;  5KLV D;  2B87 B;  2FYN C;  3FWN A;  1NTK E;  1OXZ A;  2H88 C;  3H1L J;  1AFO A;  1GL2 D;  3A0B H;  4NPF X;  2IX7 C;  1MV8 A;  2WT7 A;  5EFW B;  2K3R A;  3V4Q A;  2I1K A;  3RK3 D;  1RE3 C;  2R44 A;  5BU5 A;  1EQ7 A;  1G2C B;  2HOD A;  1YTZ I;  2AEM A;  4H13 D;  2IBZ D;  2PRR A;  4YXW H;  1ZP0 C;  3H1H D;  5AVX B;  1CI6 A;  5AVU B;  2D2C C;  4OVN F;  5KAI H;  1YJN P;  3TGU G;  1PZQ A;  2YO2 A;  1NVO A;  1HF9 A;  1FU1 A;  1GW3 A;  3KQG A;  4H44 C;  3SWF A;  5AVQ B;  2BCC D;  5TIS E;  2N9B A;  3HUS B;  1MKM A;  3H1K D;  1LTS C;  5CCH D;  1KQS O;  4CPG A;  3NTN A;  3V5B A;  2QRX A;  1VF5 C;  3MUD A;  3PP5 A;  1LWU C;  3JSV C;  5B5E E;  1FZE A;  1EDI A;  2WPR A;  2QJP C;  1YTZ T;  3BCC G;  4YPC A;  3GHG B;  2Y0C A;  3TDK A;  4N6J A;  1NKZ B;  3F5H A;  2WVR A;  4HYT B;  2ZT9 B;  4L74 A;  3AE8 C;  3LIE A;  1SQP J;  2K37 A;  4OGQ C;  1U7M A;  5BU8 B;  1ZLL A;  3SSU A;  3RBX A;  3KPE A;  4PV1 D;  1VQL P;  5CJ0 A;  4IFD K;  5H2F E;  2V4H A;  2FFD A;  4HH2 A;  3LID A;  1CW5 A;  4H0L D;  3M9B A;  1PGQ A;  1SQX D;  1KC8 Q;  2E74 C;  1S5L E;  1KB9 E;  2A06 E;  2JKV A;  4QMA A;  5CCG A;  1LT9 B;  2XND H;  1L4A A;  1AQ5 A;  2YIU C;  2OYH B;  2KP8 A;  3AE4 C;  1JTH B;  5AW0 B;  5CBO A;  2E76 B;  5E79 E;  1S3J A;  2W6J H;  2AXC A;  1BE3 E;  1J1D B;  3CX5 E;  1SQQ E;  1EZV G;  3O6Q B;  1NTM E;  1VQN P;  1L0L D;  3W67 A;  2PAJ A;  1X0T A;  4PD4 E;  4O9B A;  5AVV B;  3P32 A;  3L74 D;  3Q3D A;  1S1C X;  3H1I J;  5CCH A;  1HH0 A;  3AEC C;  2ZVN B;  1KMI Z;  3L73 D;  2Q5U A;  4WB4 A;  1JM0 A;  2MKV A;  3JCU H;  2BEQ D;  1QX8 A;  1RY3 A;  2HYN A;  2CPS A;  2W27 A;  1PP9 E;  1LTG C;  1VQM P;  3H1J J;  1KIL B;  1VPC A;  1T6A A;  1GZL A;  2P7J A;  1Q86 Q;  3L71 D;  1WMK A;  1SQP K;  2H43 A;  2KB7 P;  1NTZ D;  3JC2 2;  3RK3 C;  4D6T G;  3IR9 A;  2RH0 A;  1N7L A;  4H13 C;  2NPS A;  3H32 B;  4OWF A;  2IDB A;  2OAR A;  3L75 G;  4IL6 X;  3HD7 C;  2K9J B;  3AED C;  1K04 A;  3M91 A;  3PH0 A;  1SFC B;  5CHX A;  3CLQ A;  4ASW A;  3V2Q A;  3QH9 A;  2KS1 A;  2JEE A;  1IFD A;  1Q7Y Q;  1ZV8 A;  1H8A A;  2JR8 A;  1N7S C;  2HR3 A;  2FXO A;  2WT7 B;  1NTK D;  4NPD A; 
#chains in the Genus database with same CATH homology
 5AVS B;  2HOD B;  5AW4 B;  1DH3 A;  4DOJ A;  1J1E B;  1IFI A;  2J59 M;  3HRN A;  3TNU A;  1FZC A;  1GU5 A;  4JF7 A;  2KSJ A;  1N7S B;  3GHG A;  3HE4 A;  4I1L A;  4N78 E;  4C7R A;  1WT6 A;  1URQ C;  1NTK K;  3P8C E;  5AVT B;  3BAT A;  3M0D C;  5KTB A;  1HGZ A;  3A7O A;  2HLO A;  3VMY A;  1VDF A;  3L4F A;  3NXS A;  2YKP A;  1RF1 B;  1W2E A;  3IFM A;  4GT1 A;  1NOH A;  3V2N A;  2HPC B;  1LWU A;  2C9N Y;  4AQR D;  1JY2 P;  5BVZ A;  1T2K D;  1MZ9 A;  1RE4 A;  3M9Q A;  3HD7 A;  2W6A A;  5AW7 B;  1SP4 A;  1JO5 A;  3U1A A;  2C0W A;  1URQ B;  2FYU K;  3II6 A;  3H6P A;  3RK2 C;  1T8Z A;  1JMM A;  5AW8 B;  5AW3 B;  4N3Y B;  3VMZ A;  1PFI A;  4GIF A;  2N1T A;  5APQ A;  3HE5 B;  4WY4 C;  3VP9 A;  1A02 J;  1XTG B;  3HD7 D;  1JNM A;  1E5W A;  1FDM A;  5KJ7 A;  5AVR B;  1LT9 A;  4DZO A;  3L35 A;  4ZKU A;  2BAS A;  2R3C A;  2R32 A;  2OYH A;  1GL2 C;  3N4X A;  1L0N K;  1Z56 A;  1LTI C;  1FJP A;  1H88 A;  1RF1 A;  2N1T D;  2FFD C;  3RK2 B;  2A45 I;  3MIW A;  1G1J A;  3UIA A;  1S9K E;  5AW6 B;  1HTL C;  1KFM A;  5CMZ A;  1N7S D;  4WY4 B;  1X9V A;  1A02 F;  2YO3 A;  3B5N A;  3BRV B;  3RL0 C;  1QL1 A;  1URQ A;  3V2P A;  5CCG C;  1GL2 B;  3TK1 A;  4I6M C;  1N2D C;  1NTZ K;  4IFM A;  3BVH A;  5CJ4 A;  1JY3 P;  1NHL A;  2W6B A;  2FFD B;  1SQV K;  2Q9I A;  1GK4 A;  3HTK A;  4EOT A;  3B5N D;  1ZR2 A;  1MUU A;  4LGD E;  1KIL A;  2FYZ A;  3VOP A;  2OYI A;  5AW2 B;  1URQ D;  1LTT C;  4WBA A;  3RL0 B;  2A45 G;  1JY2 O;  2WSC H;  1X79 B;  3MGN A;  1NWQ A;  5APT A;  4M3L A;  2KLV A;  1KQL A;  4JYC A;  1HJB A;  1GW4 A;  4Y99 C;  1FAV A;  2GUS A;  3M06 A;  1NU1 K;  5AW5 B;  1SQB K;  5CCH C;  1HBW A;  1KIL D;  1IO4 A;  1HUC A;  3EFG A;  3H32 A;  5APY A;  4RES B;  4ZKP A;  1DX7 A;  4N78 D;  2Z4E A;  1CZQ A;  4I2L C;  1YYC A;  3VTP C;  3I5C A;  3P8C D;  1FOS F;  2O1K A;  4GKG A;  3L36 A;  1GL2 A;  3KYQ A;  2J58 A;  2WPQ A;  3R2P A;  3BRT B;  1SFC A;  1XTC C;  2XZR A;  4C7N A;  1IFJ A;  4WY4 D;  1CI6 B;  4Y99 B;  2P67 A;  2O1J A;  1RF0 A;  1JCC A;  1FJK A;  1T3J A;  4LLH A;  2JJL A;  1GTW A;  3E1I A;  2YKQ A;  1OXZ A;  1DEB A;  1GU4 A;  1AFO A;  1GL2 D;  4XE5 B;  1M1J A;  1FZA A;  2WSF H;  2IX7 C;  2MJZ A;  2NPS C;  2HFE D;  1MV8 A;  1SFC D;  1CSB A;  2P1J A;  1SQQ K;  2P2U A;  2WT7 A;  3OA7 A;  1NTM K;  3V4Q A;  2I1K A;  3RK3 D;  5KLV K;  2QM8 A;  3SWY A;  2WSE H;  2YNY A;  2XNX A;  1JY3 O;  1RE3 C;  3L37 A;  5BU5 A;  1EQ7 A;  1G2C B;  2HOD A;  3CL3 D;  3OJA B;  1YTZ I;  2R5B A;  5AVZ B;  1HGV A;  2I1J A;  1N7S A;  2YMY A;  4W7Z A;  3HUS C;  3T97 A;  5APW A;  1N73 C;  5AVX B;  2NPS B;  4IFF A;  1CI6 A;  5AVU B;  1M7L A;  3A2A A;  1S9K D;  1NAF A;  3MTU E;  3VP8 A;  1IJD B;  2YO2 A;  3A5T A;  1FU1 A;  1GW3 A;  1OWA A;  2HPC A;  3OAK A;  3KQG A;  3SWF A;  2VRS A;  2C0X A;  5AVQ B;  5AW9 B;  1H89 A;  2LKM A;  4W80 A;  2N9B A;  2QM7 A;  5APS A;  3HUS B;  5AW1 B;  1FZC C;  1N73 B;  3GHG C;  1HWT C;  1JY3 N;  1LTS C;  3M0D A;  5CCH D;  2KYV A;  1L4A C;  2A45 H;  3HE5 A;  4B86 A;  2XDJ A;  2Q3I A;  1LTJ C;  2M3B A;  3NTN A;  3V5B A;  1MFZ A;  2XKM A;  1T3U A;  3MUD A;  3PP5 A;  2XV5 A;  1LWU C;  1IK9 A;  1FZE A;  1RE4 C;  2WPR A;  1NO4 A;  3TNU B;  1YTZ T;  1FZC B;  2H8P D;  3TSI A;  3KDP B;  2H7H A;  2FXM A;  3GHG B;  2E43 A;  2Z5H A;  4N6J A;  1NKZ B;  1L4A B;  1G1I A;  1IFN A;  5APV A;  4HYT B;  3B8E B;  3O8Z A;  4WY4 A;  3NMD A;  1FZG A;  1LTJ B;  2N1T C;  3LIE A;  3VYI A;  5APU A;  1NKN A;  5BU8 B;  1X8Y A;  1ZLL A;  1LWU B;  4XA4 A;  5KJ7 C;  1LT9 C;  3KPE A;  1KFN A;  2IFN A;  3RK2 D;  4KHX A;  5CJ0 A;  2Z5I A;  2OYH C;  4IFD K;  3VN0 A;  2FFD A;  4HH2 A;  3LID A;  1CW5 A;  3M9B A;  2L5G B;  1J1D C;  1JY2 N;  2N1T B;  1SLQ A;  1NH4 A;  4AUW A;  3A3Y B;  2E42 A;  3LW5 H;  3V4W A;  4AYC A;  3N7N A;  3B5N C;  1LTB C;  5CCG A;  2KOG A;  1LT9 B;  1L4A A;  2PP6 A;  1AQ5 A;  1JUN A;  2OYH B;  1IFM A;  1SQX K;  2KP8 A;  1LTJ A;  2POH A;  3C9I A;  1JTH B;  5AW0 B;  2HG5 D;  3G3Z A;  1SVF A;  3RL0 D;  4OH8 B;  3M9H A;  1J1D B;  5CCG D;  1KIL C;  1J2J B;  3P8M C;  1FBM A;  2OYI C;  2PAJ A;  3B5N B;  1L4A D;  3MD0 A;  1KZU B;  2ZXE B;  1IC2 A;  4O9B A;  2WZ7 A;  5AVV B;  3P32 A;  2WPS A;  5AVY B;  4EIJ A;  5CCH A;  1HH0 A;  2Q7C A;  2Q5U A;  4WB4 A;  1L0L K;  1JCD A;  1GK6 A;  3VMX A;  3BAS A;  1LGH B;  5AVW B;  1RY3 A;  3HTK B;  2HYN A;  2CPS A;  2W27 A;  5APX A;  3U1C A;  1LTA C;  1LTG C;  3TYY A;  1FZF A;  3M0A A;  3V2R A;  1KIL B;  1N86 A;  1VPC A;  2OYI B;  1HVV A;  3EQ2 A;  1GZL A;  2P7J A;  1FOS E;  1T2K C;  2C9L Y;  1JTH A;  1SFC C;  1GDT A;  1SQP K;  1G2C A;  2H43 A;  1ZN5 A;  2KB7 P;  1ZR4 A;  3U59 A;  3WMM 0;  4C46 A;  3RK3 C;  1RF0 C;  4JYB A;  5KJ7 D;  3IR9 A;  1QL2 A;  1N7L A;  2GM4 A;  3CI9 A;  2NPS A;  3H32 B;  2IPP A;  2OAR A;  1M1J C;  2IFM A;  3HD7 C;  4LC1 A;  2WTY A;  2WWW A;  3M91 A;  3HE4 B;  2ZFC A;  1RE3 A;  1SFC B;  3P7K A;  5CHX A;  3CLQ A;  4C7N B;  3NFQ A;  3V2Q A;  2O01 H;  3RK3 B;  1WRG A;  2NPS D;  1JOC A;  2JEE A;  1IFD A;  1J1E C;  1FZB A;  1ZV8 A;  3HUS A;  2XU6 A;  1H8A A;  2R5D A;  1N73 A;  2CPB A;  1N7S C;  1M1J B;  2YKO A;  1GD2 E;  3HD7 B;  2FKW B;  2M8R A;  2WIT A;  4W7Y A;  2WT7 B;  2GUV A;  1RF1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...