3MGNA

D-peptide inhibitor pie71 in complex with iqn17
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IQN17
publication title Design of a potent D-peptide HIV-1 entry inhibitor with a strong barrier to resistance.
pubmed doi rcsb
molecule tags Viral protein/viral protein inhibitor
total genus 20
structure length 45
sequence length 45
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3mgnA00
3L36A 1T2KD 1MV8A 3HE4A 1S9KE 5AVYB 3MGNA 2R3CA 3P32A 1OWAA 5AVTB 4M3LA 2JJLA 4C46A 2Z5IA 4DZOA 3I5CA 2R5DA 1GD2E 4AUWA 2Q5UA 2W27A 1GZLA 4B86A 5AW1B 3TNUB 2QM8A 3A2AA 5APVA 1GTWA 2XV5A 5APXA 1GU4A 2P2UA 3UIAA 2WT7A 3M06A 3M0DA 2N9BA 2W6AA 4C7NB 2Z5HA 2QM7A 2E43A 3B8EB 3HTKA 5APSA 2R5BA 2P7JA 3M9BA 3KQGA 5AVRB 2Q3IA 3IR9A 3P8MC 2WWWA 3LIEA 3HE5B 1CI6B 5CMZA 4JYCA 3VN0A 1GK4A 1FOSF 5APYA 3L37A 1J2JB 5AVUB 2KP8A 3NXSA 1CSBA 4GT1A 5AW8B 2H7HA 1T2KC 3TYYA 2WPSA 3V4QA 1SP4A 3P7KA 1HBWA 3HE4B 1OXZA 1H8AA 3NFQA 2YO2A 1IO4A 4EOTA 3NMDA 2BASA 5AW7B 5AVVB 4KHXA 5AW0B 3OAKA 4AYCA 2WTYA 3NTNA 1JNMA 1NAFA 1X8YA 1MFZA 3LIDA 4AQRD 1S9KD 2Q7CA 2XU6A 4HYTB 4I6MC 3MD0A 3V4WA 2R32A 1GK6A 5AVQB 2WT7B 3VTPC 1HWTC 5APUA 1SLQA 3T97A 5AW5B 3V5BA 1G2CB 1KQLA 3M91A 5AVWB 2ZXEB 1A02J 5AW2B 1H88A 3VYIA 4GKGA 3M0AA 3VMXA 4I2LC 3A5TA 2E42A 1YYCA 3VMYA 1H89A 2VRSA 5APWA 2IPPA 1DH3A 2C9NY 2XZRA 2ZFCA 1FAVA 4C7NA 2WPRA 3VMZA 1FOSE 3M9HA 5AW6B 1JUNA 1CZQA 5APTA 5AW4B 3A3YB 3SWFA 2P67A 4RESB 5AW9B 3A7OA 4LC1A 4XE5B 1GU5A 1NWQA 3TK1A 5AVSB 3HE5A 5AVZB 3L35A 3KDPB 1CI6A 5AVXB 5APQA 1MUUA 5AW3B 1HUCA 2WPQA 1HJBA 2YO3A 3O8ZA 2YNYA 1A02F 2C9LY 3TNUA 4JYBA
chains in the Genus database with same CATH superfamily
4IL6H 2KIKA 5CBNA 3E7KA 3CXHH 1NTZE 1RF1B 1KILA 3CCQP 1UIIA 3A2AA 2GA1A 3HUSA 1VQKP 3D6ZA 3GLMA 3CWBE 1JY3P 5CBOA 2O01H 1U7JA 1ZV8A 1IC2A 1URQD 2KZJA 5AVUB 1SFCC 1HTLC 1EZVD 4GIFA 1IFPA 1URQB 5KAFH 3AEAC 1S9KD 1PPJE 3MD0A 5M1BA 1M56D 4EIJA 3HD7C 3VOPA 2Q9IA 1USDA 1LT9A 1EC5A 2O01J 4D6TJ 2IPPA 1XTGB 1SQXK 1WRGA 2K9YA 1HH0A 1SQBD 1LTSC 1L4AA 2FXOA 3C1LA 1IFDA 2N1TD 1KFMA 3L71G 3O6QA 4XFJA 2Z5IA 2J58A 1ZR4A 1JMMA 2N1TB 3W68A 3FXDA 4I7ZB 1P84E 1N7SC 1KV4A 4WY4D 1EDLA 3MIWA 1IFMA 2Z4EA 2AEJA 2Q3EA 3IR9A 1GL2D 2FYNB 2YIUB 1VL2A 1JY2O 1OW8A 2KSJA 4BXLA 2A45G 1J2JB 1T8ZA 3HE4B 2ZYDA 5B5EH 1GL2B 2WZ7A 4IL6X 5AVVB 3L71D 3A0BH 3B5ND 3CCUP 1HWTC 1VQLP 1JCDA 1VDFA 2ZXEB 3GHGC 3AEBC 3VYIA 2O1JA 1KYOE 3A5TA 2KSEA 4N78D 1QX8A 3B5NB 1R8EA 2L91A 2JEEA 1NTME 2PFXA 3VMZA 1QL1A 4W7YA 3CL3D 1NWQA 5AVSB 2LXCB 3H6PA 3GW6A 5CCGC 4JYBA 2Y0DA 1FDOA 1QEXA 5EFWB 1T2KD 2FY8A 3OA7A 2OARA 3L75G 1SQPG 3V2NA 1SQVK 2RMZA 4YTPC 2FYUJ 3CD6P 2MKVA 1RHZB 2FBWC 3B8EB 1Q90D 1X0TA 1WT6A 4DT0A 3Q1MA 2IBZI 1PPJG 2B9BA 3V2PA 3L72G 1S5LH 1KQGB 5B66E 3U59A 1M1JC 5AW8B 3HTKB 4IL6E 3PHLA 4BRYB 3V4QA 3AE2C 1SFCB 2YO2A 1IO4A 1SQQJ 3CX5I 2XNXA 1IZNB 3MZWB 1YJNP 1LTJC 2R44A 3L70E 4GDOA 4DCKA 1JY3O 1K9MQ 2G8YA 3L75D 1SQPD 1NGMB 1OW6A 3HD7B 4YXDC 2IX7C 4L73A 3L73J 3H1KG 3MUDA 2KNCA 2DW3A 3VP8A 3VMYA 1NU1K 4D6TE 2YMYA 1VQ8P 4PD4I 1BSHA 1PGJA 2WPRA 4LLHA 1FZAA 1PPJD 3L72D 1PGOA 1IFJA 4XE5B 1YI2P 2OTJP 3L35A 1N73C 5KAFE 1L0LK 5CJ0A 1FDIA 4DJGA 1PP9J 3ZDMA 2K37A 2HPCA 4L76A 2HR3A 4ASVA 1H0TB 2E76D 3P8CE 2C0WA 1OIPA 2QJYB 1DX7A 1N7SB 3H1KD 4C7NB 1KQFB 1N2DC 3GF3A 2WPVB 2M5AB 2E76B 1DD3A 2WWWA 1JTHB 3PLNA 3FXEA 1NTZJ 1GK4A 2B89A 1RF1C 5KAIH 4GT1A 1KQSO 4Y99B 4KHXA 2HFED 2K88A 1MFZA 4GODA 2KZIA 4ZNCA 4H44D 1LTIC 2P10A 4K35A 2WITA 4IOIH 4K3AA 2WT7B 3OW2O 3T97A 4ZKPA 3BATA 3BCCJ 3GHGB 3M91A 4W80A 2E42A 2HLOA 1BDCA 1NTKG 2VRSA 3H1HG 1URQC 1S5LX 3FX0A 3U1CA 2OYIC 1FU1A 5B5EE 3V2QA 1ZRTE 4LC1A 3TK1A 3AEGC 5AVZB 1MUUA 1WMKA 2OYHA 4TT3H 1M1KQ 2AXCA 1GDTA 2RH0A 5KLVJ 3SWKA 3TF5A 3CX5H 1S3JA 4ZKUA 3PTZA 3H1JG 1VQ4P 2B87A 1KILD 1PGPA 1KB9I 3H32B 2FYUE 2QM8A 2H43A 2P2UA 2E43A 1DEBA 3CC7P 2R5BA 1NTKD 1KILB 2Q3IA 5BU5A 3H1HD 3HE5B 3USSA 3CCLP 4PD4H 3L37A 1M1JB 2YKOA 2XNDH 2N1TC 1PIXA 2IZ0A 1OXZA 2J59M 4EOTA 4JQ0D 1ZMEC 3RBXA 1MZ9A 1LTJB 3CI9A 5AVQB 3IF4A 3H1JD 2FYNC 2YIUC 2K9JA 1CW5A 4WY4C 1G2CB 2FKWB 3L73E 3M0AA 2AEMA 1S5LE 3CXHD 1GL2C 3L74J 1EXIA 2XZRA 1QVGO 3RL0D 5KJ7C 2AEFA 2I1KA 2P67A 1OVUA 4BWNA 3RL0B 5AW3B 1EZVI 1HJBA 3RGUA 5KLIC 1OZHA 3B5NC 2NPSA 3ABVC 3P32A 3TGUJ 1IK9A 2ZXXA 3I5CA 2W27A 1L0NE 5K5GB 1FJKA 3VMAA 2Q1KA 2OGUA 1JO5A 2XV5A 3UIAA 1FS0E 2N9BA 1JM0A 2Z5HA 4EDFA 3I55P 2P7JA 5AVRB 5CCGA 5CMZA 1ZOYC 1AQTA 1DD4A 4OGQD 1NO4A 5APYA 2O3JA 1FZCC 3NXSA 1T2KC 1BE3G 1FE6A 4DOJA 1KORA 4OGQB 3R2PA 1NAFA 1M57D 1KTMA 3MTUE 1GK6A 1MKMA 1DEEG 2YKQA 3N7NA 3BCCE 3EFGA 5AW2B 3RK3E 4EYYQ 4WWIA 1KB9H 2BCCD 3WUUA 2ZT9C 3AE4C 3AEDC 3II6A 5KAIE 1FOSE 5AW6B 3H1IG 2OYIB 3AE5C 3L70J 1SS1A 3SWFA 3EQ2A 1SQPK 5E79H 4PJ0E 3SWYA 5APQA 2PAJA 3FWLA 1YBKA 1K8AQ 2ZYGA 5GTIH 1BE3D 4R4LA 5KLVE 1SQXE 2FXPA 1BGYG 4JPZB 4AUWA 3AEFC 1ZRTD 3RL0g 5AW1B 3V2RA 1YJ9P 1FJPA 3G4SP 2N9YB 1L0LJ 1SQQG 1N73A 3MP7B 1LWUB 4L74A 4CPGA 1RE4A 2IBZE 3CLQA 5C39A 2IYOA 1KC8Q 3H1ID 3VN0A 2KP8A 4OH8B 1H8AA 2QSIA 2QJYC 3CX5E 5AW7B 4H13D 3JSVC 1HF9A 3NTNA 3LIDA 1J1DB 2E76C 3N4XA 3E1IA 1BGYD 4H13B 3R4YA 1DIPA 4WY4B 5KJ7D 4HH2A 1KQLA 4NPFX 2KK7A 2A06E 2KLUA 1SQQD 3JC22 4Y99C 3AEEC 1PP9G 3L74E 4JF7A 4PD4E 1FAVA 2PGDA 4GOEA 1NH4A 2JKVA 1NJIQ 2QA4P 2FXMA 1BCCG 1KD1Q 3KZIE 4HB1A 2D2CD 5KLIB 2YNYA 1S1CX 4H44C 1K05A 1MV8A 1W2EA 2WSCH 5AVTB 3TGUE 4M3LA 3JCUE 1NTZG 1URQA 1G1IA 3AE1C 1YTZT 1AFOA 1AV1A 4L75A 5CCHA 1PFIA 3TDKA 1ZP0C 3CWBG 1PP9D 1YQ3C 2FFDC 1SQVE 2IZ1A 1FZCB 1SQBJ 1EQ7A 1X79B 5CJ4A 2WSSH 1BCCD 5DJTB 2H7HA 1N7LA 1SP4A 4Z1MH 2WSCJ 3PJSK 1NTKK 2LR2A 1KILC 1IFIA 2IDBA 4WVZA 1QL2A 1U7MA 1BDDA 1NTZD 2ZT9D 2Q6QA 2PP6A 3G6EP 1NYHA 3I56P 1BSNA 3VMXA 2N1TA 3G71P 4UB6H 1H89A 3CWBD 2KYVA 2ZT9B 5BVZA 5KLVG 3CMEP 2GUVA 5AW4B 4MN4C 4WB4A 1RY3A 5TJHA 2HYNA 3WUVA 3RK3D 3CC4P 3C8VA 2C9LY 3TNUA 2BEZF 1NU1E 3L36A 3HE4A 2XDJA 3L71J 1GL2A 1Z56A 3W67A 2KS1A 3SFDC 4HKZH 2OYOA 1LT9C 3KXDA 2AXTE 1X9VA 1GZLA 1KB9E 1FDMA 3H1LE 1AQ5A 3AE8C 1L0LE 1AVOA 3RL0C 5E79E 1KMIZ 3LIEA 3PH0A 3B5NA 1EDIA 1GMJA 5GTIE 1LP1B 1L0NJ 4U3FJ 3L4FA 1L4AC 2Y9ZA 4IFMA 1HBWA 2A06G 2QE7H 4AYCA 4AQRD 4I6MC 2E74D 1Y47A 2JWAA 4YPCA 4Y28J 2WSEH 1JB0J 3BRTB 3Q2YA 1FZGA 1A02J 1KFNA 1P84D 3CX5D 4PJ0H 3WU2H 1IJDB 3AE6C 3A0HH 4OGQC 1NTMG 1JUNA 1YQ4C 4RESB 2CK3H 3CCVP 1T6AA 5KKZC 2OTLP 3G3ZA 3QH9A 5AVXB 4H0LC 3G9RA 1EZVE 2WPQA 2A06D 4H44B 1A02F 2QJPC 1RF0C 1R5LA 3QWOC 4BRYA 1VF5C 1SFCA 1S9KE 2WSEJ 4C46A 3L75J 1SQPJ 1W5CE 1J1EB 1GTWA 1NKNA 1Q81Q 2HODB 1T3UA 2H88C 2W6AA 2ZJSE 3HD7A 1NKZB 2V7QH 1KYOD 1LTGC 2ZYAA 5APSA 2FFDB 3KQGA 1NTMD 3IN6A 1SQXJ 4ZMDA 1E5WA 3L72J 1CI6B 3GF7A 1FOSF 3CCJP 1SQBE 3KPEA 1HGZA 1M7LA 3EFFK 4GOFA 4YXWH 3C9IA 1LWUC 2XU6A 3S1KA 3L70G 4XA4A 3HUSB 2V7QJ 4UB8H 1QLED 3WUTA 2YXQB 1PZQA 3GMAA 5APWA 4D6TG 1OVVA 1N7SA 3KZIH 4C7NA 1JMBA 1J1DC 2KOGA 2XKMA 5APTA 2I1JA 4RJTA 2KI7B 2WSFH 2M5AA 2POHA 5H2FH 3A7OA 1AA0A 1E79H 2E75D 1JTHA 4H13C 1Y9BA 2M8RA 3K5BA 3JCUH 2V4HA 1SQQK 2CPBA 4EI2A 2E75B 3L71E 5AVYB 2YXRB 1NOHA 1EDJA 1LT9B 3L70D 3CMAP 4W7ZA 1LTTC 3MUDC 4UB6E 1W2BO 1U57A 2QG4A 2WT7A 4N78E 2W83C 2QM7A 1S72P 3GHGA 1OMIA 1USEA 2WSFJ 1L4AD 1FZBA 2UWJE 4D6TD 2M3EA 1K04A 3P8MC 4IFFA 3CC2P 5TISH 2OTKE 2D2CC 3CCMP 1L4AB 4U3FE 2WPSA 1KN7A 1VQ5P 3O6QB 2BASA 4R4MA 2ZVOB 1X8YA 3B71A 1FBMA 4NPEA 2Q7CA 1N8RQ 1SQVJ 2PRRA 5AW5B 1GW3A 3WMM0 3P8CD 4GKGA 2SPZA 1NTKJ 3H32A 2IFNA 4H0LD 3H1HJ 2K3RA 2RKLA 2QJKB 1NTZK 3BVHA 1VF5D 3CCSP 3F89A 5KKZB 1M90Q 1ZN5A 3HE5A 3M0DC 1Q7YQ 4H0LB 1VQ9P 1R5SA 1TU3F 1N86A 1M1JA 2AXTH 2QJPB 1VF5B 2JDIH 4LGDE 2Y0EA 2IFMA 3CCRP 3U1AA 1PL5A 3H1JJ 1LTJA 3L75E 1SQPE 3ITKA 2Q5UA 3WU2E 1SQBG 2I8DA 3A0HE 2FYUG 5L8RJ 5CCHD 4PV1D 1G2CA 1ZR2A 1NU1J 2E5YA 1K73Q 1VPCA 1YIJP 3L72E 3BASA 4PV1B 4JYCA 4QMAA 3RK3C 2OYHC 1VQ7P 5KTBA 1CSBA 3H1LJ 3NMDA 1QGKB 5KLVK 4HJGH 3F5HA 5APUA 2A45I 1S4XA 2MJZA 2FYUD 3H1KE 3L73G 3SFEC 2BEQD 1RQVA 2ZVNB 3AE3C 1YYCA 1G1JA 3V6IA 1OW7A 1HVVA 1XTCC 2M3BA 2WVRA 4O9BA 3AE7C 2J5UA 1RE3C 1YJWP 3BRVB 3KDPB 1HUCA 1RF1A 3IAOA 2E74C 3GG2A 3PP5A 4UB8E 4DZOA 2L5GB 1RH5B 2KNCB 2W6JH 1L0NG 3TNUB 3KYQA 4U3FG 1OVRA 1GU4A 3L73D 2K1AA 2KS1B 2BCCJ 2GUSA 3LW5H 5H2FE 2Y0CA 1RF0A 1MFTA 3B4SA 2KB7P 2D2CB 2NZ2A 4KT0J 2JP3A 2OYIA 1J1EC 3FWNA 3P7KA 1BE3J 2NPSC 4RKUJ 3EWKA 2WTYA 2HPCB 1NTMK 3H25A 4N6JA 1KILE 3VP9A 2ZAEB 1L0ND 3BCCG 4U3FD 3LW5J 5CHXA 2FYZA 1FZFA 2QRXA 4I2LC 1HJ0A 4TLFA 5TISE 2JR8A 1NTKE 1S2EA 3H1HE 5DJUB 1ZXGA 3H1IJ 2GM4A 3M9HA 1KZUB 1LWUA 3TSIA 3D6YA 3HUSC 1YHQP 2QIWA 3CCEP 2OQQA 3MGNA 1SFCD 3T97B 1SQXG 2HG5D 1BGYJ 1M8OB 3H1JE 1IK7A 2R3SA 3Q5RA 3BCCD 5APXA 3M06A 1P84I 1VQMP 4NPDA 4WY4A 3M9QA 3HD7D 3CXHE 3RK2C 2A45H 2O01N 1PV3A 2O1KA 1HGVA 2E75C 2IBZG 3AE9C 3RK3B 5KJ7A 2OYHB 1AVYA 5GTHH 1EXJA 5AW0B 1JNMA 2B87B 1JEKA 1ZLLA 1LNQA 5KLVD 1SQXD 1LT1A 3V4WA 3E1RA 1VQ6P 1D7MA 3Q5PA 4RO0A 3VTPC 3HRNA 1SLQA 2Y9YA 2LXBA 1PGQA 4A7PA 1KYOI 4OWFA 1RE4C 3L74G 1N7SD 3IFMA 2IBZD 2C0XA 2JWDA 1GW4A 1YITP 1YTZI 1BCCJ 2YMKA 1EDKA 1AJYA 1Q2NA 1NAYA 1FZCA 2YO3A 2E74B 3CPWO 2CPSA 2K9JB 2R3CA 2KXPB 3TGUG 3AECC 1LJ2A 2QJKC 4B86A 3M0DA 2BCCE 3CWBJ 3HTKA 3M9BA 3L74D 4PD4D 1OX3A 2ITAA 2NPSD 3FGAD 1SQVG 1FC2C 2W90A 2YKPA 1VQNP 4KJMA 3NFQA 1NVOA 1ZW0A 2NPSB 1UIXA 1BE3E 1JOCA 3CXHI 1RQUA 1Y8AA 1L2PA 3SSUA 4HYTB 5CCGD 3D70A 2R32A 3TGUD 2WMMA 5CCHC 4PV1C 3V5BA 2LKMA 5BU8B 5AVWB 2P1JA 3A0BE 1JY2N 1LTAC 1DH3A 2ZFCA 1P84H 3H1IE 1CZQA 2JO1A 3A3YB 5AW9B 4C7RA 1SQBK 1SQVD 4N3YB 1QVFO 2H89C 1SVFA 2FYUK 3H1KJ 1LP1A 3O8ZA 1H0TA 1NU1G 1JY2P 2E5TA 3PRJA 3S9OA 4I1LA 1OWAA 1IFNA 2JJLA 3RK2D 1BGYE 2R5DA 1GD2E 1Q82Q 2KLVA 3H1LG 1LGHB 4U7JA 5APVA 1Q86Q 2M0BA 1RE3A 3KHUA 4I7ZC 1FZEA 1SQQE 1L0LG 2B88A 3RK2B 2W8ZA 1T3JA 2WQYC 3S4RA 1NHLA 1KYOH 2IYPA 2QEXP 1VQOP 1VQPP 1LTBC 3Q5SA 4OVNF 3OAKA 1OFCX 1NU1D 1JCCA 3MHVA 2P58A 4IFDK 2RN0A 2NRGA 3OJAB 2QVAA 1N73B 1KB9D 3H1LD 1H88A 4WBAA 1L0LD 1PP9E 4ASWA 2HODA 2KUBA 1X22A 3Q3DA 1NTMJ 2C9NY 2H8PD 4JBZA 3RBZA 5GTHE 2FFDA 1GU5A 1L0NK 1BCCE 1CI6A 1EZVG 3D71A 5B66H 2BCCG 3TYYA 2G3AA 2W6BA 1JY3N
chains in the Genus database with same CATH topology
1GDTA 3L36A 3HE4A 2XDJA 3PP5A 1GL2A 1Z56A 4ZKUA 4DZOA 2L5GB 1RF1B 1LT9C 1KILA 1KILD 1X9VA 1GZLA 3TNUB 3KYQA 1FDMA 3H32B 2H43A 2QM8A 3A2AA 3HUSA 1GU4A 2P2UA 1AQ5A 3RL0C 2E43A 1DEBA 2GUSA 2R5BA 1KILB 3LW5H 1JY3P 2Q3IA 1RF0A 5BU5A 3LIEA 3HE5B 2O01H 3B5NA 1ZV8A 2KB7P 1IC2A 3L37A 1URQD 1M1JB 2OYIA 1J1EC 2YKOA 5AVUB 3L4FA 1L4AC 2N1TC 4IFMA 3P7KA 1HBWA 1OXZA 2J59M 1SFCC 1HTLC 4EOTA 2NPSC 4GIFA 4AYCA 2WTYA 1MZ9A 1LTJB 2HPCB 1URQB 1NTMK 4AQRD 1S9KD 4I6MC 3MD0A 3CI9A 5AVQB 4N6JA 3VP9A 4EIJA 1CW5A 4WY4C 3HD7C 3VOPA 1G2CB 2FKWB 2Q9IA 2WSEH 3BRTB 1FZGA 5CHXA 1A02J 1LT9A 2FYZA 1FZFA 1KFNA 3M0AA 4I2LC 1IJDB 1GL2C 2IPPA 1XTGB 2XZRA 3RL0D 5KJ7C 1SQXK 3M9HA 2GM4A 1KZUB 1LWUA 3TSIA 1JUNA 2I1KA 2P67A 4RESB 1WRGA 3HUSC 1HH0A 3G3ZA 1LTSC 5AVXB 3RL0B 5AW3B 2WPQA 1HJBA 1L4AA 1A02F 1RF0C 1IFDA 2N1TD 1KFMA 1SFCA 3B5NC 1S9KE 3MGNA 1SFCD 2NPSA 3P32A 1IK9A 2HG5D 4C46A 2Z5IA 2J58A 3I5CA 1J1EB 1ZR4A 2W27A 1JMMA 2N1TB 1FJKA 1GTWA 1JO5A 2XV5A 1NKNA 5APXA 2HODB 3UIAA 1T3UA 3M06A 2N9BA 1N7SC 2W6AA 3HD7A 3M9QA 1NKZB 4WY4A 2Z5HA 4WY4D 3HD7D 3RK2C 1LTGC 2A45H 3MIWA 1IFMA 5APSA 2Z4EA 2P7JA 2FFDB 3KQGA 5AVRB 5CCGA 2O1KA 3IR9A 1HGVA 1E5WA 1GL2D 1CI6B 1JY2O 5CMZA 2KSJA 3RK3B 1FOSF 5KJ7A 2OYHB 1NO4A 2A45G 5APYA 1J2JB 1T8ZA 3KPEA 1FZCC 3NXSA 1HGZA 1M7LA 1T2KC 3HE4B 1GL2B 2WZ7A 3C9IA 5AVVB 5AW0B 4DOJA 1LWUC 1JNMA 3R2PA 1NAFA 1ZLLA 2XU6A 3MTUE 3V4WA 1GK6A 4XA4A 3HUSB 3B5ND 2YKQA 3VTPC 1HWTC 3HRNA 1SLQA 1JCDA 1VDFA 3N7NA 3EFGA 2ZXEB 3GHGC 5AW2B 3VYIA 2O1JA 3A5TA 1RE4C 4N78D 3B5NB 5APWA 1N7SA 2JEEA 4C7NA 1N7SD 3II6A 3VMZA 1FOSE 5AW6B 3IFMA 2OYIB 2C0XA 1J1DC 1GW4A 2KOGA 2XKMA 5APTA 3SWFA 3EQ2A 1QL1A 2I1JA 3CL3D 1YTZI 4W7YA 2WSFH 1SQPK 2POHA 3A7OA 1NWQA 5AVSB 1JTHA 2M8RA 3SWYA 5APQA 2PAJA 3H6PA 1SQQK 1FZCA 2YO3A 5CCGC 4JYBA 1T2KD 2CPBA 2CPSA 5AVYB 2R3CA 3OA7A 1NOHA 2OARA 1LT9B 4W7ZA 3V2NA 4AUWA 1LTTC 1SQVK 4B86A 5AW1B 3V2RA 1FJPA 2WT7A 3M0DA 4N78E 2QM7A 1N73A 1LWUB 3B8EB 3GHGA 3HTKA 1L4AD 1FZBA 1WT6A 3M9BA 3P8MC 1RE4A 3CLQA 4IFFA 2NPSD 3V2PA 3VN0A 3U59A 1L4AB 1M1JC 2KP8A 3HTKB 2YKPA 4OH8B 5AW8B 3TYYA 2WPSA 3V4QA 1SFCB 1H8AA 3NFQA 2YO2A 1IO4A 2NPSB 2XNXA 1JOCA 2BASA 5AW7B 3NTNA 1X8YA 1LTJC 3LIDA 1FBMA 2Q7CA 1J1DB 3N4XA 4HYTB 5CCGD 3E1IA 2R32A 1JY3O 5CCHC 4WY4B 3HD7B 3V5BA 5AW5B 2IX7C 1GW3A 5KJ7D 2LKMA 5BU8B 4HH2A 1KQLA 3P8CD 5AVWB 3WMM0 4GKGA 2P1JA 3MUDA 4Y99C 1JY2N 3VP8A 3H32A 3VMYA 1NU1K 1LTAC 2YMYA 4JF7A 2IFNA 1DH3A 2ZFCA 1FAVA 2WPRA 4LLHA 1FZAA 1CZQA 3A3YB 1NH4A 5AW9B 4C7RA 1NTZK 3BVHA 1IFJA 4XE5B 1SQBK 4N3YB 2FXMA 1ZN5A 3HE5A 3M0DC 3L35A 1SVFA 2FYUK 1N73C 1N86A 1L0LK 1M1JA 3O8ZA 2YNYA 5CJ0A 1MV8A 1JY2P 1W2EA 4LGDE 4I1LA 2IFMA 1OWAA 1IFNA 2WSCH 5AVTB 4M3LA 2JJLA 3U1AA 3RK2D 1LTJA 2HPCA 1URQA 2R5DA 1G1IA 1GD2E 1YTZT 2Q5UA 2KLVA 3P8CE 1AFOA 1LGHB 2C0WA 5APVA 5CCHA 1RE3A 1PFIA 1DX7A 1N7SB 5CCHD 1FZEA 4C7NB 3RK2B 1G2CA 1T3JA 1ZR2A 1N2DC 2FFDC 1VPCA 1NHLA 2WWWA 1JTHB 3BASA 4JYCA 1GK4A 1RF1C 3RK3C 1FZCB 2OYHC 1EQ7A 1X79B 5KTBA 5CJ4A 1CSBA 4GT1A 2H7HA 1N7LA 1LTBC 1SP4A 4Y99B 3NMDA 4KHXA 1NTKK 3OAKA 2HFED 1MFZA 5KLVK 1JCCA 1KILC 4IFDK 1LTIC 1IFIA 2WITA 2WT7B 3OJAB 1QL2A 5APUA 3T97A 4ZKPA 2PP6A 3BATA 2A45I 1N73B 2MJZA 3GHGB 3M91A 1H88A 4WBAA 4W80A 3VMXA 2E42A 2N1TA 1YYCA 2HLOA 1G1JA 1H89A 2HODA 2VRSA 2KYVA 1HVVA 5BVZA 2C9NY 1XTCC 2H8PD 1URQC 3U1CA 2GUVA 2M3BA 5AW4B 2OYIC 4O9BA 4WB4A 1FU1A 1RY3A 2FFDA 3V2QA 4LC1A 1RE3C 1GU5A 3TK1A 1L0NK 3BRVB 5AVZB 3KDPB 1CI6A 1MUUA 2HYNA 1HUCA 1RF1A 2OYHA 3RK3D 2C9LY 3TNUA 2W6BA 1JY3N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L36 A;  1T2K D;  1MV8 A;  3HE4 A;  1S9K E;  5AVY B;  3MGN A;  2R3C A;  3P32 A;  1OWA A;  5AVT B;  4M3L A;  2JJL A;  4C46 A;  2Z5I A;  4DZO A;  3I5C A;  2R5D A;  1GD2 E;  4AUW A;  2Q5U A;  2W27 A;  1GZL A;  4B86 A;  5AW1 B;  3TNU B;  2QM8 A;  3A2A A;  5APV A;  1GTW A;  2XV5 A;  5APX A;  1GU4 A;  2P2U A;  3UIA A;  2WT7 A;  3M06 A;  3M0D A;  2N9B A;  2W6A A;  4C7N B;  2Z5H A;  2QM7 A;  2E43 A;  3B8E B;  3HTK A;  5APS A;  2R5B A;  2P7J A;  3M9B A;  3KQG A;  5AVR B;  2Q3I A;  3IR9 A;  3P8M C;  2WWW A;  3LIE A;  3HE5 B;  1CI6 B;  5CMZ A;  4JYC A;  3VN0 A;  1GK4 A;  1FOS F;  5APY A;  3L37 A;  1J2J B;  5AVU B;  2KP8 A;  3NXS A;  1CSB A;  4GT1 A;  5AW8 B;  2H7H A;  1T2K C;  3TYY A;  2WPS A;  3V4Q A;  1SP4 A;  3P7K A;  1HBW A;  3HE4 B;  1OXZ A;  1H8A A;  3NFQ A;  2YO2 A;  1IO4 A;  4EOT A;  3NMD A;  2BAS A;  5AW7 B;  5AVV B;  4KHX A;  5AW0 B;  3OAK A;  4AYC A;  2WTY A;  3NTN A;  1JNM A;  1NAF A;  1X8Y A;  1MFZ A;  3LID A;  4AQR D;  1S9K D;  2Q7C A;  2XU6 A;  4HYT B;  4I6M C;  3MD0 A;  3V4W A;  2R32 A;  1GK6 A;  5AVQ B;  2WT7 B;  3VTP C;  1HWT C;  5APU A;  1SLQ A;  3T97 A;  5AW5 B;  3V5B A;  1G2C B;  1KQL A;  3M91 A;  5AVW B;  2ZXE B;  1A02 J;  5AW2 B;  1H88 A;  3VYI A;  4GKG A;  3M0A A;  3VMX A;  4I2L C;  3A5T A;  2E42 A;  1YYC A;  3VMY A;  1H89 A;  2VRS A;  5APW A;  2IPP A;  1DH3 A;  2C9N Y;  2XZR A;  2ZFC A;  1FAV A;  4C7N A;  2WPR A;  3VMZ A;  1FOS E;  3M9H A;  5AW6 B;  1JUN A;  1CZQ A;  5APT A;  5AW4 B;  3A3Y B;  3SWF A;  2P67 A;  4RES B;  5AW9 B;  3A7O A;  4LC1 A;  4XE5 B;  1GU5 A;  1NWQ A;  3TK1 A;  5AVS B;  3HE5 A;  5AVZ B;  3L35 A;  3KDP B;  1CI6 A;  5AVX B;  5APQ A;  1MUU A;  5AW3 B;  1HUC A;  2WPQ A;  1HJB A;  2YO3 A;  3O8Z A;  2YNY A;  1A02 F;  2C9L Y;  3TNU A;  4JYB A; 
#chains in the Genus database with same CATH topology
 4IL6 H;  2KIK A;  5CBN A;  3E7K A;  3CXH H;  1NTZ E;  1RF1 B;  1KIL A;  3CCQ P;  1UII A;  3A2A A;  2GA1 A;  3HUS A;  1VQK P;  3D6Z A;  3GLM A;  3CWB E;  1JY3 P;  5CBO A;  2O01 H;  1U7J A;  1ZV8 A;  1IC2 A;  1URQ D;  2KZJ A;  5AVU B;  1SFC C;  1HTL C;  1EZV D;  4GIF A;  1IFP A;  1URQ B;  5KAF H;  3AEA C;  1S9K D;  1PPJ E;  3MD0 A;  5M1B A;  1M56 D;  4EIJ A;  3HD7 C;  3VOP A;  2Q9I A;  1USD A;  1LT9 A;  1EC5 A;  2O01 J;  4D6T J;  2IPP A;  1XTG B;  1SQX K;  1WRG A;  2K9Y A;  1HH0 A;  1SQB D;  1LTS C;  1L4A A;  2FXO A;  3C1L A;  1IFD A;  2N1T D;  1KFM A;  3L71 G;  3O6Q A;  4XFJ A;  2Z5I A;  2J58 A;  1ZR4 A;  1JMM A;  2N1T B;  3W68 A;  3FXD A;  4I7Z B;  1P84 E;  1N7S C;  1KV4 A;  4WY4 D;  1EDL A;  3MIW A;  1IFM A;  2Z4E A;  2AEJ A;  2Q3E A;  3IR9 A;  1GL2 D;  2FYN B;  2YIU B;  1VL2 A;  1JY2 O;  1OW8 A;  2KSJ A;  4BXL A;  2A45 G;  1J2J B;  1T8Z A;  3HE4 B;  2ZYD A;  5B5E H;  1GL2 B;  2WZ7 A;  4IL6 X;  5AVV B;  3L71 D;  3A0B H;  3B5N D;  3CCU P;  1HWT C;  1VQL P;  1JCD A;  1VDF A;  2ZXE B;  3GHG C;  3AEB C;  3VYI A;  2O1J A;  1KYO E;  3A5T A;  2KSE A;  4N78 D;  1QX8 A;  3B5N B;  1R8E A;  2L91 A;  2JEE A;  1NTM E;  2PFX A;  3VMZ A;  1QL1 A;  4W7Y A;  3CL3 D;  1NWQ A;  5AVS B;  2LXC B;  3H6P A;  3GW6 A;  5CCG C;  4JYB A;  2Y0D A;  1FDO A;  1QEX A;  5EFW B;  1T2K D;  2FY8 A;  3OA7 A;  2OAR A;  3L75 G;  1SQP G;  3V2N A;  1SQV K;  2RMZ A;  4YTP C;  2FYU J;  3CD6 P;  2MKV A;  1RHZ B;  2FBW C;  3B8E B;  1Q90 D;  1X0T A;  1WT6 A;  4DT0 A;  3Q1M A;  2IBZ I;  1PPJ G;  2B9B A;  3V2P A;  3L72 G;  1S5L H;  1KQG B;  5B66 E;  3U59 A;  1M1J C;  5AW8 B;  3HTK B;  4IL6 E;  3PHL A;  4BRY B;  3V4Q A;  3AE2 C;  1SFC B;  2YO2 A;  1IO4 A;  1SQQ J;  3CX5 I;  2XNX A;  1IZN B;  3MZW B;  1YJN P;  1LTJ C;  2R44 A;  3L70 E;  4GDO A;  4DCK A;  1JY3 O;  1K9M Q;  2G8Y A;  3L75 D;  1SQP D;  1NGM B;  1OW6 A;  3HD7 B;  4YXD C;  2IX7 C;  4L73 A;  3L73 J;  3H1K G;  3MUD A;  2KNC A;  2DW3 A;  3VP8 A;  3VMY A;  1NU1 K;  4D6T E;  2YMY A;  1VQ8 P;  4PD4 I;  1BSH A;  1PGJ A;  2WPR A;  4LLH A;  1FZA A;  1PPJ D;  3L72 D;  1PGO A;  1IFJ A;  4XE5 B;  1YI2 P;  2OTJ P;  3L35 A;  1N73 C;  5KAF E;  1L0L K;  5CJ0 A;  1FDI A;  4DJG A;  1PP9 J;  3ZDM A;  2K37 A;  2HPC A;  4L76 A;  2HR3 A;  4ASV A;  1H0T B;  2E76 D;  3P8C E;  2C0W A;  1OIP A;  2QJY B;  1DX7 A;  1N7S B;  3H1K D;  4C7N B;  1KQF B;  1N2D C;  3GF3 A;  2WPV B;  2M5A B;  2E76 B;  1DD3 A;  2WWW A;  1JTH B;  3PLN A;  3FXE A;  1NTZ J;  1GK4 A;  2B89 A;  1RF1 C;  5KAI H;  4GT1 A;  1KQS O;  4Y99 B;  4KHX A;  2HFE D;  2K88 A;  1MFZ A;  4GOD A;  2KZI A;  4ZNC A;  4H44 D;  1LTI C;  2P10 A;  4K35 A;  2WIT A;  4IOI H;  4K3A A;  2WT7 B;  3OW2 O;  3T97 A;  4ZKP A;  3BAT A;  3BCC J;  3GHG B;  3M91 A;  4W80 A;  2E42 A;  2HLO A;  1BDC A;  1NTK G;  2VRS A;  3H1H G;  1URQ C;  1S5L X;  3FX0 A;  3U1C A;  2OYI C;  1FU1 A;  5B5E E;  3V2Q A;  1ZRT E;  4LC1 A;  3TK1 A;  3AEG C;  5AVZ B;  1MUU A;  1WMK A;  2OYH A;  4TT3 H;  1M1K Q;  2AXC A;  1GDT A;  2RH0 A;  5KLV J;  3SWK A;  3TF5 A;  3CX5 H;  1S3J A;  4ZKU A;  3PTZ A;  3H1J G;  1VQ4 P;  2B87 A;  1KIL D;  1PGP A;  1KB9 I;  3H32 B;  2FYU E;  2QM8 A;  2H43 A;  2P2U A;  2E43 A;  1DEB A;  3CC7 P;  2R5B A;  1NTK D;  1KIL B;  2Q3I A;  5BU5 A;  3H1H D;  3HE5 B;  3USS A;  3CCL P;  4PD4 H;  3L37 A;  1M1J B;  2YKO A;  2XND H;  2N1T C;  1PIX A;  2IZ0 A;  1OXZ A;  2J59 M;  4EOT A;  4JQ0 D;  1ZME C;  3RBX A;  1MZ9 A;  1LTJ B;  3CI9 A;  5AVQ B;  3IF4 A;  3H1J D;  2FYN C;  2YIU C;  2K9J A;  1CW5 A;  4WY4 C;  1G2C B;  2FKW B;  3L73 E;  3M0A A;  2AEM A;  1S5L E;  3CXH D;  1GL2 C;  3L74 J;  1EXI A;  2XZR A;  1QVG O;  3RL0 D;  5KJ7 C;  2AEF A;  2I1K A;  2P67 A;  1OVU A;  4BWN A;  3RL0 B;  5AW3 B;  1EZV I;  1HJB A;  3RGU A;  5KLI C;  1OZH A;  3B5N C;  2NPS A;  3ABV C;  3P32 A;  3TGU J;  1IK9 A;  2ZXX A;  3I5C A;  2W27 A;  1L0N E;  5K5G B;  1FJK A;  3VMA A;  2Q1K A;  2OGU A;  1JO5 A;  2XV5 A;  3UIA A;  1FS0 E;  2N9B A;  1JM0 A;  2Z5H A;  4EDF A;  3I55 P;  2P7J A;  5AVR B;  5CCG A;  5CMZ A;  1ZOY C;  1AQT A;  1DD4 A;  4OGQ D;  1NO4 A;  5APY A;  2O3J A;  1FZC C;  3NXS A;  1T2K C;  1BE3 G;  1FE6 A;  4DOJ A;  1KOR A;  4OGQ B;  3R2P A;  1NAF A;  1M57 D;  1KTM A;  3MTU E;  1GK6 A;  1MKM A;  1DEE G;  2YKQ A;  3N7N A;  3BCC E;  3EFG A;  5AW2 B;  3RK3 E;  4EYY Q;  4WWI A;  1KB9 H;  2BCC D;  3WUU A;  2ZT9 C;  3AE4 C;  3AED C;  3II6 A;  5KAI E;  1FOS E;  5AW6 B;  3H1I G;  2OYI B;  3AE5 C;  3L70 J;  1SS1 A;  3SWF A;  3EQ2 A;  1SQP K;  5E79 H;  4PJ0 E;  3SWY A;  5APQ A;  2PAJ A;  3FWL A;  1YBK A;  1K8A Q;  2ZYG A;  5GTI H;  1BE3 D;  4R4L A;  5KLV E;  1SQX E;  2FXP A;  1BGY G;  4JPZ B;  4AUW A;  3AEF C;  1ZRT D;  3RL0 g;  5AW1 B;  3V2R A;  1YJ9 P;  1FJP A;  3G4S P;  2N9Y B;  1L0L J;  1SQQ G;  1N73 A;  3MP7 B;  1LWU B;  4L74 A;  4CPG A;  1RE4 A;  2IBZ E;  3CLQ A;  5C39 A;  2IYO A;  1KC8 Q;  3H1I D;  3VN0 A;  2KP8 A;  4OH8 B;  1H8A A;  2QSI A;  2QJY C;  3CX5 E;  5AW7 B;  4H13 D;  3JSV C;  1HF9 A;  3NTN A;  3LID A;  1J1D B;  2E76 C;  3N4X A;  3E1I A;  1BGY D;  4H13 B;  3R4Y A;  1DIP A;  4WY4 B;  5KJ7 D;  4HH2 A;  1KQL A;  4NPF X;  2KK7 A;  2A06 E;  2KLU A;  1SQQ D;  3JC2 2;  4Y99 C;  3AEE C;  1PP9 G;  3L74 E;  4JF7 A;  4PD4 E;  1FAV A;  2PGD A;  4GOE A;  1NH4 A;  2JKV A;  1NJI Q;  2QA4 P;  2FXM A;  1BCC G;  1KD1 Q;  3KZI E;  4HB1 A;  2D2C D;  5KLI B;  2YNY A;  1S1C X;  4H44 C;  1K05 A;  1MV8 A;  1W2E A;  2WSC H;  5AVT B;  3TGU E;  4M3L A;  3JCU E;  1NTZ G;  1URQ A;  1G1I A;  3AE1 C;  1YTZ T;  1AFO A;  1AV1 A;  4L75 A;  5CCH A;  1PFI A;  3TDK A;  1ZP0 C;  3CWB G;  1PP9 D;  1YQ3 C;  2FFD C;  1SQV E;  2IZ1 A;  1FZC B;  1SQB J;  1EQ7 A;  1X79 B;  5CJ4 A;  2WSS H;  1BCC D;  5DJT B;  2H7H A;  1N7L A;  1SP4 A;  4Z1M H;  2WSC J;  3PJS K;  1NTK K;  2LR2 A;  1KIL C;  1IFI A;  2IDB A;  4WVZ A;  1QL2 A;  1U7M A;  1BDD A;  1NTZ D;  2ZT9 D;  2Q6Q A;  2PP6 A;  3G6E P;  1NYH A;  3I56 P;  1BSN A;  3VMX A;  2N1T A;  3G71 P;  4UB6 H;  1H89 A;  3CWB D;  2KYV A;  2ZT9 B;  5BVZ A;  5KLV G;  3CME P;  2GUV A;  5AW4 B;  4MN4 C;  4WB4 A;  1RY3 A;  5TJH A;  2HYN A;  3WUV A;  3RK3 D;  3CC4 P;  3C8V A;  2C9L Y;  3TNU A;  2BEZ F;  1NU1 E;  3L36 A;  3HE4 A;  2XDJ A;  3L71 J;  1GL2 A;  1Z56 A;  3W67 A;  2KS1 A;  3SFD C;  4HKZ H;  2OYO A;  1LT9 C;  3KXD A;  2AXT E;  1X9V A;  1GZL A;  1KB9 E;  1FDM A;  3H1L E;  1AQ5 A;  3AE8 C;  1L0L E;  1AVO A;  3RL0 C;  5E79 E;  1KMI Z;  3LIE A;  3PH0 A;  3B5N A;  1EDI A;  1GMJ A;  5GTI E;  1LP1 B;  1L0N J;  4U3F J;  3L4F A;  1L4A C;  2Y9Z A;  4IFM A;  1HBW A;  2A06 G;  2QE7 H;  4AYC A;  4AQR D;  4I6M C;  2E74 D;  1Y47 A;  2JWA A;  4YPC A;  4Y28 J;  2WSE H;  1JB0 J;  3BRT B;  3Q2Y A;  1FZG A;  1A02 J;  1KFN A;  1P84 D;  3CX5 D;  4PJ0 H;  3WU2 H;  1IJD B;  3AE6 C;  3A0H H;  4OGQ C;  1NTM G;  1JUN A;  1YQ4 C;  4RES B;  2CK3 H;  3CCV P;  1T6A A;  5KKZ C;  2OTL P;  3G3Z A;  3QH9 A;  5AVX B;  4H0L C;  3G9R A;  1EZV E;  2WPQ A;  2A06 D;  4H44 B;  1A02 F;  2QJP C;  1RF0 C;  1R5L A;  3QWO C;  4BRY A;  1VF5 C;  1SFC A;  1S9K E;  2WSE J;  4C46 A;  3L75 J;  1SQP J;  1W5C E;  1J1E B;  1GTW A;  1NKN A;  1Q81 Q;  2HOD B;  1T3U A;  2H88 C;  2W6A A;  2ZJS E;  3HD7 A;  1NKZ B;  2V7Q H;  1KYO D;  1LTG C;  2ZYA A;  5APS A;  2FFD B;  3KQG A;  1NTM D;  3IN6 A;  1SQX J;  4ZMD A;  1E5W A;  3L72 J;  1CI6 B;  3GF7 A;  1FOS F;  3CCJ P;  1SQB E;  3KPE A;  1HGZ A;  1M7L A;  3EFF K;  4GOF A;  4YXW H;  3C9I A;  1LWU C;  2XU6 A;  3S1K A;  3L70 G;  4XA4 A;  3HUS B;  2V7Q J;  4UB8 H;  1QLE D;  3WUT A;  2YXQ B;  1PZQ A;  3GMA A;  5APW A;  4D6T G;  1OVV A;  1N7S A;  3KZI H;  4C7N A;  1JMB A;  1J1D C;  2KOG A;  2XKM A;  5APT A;  2I1J A;  4RJT A;  2KI7 B;  2WSF H;  2M5A A;  2POH A;  5H2F H;  3A7O A;  1AA0 A;  1E79 H;  2E75 D;  1JTH A;  4H13 C;  1Y9B A;  2M8R A;  3K5B A;  3JCU H;  2V4H A;  1SQQ K;  2CPB A;  4EI2 A;  2E75 B;  3L71 E;  5AVY B;  2YXR B;  1NOH A;  1EDJ A;  1LT9 B;  3L70 D;  3CMA P;  4W7Z A;  1LTT C;  3MUD C;  4UB6 E;  1W2B O;  1U57 A;  2QG4 A;  2WT7 A;  4N78 E;  2W83 C;  2QM7 A;  1S72 P;  3GHG A;  1OMI A;  1USE A;  2WSF J;  1L4A D;  1FZB A;  2UWJ E;  4D6T D;  2M3E A;  1K04 A;  3P8M C;  4IFF A;  3CC2 P;  5TIS H;  2OTK E;  2D2C C;  3CCM P;  1L4A B;  4U3F E;  2WPS A;  1KN7 A;  1VQ5 P;  3O6Q B;  2BAS A;  4R4M A;  2ZVO B;  1X8Y A;  3B71 A;  1FBM A;  4NPE A;  2Q7C A;  1N8R Q;  1SQV J;  2PRR A;  5AW5 B;  1GW3 A;  3WMM 0;  3P8C D;  4GKG A;  2SPZ A;  1NTK J;  3H32 A;  2IFN A;  4H0L D;  3H1H J;  2K3R A;  2RKL A;  2QJK B;  1NTZ K;  3BVH A;  1VF5 D;  3CCS P;  3F89 A;  5KKZ B;  1M90 Q;  1ZN5 A;  3HE5 A;  3M0D C;  1Q7Y Q;  4H0L B;  1VQ9 P;  1R5S A;  1TU3 F;  1N86 A;  1M1J A;  2AXT H;  2QJP B;  1VF5 B;  2JDI H;  4LGD E;  2Y0E A;  2IFM A;  3CCR P;  3U1A A;  1PL5 A;  3H1J J;  1LTJ A;  3L75 E;  1SQP E;  3ITK A;  2Q5U A;  3WU2 E;  1SQB G;  2I8D A;  3A0H E;  2FYU G;  5L8R J;  5CCH D;  4PV1 D;  1G2C A;  1ZR2 A;  1NU1 J;  2E5Y A;  1K73 Q;  1VPC A;  1YIJ P;  3L72 E;  3BAS A;  4PV1 B;  4JYC A;  4QMA A;  3RK3 C;  2OYH C;  1VQ7 P;  5KTB A;  1CSB A;  3H1L J;  3NMD A;  1QGK B;  5KLV K;  4HJG H;  3F5H A;  5APU A;  2A45 I;  1S4X A;  2MJZ A;  2FYU D;  3H1K E;  3L73 G;  3SFE C;  2BEQ D;  1RQV A;  2ZVN B;  3AE3 C;  1YYC A;  1G1J A;  3V6I A;  1OW7 A;  1HVV A;  1XTC C;  2M3B A;  2WVR A;  4O9B A;  3AE7 C;  2J5U A;  1RE3 C;  1YJW P;  3BRV B;  3KDP B;  1HUC A;  1RF1 A;  3IAO A;  2E74 C;  3GG2 A;  3PP5 A;  4UB8 E;  4DZO A;  2L5G B;  1RH5 B;  2KNC B;  2W6J H;  1L0N G;  3TNU B;  3KYQ A;  4U3F G;  1OVR A;  1GU4 A;  3L73 D;  2K1A A;  2KS1 B;  2BCC J;  2GUS A;  3LW5 H;  5H2F E;  2Y0C A;  1RF0 A;  1MFT A;  3B4S A;  2KB7 P;  2D2C B;  2NZ2 A;  4KT0 J;  2JP3 A;  2OYI A;  1J1E C;  3FWN A;  3P7K A;  1BE3 J;  2NPS C;  4RKU J;  3EWK A;  2WTY A;  2HPC B;  1NTM K;  3H25 A;  4N6J A;  1KIL E;  3VP9 A;  2ZAE B;  1L0N D;  3BCC G;  4U3F D;  3LW5 J;  5CHX A;  2FYZ A;  1FZF A;  2QRX A;  4I2L C;  1HJ0 A;  4TLF A;  5TIS E;  2JR8 A;  1NTK E;  1S2E A;  3H1H E;  5DJU B;  1ZXG A;  3H1I J;  2GM4 A;  3M9H A;  1KZU B;  1LWU A;  3TSI A;  3D6Y A;  3HUS C;  1YHQ P;  2QIW A;  3CCE P;  2OQQ A;  3MGN A;  1SFC D;  3T97 B;  1SQX G;  2HG5 D;  1BGY J;  1M8O B;  3H1J E;  1IK7 A;  2R3S A;  3Q5R A;  3BCC D;  5APX A;  3M06 A;  1P84 I;  1VQM P;  4NPD A;  4WY4 A;  3M9Q A;  3HD7 D;  3CXH E;  3RK2 C;  2A45 H;  2O01 N;  1PV3 A;  2O1K A;  1HGV A;  2E75 C;  2IBZ G;  3AE9 C;  3RK3 B;  5KJ7 A;  2OYH B;  1AVY A;  5GTH H;  1EXJ A;  5AW0 B;  1JNM A;  2B87 B;  1JEK A;  1ZLL A;  1LNQ A;  5KLV D;  1SQX D;  1LT1 A;  3V4W A;  3E1R A;  1VQ6 P;  1D7M A;  3Q5P A;  4RO0 A;  3VTP C;  3HRN A;  1SLQ A;  2Y9Y A;  2LXB A;  1PGQ A;  4A7P A;  1KYO I;  4OWF A;  1RE4 C;  3L74 G;  1N7S D;  3IFM A;  2IBZ D;  2C0X A;  2JWD A;  1GW4 A;  1YIT P;  1YTZ I;  1BCC J;  2YMK A;  1EDK A;  1AJY A;  1Q2N A;  1NAY A;  1FZC A;  2YO3 A;  2E74 B;  3CPW O;  2CPS A;  2K9J B;  2R3C A;  2KXP B;  3TGU G;  3AEC C;  1LJ2 A;  2QJK C;  4B86 A;  3M0D A;  2BCC E;  3CWB J;  3HTK A;  3M9B A;  3L74 D;  4PD4 D;  1OX3 A;  2ITA A;  2NPS D;  3FGA D;  1SQV G;  1FC2 C;  2W90 A;  2YKP A;  1VQN P;  4KJM A;  3NFQ A;  1NVO A;  1ZW0 A;  2NPS B;  1UIX A;  1BE3 E;  1JOC A;  3CXH I;  1RQU A;  1Y8A A;  1L2P A;  3SSU A;  4HYT B;  5CCG D;  3D70 A;  2R32 A;  3TGU D;  2WMM A;  5CCH C;  4PV1 C;  3V5B A;  2LKM A;  5BU8 B;  5AVW B;  2P1J A;  3A0B E;  1JY2 N;  1LTA C;  1DH3 A;  2ZFC A;  1P84 H;  3H1I E;  1CZQ A;  2JO1 A;  3A3Y B;  5AW9 B;  4C7R A;  1SQB K;  1SQV D;  4N3Y B;  1QVF O;  2H89 C;  1SVF A;  2FYU K;  3H1K J;  1LP1 A;  3O8Z A;  1H0T A;  1NU1 G;  1JY2 P;  2E5T A;  3PRJ A;  3S9O A;  4I1L A;  1OWA A;  1IFN A;  2JJL A;  3RK2 D;  1BGY E;  2R5D A;  1GD2 E;  1Q82 Q;  2KLV A;  3H1L G;  1LGH B;  4U7J A;  5APV A;  1Q86 Q;  2M0B A;  1RE3 A;  3KHU A;  4I7Z C;  1FZE A;  1SQQ E;  1L0L G;  2B88 A;  3RK2 B;  2W8Z A;  1T3J A;  2WQY C;  3S4R A;  1NHL A;  1KYO H;  2IYP A;  2QEX P;  1VQO P;  1VQP P;  1LTB C;  3Q5S A;  4OVN F;  3OAK A;  1OFC X;  1NU1 D;  1JCC A;  3MHV A;  2P58 A;  4IFD K;  2RN0 A;  2NRG A;  3OJA B;  2QVA A;  1N73 B;  1KB9 D;  3H1L D;  1H88 A;  4WBA A;  1L0L D;  1PP9 E;  4ASW A;  2HOD A;  2KUB A;  1X22 A;  3Q3D A;  1NTM J;  2C9N Y;  2H8P D;  4JBZ A;  3RBZ A;  5GTH E;  2FFD A;  1GU5 A;  1L0N K;  1BCC E;  1CI6 A;  1EZV G;  3D71 A;  5B66 H;  2BCC G;  3TYY A;  2G3A A;  2W6B A;  1JY3 N; 
#chains in the Genus database with same CATH homology
 1GDT A;  3L36 A;  3HE4 A;  2XDJ A;  3PP5 A;  1GL2 A;  1Z56 A;  4ZKU A;  4DZO A;  2L5G B;  1RF1 B;  1LT9 C;  1KIL A;  1KIL D;  1X9V A;  1GZL A;  3TNU B;  3KYQ A;  1FDM A;  3H32 B;  2H43 A;  2QM8 A;  3A2A A;  3HUS A;  1GU4 A;  2P2U A;  1AQ5 A;  3RL0 C;  2E43 A;  1DEB A;  2GUS A;  2R5B A;  1KIL B;  3LW5 H;  1JY3 P;  2Q3I A;  1RF0 A;  5BU5 A;  3LIE A;  3HE5 B;  2O01 H;  3B5N A;  1ZV8 A;  2KB7 P;  1IC2 A;  3L37 A;  1URQ D;  1M1J B;  2OYI A;  1J1E C;  2YKO A;  5AVU B;  3L4F A;  1L4A C;  2N1T C;  4IFM A;  3P7K A;  1HBW A;  1OXZ A;  2J59 M;  1SFC C;  1HTL C;  4EOT A;  2NPS C;  4GIF A;  4AYC A;  2WTY A;  1MZ9 A;  1LTJ B;  2HPC B;  1URQ B;  1NTM K;  4AQR D;  1S9K D;  4I6M C;  3MD0 A;  3CI9 A;  5AVQ B;  4N6J A;  3VP9 A;  4EIJ A;  1CW5 A;  4WY4 C;  3HD7 C;  3VOP A;  1G2C B;  2FKW B;  2Q9I A;  2WSE H;  3BRT B;  1FZG A;  5CHX A;  1A02 J;  1LT9 A;  2FYZ A;  1FZF A;  1KFN A;  3M0A A;  4I2L C;  1IJD B;  1GL2 C;  2IPP A;  1XTG B;  2XZR A;  3RL0 D;  5KJ7 C;  1SQX K;  3M9H A;  2GM4 A;  1KZU B;  1LWU A;  3TSI A;  1JUN A;  2I1K A;  2P67 A;  4RES B;  1WRG A;  3HUS C;  1HH0 A;  3G3Z A;  1LTS C;  5AVX B;  3RL0 B;  5AW3 B;  2WPQ A;  1HJB A;  1L4A A;  1A02 F;  1RF0 C;  1IFD A;  2N1T D;  1KFM A;  1SFC A;  3B5N C;  1S9K E;  3MGN A;  1SFC D;  2NPS A;  3P32 A;  1IK9 A;  2HG5 D;  4C46 A;  2Z5I A;  2J58 A;  3I5C A;  1J1E B;  1ZR4 A;  2W27 A;  1JMM A;  2N1T B;  1FJK A;  1GTW A;  1JO5 A;  2XV5 A;  1NKN A;  5APX A;  2HOD B;  3UIA A;  1T3U A;  3M06 A;  2N9B A;  1N7S C;  2W6A A;  3HD7 A;  3M9Q A;  1NKZ B;  4WY4 A;  2Z5H A;  4WY4 D;  3HD7 D;  3RK2 C;  1LTG C;  2A45 H;  3MIW A;  1IFM A;  5APS A;  2Z4E A;  2P7J A;  2FFD B;  3KQG A;  5AVR B;  5CCG A;  2O1K A;  3IR9 A;  1HGV A;  1E5W A;  1GL2 D;  1CI6 B;  1JY2 O;  5CMZ A;  2KSJ A;  3RK3 B;  1FOS F;  5KJ7 A;  2OYH B;  1NO4 A;  2A45 G;  5APY A;  1J2J B;  1T8Z A;  3KPE A;  1FZC C;  3NXS A;  1HGZ A;  1M7L A;  1T2K C;  3HE4 B;  1GL2 B;  2WZ7 A;  3C9I A;  5AVV B;  5AW0 B;  4DOJ A;  1LWU C;  1JNM A;  3R2P A;  1NAF A;  1ZLL A;  2XU6 A;  3MTU E;  3V4W A;  1GK6 A;  4XA4 A;  3HUS B;  3B5N D;  2YKQ A;  3VTP C;  1HWT C;  3HRN A;  1SLQ A;  1JCD A;  1VDF A;  3N7N A;  3EFG A;  2ZXE B;  3GHG C;  5AW2 B;  3VYI A;  2O1J A;  3A5T A;  1RE4 C;  4N78 D;  3B5N B;  5APW A;  1N7S A;  2JEE A;  4C7N A;  1N7S D;  3II6 A;  3VMZ A;  1FOS E;  5AW6 B;  3IFM A;  2OYI B;  2C0X A;  1J1D C;  1GW4 A;  2KOG A;  2XKM A;  5APT A;  3SWF A;  3EQ2 A;  1QL1 A;  2I1J A;  3CL3 D;  1YTZ I;  4W7Y A;  2WSF H;  1SQP K;  2POH A;  3A7O A;  1NWQ A;  5AVS B;  1JTH A;  2M8R A;  3SWY A;  5APQ A;  2PAJ A;  3H6P A;  1SQQ K;  1FZC A;  2YO3 A;  5CCG C;  4JYB A;  1T2K D;  2CPB A;  2CPS A;  5AVY B;  2R3C A;  3OA7 A;  1NOH A;  2OAR A;  1LT9 B;  4W7Z A;  3V2N A;  4AUW A;  1LTT C;  1SQV K;  4B86 A;  5AW1 B;  3V2R A;  1FJP A;  2WT7 A;  3M0D A;  4N78 E;  2QM7 A;  1N73 A;  1LWU B;  3B8E B;  3GHG A;  3HTK A;  1L4A D;  1FZB A;  1WT6 A;  3M9B A;  3P8M C;  1RE4 A;  3CLQ A;  4IFF A;  2NPS D;  3V2P A;  3VN0 A;  3U59 A;  1L4A B;  1M1J C;  2KP8 A;  3HTK B;  2YKP A;  4OH8 B;  5AW8 B;  3TYY A;  2WPS A;  3V4Q A;  1SFC B;  1H8A A;  3NFQ A;  2YO2 A;  1IO4 A;  2NPS B;  2XNX A;  1JOC A;  2BAS A;  5AW7 B;  3NTN A;  1X8Y A;  1LTJ C;  3LID A;  1FBM A;  2Q7C A;  1J1D B;  3N4X A;  4HYT B;  5CCG D;  3E1I A;  2R32 A;  1JY3 O;  5CCH C;  4WY4 B;  3HD7 B;  3V5B A;  5AW5 B;  2IX7 C;  1GW3 A;  5KJ7 D;  2LKM A;  5BU8 B;  4HH2 A;  1KQL A;  3P8C D;  5AVW B;  3WMM 0;  4GKG A;  2P1J A;  3MUD A;  4Y99 C;  1JY2 N;  3VP8 A;  3H32 A;  3VMY A;  1NU1 K;  1LTA C;  2YMY A;  4JF7 A;  2IFN A;  1DH3 A;  2ZFC A;  1FAV A;  2WPR A;  4LLH A;  1FZA A;  1CZQ A;  3A3Y B;  1NH4 A;  5AW9 B;  4C7R A;  1NTZ K;  3BVH A;  1IFJ A;  4XE5 B;  1SQB K;  4N3Y B;  2FXM A;  1ZN5 A;  3HE5 A;  3M0D C;  3L35 A;  1SVF A;  2FYU K;  1N73 C;  1N86 A;  1L0L K;  1M1J A;  3O8Z A;  2YNY A;  5CJ0 A;  1MV8 A;  1JY2 P;  1W2E A;  4LGD E;  4I1L A;  2IFM A;  1OWA A;  1IFN A;  2WSC H;  5AVT B;  4M3L A;  2JJL A;  3U1A A;  3RK2 D;  1LTJ A;  2HPC A;  1URQ A;  2R5D A;  1G1I A;  1GD2 E;  1YTZ T;  2Q5U A;  2KLV A;  3P8C E;  1AFO A;  1LGH B;  2C0W A;  5APV A;  5CCH A;  1RE3 A;  1PFI A;  1DX7 A;  1N7S B;  5CCH D;  1FZE A;  4C7N B;  3RK2 B;  1G2C A;  1T3J A;  1ZR2 A;  1N2D C;  2FFD C;  1VPC A;  1NHL A;  2WWW A;  1JTH B;  3BAS A;  4JYC A;  1GK4 A;  1RF1 C;  3RK3 C;  1FZC B;  2OYH C;  1EQ7 A;  1X79 B;  5KTB A;  5CJ4 A;  1CSB A;  4GT1 A;  2H7H A;  1N7L A;  1LTB C;  1SP4 A;  4Y99 B;  3NMD A;  4KHX A;  1NTK K;  3OAK A;  2HFE D;  1MFZ A;  5KLV K;  1JCC A;  1KIL C;  4IFD K;  1LTI C;  1IFI A;  2WIT A;  2WT7 B;  3OJA B;  1QL2 A;  5APU A;  3T97 A;  4ZKP A;  2PP6 A;  3BAT A;  2A45 I;  1N73 B;  2MJZ A;  3GHG B;  3M91 A;  1H88 A;  4WBA A;  4W80 A;  3VMX A;  2E42 A;  2N1T A;  1YYC A;  2HLO A;  1G1J A;  1H89 A;  2HOD A;  2VRS A;  2KYV A;  1HVV A;  5BVZ A;  2C9N Y;  1XTC C;  2H8P D;  1URQ C;  3U1C A;  2GUV A;  2M3B A;  5AW4 B;  2OYI C;  4O9B A;  4WB4 A;  1FU1 A;  1RY3 A;  2FFD A;  3V2Q A;  4LC1 A;  1RE3 C;  1GU5 A;  3TK1 A;  1L0N K;  3BRV B;  5AVZ B;  3KDP B;  1CI6 A;  1MUU A;  2HYN A;  1HUC A;  1RF1 A;  2OYH A;  3RK3 D;  2C9L Y;  3TNU A;  2W6B A;  1JY3 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...