3MGNA

D-peptide inhibitor pie71 in complex with iqn17
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of a potent D-peptide HIV-1 entry inhibitor with a strong barrier to resistance.
pubmed doi rcsb
molecule tags Viral protein/viral protein inhibitor
molecule keywords IQN17
total genus 20
structure length 45
sequence length 45
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3mgnA00
3V4QA 4RESB 2BASA 3LIDA 2XV5A 3M91A 4C7NA 3NMDA 3P7KA 1YYCA 1T2KC 1GU4A 5AW9B 3M9HA 3T97A 2WPQA 1GU5A 1S9KE 4I2LC 1H89A 5AVVB 5AVZB 1FOSF 5AW0B 1SP4A 1A02F 1IO4A 4GT1A 3HE5B 5CMZA 2QM8A 1HWTC 1S9KD 1CSBA 3LIEA 3TNUA 3L37A 3A3YB 5APVA 2WTYA 1HBWA 4I6MC 1JNMA 4M3LA 5AW7B 2R5BA 2XZRA 1GZLA 2ZXEB 5AVUB 3M0AA 2WPSA 3VTPC 2JJLA 1JUNA 1H88A 1G2CB 5APXA 4JYBA 1CZQA 4AUWA 5APSA 2ZFCA 3NXSA 1HJBA 2Q5UA 3OAKA 5APTA 2WT7B 3L36A 1OXZA 2IPPA 3V4WA 2R32A 1H8AA 3L35A 2R3CA 1CI6A 5APWA 3VMZA 2P2UA 1MV8A 4B86A 2WWWA 2Z5IA 2C9NY 3M0DA 3MGNA 3VYIA 4LC1A 1FOSE 1GTWA 2N9BA 3I5CA 2VRSA 5AVRB 1FAVA 5AVQB 3P32A 2Q3IA 4C7NB 5AW8B 3VMXA 3O8ZA 2YNYA 3KDPB 5AW1B 2Q7CA 3V5BA 2XU6A 4XE5B 2WT7A 3VMYA 2E43A 4AYCA 1DH3A 1X8YA 4C46A 3VN0A 2Z5HA 3M06A 3TK1A 3P8MC 3M9BA 2KP8A 5APQA 1KQLA 1NWQA 3HTKA 2YO3A 5AVSB 1A02J 3TYYA 1J2JB 1MFZA 1NAFA 5AW4B 4DZOA 3TNUB 3A7OA 2C9LY 1GK4A 3B8EB 1MUUA 3NFQA 3A2AA 3MD0A 4EOTA 1CI6B 2W6AA 3UIAA 4GKGA 2R5DA 3SWFA 3NTNA 5APYA 1HUCA 5AVXB 3HE4B 5AW6B 2YO2A 4JYCA 4AQRD 5AVYB 2E42A 2W27A 3HE5A 2P67A 1GD2E 2H7HA 1SLQA 4HYTB 5AVTB 5AVWB 3KQGA 1GK6A 5AW2B 1T2KD 1OWAA 5AW5B 3IR9A 5APUA 2P7JA 3HE4A 5AW3B 2WPRA 3A5TA 4KHXA 2QM7A
chains in the Genus database with same CATH superfamily
1X22A 1Q2NA 2BASA 3H1HJ 4RESB 1T8ZA 1N86A 1L4AB 3LIDA 4WB4A 2A06E 3A0BH 3NMDA 3U1AA 1RF0A 4DJGA 1IK7A 5KLVD 1EDIA 2ZT9B 3R4YA 2IYOA 1P84E 3M9HA 4OVNF 2IDBA 3H6PA 5KLIB 2WSCJ 2QVAA 2WPQA 2ZVOB 2QA4P 2B9BA 1M1JC 4L75A 1S9KE 2A45G 1LTAC 5CCGC 3EFGA 5AVVB 1FS0E 1M1JA 2C0XA 3AE8C 2XDJA 1A02F 1SQBJ 4GT1A 1E5WA 5CMZA 4IFFA 1SQQD 2OTJP 1S9KD 2AXTH 2GUSA 4QMAA 1VQ5P 3LIEA 2KZJA 3PH0A 4H44B 4JPZB 2YXRB 3H1JG 1CW5A 1M8OB 2OYHC 3A3YB 5APVA 5KLVE 2YMKA 2KSJA 1JNMA 5AW7B 2I1JA 2R5BA 3BCCJ 2A06G 1GZLA 2LXBA 3B5NB 2CPBA 4HB1A 1IFDA 2G8YA 5KAFH 5B66E 3V2PA 1PPJD 1N8RQ 2WPVB 3EFFK 4NPFX 4N3YB 1SQPG 3PRJA 4H0LB 4ZMDA 4PD4I 3CMAP 1VQ8P 1RE3A 3AE1C 1JY2O 1T6AA 1TU3F 3A0HH 3OAKA 2HLOA 1IK9A 3G71P 1CI6A 1PPJE 4LLHA 1BCCE 4C7RA 1AVYA 3FWNA 3L75D 4UB8H 1NU1D 5M1BA 3RK2C 1NTKD 2OGUA 4H0LD 3VMZA 3E1RA 3D71A 2FKWB 2P2UA 4A7PA 1X9VA 2WWWA 1U7JA 1ZRTE 3D6ZA 1SQQJ 1T3UA 4OGQB 3FGAD 2WSEJ 3MHVA 1VDFA 3N7NA 1GTWA 2N9BA 5KAIE 3AE2C 3L73E 2NZ2A 3L72G 2HPCB 1OMIA 1SVFA 1ZLLA 1OX3A 3CWBE 5AVQB 1YITP 1KD1Q 2HYNA 1JY3P 3VMXA 3CCLP 3RL0D 3O8ZA 5C39A 5AW1B 1JMBA 1KMIZ 3L70G 4L74A 3L72J 5KLVK 4K35A 2IZ1A 1PGJA 2FY8A 4N6JA 1NKZB 2N1TC 1LTTC 1GW3A 1ZR2A 1FZCC 2E43A 4AYCA 3G3ZA 4C46A 3L73D 3MP7B 2BEZF 4DOJA 2O01J 2V7QJ 5KKZB 2Y0EA 1LGHB 1KB9E 3TK1A 3HD7A 3P8MC 1VQ6P 3HD7B 3M9BA 2Y0CA 1BE3J 1J1EB 1NWQA 1SQBK 3CCEP 3B5NA 2FXMA 3RBZA 1JY2N 5AVSB 4JQ0D 3TYYA 3B5NC 2WITA 3PP5A 1KC8Q 2WSSH 1GL2A 1PPJG 4OGQD 3L74D 4DCKA 1FZGA 3H1JJ 3CWBJ 1ZMEC 1NAYA 2JKVA 5H2FE 1GDTA 1MFTA 4GOEA 1GK4A 1LT1A 3B8EB 2P58A 1SQBG 1HJ0A 1OZHA 1QGKB 1P84H 3A2AA 3CI9A 4GKGA 1YJ9P 1RQVA 4XA4A 3EQ2A 1KYOE 2KZIA 1EZVE 1L0NE 3GLMA 3USSA 1URQC 5AVXB 3HE4B 1LT9A 1LWUA 3GHGB 1LWUC 3BASA 3H1JE 4UB6H 1Q81Q 2W90A 2KK7A 3BRVB 1GL2D 2L91A 3S1KA 1PZQA 4HYTB 1VQ7P 4U3FD 1SQQE 2H88C 1NHLA 4JBZA 3SWKA 2YKPA 4H13C 5APUA 1J1EC 3AEEC 3M0DC 2GM4A 5AW3B 2WZ7A 3V6IA 1U7MA 2WPRA 3HTKB 3MUDC 4KHXA 3CCJP 3Q5RA 1J1DC 4TLFA 1L4AC 1KILE 3BCCE 3I56P 2A45H 2QM7A 3HUSC 3V4QA 3WMM0 2JWDA 1EDJA 1S5LH 1L4AA 3PLNA 1W2EA 3MIWA 3M91A 2RKLA 2YKOA 3RK3B 3S9OA 5CCGA 3P7KA 1YI2P 2L5GB 1T2KC 1BDDA 3H1HG 2IFNA 2FBWC 5AW9B 5GTHH 2AEMA 1S4XA 2HODA 1FZEA 2ITAA 2AEFA 1RF1C 5E79H 4I2LC 1BCCD 1P84D 1H89A 3V2RA 1RF1A 1FOSF 2JDIH 1NVOA 2J58A 1SP4A 4I7ZB 4WY4B 2OYHA 1IO4A 1E79H 4L76A 2PP6A 5K5GB 3H25A 2IBZE 4H44C 2V4HA 3L73J 1VQKP 3H32B 1YBKA 1VQNP 2FXPA 1BGYG 2E76D 3K5BA 2FFDA 3E1IA 2WSEH 4GDOA 4W7YA 2QG4A 4IOIH 2FFDC 4OH8B 2WTYA 2KUBA 2KSEA 2XZRA 2JR8A 1S3JA 2GA1A 2ZXEB 5AVUB 1EZVG 1L0NG 2QJYB 1ZOYC 3L71E 4H0LC 4K3AA 3FXDA 3S4RA 3WUVA 3L70J 1H88A 1VQLP 1JUNA 1SQXJ 4AUWA 1LT9B 1L2PA 5CCHD 1FU1A 3B4SA 2WT7A 1HJBA 1VQ9P 1BE3E 2O01H 2KXPB 2V7QH 3L36A 4LGDE 1VQ4P 3IN6A 5APWA 1KYOD 1QVFO 3H32A 1JEKA 1FBMA 1Q86Q 2KI7B 2O1JA 2KLUA 4EYYQ 1NU1J 4WWIA 4XFJA 4BRYB 1BGYJ 4WY4A 1N73A 2C9NY 2KNCA 1G1IA 3L74J 2M3EA 2D2CB 1GL2B 2NPSC 1KILB 4WVZA 2P1JA 1R5SA 3VYIA 2YMYA 4PD4D 3Q5PA 1VQMP 1K9MQ 1KORA 1W5CE 1GMJA 1FAVA 3H1LG 1ZRTD 2B87A 2E74B 1FC2C 5AW8B 3VOPA 2QJKB 1J1DB 1LTBC 1AFOA 4IL6E 3BVHA 2FYUE 2YNYA 3KDPB 1LP1A 2Q1KA 3PJSK 5KLIC 2Q7CA 2OARA 2IX7C 3CCSP 3RK2D 4XE5B 3L4FA 3C9IA 2OYIA 3L73G 5L8RJ 1DH3A 2ZJSE 2FYUD 2Z5HA 1OW7A 2JO1A 2FYNC 2M0BA 4UB8E 1L0NK 1GL2C 1Z56A 2NPSB 3AEDC 4L73A 1H0TB 2KP8A 1LWUB 1KQLA 1LTJB 3A0BE 4JF7A 1VQOP 3AECC 4D6TJ 4Y99B 1RE4C 2K9YA 2B87B 2M5AA 3RBXA 1DIPA 1LTIC 1NTME 3BRTB 3ITKA 3Q1MA 1J2JB 1FDIA 1MFZA 1NAFA 3CX5E 1URQD 1N2DC 1KILD 3BCCD 4Y99C 1SS1A 3IAOA 4KJMA 3IFMA 2C9LY 2KOGA 1QL2A 2JEEA 3SWYA 2H8PD 1WT6A 2KNCB 3R2PA 3CC7P 2CPSA 1YIJP 2P10A 3H1KJ 4MN4C 2QSIA 1CI6B 2W6AA 1FZFA 2JP3A 1AQ5A 3SWFA 1NH4A 2PAJA 3NTNA 4YTPC 4D6TG 1VPCA 2NRGA 1HUCA 1NTZJ 1U57A 3L75G 3LW5H 4JYCA 5AW6B 3N4XA 4ZNCA 5AVYB 2E42A 3P8CE 1RE3C 2W27A 3HE5A 1WRGA 3PTZA 1L0LD 1PP9D 1S5LE 3CXHE 5CHXA 4D6TD 2ZYDA 1MKMA 2KB7P 2N9YB 1OWAA 3RK3D 1JB0J 1QEXA 5AW5B 2NPSD 1XTGB 1KFNA 4YXDC 1OVUA 2QE7H 1W2BO 2MKVA 2E75B 4EIJA 1BDCA 2IBZI 1KILC 2N1TD 3BATA 4BWNA 1LTGC 3TSIA 1SQXK 3D70A 4PD4E 2Q3EA 4WBAA 1KILA 1M7LA 4PD4H 3GG2A 3QWOC 1Q90D 2K9JB 1JTHA 2XV5A 2FYZA 1LTSC 2R3SA 1OW8A 1OIPA 3ABVC 1GU4A 4PV1D 3WU2H 1KQGB 1SQBD 4PV1C 4DT0A 5GTIE 3JCUH 3T97A 3CC4P 1EDLA 1KQSO 1JOCA 1KYOH 1N7SD 3JCUE 1AQTA 2ZVNB 3RK2B 5CCGD 2PFXA 5CCHA 3RL0g 1EDKA 2K1AA 5AVZB 1NU1G 3U1CA 1NGMB 2BCCD 1X0TA 5KJ7D 2OTKE 3H1IJ 4UB6E 2N1TA 4PJ0H 4Z1MH 1FZCA 1G1JA 1HWTC 3CMEP 1CSBA 1USDA 4CPGA 2Y9ZA 3TNUA 1OFCX 4U3FG 1KN7A 3TGUJ 3G9RA 2BCCG 1SQPD 4OWFA 1IFIA 3CLQA 3MTUE 3CWBD 1HF9A 1FJKA 3H1LD 2E75D 3M0AA 1PIXA 1YJWP 3CXHH 3VTPC 1DD3A 1M56D 4NPDA 3CL3D 2E74C 2PGDA 1IC2A 1CZQA 2RMZA 3L70D 1NTMJ 5APSA 2I8DA 1RH5B 1H8AA 3NXSA 3CD6P 1DX7A 1Q7YQ 3AE9C 3O6QA 1GU5A 2Q5UA 1RF1B 1VF5D 1DD4A 1VF5C 2WT7B 4PV1B 3A0HE 1SQQG 2R32A 4WY4C 3ZDMA 3CCUP 1SQVD 2R3CA 5B5EE 1L0LE 1PP9E 1N7LA 1QX8A 3AE5C 3HRNA 3EWKA 3V2QA 1HGVA 1SQXG 1KZUB 1QVGO 2GUVA 1SQPK 2I1KA 3JC22 2WSCH 5EFWB 4B86A 1JMMA 1SQVJ 2E74D 3L75E 4W80A 4BRYA 3G4SP 4ASWA 4HKZH 3RL0B 1ZV8A 4D6TE 1IZNB 5KAIH 3CX5H 1K04A 1VL2A 2Y9YA 1NTKG 1FOSE 1KTMA 2BEQD 3HUSB 3I5CA 3IF4A 3OA7A 2QJYC 1IFNA 1RF0C 1BE3D 3KPEA 5AVRB 5CBOA 1KV4A 1AVOA 4ZKPA 1HH0A 5KJ7A 1K73Q 1KYOI 2XNXA 5KJ7C 3H1KG 5TJHA 1ZW0A 2KLVA 3II6A 4GODA 1NTZD 1N7SA 2O3JA 1PGPA 3MUDA 2OYIC 5CJ0A 3V5BA 3HUSA 2WQYC 2FXOA 2YIUC 4U7JA 3CC2P 2W6BA 1Y47A 2A06D 3F5HA 1QLED 3L71D 3T97B 1URQB 1JY3N 1NTKE 1PL5A 3VN0A 3W68A 2QJPB 3M06A 3L72D 3H1JD 1AV1A 2J59M 2JWAA 2K9JA 2OYHB 4N78D 4IFDK 2IFMA 1MZ9A 2MJZA 2LXCB 1NO4A 1SQXE 2W6JH 1OVRA 1L0LK 4IFMA 1USEA 4R4MA 1S2EA 3B5ND 3L70E 1JCDA 1XTCC 2FYUG 2RN0A 4DZOA 1M57D 3VMAA 1FZAA 4EDFA 2CK3H 2HFED 3HD7D 2KYVA 3PHLA 5BU5A 2B89A 2M8RA 3H1LE 3NFQA 1MUUA 3CWBG 3L72E 1RQUA 1ZN5A 2A45I 1K05A 4EOTA 2R44A 2HR3A 1SQVE 1KB9I 1OVVA 3B71A 3VP8A 1NJIQ 2LKMA 5APYA 4U3FJ 3W67A 5KTBA 2KS1B 3GHGC 1YJNP 1GW4A 2XNDH 2YO2A 3GF7A 1BCCJ 1L0LJ 1PP9J 2N1TB 2BCCE 1FZCB 2UWJE 4U3FE 1GD2E 2P67A 3V2NA 1M1KQ 3RL0C 1SLQA 1KB9D 1NKNA 1Y9BA 2B88A 1JM0A 2YXQB 2ZYGA 3P8CD 5AVTB 3KQGA 1GK6A 2AXCA 2H89C 3GMAA 1T3JA 3M9QA 5AW2B 3IR9A 2C0WA 1YTZI 3AE3C 2FYUJ 2P7JA 3HE4A 4OGQC 3CXHI 4EI2A 1NTZK 3CPWO 2Q6QA 1YHQP 1LJ2A 1SFCD 1N73C 1SFCC 2E75C 2PRRA 1P84I 1KB9H 3L71G 1N7SB 1HTLC 1NTZE 1EZVI 2NPSA 2RH0A 3L74G 5DJUB 2E5TA 5TISE 2ZT9C 2KIKA 3SSUA 2WMMA 3KYQA 1YYCA 4C7NA 5CJ4A 4ASVA 4PJ0E 1PV3A 3AEGC 3E7KA 2POHA 2W83C 5KAFE 5KLVG 4YPCA 4H13D 1NTZG 2E76B 3L74E 3RK3E 3SFDC 2H43A 1EZVD 1BGYE 1L0ND 5KKZC 3I55P 3CCVP 1LP1B 2IBZD 4RKUJ 2G3AA 5H2FH 1L4AD 2FYUK 2IBZG 2QIWA 3HD7C 5AW0B 1M90Q 1NU1K 3KXDA 3HE5B 2OTLP 1FZBA 2QM8A 1PGQA 1SQVK 1RY3A 1BGYD 2DW3A 4H13B 1EXJA 3WUUA 3GW6A 3L37A 1OW6A 2XKMA 1NOHA 3L75J 4N78E 3H1HE 3CCMP 1BSHA 4WY4D 3OJAB 3WUTA 4I6MC 4IL6X 4M3LA 1HBWA 2K3RA 2IYPA 3U59A 3Q2YA 3C8VA 1DEEG 1FDOA 3SFEC 1KFMA 2OYOA 1RE4A 2WPSA 2JJLA 1SQVG 1SFCB 1JCCA 1NTMK 3KHUA 1G2CB 1JTHB 3BCCG 3C1LA 3MZWB 4H44D 4JYBA 5APXA 2ZFCA 1IFJA 2KS1A 1M1JB 2K37A 3RK3C 5APTA 3TF5A 3KZIE 2E5YA 4ZKUA 2OYIB 1LT9C 3V4WA 1OXZA 2IPPA 2M5AB 2W8ZA 3KZIH 4R4LA 2ZAEB 1SQQK 3L35A 5GTIH 2QEXP 2YIUB 2FYNB 3CCQP 1S72P 3TGUD 1NTKJ 1SQPJ 1NTMG 2QRXA 1WMKA 5TISH 3AEFC 1R5LA 1Q82Q 1H0TA 2AEJA 1MV8A 2Z5IA 1PGOA 5GTHE 3D6YA 1FJPA 3H1ID 3M0DA 3MGNA 2OQQA 1IFPA 1LNQA 1NTKK 4LC1A 3CX5D 5E79E 1NTMD 2YKQA 5B5EH 1N7SC 2VRSA 3AEBC 3TGUG 1SQBE 3P32A 2Q3IA 3AE6C 1DEBA 4RO0A 3RGUA 4C7NB 3OW2O 1YQ3C 1N73B 1VQPP 1JY3O 2SPZA 3QH9A 5KLVJ 2D2CD 1ZR4A 2ZT9D 3AEAC 1G2CA 3CX5I 2LR2A 1UIIA 4HJGH 3H1KE 2XU6A 1EC5A 1S1CX 1ZP0C 3H1IE 3L71J 1S5LX 1D7MA 2M3BA 3FXEA 4I7ZC 3VMYA 5CBNA 2QJPC 1ZXGA 3O6QB 1JY2P 1EQ7A 1VF5B 1X8YA 2HODB 2WVRA 3Q3DA 2BCCJ 1Y8AA 2O1KA 4HH2A 3AE4C 3CXHD 1K8AQ 1FE6A 2Q9IA 1HVVA 2O01N 1L0NJ 5APQA 5CCHC 3HTKA 3TDKA 3H1IG 2Z4EA 3FX0A 2YO3A 3WU2E 1EXIA 3G6EP 2ZXXA 1A02J 5AW4B 1AJYA 3GF3A 1L0LG 1NYHA 1PP9G 3H1LJ 3TNUB 2QJKC 3A7OA 5DJTB 1R8EA 1JO5A 2FFDB 1AA0A 1BE3G 1QL1A 3FWLA 3AE7C 1HGZA 3F89A 4NPEA 3GHGA 2WSFH 2ZYAA 3JSVC 3LW5J 3VP9A 3TGUE 2E76C 3MD0A 3UIAA 2AXTE 3CCRP 2HG5D 2R5DA 4Y28J 4O9BA 1UIXA 4I1LA 4BXLA 2Y0DA 4AQRD 1SQXD 1YQ4C 4YXWH 1LTJA 1RHZB 4GIFA 4TT3H 5BVZA 2H7HA 1LTJC 3Q5SA 2D2CC 4IL6H 4GOFA 1BCCG 5B66H 1URQA 2IZ0A 1KQFB 1SFCA 5AVWB 2K88A 2WSFJ 4RJTA 1T2KD 4W7ZA 1BSNA 2J5UA 4KT0J 1YTZT 2HPCA 3H1HD 1NU1E 1X79B 1IJDB 1IFMA 1FDMA 1SQPE 3A5TA 3H1KD 5BU8B 1PFIA
chains in the Genus database with same CATH topology
4RESB 2BASA 1T8ZA 1N86A 1L4AB 3LIDA 4WB4A 3NMDA 3U1AA 1RF0A 3M9HA 3H6PA 2WPQA 1GU5A 1S9KE 1M1JC 2A45G 1LTAC 5CCGC 3EFGA 5AVVB 1M1JA 2C0XA 2XDJA 1A02F 4GT1A 1E5WA 5CMZA 4IFFA 1S9KD 2GUSA 3LIEA 1CW5A 2OYHC 3A3YB 5APVA 2KSJA 1JNMA 5AW7B 2I1JA 2R5BA 1GZLA 3B5NB 2CPBA 1IFDA 3V2PA 4N3YB 1RE3A 1JY2O 3OAKA 2HLOA 1IK9A 1CI6A 4LLHA 4C7RA 3RK2C 3VMZA 2FKWB 2P2UA 1X9VA 2WWWA 1T3UA 3N7NA 1VDFA 1GTWA 2N9BA 2HPCB 1SVFA 5AVQB 1ZLLA 2HYNA 1JY3P 3VMXA 3RL0D 3O8ZA 5AW1B 5KLVK 4N6JA 1NKZB 2N1TC 1LTTC 1GW3A 1ZR2A 1FZCC 2E43A 4AYCA 3G3ZA 4C46A 4DOJA 1LGHB 3TK1A 3HD7A 3P8MC 3HD7B 3M9BA 1J1EB 1NWQA 1SQBK 3B5NA 2FXMA 1JY2N 5AVSB 3TYYA 3B5NC 2WITA 3PP5A 1FZGA 1GL2A 1GDTA 1GK4A 3B8EB 3A2AA 3CI9A 4GKGA 4XA4A 3EQ2A 1URQC 5AVXB 3HE4B 1LT9A 1LWUA 3GHGB 1LWUC 3BASA 3BRVB 1GL2D 4HYTB 1NHLA 2YKPA 5APUA 1J1EC 3M0DC 2GM4A 5AW3B 2WZ7A 2WPRA 3HTKB 4KHXA 1J1DC 1L4AC 2A45H 3HUSC 2QM7A 3V4QA 3WMM0 1L4AA 1W2EA 3MIWA 3M91A 3RK3B 2YKOA 5CCGA 3P7KA 2L5GB 1T2KC 2IFNA 5AW9B 2HODA 1FZEA 1RF1C 4I2LC 1H89A 3V2RA 1RF1A 1FOSF 4WY4B 2J58A 1SP4A 2OYHA 1IO4A 2PP6A 3H32B 2FFDA 3E1IA 2WSEH 4W7YA 2FFDC 4OH8B 2WTYA 2XZRA 2ZXEB 5AVUB 1JUNA 1H88A 4AUWA 1LT9B 5CCHD 1FU1A 1HJBA 2O01H 4LGDE 3L36A 5APWA 3H32A 1FBMA 2O1JA 4WY4A 1N73A 2C9NY 1G1IA 1GL2B 2NPSC 1KILB 3VYIA 2P1JA 2YMYA 1FAVA 5AW8B 3VOPA 1J1DB 1LTBC 1AFOA 3BVHA 2YNYA 3KDPB 2Q7CA 2OARA 2IX7C 4XE5B 3L4FA 3C9IA 2OYIA 1DH3A 2Z5HA 1L0NK 1GL2C 1Z56A 2NPSB 2KP8A 1LWUB 1KQLA 1LTJB 4JF7A 4Y99B 1RE4C 1LTIC 3BRTB 1J2JB 1MFZA 1NAFA 4Y99C 1N2DC 1URQD 1KILD 3IFMA 2C9LY 2KOGA 1QL2A 2JEEA 3SWYA 2H8PD 1WT6A 3R2PA 2CPSA 1CI6B 2W6AA 1FZFA 1AQ5A 3SWFA 1NH4A 2PAJA 3NTNA 1VPCA 1HUCA 3LW5H 5AW6B 4JYCA 3N4XA 5AVYB 2E42A 3P8CE 1RE3C 2W27A 3HE5A 1WRGA 5CHXA 2KB7P 1OWAA 3RK3D 5AW5B 2NPSD 1XTGB 1KFNA 4EIJA 1KILC 2N1TD 3BATA 1LTGC 3TSIA 1SQXK 4WBAA 1KILA 1M7LA 2XV5A 1JTHA 2FYZA 1LTSC 1GU4A 3T97A 1JOCA 1N7SD 3RK2B 5CCGD 5CCHA 5AVZB 3U1CA 5KJ7D 2N1TA 1FZCA 1HWTC 1G1JA 1CSBA 3TNUA 1IFIA 3CLQA 3MTUE 1FJKA 3M0AA 3VTPC 3CL3D 1IC2A 1CZQA 5APSA 3NXSA 1DX7A 1RF1B 2Q5UA 2WT7B 4WY4C 2R32A 2R3CA 3HRNA 1N7LA 3V2QA 1HGVA 1KZUB 2GUVA 1SQPK 2I1KA 2WSCH 4B86A 1JMMA 4W80A 3RL0B 1ZV8A 1FOSE 3HUSB 3OA7A 3I5CA 5AVRB 1IFNA 1RF0C 3KPEA 5KJ7A 4ZKPA 1HH0A 2XNXA 5KJ7C 2KLVA 3II6A 2OYIC 1N7SA 3MUDA 5CJ0A 3V5BA 3HUSA 2W6BA 3VN0A 1URQB 1JY3N 3M06A 2J59M 4IFDK 2OYHB 4N78D 2IFMA 1MZ9A 2MJZA 1NO4A 4IFMA 1L0LK 3B5ND 1JCDA 1XTCC 4DZOA 1FZAA 2HFED 3HD7D 2KYVA 5BU5A 2M8RA 3NFQA 1MUUA 1ZN5A 2A45I 4EOTA 3VP8A 2LKMA 5APYA 5KTBA 3GHGC 1GW4A 2YO2A 2N1TB 1FZCB 1GD2E 2P67A 3V2NA 3RL0C 1SLQA 1NKNA 3P8CD 5AVTB 3KQGA 1GK6A 5AW2B 1T3JA 3M9QA 3IR9A 2C0WA 1YTZI 2P7JA 3HE4A 1NTZK 1SFCD 1N73C 1SFCC 3RK2D 1N7SB 1HTLC 2NPSA 4C7NA 3KYQA 1YYCA 5CJ4A 2POHA 2H43A 1L4AD 2FYUK 3HD7C 5AW0B 1NU1K 3HE5B 1FZBA 2QM8A 1SQVK 1RY3A 3L37A 2XKMA 1NOHA 4N78E 4WY4D 3OJAB 1HBWA 4I6MC 4M3LA 3U59A 1KFMA 2WPSA 1RE4A 2JJLA 1SFCB 1JCCA 1NTMK 1G2CB 1JTHB 4JYBA 5APXA 2ZFCA 1IFJA 3RK3C 1M1JB 5APTA 2OYIB 4ZKUA 1LT9C 3V4WA 1OXZA 2IPPA 1H8AA 1SQQK 3L35A 1MV8A 2Z5IA 1FJPA 3M0DA 3MGNA 1NTKK 4LC1A 2YKQA 1N7SC 2VRSA 3P32A 2Q3IA 1DEBA 4C7NB 1N73B 1JY3O 1ZR4A 1G2CA 2XU6A 2M3BA 2WT7A 3VMYA 1JY2P 1EQ7A 1X8YA 2HODB 2O1KA 4HH2A 2Q9IA 1HVVA 5APQA 5CCHC 3HTKA 2Z4EA 2YO3A 1A02J 5AW4B 3TNUB 3A7OA 1JO5A 2FFDB 1QL1A 1HGZA 3GHGA 2WSFH 3VP9A 3MD0A 3UIAA 2HG5D 2R5DA 4O9BA 4I1LA 4AQRD 1LTJA 4GIFA 5BVZA 2H7HA 1LTJC 1URQA 1SFCA 5AVWB 1T2KD 4W7ZA 2HPCA 1YTZT 1X79B 1IJDB 1IFMA 1FDMA 3A5TA 5BU8B 1PFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4Q A;  4RES B;  2BAS A;  3LID A;  2XV5 A;  3M91 A;  4C7N A;  3NMD A;  3P7K A;  1YYC A;  1T2K C;  1GU4 A;  5AW9 B;  3M9H A;  3T97 A;  2WPQ A;  1GU5 A;  1S9K E;  4I2L C;  1H89 A;  5AVV B;  5AVZ B;  1FOS F;  5AW0 B;  1SP4 A;  1A02 F;  1IO4 A;  4GT1 A;  3HE5 B;  5CMZ A;  2QM8 A;  1HWT C;  1S9K D;  1CSB A;  3LIE A;  3TNU A;  3L37 A;  3A3Y B;  5APV A;  2WTY A;  1HBW A;  4I6M C;  1JNM A;  4M3L A;  5AW7 B;  2R5B A;  2XZR A;  1GZL A;  2ZXE B;  5AVU B;  3M0A A;  2WPS A;  3VTP C;  2JJL A;  1JUN A;  1H88 A;  1G2C B;  5APX A;  4JYB A;  1CZQ A;  4AUW A;  5APS A;  2ZFC A;  3NXS A;  1HJB A;  2Q5U A;  3OAK A;  5APT A;  2WT7 B;  3L36 A;  1OXZ A;  2IPP A;  3V4W A;  2R32 A;  1H8A A;  3L35 A;  2R3C A;  1CI6 A;  5APW A;  3VMZ A;  2P2U A;  1MV8 A;  4B86 A;  2WWW A;  2Z5I A;  2C9N Y;  3M0D A;  3MGN A;  3VYI A;  4LC1 A;  1FOS E;  1GTW A;  2N9B A;  3I5C A;  2VRS A;  5AVR B;  1FAV A;  5AVQ B;  3P32 A;  2Q3I A;  4C7N B;  5AW8 B;  3VMX A;  3O8Z A;  2YNY A;  3KDP B;  5AW1 B;  2Q7C A;  3V5B A;  2XU6 A;  4XE5 B;  2WT7 A;  3VMY A;  2E43 A;  4AYC A;  1DH3 A;  1X8Y A;  4C46 A;  3VN0 A;  2Z5H A;  3M06 A;  3TK1 A;  3P8M C;  3M9B A;  2KP8 A;  5APQ A;  1KQL A;  1NWQ A;  3HTK A;  2YO3 A;  5AVS B;  1A02 J;  3TYY A;  1J2J B;  1MFZ A;  1NAF A;  5AW4 B;  4DZO A;  3TNU B;  3A7O A;  2C9L Y;  1GK4 A;  3B8E B;  1MUU A;  3NFQ A;  3A2A A;  3MD0 A;  4EOT A;  1CI6 B;  2W6A A;  3UIA A;  4GKG A;  2R5D A;  3SWF A;  3NTN A;  5APY A;  1HUC A;  5AVX B;  3HE4 B;  5AW6 B;  2YO2 A;  4JYC A;  4AQR D;  5AVY B;  2E42 A;  2W27 A;  3HE5 A;  2P67 A;  1GD2 E;  2H7H A;  1SLQ A;  4HYT B;  5AVT B;  5AVW B;  3KQG A;  1GK6 A;  5AW2 B;  1T2K D;  1OWA A;  5AW5 B;  3IR9 A;  5APU A;  2P7J A;  3HE4 A;  5AW3 B;  2WPR A;  3A5T A;  4KHX A;  2QM7 A; 
#chains in the Genus database with same CATH topology
 1X22 A;  1Q2N A;  2BAS A;  3H1H J;  4RES B;  1T8Z A;  1N86 A;  1L4A B;  3LID A;  4WB4 A;  2A06 E;  3A0B H;  3NMD A;  3U1A A;  1RF0 A;  4DJG A;  1IK7 A;  5KLV D;  1EDI A;  2ZT9 B;  3R4Y A;  2IYO A;  1P84 E;  3M9H A;  4OVN F;  2IDB A;  3H6P A;  5KLI B;  2WSC J;  2QVA A;  2WPQ A;  2ZVO B;  2QA4 P;  2B9B A;  1M1J C;  4L75 A;  1S9K E;  2A45 G;  1LTA C;  5CCG C;  3EFG A;  5AVV B;  1FS0 E;  1M1J A;  2C0X A;  3AE8 C;  2XDJ A;  1A02 F;  1SQB J;  4GT1 A;  1E5W A;  5CMZ A;  4IFF A;  1SQQ D;  2OTJ P;  1S9K D;  2AXT H;  2GUS A;  4QMA A;  1VQ5 P;  3LIE A;  2KZJ A;  3PH0 A;  4H44 B;  4JPZ B;  2YXR B;  3H1J G;  1CW5 A;  1M8O B;  2OYH C;  3A3Y B;  5APV A;  5KLV E;  2YMK A;  2KSJ A;  1JNM A;  5AW7 B;  2I1J A;  2R5B A;  3BCC J;  2A06 G;  1GZL A;  2LXB A;  3B5N B;  2CPB A;  4HB1 A;  1IFD A;  2G8Y A;  5KAF H;  5B66 E;  3V2P A;  1PPJ D;  1N8R Q;  2WPV B;  3EFF K;  4NPF X;  4N3Y B;  1SQP G;  3PRJ A;  4H0L B;  4ZMD A;  4PD4 I;  3CMA P;  1VQ8 P;  1RE3 A;  3AE1 C;  1JY2 O;  1T6A A;  1TU3 F;  3A0H H;  3OAK A;  2HLO A;  1IK9 A;  3G71 P;  1CI6 A;  1PPJ E;  4LLH A;  1BCC E;  4C7R A;  1AVY A;  3FWN A;  3L75 D;  4UB8 H;  1NU1 D;  5M1B A;  3RK2 C;  1NTK D;  2OGU A;  4H0L D;  3VMZ A;  3E1R A;  3D71 A;  2FKW B;  2P2U A;  4A7P A;  1X9V A;  2WWW A;  1U7J A;  1ZRT E;  3D6Z A;  1SQQ J;  1T3U A;  4OGQ B;  3FGA D;  2WSE J;  3MHV A;  1VDF A;  3N7N A;  1GTW A;  2N9B A;  5KAI E;  3AE2 C;  3L73 E;  2NZ2 A;  3L72 G;  2HPC B;  1OMI A;  1SVF A;  1ZLL A;  1OX3 A;  3CWB E;  5AVQ B;  1YIT P;  1KD1 Q;  2HYN A;  1JY3 P;  3VMX A;  3CCL P;  3RL0 D;  3O8Z A;  5C39 A;  5AW1 B;  1JMB A;  1KMI Z;  3L70 G;  4L74 A;  3L72 J;  5KLV K;  4K35 A;  2IZ1 A;  1PGJ A;  2FY8 A;  4N6J A;  1NKZ B;  2N1T C;  1LTT C;  1GW3 A;  1ZR2 A;  1FZC C;  2E43 A;  4AYC A;  3G3Z A;  4C46 A;  3L73 D;  3MP7 B;  2BEZ F;  4DOJ A;  2O01 J;  2V7Q J;  5KKZ B;  2Y0E A;  1LGH B;  1KB9 E;  3TK1 A;  3HD7 A;  3P8M C;  1VQ6 P;  3HD7 B;  3M9B A;  2Y0C A;  1BE3 J;  1J1E B;  1NWQ A;  1SQB K;  3CCE P;  3B5N A;  2FXM A;  3RBZ A;  1JY2 N;  5AVS B;  4JQ0 D;  3TYY A;  3B5N C;  2WIT A;  3PP5 A;  1KC8 Q;  2WSS H;  1GL2 A;  1PPJ G;  4OGQ D;  3L74 D;  4DCK A;  1FZG A;  3H1J J;  3CWB J;  1ZME C;  1NAY A;  2JKV A;  5H2F E;  1GDT A;  1MFT A;  4GOE A;  1GK4 A;  1LT1 A;  3B8E B;  2P58 A;  1SQB G;  1HJ0 A;  1OZH A;  1QGK B;  1P84 H;  3A2A A;  3CI9 A;  4GKG A;  1YJ9 P;  1RQV A;  4XA4 A;  3EQ2 A;  1KYO E;  2KZI A;  1EZV E;  1L0N E;  3GLM A;  3USS A;  1URQ C;  5AVX B;  3HE4 B;  1LT9 A;  1LWU A;  3GHG B;  1LWU C;  3BAS A;  3H1J E;  4UB6 H;  1Q81 Q;  2W90 A;  2KK7 A;  3BRV B;  1GL2 D;  2L91 A;  3S1K A;  1PZQ A;  4HYT B;  1VQ7 P;  4U3F D;  1SQQ E;  2H88 C;  1NHL A;  4JBZ A;  3SWK A;  2YKP A;  4H13 C;  5APU A;  1J1E C;  3AEE C;  3M0D C;  2GM4 A;  5AW3 B;  2WZ7 A;  3V6I A;  1U7M A;  2WPR A;  3HTK B;  3MUD C;  4KHX A;  3CCJ P;  3Q5R A;  1J1D C;  4TLF A;  1L4A C;  1KIL E;  3BCC E;  3I56 P;  2A45 H;  2QM7 A;  3HUS C;  3V4Q A;  3WMM 0;  2JWD A;  1EDJ A;  1S5L H;  1L4A A;  3PLN A;  1W2E A;  3MIW A;  3M91 A;  2RKL A;  2YKO A;  3RK3 B;  3S9O A;  5CCG A;  3P7K A;  1YI2 P;  2L5G B;  1T2K C;  1BDD A;  3H1H G;  2IFN A;  2FBW C;  5AW9 B;  5GTH H;  2AEM A;  1S4X A;  2HOD A;  1FZE A;  2ITA A;  2AEF A;  1RF1 C;  5E79 H;  4I2L C;  1BCC D;  1P84 D;  1H89 A;  3V2R A;  1RF1 A;  1FOS F;  2JDI H;  1NVO A;  2J58 A;  1SP4 A;  4I7Z B;  4WY4 B;  2OYH A;  1IO4 A;  1E79 H;  4L76 A;  2PP6 A;  5K5G B;  3H25 A;  2IBZ E;  4H44 C;  2V4H A;  3L73 J;  1VQK P;  3H32 B;  1YBK A;  1VQN P;  2FXP A;  1BGY G;  2E76 D;  3K5B A;  2FFD A;  3E1I A;  2WSE H;  4GDO A;  4W7Y A;  2QG4 A;  4IOI H;  2FFD C;  4OH8 B;  2WTY A;  2KUB A;  2KSE A;  2XZR A;  2JR8 A;  1S3J A;  2GA1 A;  2ZXE B;  5AVU B;  1EZV G;  1L0N G;  2QJY B;  1ZOY C;  3L71 E;  4H0L C;  4K3A A;  3FXD A;  3S4R A;  3WUV A;  3L70 J;  1H88 A;  1VQL P;  1JUN A;  1SQX J;  4AUW A;  1LT9 B;  1L2P A;  5CCH D;  1FU1 A;  3B4S A;  2WT7 A;  1HJB A;  1VQ9 P;  1BE3 E;  2O01 H;  2KXP B;  2V7Q H;  3L36 A;  4LGD E;  1VQ4 P;  3IN6 A;  5APW A;  1KYO D;  1QVF O;  3H32 A;  1JEK A;  1FBM A;  1Q86 Q;  2KI7 B;  2O1J A;  2KLU A;  4EYY Q;  1NU1 J;  4WWI A;  4XFJ A;  4BRY B;  1BGY J;  4WY4 A;  1N73 A;  2C9N Y;  2KNC A;  1G1I A;  3L74 J;  2M3E A;  2D2C B;  1GL2 B;  2NPS C;  1KIL B;  4WVZ A;  2P1J A;  1R5S A;  3VYI A;  2YMY A;  4PD4 D;  3Q5P A;  1VQM P;  1K9M Q;  1KOR A;  1W5C E;  1GMJ A;  1FAV A;  3H1L G;  1ZRT D;  2B87 A;  2E74 B;  1FC2 C;  5AW8 B;  3VOP A;  2QJK B;  1J1D B;  1LTB C;  1AFO A;  4IL6 E;  3BVH A;  2FYU E;  2YNY A;  3KDP B;  1LP1 A;  2Q1K A;  3PJS K;  5KLI C;  2Q7C A;  2OAR A;  2IX7 C;  3CCS P;  3RK2 D;  4XE5 B;  3L4F A;  3C9I A;  2OYI A;  3L73 G;  5L8R J;  1DH3 A;  2ZJS E;  2FYU D;  2Z5H A;  1OW7 A;  2JO1 A;  2FYN C;  2M0B A;  4UB8 E;  1L0N K;  1GL2 C;  1Z56 A;  2NPS B;  3AED C;  4L73 A;  1H0T B;  2KP8 A;  1LWU B;  1KQL A;  1LTJ B;  3A0B E;  4JF7 A;  1VQO P;  3AEC C;  4D6T J;  4Y99 B;  1RE4 C;  2K9Y A;  2B87 B;  2M5A A;  3RBX A;  1DIP A;  1LTI C;  1NTM E;  3BRT B;  3ITK A;  3Q1M A;  1J2J B;  1FDI A;  1MFZ A;  1NAF A;  3CX5 E;  1URQ D;  1N2D C;  1KIL D;  3BCC D;  4Y99 C;  1SS1 A;  3IAO A;  4KJM A;  3IFM A;  2C9L Y;  2KOG A;  1QL2 A;  2JEE A;  3SWY A;  2H8P D;  1WT6 A;  2KNC B;  3R2P A;  3CC7 P;  2CPS A;  1YIJ P;  2P10 A;  3H1K J;  4MN4 C;  2QSI A;  1CI6 B;  2W6A A;  1FZF A;  2JP3 A;  1AQ5 A;  3SWF A;  1NH4 A;  2PAJ A;  3NTN A;  4YTP C;  4D6T G;  1VPC A;  2NRG A;  1HUC A;  1NTZ J;  1U57 A;  3L75 G;  3LW5 H;  4JYC A;  5AW6 B;  3N4X A;  4ZNC A;  5AVY B;  2E42 A;  3P8C E;  1RE3 C;  2W27 A;  3HE5 A;  1WRG A;  3PTZ A;  1L0L D;  1PP9 D;  1S5L E;  3CXH E;  5CHX A;  4D6T D;  2ZYD A;  1MKM A;  2KB7 P;  2N9Y B;  1OWA A;  3RK3 D;  1JB0 J;  1QEX A;  5AW5 B;  2NPS D;  1XTG B;  1KFN A;  4YXD C;  1OVU A;  2QE7 H;  1W2B O;  2MKV A;  2E75 B;  4EIJ A;  1BDC A;  2IBZ I;  1KIL C;  2N1T D;  3BAT A;  4BWN A;  1LTG C;  3TSI A;  1SQX K;  3D70 A;  4PD4 E;  2Q3E A;  4WBA A;  1KIL A;  1M7L A;  4PD4 H;  3GG2 A;  3QWO C;  1Q90 D;  2K9J B;  1JTH A;  2XV5 A;  2FYZ A;  1LTS C;  2R3S A;  1OW8 A;  1OIP A;  3ABV C;  1GU4 A;  4PV1 D;  3WU2 H;  1KQG B;  1SQB D;  4PV1 C;  4DT0 A;  5GTI E;  3JCU H;  3T97 A;  3CC4 P;  1EDL A;  1KQS O;  1JOC A;  1KYO H;  1N7S D;  3JCU E;  1AQT A;  2ZVN B;  3RK2 B;  5CCG D;  2PFX A;  5CCH A;  3RL0 g;  1EDK A;  2K1A A;  5AVZ B;  1NU1 G;  3U1C A;  1NGM B;  2BCC D;  1X0T A;  5KJ7 D;  2OTK E;  3H1I J;  4UB6 E;  2N1T A;  4PJ0 H;  4Z1M H;  1FZC A;  1G1J A;  1HWT C;  3CME P;  1CSB A;  1USD A;  4CPG A;  2Y9Z A;  3TNU A;  1OFC X;  4U3F G;  1KN7 A;  3TGU J;  3G9R A;  2BCC G;  1SQP D;  4OWF A;  1IFI A;  3CLQ A;  3MTU E;  3CWB D;  1HF9 A;  1FJK A;  3H1L D;  2E75 D;  3M0A A;  1PIX A;  1YJW P;  3CXH H;  3VTP C;  1DD3 A;  1M56 D;  4NPD A;  3CL3 D;  2E74 C;  2PGD A;  1IC2 A;  1CZQ A;  2RMZ A;  3L70 D;  1NTM J;  5APS A;  2I8D A;  1RH5 B;  1H8A A;  3NXS A;  3CD6 P;  1DX7 A;  1Q7Y Q;  3AE9 C;  3O6Q A;  1GU5 A;  2Q5U A;  1RF1 B;  1VF5 D;  1DD4 A;  1VF5 C;  2WT7 B;  4PV1 B;  3A0H E;  1SQQ G;  2R32 A;  4WY4 C;  3ZDM A;  3CCU P;  1SQV D;  2R3C A;  5B5E E;  1L0L E;  1PP9 E;  1N7L A;  1QX8 A;  3AE5 C;  3HRN A;  3EWK A;  3V2Q A;  1HGV A;  1SQX G;  1KZU B;  1QVG O;  2GUV A;  1SQP K;  2I1K A;  3JC2 2;  2WSC H;  5EFW B;  4B86 A;  1JMM A;  1SQV J;  2E74 D;  3L75 E;  4W80 A;  4BRY A;  3G4S P;  4ASW A;  4HKZ H;  3RL0 B;  1ZV8 A;  4D6T E;  1IZN B;  5KAI H;  3CX5 H;  1K04 A;  1VL2 A;  2Y9Y A;  1NTK G;  1FOS E;  1KTM A;  2BEQ D;  3HUS B;  3I5C A;  3IF4 A;  3OA7 A;  2QJY C;  1IFN A;  1RF0 C;  1BE3 D;  3KPE A;  5AVR B;  5CBO A;  1KV4 A;  1AVO A;  4ZKP A;  1HH0 A;  5KJ7 A;  1K73 Q;  1KYO I;  2XNX A;  5KJ7 C;  3H1K G;  5TJH A;  1ZW0 A;  2KLV A;  3II6 A;  4GOD A;  1NTZ D;  1N7S A;  2O3J A;  1PGP A;  3MUD A;  2OYI C;  5CJ0 A;  3V5B A;  3HUS A;  2WQY C;  2FXO A;  2YIU C;  4U7J A;  3CC2 P;  2W6B A;  1Y47 A;  2A06 D;  3F5H A;  1QLE D;  3L71 D;  3T97 B;  1URQ B;  1JY3 N;  1NTK E;  1PL5 A;  3VN0 A;  3W68 A;  2QJP B;  3M06 A;  3L72 D;  3H1J D;  1AV1 A;  2J59 M;  2JWA A;  2K9J A;  2OYH B;  4N78 D;  4IFD K;  2IFM A;  1MZ9 A;  2MJZ A;  2LXC B;  1NO4 A;  1SQX E;  2W6J H;  1OVR A;  1L0L K;  4IFM A;  1USE A;  4R4M A;  1S2E A;  3B5N D;  3L70 E;  1JCD A;  1XTC C;  2FYU G;  2RN0 A;  4DZO A;  1M57 D;  3VMA A;  1FZA A;  4EDF A;  2CK3 H;  2HFE D;  3HD7 D;  2KYV A;  3PHL A;  5BU5 A;  2B89 A;  2M8R A;  3H1L E;  3NFQ A;  1MUU A;  3CWB G;  3L72 E;  1RQU A;  1ZN5 A;  2A45 I;  1K05 A;  4EOT A;  2R44 A;  2HR3 A;  1SQV E;  1KB9 I;  1OVV A;  3B71 A;  3VP8 A;  1NJI Q;  2LKM A;  5APY A;  4U3F J;  3W67 A;  5KTB A;  2KS1 B;  3GHG C;  1YJN P;  1GW4 A;  2XND H;  2YO2 A;  3GF7 A;  1BCC J;  1L0L J;  1PP9 J;  2N1T B;  2BCC E;  1FZC B;  2UWJ E;  4U3F E;  1GD2 E;  2P67 A;  3V2N A;  1M1K Q;  3RL0 C;  1SLQ A;  1KB9 D;  1NKN A;  1Y9B A;  2B88 A;  1JM0 A;  2YXQ B;  2ZYG A;  3P8C D;  5AVT B;  3KQG A;  1GK6 A;  2AXC A;  2H89 C;  3GMA A;  1T3J A;  3M9Q A;  5AW2 B;  3IR9 A;  2C0W A;  1YTZ I;  3AE3 C;  2FYU J;  2P7J A;  3HE4 A;  4OGQ C;  3CXH I;  4EI2 A;  1NTZ K;  3CPW O;  2Q6Q A;  1YHQ P;  1LJ2 A;  1SFC D;  1N73 C;  1SFC C;  2E75 C;  2PRR A;  1P84 I;  1KB9 H;  3L71 G;  1N7S B;  1HTL C;  1NTZ E;  1EZV I;  2NPS A;  2RH0 A;  3L74 G;  5DJU B;  2E5T A;  5TIS E;  2ZT9 C;  2KIK A;  3SSU A;  2WMM A;  3KYQ A;  1YYC A;  4C7N A;  5CJ4 A;  4ASV A;  4PJ0 E;  1PV3 A;  3AEG C;  3E7K A;  2POH A;  2W83 C;  5KAF E;  5KLV G;  4YPC A;  4H13 D;  1NTZ G;  2E76 B;  3L74 E;  3RK3 E;  3SFD C;  2H43 A;  1EZV D;  1BGY E;  1L0N D;  5KKZ C;  3I55 P;  3CCV P;  1LP1 B;  2IBZ D;  4RKU J;  2G3A A;  5H2F H;  1L4A D;  2FYU K;  2IBZ G;  2QIW A;  3HD7 C;  5AW0 B;  1M90 Q;  1NU1 K;  3KXD A;  3HE5 B;  2OTL P;  1FZB A;  2QM8 A;  1PGQ A;  1SQV K;  1RY3 A;  1BGY D;  2DW3 A;  4H13 B;  1EXJ A;  3WUU A;  3GW6 A;  3L37 A;  1OW6 A;  2XKM A;  1NOH A;  3L75 J;  4N78 E;  3H1H E;  3CCM P;  1BSH A;  4WY4 D;  3OJA B;  3WUT A;  4I6M C;  4IL6 X;  4M3L A;  1HBW A;  2K3R A;  2IYP A;  3U59 A;  3Q2Y A;  3C8V A;  1DEE G;  1FDO A;  3SFE C;  1KFM A;  2OYO A;  1RE4 A;  2WPS A;  2JJL A;  1SQV G;  1SFC B;  1JCC A;  1NTM K;  3KHU A;  1G2C B;  1JTH B;  3BCC G;  3C1L A;  3MZW B;  4H44 D;  4JYB A;  5APX A;  2ZFC A;  1IFJ A;  2KS1 A;  1M1J B;  2K37 A;  3RK3 C;  5APT A;  3TF5 A;  3KZI E;  2E5Y A;  4ZKU A;  2OYI B;  1LT9 C;  3V4W A;  1OXZ A;  2IPP A;  2M5A B;  2W8Z A;  3KZI H;  4R4L A;  2ZAE B;  1SQQ K;  3L35 A;  5GTI H;  2QEX P;  2YIU B;  2FYN B;  3CCQ P;  1S72 P;  3TGU D;  1NTK J;  1SQP J;  1NTM G;  2QRX A;  1WMK A;  5TIS H;  3AEF C;  1R5L A;  1Q82 Q;  1H0T A;  2AEJ A;  1MV8 A;  2Z5I A;  1PGO A;  5GTH E;  3D6Y A;  1FJP A;  3H1I D;  3M0D A;  3MGN A;  2OQQ A;  1IFP A;  1LNQ A;  1NTK K;  4LC1 A;  3CX5 D;  5E79 E;  1NTM D;  2YKQ A;  5B5E H;  1N7S C;  2VRS A;  3AEB C;  3TGU G;  1SQB E;  3P32 A;  2Q3I A;  3AE6 C;  1DEB A;  4RO0 A;  3RGU A;  4C7N B;  3OW2 O;  1YQ3 C;  1N73 B;  1VQP P;  1JY3 O;  2SPZ A;  3QH9 A;  5KLV J;  2D2C D;  1ZR4 A;  2ZT9 D;  3AEA C;  1G2C A;  3CX5 I;  2LR2 A;  1UII A;  4HJG H;  3H1K E;  2XU6 A;  1EC5 A;  1S1C X;  1ZP0 C;  3H1I E;  3L71 J;  1S5L X;  1D7M A;  2M3B A;  3FXE A;  4I7Z C;  3VMY A;  5CBN A;  2QJP C;  1ZXG A;  3O6Q B;  1JY2 P;  1EQ7 A;  1VF5 B;  1X8Y A;  2HOD B;  2WVR A;  3Q3D A;  2BCC J;  1Y8A A;  2O1K A;  4HH2 A;  3AE4 C;  3CXH D;  1K8A Q;  1FE6 A;  2Q9I A;  1HVV A;  2O01 N;  1L0N J;  5APQ A;  5CCH C;  3HTK A;  3TDK A;  3H1I G;  2Z4E A;  3FX0 A;  2YO3 A;  3WU2 E;  1EXI A;  3G6E P;  2ZXX A;  1A02 J;  5AW4 B;  1AJY A;  3GF3 A;  1L0L G;  1NYH A;  1PP9 G;  3H1L J;  3TNU B;  2QJK C;  3A7O A;  5DJT B;  1R8E A;  1JO5 A;  2FFD B;  1AA0 A;  1BE3 G;  1QL1 A;  3FWL A;  3AE7 C;  1HGZ A;  3F89 A;  4NPE A;  3GHG A;  2WSF H;  2ZYA A;  3JSV C;  3LW5 J;  3VP9 A;  3TGU E;  2E76 C;  3MD0 A;  3UIA A;  2AXT E;  3CCR P;  2HG5 D;  2R5D A;  4Y28 J;  4O9B A;  1UIX A;  4I1L A;  4BXL A;  2Y0D A;  4AQR D;  1SQX D;  1YQ4 C;  4YXW H;  1LTJ A;  1RHZ B;  4GIF A;  4TT3 H;  5BVZ A;  2H7H A;  1LTJ C;  3Q5S A;  2D2C C;  4IL6 H;  4GOF A;  1BCC G;  5B66 H;  1URQ A;  2IZ0 A;  1KQF B;  1SFC A;  5AVW B;  2K88 A;  2WSF J;  4RJT A;  1T2K D;  4W7Z A;  1BSN A;  2J5U A;  4KT0 J;  1YTZ T;  2HPC A;  3H1H D;  1NU1 E;  1X79 B;  1IJD B;  1IFM A;  1FDM A;  1SQP E;  3A5T A;  3H1K D;  5BU8 B;  1PFI A; 
#chains in the Genus database with same CATH homology
 4RES B;  2BAS A;  1T8Z A;  1N86 A;  1L4A B;  3LID A;  4WB4 A;  3NMD A;  3U1A A;  1RF0 A;  3M9H A;  3H6P A;  2WPQ A;  1GU5 A;  1S9K E;  1M1J C;  2A45 G;  1LTA C;  5CCG C;  3EFG A;  5AVV B;  1M1J A;  2C0X A;  2XDJ A;  1A02 F;  4GT1 A;  1E5W A;  5CMZ A;  4IFF A;  1S9K D;  2GUS A;  3LIE A;  1CW5 A;  2OYH C;  3A3Y B;  5APV A;  2KSJ A;  1JNM A;  5AW7 B;  2I1J A;  2R5B A;  1GZL A;  3B5N B;  2CPB A;  1IFD A;  3V2P A;  4N3Y B;  1RE3 A;  1JY2 O;  3OAK A;  2HLO A;  1IK9 A;  1CI6 A;  4LLH A;  4C7R A;  3RK2 C;  3VMZ A;  2FKW B;  2P2U A;  1X9V A;  2WWW A;  1T3U A;  3N7N A;  1VDF A;  1GTW A;  2N9B A;  2HPC B;  1SVF A;  5AVQ B;  1ZLL A;  2HYN A;  1JY3 P;  3VMX A;  3RL0 D;  3O8Z A;  5AW1 B;  5KLV K;  4N6J A;  1NKZ B;  2N1T C;  1LTT C;  1GW3 A;  1ZR2 A;  1FZC C;  2E43 A;  4AYC A;  3G3Z A;  4C46 A;  4DOJ A;  1LGH B;  3TK1 A;  3HD7 A;  3P8M C;  3HD7 B;  3M9B A;  1J1E B;  1NWQ A;  1SQB K;  3B5N A;  2FXM A;  1JY2 N;  5AVS B;  3TYY A;  3B5N C;  2WIT A;  3PP5 A;  1FZG A;  1GL2 A;  1GDT A;  1GK4 A;  3B8E B;  3A2A A;  3CI9 A;  4GKG A;  4XA4 A;  3EQ2 A;  1URQ C;  5AVX B;  3HE4 B;  1LT9 A;  1LWU A;  3GHG B;  1LWU C;  3BAS A;  3BRV B;  1GL2 D;  4HYT B;  1NHL A;  2YKP A;  5APU A;  1J1E C;  3M0D C;  2GM4 A;  5AW3 B;  2WZ7 A;  2WPR A;  3HTK B;  4KHX A;  1J1D C;  1L4A C;  2A45 H;  3HUS C;  2QM7 A;  3V4Q A;  3WMM 0;  1L4A A;  1W2E A;  3MIW A;  3M91 A;  3RK3 B;  2YKO A;  5CCG A;  3P7K A;  2L5G B;  1T2K C;  2IFN A;  5AW9 B;  2HOD A;  1FZE A;  1RF1 C;  4I2L C;  1H89 A;  3V2R A;  1RF1 A;  1FOS F;  4WY4 B;  2J58 A;  1SP4 A;  2OYH A;  1IO4 A;  2PP6 A;  3H32 B;  2FFD A;  3E1I A;  2WSE H;  4W7Y A;  2FFD C;  4OH8 B;  2WTY A;  2XZR A;  2ZXE B;  5AVU B;  1JUN A;  1H88 A;  4AUW A;  1LT9 B;  5CCH D;  1FU1 A;  1HJB A;  2O01 H;  4LGD E;  3L36 A;  5APW A;  3H32 A;  1FBM A;  2O1J A;  4WY4 A;  1N73 A;  2C9N Y;  1G1I A;  1GL2 B;  2NPS C;  1KIL B;  3VYI A;  2P1J A;  2YMY A;  1FAV A;  5AW8 B;  3VOP A;  1J1D B;  1LTB C;  1AFO A;  3BVH A;  2YNY A;  3KDP B;  2Q7C A;  2OAR A;  2IX7 C;  4XE5 B;  3L4F A;  3C9I A;  2OYI A;  1DH3 A;  2Z5H A;  1L0N K;  1GL2 C;  1Z56 A;  2NPS B;  2KP8 A;  1LWU B;  1KQL A;  1LTJ B;  4JF7 A;  4Y99 B;  1RE4 C;  1LTI C;  3BRT B;  1J2J B;  1MFZ A;  1NAF A;  4Y99 C;  1N2D C;  1URQ D;  1KIL D;  3IFM A;  2C9L Y;  2KOG A;  1QL2 A;  2JEE A;  3SWY A;  2H8P D;  1WT6 A;  3R2P A;  2CPS A;  1CI6 B;  2W6A A;  1FZF A;  1AQ5 A;  3SWF A;  1NH4 A;  2PAJ A;  3NTN A;  1VPC A;  1HUC A;  3LW5 H;  5AW6 B;  4JYC A;  3N4X A;  5AVY B;  2E42 A;  3P8C E;  1RE3 C;  2W27 A;  3HE5 A;  1WRG A;  5CHX A;  2KB7 P;  1OWA A;  3RK3 D;  5AW5 B;  2NPS D;  1XTG B;  1KFN A;  4EIJ A;  1KIL C;  2N1T D;  3BAT A;  1LTG C;  3TSI A;  1SQX K;  4WBA A;  1KIL A;  1M7L A;  2XV5 A;  1JTH A;  2FYZ A;  1LTS C;  1GU4 A;  3T97 A;  1JOC A;  1N7S D;  3RK2 B;  5CCG D;  5CCH A;  5AVZ B;  3U1C A;  5KJ7 D;  2N1T A;  1FZC A;  1HWT C;  1G1J A;  1CSB A;  3TNU A;  1IFI A;  3CLQ A;  3MTU E;  1FJK A;  3M0A A;  3VTP C;  3CL3 D;  1IC2 A;  1CZQ A;  5APS A;  3NXS A;  1DX7 A;  1RF1 B;  2Q5U A;  2WT7 B;  4WY4 C;  2R32 A;  2R3C A;  3HRN A;  1N7L A;  3V2Q A;  1HGV A;  1KZU B;  2GUV A;  1SQP K;  2I1K A;  2WSC H;  4B86 A;  1JMM A;  4W80 A;  3RL0 B;  1ZV8 A;  1FOS E;  3HUS B;  3OA7 A;  3I5C A;  5AVR B;  1IFN A;  1RF0 C;  3KPE A;  5KJ7 A;  4ZKP A;  1HH0 A;  2XNX A;  5KJ7 C;  2KLV A;  3II6 A;  2OYI C;  1N7S A;  3MUD A;  5CJ0 A;  3V5B A;  3HUS A;  2W6B A;  3VN0 A;  1URQ B;  1JY3 N;  3M06 A;  2J59 M;  4IFD K;  2OYH B;  4N78 D;  2IFM A;  1MZ9 A;  2MJZ A;  1NO4 A;  4IFM A;  1L0L K;  3B5N D;  1JCD A;  1XTC C;  4DZO A;  1FZA A;  2HFE D;  3HD7 D;  2KYV A;  5BU5 A;  2M8R A;  3NFQ A;  1MUU A;  1ZN5 A;  2A45 I;  4EOT A;  3VP8 A;  2LKM A;  5APY A;  5KTB A;  3GHG C;  1GW4 A;  2YO2 A;  2N1T B;  1FZC B;  1GD2 E;  2P67 A;  3V2N A;  3RL0 C;  1SLQ A;  1NKN A;  3P8C D;  5AVT B;  3KQG A;  1GK6 A;  5AW2 B;  1T3J A;  3M9Q A;  3IR9 A;  2C0W A;  1YTZ I;  2P7J A;  3HE4 A;  1NTZ K;  1SFC D;  1N73 C;  1SFC C;  3RK2 D;  1N7S B;  1HTL C;  2NPS A;  4C7N A;  3KYQ A;  1YYC A;  5CJ4 A;  2POH A;  2H43 A;  1L4A D;  2FYU K;  3HD7 C;  5AW0 B;  1NU1 K;  3HE5 B;  1FZB A;  2QM8 A;  1SQV K;  1RY3 A;  3L37 A;  2XKM A;  1NOH A;  4N78 E;  4WY4 D;  3OJA B;  1HBW A;  4I6M C;  4M3L A;  3U59 A;  1KFM A;  2WPS A;  1RE4 A;  2JJL A;  1SFC B;  1JCC A;  1NTM K;  1G2C B;  1JTH B;  4JYB A;  5APX A;  2ZFC A;  1IFJ A;  3RK3 C;  1M1J B;  5APT A;  2OYI B;  4ZKU A;  1LT9 C;  3V4W A;  1OXZ A;  2IPP A;  1H8A A;  1SQQ K;  3L35 A;  1MV8 A;  2Z5I A;  1FJP A;  3M0D A;  3MGN A;  1NTK K;  4LC1 A;  2YKQ A;  1N7S C;  2VRS A;  3P32 A;  2Q3I A;  1DEB A;  4C7N B;  1N73 B;  1JY3 O;  1ZR4 A;  1G2C A;  2XU6 A;  2M3B A;  2WT7 A;  3VMY A;  1JY2 P;  1EQ7 A;  1X8Y A;  2HOD B;  2O1K A;  4HH2 A;  2Q9I A;  1HVV A;  5APQ A;  5CCH C;  3HTK A;  2Z4E A;  2YO3 A;  1A02 J;  5AW4 B;  3TNU B;  3A7O A;  1JO5 A;  2FFD B;  1QL1 A;  1HGZ A;  3GHG A;  2WSF H;  3VP9 A;  3MD0 A;  3UIA A;  2HG5 D;  2R5D A;  4O9B A;  4I1L A;  4AQR D;  1LTJ A;  4GIF A;  5BVZ A;  2H7H A;  1LTJ C;  1URQ A;  1SFC A;  5AVW B;  1T2K D;  4W7Z A;  2HPC A;  1YTZ T;  1X79 B;  1IJD B;  1IFM A;  1FDM A;  3A5T A;  5BU8 B;  1PFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...