3MGNA

D-peptide inhibitor pie71 in complex with iqn17
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of a potent D-peptide HIV-1 entry inhibitor with a strong barrier to resistance.
pubmed doi rcsb
molecule tags Viral protein/viral protein inhibitor
molecule keywords IQN17
total genus 20
structure length 45
sequence length 45
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3mgnA00
2YO2A 3SWFA 2Z5HA 3L37A 3MD0A 3HTKA 5APQA 1H89A 2YO3A 3HE5B 3L36A 3L35A 2N9BA 1CI6A 5APWA 2W27A 3O8ZA 1OWAA 3KDPB 3LIDA 2QM7A 2WT7A 2Q3IA 2Q7CA 1H8AA 4C7NA 3VMZA 3VMYA 5AW4B 1GK6A 1HUCA 4EOTA 1A02F 5APXA 3HE5A 4GT1A 3I5CA 4C46A 5CMZA 3TYYA 3OAKA 1T2KD 2E42A 2Q5UA 5AVWB 5AVYB 5AW1B 5AVRB 4HYTB 3M06A 5AW5B 5AVUB 3NMDA 4M3LA 2H7HA 3M9BA 3V4QA 3VN0A 4AQRD 3IR9A 3A5TA 1FOSE 1IO4A 4I2LC 3A3YB 3T97A 2KP8A 1SP4A 3M91A 1GD2E 1CSBA 1YYCA 3M9HA 5APSA 5AVQB 1FOSF 3M0DA 1A02J 3P8MC 2IPPA 2YNYA 4LC1A 1X8YA 2W6AA 4KHXA 5AW7B 1MFZA 2P2UA 2XZRA 3A2AA 4AUWA 2E43A 2R32A 3LIEA 2WTYA 5AVVB 3NXSA 4JYCA 5AW3B 3V5BA 2VRSA 2BASA 1HJBA 1CZQA 2WPSA 4RESB 1MV8A 3B8EB 4AYCA 2P7JA 1GU5A 1G2CB 1HBWA 3TK1A 1KQLA 2C9LY 1OXZA 3P32A 2WT7B 1FAVA 3MGNA 1DH3A 2WPRA 4JYBA 5AW9B 1JNMA 3NTNA 2R5DA 1CI6B 3A7OA 5AVSB 5AW6B 3M0AA 2R3CA 5APUA 1GK4A 2WPQA 3HE4A 3VMXA 1GTWA 5AW8B 3P7KA 5AVTB 1T2KC 2R5BA 1S9KD 3VYIA 2P67A 1S9KE 3UIAA 5APTA 5AVZB 1MUUA 5AVXB 3VTPC 3TNUA 2ZXEB 4GKGA 4DZOA 1NAFA 1GZLA 3V4WA 2JJLA 2Z5IA 5APYA 2ZFCA 4XE5B 5AW2B 4B86A 1NWQA 2XU6A 3HE4B 1H88A 3TNUB 1J2JB 1HWTC 3NFQA 2XV5A 3KQGA 2C9NY 2QM8A 4I6MC 4C7NB 1JUNA 1SLQA 5AW0B 1GU4A 5APVA 2WWWA
chains in the Genus database with same CATH superfamily
3MIWA 1VQ8P 1KZUB 1SQVD 1RF0A 4UB8E 4IL6X 3HTKA 1H89A 1H0TB 1VQNP 3MHVA 3HE5B 3F89A 4NPEA 4R4MA 1NAYA 1CI6A 5APWA 2W27A 2AEJA 2YXQB 4Z1MH 3HTKB 2KS1B 2WPVB 1KYOD 2ZVOB 3S4RA 1L4AD 2IDBA 1KQGB 3CLQA 3CX5D 1FU1A 4BRYA 1M1JA 1FZFA 1IFJA 1PGJA 2KZIA 2P10A 1JY2N 1N7SD 3CX5I 3HUSB 2KNCA 1M56D 3L72D 1J1DB 1U7JA 1JY3N 2BEQD 2D2CB 3E1IA 3VMZA 5AW4B 1NTKG 3A0BE 3II6A 4WVZA 2IX7C 2E75B 3M0DC 1LTJA 3MUDA 1BCCJ 1NU1J 1W5CE 3H32B 1VQ7P 1HVVA 3USSA 3I5CA 5DJTB 3TGUJ 2KSEA 3B71A 2BCCD 4HKZH 5CMZA 1NH4A 3TYYA 1JY2O 3CX5H 1K8AQ 4IFMA 5BU8B 2K9JA 1BE3J 1BE3G 1QGKB 1SQXE 1ZMEC 1HBWA 1U7MA 2O01N 2Q5UA 2JP3A 2K37A 1FJKA 1JCCA 1S5LE 1LWUC 5L8RJ 4ZMDA 1NTMD 1BCCG 4RJTA 1SQBK 4O9BA 2FFDB 1LTAC 2BCCE 3H1JD 3NMDA 2ZXXA 1NTKJ 2GA1A 1SQPJ 1PV3A 2QA4P 3IR9A 3A5TA 4I2LC 3A3YB 4W7YA 4U3FG 3M91A 1KILC 1EDJA 2BCCJ 2OTJP 1YYCA 3SWYA 3M9HA 3T97B 1W2EA 2E74D 1JB0J 4U3FJ 5APSA 1FOSF 3M0DA 5K5GB 2Y9ZA 1SQXG 2L91A 2OYOA 2H8PD 2N1TA 1LTJB 3CX5E 3P8MC 1Q7YQ 1SQXJ 3L71D 3D6YA 3CCJP 1NVOA 2W6AA 4WBAA 4DT0A 2I1KA 1BCCE 1X79B 3AE6C 1ZOYC 3GW6A 2BCCG 3HUSA 3KPEA 1VF5C 1N7SB 1NU1E 2C0XA 2OYHA 1NTMG 2YKPA 3EFGA 4AUWA 2WTYA 5AVVB 1KN7A 2RH0A 1S1CX 4JYCA 1SQPG 4IL6H 3H1IE 1IC2A 3GHGA 3N7NA 2IFMA 2VRSA 1J1EC 1FE6A 3WUVA 2OYIB 3H6PA 3WUTA 2WSSH 1H0TA 1USDA 1S5LX 3AE5C 3AEGC 3GHGC 5EFWB 5TISH 1PIXA 1CZQA 1JCDA 1FDOA 3L70D 4RESB 5CCHA 3CCLP 2XKMA 1YBKA 1KQLA 1L4AB 3OA7A 2C9LY 1OXZA 1T3JA 5KLIC 1M1JC 1DH3A 4NPDA 2WPRA 3TGUG 2O1JA 3K5BA 1NU1G 2AEFA 1QX8A 2NPSA 4PD4E 1BE3E 2E76B 1GL2B 1SQXK 1SS1A 2E5TA 2JR8A 2WPQA 3S9OA 4A7PA 5CCGA 5AW8B 3P7KA 2YXRB 5E79H 1JEKA 3RBZA 1URQD 2D2CC 2J5UA 1VQMP 1JO5A 2GM4A 1OVRA 2ZT9B 4LLHA 5KLVE 3P8CD 3UIAA 3Q5PA 1KYOI 1YITP 1FJPA 1BGYG 1RQVA 2KXPB 2KOGA 3PTZA 1ZRTE 3QWOC 1W2BO 3JC22 2WSCH 3BCCE 4WB4A 1MFTA 1SQQD 3AECC 4L73A 2E76C 2FYUD 3CD6P 2Q9IA 1PP9D 2JO1A 1VQ6P 3U1CA 1QL2A 4PD4H 5KAIH 1NWQA 3A0HH 1OIPA 4JBZA 1PPJE 2CPSA 3CCEP 2XV5A 5KLVK 1KD1Q 4KT0J 2W6JH 1NTZD 1D7MA 1LJ2A 2A45H 2Y0EA 1NU1K 1BSHA 1PGOA 1PL5A 1KILB 1USEA 2QM8A 4XA4A 2G8YA 2KLVA 2KNCB 3OW2O 1SLQA 1SQQJ 1DEEG 3TF5A 3B5NB 4OH8B 3VMAA 2WMMA 1HGVA 1WRGA 2P1JA 3L74J 1SQPD 1RE3A 1OVUA 1QL1A 2B89A 3L70E 4H44B 3L37A 4L76A 4KJMA 3SWFA 3BCCJ 4N78D 3U1AA 4YXDC 4HB1A 1KORA 1OWAA 1RE4A 2B9BA 1JY3P 1E79H 2E75D 3KDPB 3LIDA 3RK3C 1K05A 1VF5B 3AE3C 3A0HE 1NTKK 1VF5D 3C9IA 3G71P 2FKWB 4GOEA 1ZV8A 1NTMK 3BVHA 4GIFA 2YMYA 3PP5A 1M57D 2A06E 3VMYA 3AEEC 4H44C 3MP7B 1KQFB 1VDFA 1PP9J 2DW3A 2FYUJ 5APXA 1EXIA 3L75J 4GT1A 3H1KD 2I8DA 2AXCA 3GHGB 3CCVP 1Q90D 4RKUJ 2OYIA 3L70J 4YPCA 3HD7A 3FWNA 5GTHH 1BGYE 1L4AC 4EDFA 1T2KD 1FZCA 2E42A 1UIXA 3EWKA 4PJ0E 4WWIA 5KLIB 3MZWB 2IZ0A 1EC5A 2M5AA 5AVWB 2FBWC 5AVYB 1HJ0A 1JMMA 1OFCX 5H2FH 1RF1B 2BEZF 1T6AA 4PV1C 1FZEA 3H1JE 2LKMA 5AVUB 1FZGA 2OTKE 4OGQB 4QMAA 2HYNA 4W7ZA 4OGQD 1LT9B 3VN0A 1S3JA 2E76D 3KXDA 3Q3DA 2OTLP 1FOSE 4U7JA 3T97A 1UIIA 1L0ND 1SP4A 1Z56A 1VQ9P 3L72J 2K3RA 1SQXD 4H13C 2A06D 1HGZA 2KI7B 1R8EA 1CW5A 1Y47A 5AVQB 3G3ZA 3H1HJ 1Q81Q 2QIWA 1L0NJ 1P84E 3VP8A 3PHLA 1OZHA 2FYZA 3R2PA 2IPPA 2QJKB 1X8YA 3L73G 1L0NE 2K9YA 2QSIA 3H1HE 4OGQC 2UWJE 2FXMA 2M5AB 1MFZA 1JY3O 3H1JG 1RF0C 3SWKA 1Q2NA 3LIEA 4R4LA 3IF4A 3H1KE 3EQ2A 1AFOA 3KZIH 5AW3B 3B5ND 2ZYGA 1GMJA 1NKNA 2BASA 5KJ7C 2FY8A 1NJIQ 1XTGB 2WITA 3Q5RA 3FWLA 2RN0A 3H1KJ 3SSUA 3AEDC 1L4AA 3RL0g 3B8EB 1FZCC 1WMKA 4H0LC 1G2CA 1SFCD 1NTZJ 1PPJD 3L73E 3TK1A 4AYCA 5KTBA 2QEXP 1S72P 1M7LA 4H44D 2WZ7A 3MGNA 4BWNA 2WT7B 4JYBA 3NTNA 2QJYC 3AEAC 1DD4A 2HG5D 3A7OA 1VQPP 1SQPK 5AW6B 3RK3B 1JM0A 1G1JA 3R4YA 2IYOA 4OVNF 1RHZB 2N1TC 5APUA 5BU5A 1PGQA 1KV4A 2XNDH 3AE9C 3H1LD 3VMXA 1GTWA 3BRVB 1KYOE 1YJ9P 4DOJA 1FS0E 1VQOP 2R5BA 3JCUE 1KC8Q 1URQB 2JWAA 1EDKA 3CCSP 3CWBG 3VYIA 3GG2A 3L74D 1AVYA 1SQBG 1NGMB 3CCRP 1AV1A 1MUUA 1SQVJ 1S2EA 5KAFE 3WUUA 4C7NA 1IZNB 4ASVA 1YHQP 1VQKP 2QJYB 2Y9YA 3O6QB 3VTPC 5KLVJ 2V7QJ 3IAOA 1BE3D 4GKGA 4N6JA 1RE3C 2JJLA 2Z5IA 3CWBD 2ZFCA 5CCGD 5AW2B 4GODA 4PV1B 4Y99C 1H88A 1E5WA 2IFNA 3H1IG 3NFQA 1EZVE 3O6QA 3H1LG 3V2RA 4EIJA 2FFDA 1HWTC 1Y8AA 3AEBC 2M3BA 3P8CE 4PD4D 3A0BH 1JOCA 2SPZA 1QVGO 1L0LG 4I6MC 1NHLA 4H13B 5AW0B 5APVA 1YQ3C 3RK2D 2ZVNB 1IFDA 3RK2B 2YO2A 1JTHB 1NOHA 4D6TG 1GDTA 2Z5HA 1P84I 1T8ZA 1GL2A 1GW4A 3MD0A 1QVFO 2Y0CA 1YTZI 1XTCC 2R44A 1IFPA 3E7KA 5E79E 1N8RQ 4L75A 3L35A 2N9BA 1NO4A 2Y0DA 4JF7A 5GTIE 3O8ZA 2OGUA 3V2NA 1SFCA 4DCKA 4WY4C 4LGDE 3L73D 3H1LE 1EQ7A 1M8OB 1X9VA 3CMAP 2XDJA 4TLFA 3C8VA 5KKZB 1IFNA 3L71J 3L75D 1SFCC 4W80A 3BRTB 2E74C 1GK6A 3AEFC 3JSVC 3E1RA 4L74A 1HUCA 4D6TE 5B5EH 1IK9A 2P58A 3H1ID 3L71E 4YTPC 4EOTA 1A02F 2YMKA 2HFED 1EXJA 1KFNA 1PGPA 4H0LB 3G9RA 3OAKA 4EYYQ 4IOIH 1IJDB 2M3EA 1HTLC 1L0LK 3AE2C 1LTSC 1KB9I 5KKZC 5AVRB 2LR2A 4HYTB 2E74B 2N1TB 2WSCJ 2KK7A 1KFMA 2N1TD 3CCUP 2H7HA 2E75C 2I1JA 3PRJA 1LTTC 2K1AA 2N9YB 4AQRD 3CL3D 4U3FE 3Q2YA 1VQ5P 2KP8A 3L71G 1KQSO 2ZJSE 1FZAA 3HD7C 1KB9H 1DIPA 1GD2E 1Y9BA 1CSBA 3B4SA 2CPBA 3FX0A 1PZQA 5TISE 1BGYD 2HLOA 3D70A 5KJ7A 3CXHH 4EI2A 1A02J 4DJGA 1M1KQ 1VQ4P 1KYOH 1JY2P 1SQVK 2YNYA 3SFEC 3CPWO 2FFDC 3AE4C 2CK3H 3ABVC 2HPCA 4RO0A 5AW7B 2IBZG 2KB7P 2W90A 1U57A 1LP1A 2WSFH 2FYNB 3AE8C 5CCGC 1S5LH 4N78E 1M1JB 3W67A 4D6TJ 2QJPB 1KILD 1LNQA 2E43A 3CMEP 1SQVE 3HD7B 1NTME 1SQPE 2AXTE 2V4HA 1NTZK 2WQYC 3CXHI 3GF3A 3KYQA 3NXSA 4PD4I 2KYVA 4XFJA 4Y28J 3V5BA 1OW8A 2M0BA 4I7ZB 2A45I 2NPSB 3H1LJ 4JQ0D 2NPSD 3CC7P 1M90Q 3H1IJ 4WY4D 1IFMA 1AA0A 1N2DC 2ITAA 1HJBA 4CPGA 1GW3A 1IK7A 3CXHD 2YKOA 4OWFA 1JMBA 2PFXA 1N7SA 3B5NA 1G2CB 1OVVA 4WY4A 2JKVA 3EFFK 2KUBA 3RL0D 4BXLA 3RL0B 2QRXA 4N3YB 1YIJP 1FAVA 5AW9B 1JNMA 4ZKPA 2R5DA 2G3AA 3BATA 4UB6H 3TGUE 3L72E 3D71A 2O1KA 2IBZD 1G1IA 1SQVG 2ZT9D 5AVSB 2XNXA 1BDCA 1OW7A 2OQQA 1LGHB 1GK4A 1SQBJ 2QVAA 3HE4A 4K35A 5M1BA 3CWBJ 1ZR4A 1JTHA 2B88A 1LT9C 3HUSC 4UB8H 2POHA 3GF7A 1NKZB 2YIUC 2YKQA 2OARA 4H0LD 5KLVD 3PH0A 3U59A 2PAJA 2P67A 2Q3EA 1S9KE 5CBOA 1LT9A 5APTA 3KHUA 5AVZB 1NTKE 4HJGH 2Q1KA 1AQ5A 3ITKA 2HODB 3BCCD 4PV1D 2J59M 3CCMP 3M9QA 2RKLA 1R5SA 1ZRTD 1DEBA 3TDKA 4NPFX 3KZIE 1ZR2A 1EDLA 1PFIA 3G6EP 2J58A 1DD3A 2O01J 1AQTA 4HH2A 5B66H 2MJZA 1RF1A 1EZVI 5CJ0A 2FYUE 5APYA 3V4WA 2IYPA 2QE7H 4XE5B 2KLUA 3HD7D 1LWUB 4B86A 1N73A 3AE7C 1L0LJ 2YIUB 4C7RA 3H1KG 2LXCB 1YQ4C 1J2JB 1QLED 2KIKA 2ZT9C 3KQGA 1YI2P 1NTKD 3FGAD 3F5HA 2C9NY 3CC2P 1KB9D 5CJ4A 2L5GB 2LXBA 2MKVA 4C7NB 5CCHC 1R5LA 4H13D 4IFFA 1RY3A 2WWWA 1Q86Q 3H1JJ 5TJHA 1GU4A 1FZCB 2FYUK 1EDIA 1N7LA 1LTJC 1ZW0A 3MUDC 5APQA 3L74E 2YO3A 1LTBC 2Q6QA 1MKMA 1RQUA 1LT1A 1RH5B 1ZXGA 3JCUH 3L36A 3TGUD 3I56P 1KTMA 3G4SP 1FDIA 3V2QA 2QM7A 3W68A 1L2PA 2FYNC 4GDOA 2Q3IA 5KAIE 2Q7CA 2WT7A 3IFMA 2QJPC 2O01H 2W6BA 1DX7A 3L72G 3CXHE 1H8AA 3H32A 1NU1D 2H43A 1YTZT 2OYIC 3B5NC 3LW5J 1SQBE 1J1EB 1FDMA 2R3SA 1GL2D 2A45G 2W83C 2ZYAA 3HE5A 4U3FD 1SVFA 2JEEA 1ZP0C 1P84D 2ZYDA 4C46A 1KILE 3BASA 2AXTH 1WT6A 2OYHB 3RL0C 1NTZG 2NZ2A 2IBZI 2KSJA 1SQQK 1YJNP 4ZKUA 5AW1B 1N73C 3QH9A 3WMM0 1X0TA 1N86A 3TSIA 2QJKC 3M06A 5AW5B 3VOPA 1GL2C 2FYUG 2GUSA 4M3LA 2V7QH 2IZ1A 3M9BA 3CCQP 1X22A 3V4QA 3C1LA 1BCCD 1IO4A 1QEXA 3H1HD 1FZBA 2O3JA 1VPCA 2K88A 5GTIH 1ZN5A 4UB6E 2K9JB 1SQBD 1Q82Q 1ZLLA 3WU2H 1YJWP 2PP6A 5KLVG 3L73J 1RF1C 3S1KA 1K9MQ 1L0NG 4LC1A 3BCCG 4TT3H 3H1HG 3GMAA 5B5EE 2C0WA 4KHXA 5H2FE 4GOFA 3L74G 5CBNA 4WY4B 3OJAB 2KZJA 2XZRA 3A2AA 3L75E 5CCHD 2R32A 2WVRA 1OX3A 4BRYB 3HRNA 2RMZA 1SFCB 2KS1A 5CHXA 1PPJG 1J1DC 3FXDA 4JPZB 5C39A 4D6TD 1MZ9A 3I55P 1BSNA 5B66E 3Q1MA 1VQLP 4I1LA 3FXEA 1LTIC 3PLNA 3V6IA 4ZNCA 5KAFH 3WU2E 3RK3D 2WPSA 1GU5A 1MV8A 1URQC 2D2CD 2NRGA 2P7JA 2E5YA 1BDDA 1P84H 5DJUB 1HF9A 2JWDA 2PRRA 3LW5H 2Z4EA 3P32A 1KILA 3L70G 3IN6A 1K04A 3RGUA 2QG4A 2HPCB 3V2PA 1KB9E 1K73Q 3L75G 1CI6B 1FC2C 1AVOA 1S4XA 1L0LD 1NTZE 2GUVA 1L0NK 1PP9G 2M8RA 2WSEH 1BGYJ 3M0AA 3N4XA 1SQQE 2R3CA 5KJ7D 1OW6A 4ASWA 1OMIA 2AEMA 1LWUA 3AE1C 1VL2A 2JDIH 5AVTB 4Y99B 1T2KC 1LP1B 1LTGC 3CWBE 1S9KD 3Q5SA 2H89C 1IFIA 2A06G 3CC4P 3GLMA 1EZVD 3H25A 1T3UA 5BVZA 5AVXB 2H88C 2ZAEB 2B87A 1FBMA 4IL6E 3TNUA 3ZDMA 2OYHC 2ZXEB 2IBZE 1URQA 3L4FA 3MTUE 4DZOA 3D6ZA 3RK2C 1NAFA 1GZLA 1PP9E 2PGDA 4YXWH 1N73B 1SQQG 1KMIZ 4K3AA 2W8ZA 1N7SC 2XU6A 2HR3A 3HE4B 1TU3F 2B87B 1EZVG 3SFDC 3TNUB 1AJYA 4IFDK 3VP9A 1RE4C 2HODA 3RK3E 5GTHE 2WSEJ 2FXPA 4I7ZC 3PJSK 1L0LE 4MN4C 2NPSC 4PJ0H 3RBXA 2FXOA 2WSFJ 1NTMJ 1NYHA 1HH0A 3CI9A 1JUNA 2P2UA
chains in the Genus database with same CATH topology
3MIWA 1KZUB 1RF0A 3HTKA 1H89A 3HE5B 5APWA 1CI6A 2W27A 3HTKB 1L4AD 3CLQA 1FU1A 1M1JA 1FZFA 1IFJA 3HUSB 1JY2N 1N7SD 4C7NA 3VMZA 1J1DB 3E1IA 1JY3N 5AW4B 3II6A 2IX7C 3M0DC 1LTJA 3MUDA 1HVVA 3I5CA 5CMZA 3TYYA 1NH4A 1JY2O 4IFMA 5BU8B 2Q5UA 1FJKA 1JCCA 1LWUC 1SQBK 4O9BA 2FFDB 1LTAC 3NMDA 3IR9A 3A5TA 4I2LC 3A3YB 4W7YA 3M91A 1KILC 1YYCA 3SWYA 3M9HA 1W2EA 5APSA 1FOSF 3M0DA 3P8MC 2H8PD 2N1TA 1LTJB 2W6AA 4WBAA 2I1KA 1X79B 3HUSA 3KPEA 1N7SB 2C0XA 4AUWA 2OYHA 2YKPA 3EFGA 2WTYA 5AVVB 4JYCA 1IC2A 3GHGA 3N7NA 2IFMA 2VRSA 1J1EC 2OYIB 3H6PA 3GHGC 1CZQA 1JCDA 4RESB 5CCHA 2XKMA 1KQLA 1L4AB 3OA7A 2C9LY 1OXZA 1T3JA 1M1JC 1DH3A 2WPRA 2O1JA 2NPSA 1GL2B 1SQXK 2WPQA 5CCGA 5AW8B 3P7KA 1URQD 1JO5A 2GM4A 4LLHA 3P8CD 3UIAA 1FJPA 2KOGA 2WSCH 4WB4A 2Q9IA 3U1CA 1QL2A 1NWQA 2CPSA 2XV5A 5KLVK 2A45H 1NU1K 1KILB 2QM8A 4XA4A 2KLVA 1SLQA 3B5NB 4OH8B 1HGVA 1WRGA 2P1JA 1RE3A 1QL1A 3SWFA 3L37A 4N78D 3U1AA 1OWAA 1RE4A 3KDPB 1JY3P 3LIDA 3RK3C 1NTKK 3C9IA 2FKWB 1ZV8A 1NTMK 3BVHA 4GIFA 2YMYA 3PP5A 3VMYA 1VDFA 5APXA 4GT1A 3GHGB 2OYIA 3HD7A 1L4AC 1T2KD 1FZCA 2E42A 5AVWB 5AVYB 1RF1B 1JMMA 1FZEA 2LKMA 5AVUB 1FZGA 2HYNA 4W7ZA 1LT9B 3VN0A 1FOSE 3T97A 1Z56A 1SP4A 1HGZA 1CW5A 5AVQB 3G3ZA 3VP8A 2FYZA 3R2PA 2IPPA 1X8YA 2FXMA 1MFZA 1JY3O 1RF0C 3LIEA 3EQ2A 1AFOA 5AW3B 3B5ND 2BASA 1NKNA 5KJ7C 1XTGB 2WITA 1L4AA 1FZCC 3B8EB 4AYCA 5KTBA 1G2CA 1SFCD 1HBWA 3TK1A 1M7LA 2WT7B 2WZ7A 3MGNA 4JYBA 3NTNA 2HG5D 3A7OA 1SQPK 5AW6B 3RK3B 1G1JA 5BU5A 5APUA 2N1TC 3VMXA 1GTWA 3BRVB 4DOJA 2R5BA 1URQB 3VYIA 1MUUA 3VTPC 4GKGA 4N6JA 1RE3C 2JJLA 2Z5IA 2ZFCA 5CCGD 5AW2B 4Y99C 1H88A 1E5WA 2IFNA 1HWTC 3NFQA 3V2RA 4EIJA 2FFDA 2M3BA 3P8CE 1JOCA 4I6MC 1NHLA 5AW0B 5APVA 3RK2D 1IFDA 3RK2B 2YO2A 1JTHB 1NOHA 1GDTA 2Z5HA 1T8ZA 3MD0A 1GL2A 1GW4A 1YTZI 1XTCC 3L35A 2N9BA 1NO4A 4JF7A 3O8ZA 3V2NA 1SFCA 4WY4C 4LGDE 1EQ7A 1X9VA 2XDJA 1IFNA 1SFCC 4W80A 3BRTB 1GK6A 1HUCA 4EOTA 1A02F 1IK9A 2HFED 1KFNA 3OAKA 1IJDB 1HTLC 1L0LK 1LTSC 5AVRB 4HYTB 2N1TB 1KFMA 2N1TD 2H7HA 2I1JA 1LTTC 4AQRD 3CL3D 2KP8A 1FZAA 3HD7C 1GD2E 1CSBA 2CPBA 2HLOA 5KJ7A 1A02J 1JY2P 1SQVK 2YNYA 2FFDC 2HPCA 5AW7B 2KB7P 2WSFH 5CCGC 4N78E 1M1JB 2E43A 1KILD 3HD7B 3NXSA 3KYQA 1NTZK 2KYVA 3V5BA 2A45I 2NPSB 2NPSD 4WY4D 1IFMA 1N2DC 1HJBA 1GW3A 2YKOA 3B5NA 1N7SA 1G2CB 5BVZA 4WY4A 3RL0D 3RL0B 4N3YB 1FAVA 5AW9B 1JNMA 4ZKPA 2R5DA 3BATA 2O1KA 1G1IA 5AVSB 2XNXA 1LGHB 1GK4A 1ZR4A 3HE4A 1JTHA 3HUSC 1LT9C 2POHA 1NKZB 2YKQA 2OARA 3U59A 2PAJA 2P67A 1S9KE 1LT9A 5APTA 5AVZB 1AQ5A 2HODB 2J59M 3M9QA 1ZR2A 1DEBA 1PFIA 2J58A 1RF1A 4HH2A 2MJZA 3V4WA 5CJ0A 5APYA 4XE5B 3HD7D 4B86A 1LWUB 1N73A 4C7RA 1J2JB 3KQGA 2C9NY 5CJ4A 2L5GB 4C7NB 5CCHC 4IFFA 1GU4A 1RY3A 2WWWA 1FZCB 2FYUK 1N7LA 1LTJC 5APQA 2YO3A 1LTBC 3L36A 3V2QA 2QM7A 2WT7A 2Q3IA 2Q7CA 3IFMA 2O01H 2W6BA 1DX7A 1H8AA 3H32A 2H43A 1YTZT 2OYIC 3B5NC 1J1EB 1FDMA 1GL2D 2A45G 3HE5A 1SVFA 2JEEA 4C46A 3BASA 1WT6A 2OYHB 3RL0C 2KSJA 1SQQK 1N73C 4ZKUA 5AW1B 3WMM0 3TSIA 1N86A 3M06A 5AW5B 3VOPA 1GL2C 2GUSA 4M3LA 3M9BA 3V4QA 1IO4A 1FZBA 1VPCA 1ZN5A 1ZLLA 2PP6A 1RF1C 4LC1A 2C0WA 4KHXA 4WY4B 3OJAB 2XZRA 3A2AA 5CCHD 2R32A 3HRNA 1SFCB 5CHXA 1J1DC 1MZ9A 4I1LA 1LTIC 3RK3D 2WPSA 1GU5A 1MV8A 1URQC 2P7JA 3LW5H 2Z4EA 3P32A 1KILA 2HPCB 3V2PA 1CI6B 2GUVA 2M8RA 2WSEH 1L0NK 3M0AA 5KJ7D 3N4XA 2R3CA 1LWUA 5AVTB 4Y99B 1T2KC 1LTGC 1S9KD 1IFIA 1T3UA 5AVXB 3TNUA 1FBMA 2OYHC 2ZXEB 1URQA 3L4FA 3MTUE 4DZOA 1N73B 3RK2C 1NAFA 1GZLA 1N7SC 2XU6A 3HE4B 3TNUB 4IFDK 3VP9A 1RE4C 2HODA 2NPSC 3H32B 1HH0A 3CI9A 1JUNA 2P2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YO2 A;  3SWF A;  2Z5H A;  3L37 A;  3MD0 A;  3HTK A;  5APQ A;  1H89 A;  2YO3 A;  3HE5 B;  3L36 A;  3L35 A;  2N9B A;  1CI6 A;  5APW A;  2W27 A;  3O8Z A;  1OWA A;  3KDP B;  3LID A;  2QM7 A;  2WT7 A;  2Q3I A;  2Q7C A;  1H8A A;  4C7N A;  3VMZ A;  3VMY A;  5AW4 B;  1GK6 A;  1HUC A;  4EOT A;  1A02 F;  5APX A;  3HE5 A;  4GT1 A;  3I5C A;  4C46 A;  5CMZ A;  3TYY A;  3OAK A;  1T2K D;  2E42 A;  2Q5U A;  5AVW B;  5AVY B;  5AW1 B;  5AVR B;  4HYT B;  3M06 A;  5AW5 B;  5AVU B;  3NMD A;  4M3L A;  2H7H A;  3M9B A;  3V4Q A;  3VN0 A;  4AQR D;  3IR9 A;  3A5T A;  1FOS E;  1IO4 A;  4I2L C;  3A3Y B;  3T97 A;  2KP8 A;  1SP4 A;  3M91 A;  1GD2 E;  1CSB A;  1YYC A;  3M9H A;  5APS A;  5AVQ B;  1FOS F;  3M0D A;  1A02 J;  3P8M C;  2IPP A;  2YNY A;  4LC1 A;  1X8Y A;  2W6A A;  4KHX A;  5AW7 B;  1MFZ A;  2P2U A;  2XZR A;  3A2A A;  4AUW A;  2E43 A;  2R32 A;  3LIE A;  2WTY A;  5AVV B;  3NXS A;  4JYC A;  5AW3 B;  3V5B A;  2VRS A;  2BAS A;  1HJB A;  1CZQ A;  2WPS A;  4RES B;  1MV8 A;  3B8E B;  4AYC A;  2P7J A;  1GU5 A;  1G2C B;  1HBW A;  3TK1 A;  1KQL A;  2C9L Y;  1OXZ A;  3P32 A;  2WT7 B;  1FAV A;  3MGN A;  1DH3 A;  2WPR A;  4JYB A;  5AW9 B;  1JNM A;  3NTN A;  2R5D A;  1CI6 B;  3A7O A;  5AVS B;  5AW6 B;  3M0A A;  2R3C A;  5APU A;  1GK4 A;  2WPQ A;  3HE4 A;  3VMX A;  1GTW A;  5AW8 B;  3P7K A;  5AVT B;  1T2K C;  2R5B A;  1S9K D;  3VYI A;  2P67 A;  1S9K E;  3UIA A;  5APT A;  5AVZ B;  1MUU A;  5AVX B;  3VTP C;  3TNU A;  2ZXE B;  4GKG A;  4DZO A;  1NAF A;  1GZL A;  3V4W A;  2JJL A;  2Z5I A;  5APY A;  2ZFC A;  4XE5 B;  5AW2 B;  4B86 A;  1NWQ A;  2XU6 A;  3HE4 B;  1H88 A;  3TNU B;  1J2J B;  1HWT C;  3NFQ A;  2XV5 A;  3KQG A;  2C9N Y;  2QM8 A;  4I6M C;  4C7N B;  1JUN A;  1SLQ A;  5AW0 B;  1GU4 A;  5APV A;  2WWW A; 
#chains in the Genus database with same CATH topology
 3MIW A;  1VQ8 P;  1KZU B;  1SQV D;  1RF0 A;  4UB8 E;  4IL6 X;  3HTK A;  1H89 A;  1H0T B;  1VQN P;  3MHV A;  3HE5 B;  3F89 A;  4NPE A;  4R4M A;  1NAY A;  1CI6 A;  5APW A;  2W27 A;  2AEJ A;  2YXQ B;  4Z1M H;  3HTK B;  2KS1 B;  2WPV B;  1KYO D;  2ZVO B;  3S4R A;  1L4A D;  2IDB A;  1KQG B;  3CLQ A;  3CX5 D;  1FU1 A;  4BRY A;  1M1J A;  1FZF A;  1IFJ A;  1PGJ A;  2KZI A;  2P10 A;  1JY2 N;  1N7S D;  3CX5 I;  3HUS B;  2KNC A;  1M56 D;  3L72 D;  1J1D B;  1U7J A;  1JY3 N;  2BEQ D;  2D2C B;  3E1I A;  3VMZ A;  5AW4 B;  1NTK G;  3A0B E;  3II6 A;  4WVZ A;  2IX7 C;  2E75 B;  3M0D C;  1LTJ A;  3MUD A;  1BCC J;  1NU1 J;  1W5C E;  3H32 B;  1VQ7 P;  1HVV A;  3USS A;  3I5C A;  5DJT B;  3TGU J;  2KSE A;  3B71 A;  2BCC D;  4HKZ H;  5CMZ A;  1NH4 A;  3TYY A;  1JY2 O;  3CX5 H;  1K8A Q;  4IFM A;  5BU8 B;  2K9J A;  1BE3 J;  1BE3 G;  1QGK B;  1SQX E;  1ZME C;  1HBW A;  1U7M A;  2O01 N;  2Q5U A;  2JP3 A;  2K37 A;  1FJK A;  1JCC A;  1S5L E;  1LWU C;  5L8R J;  4ZMD A;  1NTM D;  1BCC G;  4RJT A;  1SQB K;  4O9B A;  2FFD B;  1LTA C;  2BCC E;  3H1J D;  3NMD A;  2ZXX A;  1NTK J;  2GA1 A;  1SQP J;  1PV3 A;  2QA4 P;  3IR9 A;  3A5T A;  4I2L C;  3A3Y B;  4W7Y A;  4U3F G;  3M91 A;  1KIL C;  1EDJ A;  2BCC J;  2OTJ P;  1YYC A;  3SWY A;  3M9H A;  3T97 B;  1W2E A;  2E74 D;  1JB0 J;  4U3F J;  5APS A;  1FOS F;  3M0D A;  5K5G B;  2Y9Z A;  1SQX G;  2L91 A;  2OYO A;  2H8P D;  2N1T A;  1LTJ B;  3CX5 E;  3P8M C;  1Q7Y Q;  1SQX J;  3L71 D;  3D6Y A;  3CCJ P;  1NVO A;  2W6A A;  4WBA A;  4DT0 A;  2I1K A;  1BCC E;  1X79 B;  3AE6 C;  1ZOY C;  3GW6 A;  2BCC G;  3HUS A;  3KPE A;  1VF5 C;  1N7S B;  1NU1 E;  2C0X A;  2OYH A;  1NTM G;  2YKP A;  3EFG A;  4AUW A;  2WTY A;  5AVV B;  1KN7 A;  2RH0 A;  1S1C X;  4JYC A;  1SQP G;  4IL6 H;  3H1I E;  1IC2 A;  3GHG A;  3N7N A;  2IFM A;  2VRS A;  1J1E C;  1FE6 A;  3WUV A;  2OYI B;  3H6P A;  3WUT A;  2WSS H;  1H0T A;  1USD A;  1S5L X;  3AE5 C;  3AEG C;  3GHG C;  5EFW B;  5TIS H;  1PIX A;  1CZQ A;  1JCD A;  1FDO A;  3L70 D;  4RES B;  5CCH A;  3CCL P;  2XKM A;  1YBK A;  1KQL A;  1L4A B;  3OA7 A;  2C9L Y;  1OXZ A;  1T3J A;  5KLI C;  1M1J C;  1DH3 A;  4NPD A;  2WPR A;  3TGU G;  2O1J A;  3K5B A;  1NU1 G;  2AEF A;  1QX8 A;  2NPS A;  4PD4 E;  1BE3 E;  2E76 B;  1GL2 B;  1SQX K;  1SS1 A;  2E5T A;  2JR8 A;  2WPQ A;  3S9O A;  4A7P A;  5CCG A;  5AW8 B;  3P7K A;  2YXR B;  5E79 H;  1JEK A;  3RBZ A;  1URQ D;  2D2C C;  2J5U A;  1VQM P;  1JO5 A;  2GM4 A;  1OVR A;  2ZT9 B;  4LLH A;  5KLV E;  3P8C D;  3UIA A;  3Q5P A;  1KYO I;  1YIT P;  1FJP A;  1BGY G;  1RQV A;  2KXP B;  2KOG A;  3PTZ A;  1ZRT E;  3QWO C;  1W2B O;  3JC2 2;  2WSC H;  3BCC E;  4WB4 A;  1MFT A;  1SQQ D;  3AEC C;  4L73 A;  2E76 C;  2FYU D;  3CD6 P;  2Q9I A;  1PP9 D;  2JO1 A;  1VQ6 P;  3U1C A;  1QL2 A;  4PD4 H;  5KAI H;  1NWQ A;  3A0H H;  1OIP A;  4JBZ A;  1PPJ E;  2CPS A;  3CCE P;  2XV5 A;  5KLV K;  1KD1 Q;  4KT0 J;  2W6J H;  1NTZ D;  1D7M A;  1LJ2 A;  2A45 H;  2Y0E A;  1NU1 K;  1BSH A;  1PGO A;  1PL5 A;  1KIL B;  1USE A;  2QM8 A;  4XA4 A;  2G8Y A;  2KLV A;  2KNC B;  3OW2 O;  1SLQ A;  1SQQ J;  1DEE G;  3TF5 A;  3B5N B;  4OH8 B;  3VMA A;  2WMM A;  1HGV A;  1WRG A;  2P1J A;  3L74 J;  1SQP D;  1RE3 A;  1OVU A;  1QL1 A;  2B89 A;  3L70 E;  4H44 B;  3L37 A;  4L76 A;  4KJM A;  3SWF A;  3BCC J;  4N78 D;  3U1A A;  4YXD C;  4HB1 A;  1KOR A;  1OWA A;  1RE4 A;  2B9B A;  1JY3 P;  1E79 H;  2E75 D;  3KDP B;  3LID A;  3RK3 C;  1K05 A;  1VF5 B;  3AE3 C;  3A0H E;  1NTK K;  1VF5 D;  3C9I A;  3G71 P;  2FKW B;  4GOE A;  1ZV8 A;  1NTM K;  3BVH A;  4GIF A;  2YMY A;  3PP5 A;  1M57 D;  2A06 E;  3VMY A;  3AEE C;  4H44 C;  3MP7 B;  1KQF B;  1VDF A;  1PP9 J;  2DW3 A;  2FYU J;  5APX A;  1EXI A;  3L75 J;  4GT1 A;  3H1K D;  2I8D A;  2AXC A;  3GHG B;  3CCV P;  1Q90 D;  4RKU J;  2OYI A;  3L70 J;  4YPC A;  3HD7 A;  3FWN A;  5GTH H;  1BGY E;  1L4A C;  4EDF A;  1T2K D;  1FZC A;  2E42 A;  1UIX A;  3EWK A;  4PJ0 E;  4WWI A;  5KLI B;  3MZW B;  2IZ0 A;  1EC5 A;  2M5A A;  5AVW B;  2FBW C;  5AVY B;  1HJ0 A;  1JMM A;  1OFC X;  5H2F H;  1RF1 B;  2BEZ F;  1T6A A;  4PV1 C;  1FZE A;  3H1J E;  2LKM A;  5AVU B;  1FZG A;  2OTK E;  4OGQ B;  4QMA A;  2HYN A;  4W7Z A;  4OGQ D;  1LT9 B;  3VN0 A;  1S3J A;  2E76 D;  3KXD A;  3Q3D A;  2OTL P;  1FOS E;  4U7J A;  3T97 A;  1UII A;  1L0N D;  1SP4 A;  1Z56 A;  1VQ9 P;  3L72 J;  2K3R A;  1SQX D;  4H13 C;  2A06 D;  1HGZ A;  2KI7 B;  1R8E A;  1CW5 A;  1Y47 A;  5AVQ B;  3G3Z A;  3H1H J;  1Q81 Q;  2QIW A;  1L0N J;  1P84 E;  3VP8 A;  3PHL A;  1OZH A;  2FYZ A;  3R2P A;  2IPP A;  2QJK B;  1X8Y A;  3L73 G;  1L0N E;  2K9Y A;  2QSI A;  3H1H E;  4OGQ C;  2UWJ E;  2FXM A;  2M5A B;  1MFZ A;  1JY3 O;  3H1J G;  1RF0 C;  3SWK A;  1Q2N A;  3LIE A;  4R4L A;  3IF4 A;  3H1K E;  3EQ2 A;  1AFO A;  3KZI H;  5AW3 B;  3B5N D;  2ZYG A;  1GMJ A;  1NKN A;  2BAS A;  5KJ7 C;  2FY8 A;  1NJI Q;  1XTG B;  2WIT A;  3Q5R A;  3FWL A;  2RN0 A;  3H1K J;  3SSU A;  3AED C;  1L4A A;  3RL0 g;  3B8E B;  1FZC C;  1WMK A;  4H0L C;  1G2C A;  1SFC D;  1NTZ J;  1PPJ D;  3L73 E;  3TK1 A;  4AYC A;  5KTB A;  2QEX P;  1S72 P;  1M7L A;  4H44 D;  2WZ7 A;  3MGN A;  4BWN A;  2WT7 B;  4JYB A;  3NTN A;  2QJY C;  3AEA C;  1DD4 A;  2HG5 D;  3A7O A;  1VQP P;  1SQP K;  5AW6 B;  3RK3 B;  1JM0 A;  1G1J A;  3R4Y A;  2IYO A;  4OVN F;  1RHZ B;  2N1T C;  5APU A;  5BU5 A;  1PGQ A;  1KV4 A;  2XND H;  3AE9 C;  3H1L D;  3VMX A;  1GTW A;  3BRV B;  1KYO E;  1YJ9 P;  4DOJ A;  1FS0 E;  1VQO P;  2R5B A;  3JCU E;  1KC8 Q;  1URQ B;  2JWA A;  1EDK A;  3CCS P;  3CWB G;  3VYI A;  3GG2 A;  3L74 D;  1AVY A;  1SQB G;  1NGM B;  3CCR P;  1AV1 A;  1MUU A;  1SQV J;  1S2E A;  5KAF E;  3WUU A;  4C7N A;  1IZN B;  4ASV A;  1YHQ P;  1VQK P;  2QJY B;  2Y9Y A;  3O6Q B;  3VTP C;  5KLV J;  2V7Q J;  3IAO A;  1BE3 D;  4GKG A;  4N6J A;  1RE3 C;  2JJL A;  2Z5I A;  3CWB D;  2ZFC A;  5CCG D;  5AW2 B;  4GOD A;  4PV1 B;  4Y99 C;  1H88 A;  1E5W A;  2IFN A;  3H1I G;  3NFQ A;  1EZV E;  3O6Q A;  3H1L G;  3V2R A;  4EIJ A;  2FFD A;  1HWT C;  1Y8A A;  3AEB C;  2M3B A;  3P8C E;  4PD4 D;  3A0B H;  1JOC A;  2SPZ A;  1QVG O;  1L0L G;  4I6M C;  1NHL A;  4H13 B;  5AW0 B;  5APV A;  1YQ3 C;  3RK2 D;  2ZVN B;  1IFD A;  3RK2 B;  2YO2 A;  1JTH B;  1NOH A;  4D6T G;  1GDT A;  2Z5H A;  1P84 I;  1T8Z A;  1GL2 A;  1GW4 A;  3MD0 A;  1QVF O;  2Y0C A;  1YTZ I;  1XTC C;  2R44 A;  1IFP A;  3E7K A;  5E79 E;  1N8R Q;  4L75 A;  3L35 A;  2N9B A;  1NO4 A;  2Y0D A;  4JF7 A;  5GTI E;  3O8Z A;  2OGU A;  3V2N A;  1SFC A;  4DCK A;  4WY4 C;  4LGD E;  3L73 D;  3H1L E;  1EQ7 A;  1M8O B;  1X9V A;  3CMA P;  2XDJ A;  4TLF A;  3C8V A;  5KKZ B;  1IFN A;  3L71 J;  3L75 D;  1SFC C;  4W80 A;  3BRT B;  2E74 C;  1GK6 A;  3AEF C;  3JSV C;  3E1R A;  4L74 A;  1HUC A;  4D6T E;  5B5E H;  1IK9 A;  2P58 A;  3H1I D;  3L71 E;  4YTP C;  4EOT A;  1A02 F;  2YMK A;  2HFE D;  1EXJ A;  1KFN A;  1PGP A;  4H0L B;  3G9R A;  3OAK A;  4EYY Q;  4IOI H;  1IJD B;  2M3E A;  1HTL C;  1L0L K;  3AE2 C;  1LTS C;  1KB9 I;  5KKZ C;  5AVR B;  2LR2 A;  4HYT B;  2E74 B;  2N1T B;  2WSC J;  2KK7 A;  1KFM A;  2N1T D;  3CCU P;  2H7H A;  2E75 C;  2I1J A;  3PRJ A;  1LTT C;  2K1A A;  2N9Y B;  4AQR D;  3CL3 D;  4U3F E;  3Q2Y A;  1VQ5 P;  2KP8 A;  3L71 G;  1KQS O;  2ZJS E;  1FZA A;  3HD7 C;  1KB9 H;  1DIP A;  1GD2 E;  1Y9B A;  1CSB A;  3B4S A;  2CPB A;  3FX0 A;  1PZQ A;  5TIS E;  1BGY D;  2HLO A;  3D70 A;  5KJ7 A;  3CXH H;  4EI2 A;  1A02 J;  4DJG A;  1M1K Q;  1VQ4 P;  1KYO H;  1JY2 P;  1SQV K;  2YNY A;  3SFE C;  3CPW O;  2FFD C;  3AE4 C;  2CK3 H;  3ABV C;  2HPC A;  4RO0 A;  5AW7 B;  2IBZ G;  2KB7 P;  2W90 A;  1U57 A;  1LP1 A;  2WSF H;  2FYN B;  3AE8 C;  5CCG C;  1S5L H;  4N78 E;  1M1J B;  3W67 A;  4D6T J;  2QJP B;  1KIL D;  1LNQ A;  2E43 A;  3CME P;  1SQV E;  3HD7 B;  1NTM E;  1SQP E;  2AXT E;  2V4H A;  1NTZ K;  2WQY C;  3CXH I;  3GF3 A;  3KYQ A;  3NXS A;  4PD4 I;  2KYV A;  4XFJ A;  4Y28 J;  3V5B A;  1OW8 A;  2M0B A;  4I7Z B;  2A45 I;  2NPS B;  3H1L J;  4JQ0 D;  2NPS D;  3CC7 P;  1M90 Q;  3H1I J;  4WY4 D;  1IFM A;  1AA0 A;  1N2D C;  2ITA A;  1HJB A;  4CPG A;  1GW3 A;  1IK7 A;  3CXH D;  2YKO A;  4OWF A;  1JMB A;  2PFX A;  1N7S A;  3B5N A;  1G2C B;  1OVV A;  4WY4 A;  2JKV A;  3EFF K;  2KUB A;  3RL0 D;  4BXL A;  3RL0 B;  2QRX A;  4N3Y B;  1YIJ P;  1FAV A;  5AW9 B;  1JNM A;  4ZKP A;  2R5D A;  2G3A A;  3BAT A;  4UB6 H;  3TGU E;  3L72 E;  3D71 A;  2O1K A;  2IBZ D;  1G1I A;  1SQV G;  2ZT9 D;  5AVS B;  2XNX A;  1BDC A;  1OW7 A;  2OQQ A;  1LGH B;  1GK4 A;  1SQB J;  2QVA A;  3HE4 A;  4K35 A;  5M1B A;  3CWB J;  1ZR4 A;  1JTH A;  2B88 A;  1LT9 C;  3HUS C;  4UB8 H;  2POH A;  3GF7 A;  1NKZ B;  2YIU C;  2YKQ A;  2OAR A;  4H0L D;  5KLV D;  3PH0 A;  3U59 A;  2PAJ A;  2P67 A;  2Q3E A;  1S9K E;  5CBO A;  1LT9 A;  5APT A;  3KHU A;  5AVZ B;  1NTK E;  4HJG H;  2Q1K A;  1AQ5 A;  3ITK A;  2HOD B;  3BCC D;  4PV1 D;  2J59 M;  3CCM P;  3M9Q A;  2RKL A;  1R5S A;  1ZRT D;  1DEB A;  3TDK A;  4NPF X;  3KZI E;  1ZR2 A;  1EDL A;  1PFI A;  3G6E P;  2J58 A;  1DD3 A;  2O01 J;  1AQT A;  4HH2 A;  5B66 H;  2MJZ A;  1RF1 A;  1EZV I;  5CJ0 A;  2FYU E;  5APY A;  3V4W A;  2IYP A;  2QE7 H;  4XE5 B;  2KLU A;  3HD7 D;  1LWU B;  4B86 A;  1N73 A;  3AE7 C;  1L0L J;  2YIU B;  4C7R A;  3H1K G;  2LXC B;  1YQ4 C;  1J2J B;  1QLE D;  2KIK A;  2ZT9 C;  3KQG A;  1YI2 P;  1NTK D;  3FGA D;  3F5H A;  2C9N Y;  3CC2 P;  1KB9 D;  5CJ4 A;  2L5G B;  2LXB A;  2MKV A;  4C7N B;  5CCH C;  1R5L A;  4H13 D;  4IFF A;  1RY3 A;  2WWW A;  1Q86 Q;  3H1J J;  5TJH A;  1GU4 A;  1FZC B;  2FYU K;  1EDI A;  1N7L A;  1LTJ C;  1ZW0 A;  3MUD C;  5APQ A;  3L74 E;  2YO3 A;  1LTB C;  2Q6Q A;  1MKM A;  1RQU A;  1LT1 A;  1RH5 B;  1ZXG A;  3JCU H;  3L36 A;  3TGU D;  3I56 P;  1KTM A;  3G4S P;  1FDI A;  3V2Q A;  2QM7 A;  3W68 A;  1L2P A;  2FYN C;  4GDO A;  2Q3I A;  5KAI E;  2Q7C A;  2WT7 A;  3IFM A;  2QJP C;  2O01 H;  2W6B A;  1DX7 A;  3L72 G;  3CXH E;  1H8A A;  3H32 A;  1NU1 D;  2H43 A;  1YTZ T;  2OYI C;  3B5N C;  3LW5 J;  1SQB E;  1J1E B;  1FDM A;  2R3S A;  1GL2 D;  2A45 G;  2W83 C;  2ZYA A;  3HE5 A;  4U3F D;  1SVF A;  2JEE A;  1ZP0 C;  1P84 D;  2ZYD A;  4C46 A;  1KIL E;  3BAS A;  2AXT H;  1WT6 A;  2OYH B;  3RL0 C;  1NTZ G;  2NZ2 A;  2IBZ I;  2KSJ A;  1SQQ K;  1YJN P;  4ZKU A;  5AW1 B;  1N73 C;  3QH9 A;  3WMM 0;  1X0T A;  1N86 A;  3TSI A;  2QJK C;  3M06 A;  5AW5 B;  3VOP A;  1GL2 C;  2FYU G;  2GUS A;  4M3L A;  2V7Q H;  2IZ1 A;  3M9B A;  3CCQ P;  1X22 A;  3V4Q A;  3C1L A;  1BCC D;  1IO4 A;  1QEX A;  3H1H D;  1FZB A;  2O3J A;  1VPC A;  2K88 A;  5GTI H;  1ZN5 A;  4UB6 E;  2K9J B;  1SQB D;  1Q82 Q;  1ZLL A;  3WU2 H;  1YJW P;  2PP6 A;  5KLV G;  3L73 J;  1RF1 C;  3S1K A;  1K9M Q;  1L0N G;  4LC1 A;  3BCC G;  4TT3 H;  3H1H G;  3GMA A;  5B5E E;  2C0W A;  4KHX A;  5H2F E;  4GOF A;  3L74 G;  5CBN A;  4WY4 B;  3OJA B;  2KZJ A;  2XZR A;  3A2A A;  3L75 E;  5CCH D;  2R32 A;  2WVR A;  1OX3 A;  4BRY B;  3HRN A;  2RMZ A;  1SFC B;  2KS1 A;  5CHX A;  1PPJ G;  1J1D C;  3FXD A;  4JPZ B;  5C39 A;  4D6T D;  1MZ9 A;  3I55 P;  1BSN A;  5B66 E;  3Q1M A;  1VQL P;  4I1L A;  3FXE A;  1LTI C;  3PLN A;  3V6I A;  4ZNC A;  5KAF H;  3WU2 E;  3RK3 D;  2WPS A;  1GU5 A;  1MV8 A;  1URQ C;  2D2C D;  2NRG A;  2P7J A;  2E5Y A;  1BDD A;  1P84 H;  5DJU B;  1HF9 A;  2JWD A;  2PRR A;  3LW5 H;  2Z4E A;  3P32 A;  1KIL A;  3L70 G;  3IN6 A;  1K04 A;  3RGU A;  2QG4 A;  2HPC B;  3V2P A;  1KB9 E;  1K73 Q;  3L75 G;  1CI6 B;  1FC2 C;  1AVO A;  1S4X A;  1L0L D;  1NTZ E;  2GUV A;  1L0N K;  1PP9 G;  2M8R A;  2WSE H;  1BGY J;  3M0A A;  3N4X A;  1SQQ E;  2R3C A;  5KJ7 D;  1OW6 A;  4ASW A;  1OMI A;  2AEM A;  1LWU A;  3AE1 C;  1VL2 A;  2JDI H;  5AVT B;  4Y99 B;  1T2K C;  1LP1 B;  1LTG C;  3CWB E;  1S9K D;  3Q5S A;  2H89 C;  1IFI A;  2A06 G;  3CC4 P;  3GLM A;  1EZV D;  3H25 A;  1T3U A;  5BVZ A;  5AVX B;  2H88 C;  2ZAE B;  2B87 A;  1FBM A;  4IL6 E;  3TNU A;  3ZDM A;  2OYH C;  2ZXE B;  2IBZ E;  1URQ A;  3L4F A;  3MTU E;  4DZO A;  3D6Z A;  3RK2 C;  1NAF A;  1GZL A;  1PP9 E;  2PGD A;  4YXW H;  1N73 B;  1SQQ G;  1KMI Z;  4K3A A;  2W8Z A;  1N7S C;  2XU6 A;  2HR3 A;  3HE4 B;  1TU3 F;  2B87 B;  1EZV G;  3SFD C;  3TNU B;  1AJY A;  4IFD K;  3VP9 A;  1RE4 C;  2HOD A;  3RK3 E;  5GTH E;  2WSE J;  2FXP A;  4I7Z C;  3PJS K;  1L0L E;  4MN4 C;  2NPS C;  4PJ0 H;  3RBX A;  2FXO A;  2WSF J;  1NTM J;  1NYH A;  1HH0 A;  3CI9 A;  1JUN A;  2P2U A; 
#chains in the Genus database with same CATH homology
 3MIW A;  1KZU B;  1RF0 A;  3HTK A;  1H89 A;  3HE5 B;  5APW A;  1CI6 A;  2W27 A;  3HTK B;  1L4A D;  3CLQ A;  1FU1 A;  1M1J A;  1FZF A;  1IFJ A;  3HUS B;  1JY2 N;  1N7S D;  4C7N A;  3VMZ A;  1J1D B;  3E1I A;  1JY3 N;  5AW4 B;  3II6 A;  2IX7 C;  3M0D C;  1LTJ A;  3MUD A;  1HVV A;  3I5C A;  5CMZ A;  3TYY A;  1NH4 A;  1JY2 O;  4IFM A;  5BU8 B;  2Q5U A;  1FJK A;  1JCC A;  1LWU C;  1SQB K;  4O9B A;  2FFD B;  1LTA C;  3NMD A;  3IR9 A;  3A5T A;  4I2L C;  3A3Y B;  4W7Y A;  3M91 A;  1KIL C;  1YYC A;  3SWY A;  3M9H A;  1W2E A;  5APS A;  1FOS F;  3M0D A;  3P8M C;  2H8P D;  2N1T A;  1LTJ B;  2W6A A;  4WBA A;  2I1K A;  1X79 B;  3HUS A;  3KPE A;  1N7S B;  2C0X A;  4AUW A;  2OYH A;  2YKP A;  3EFG A;  2WTY A;  5AVV B;  4JYC A;  1IC2 A;  3GHG A;  3N7N A;  2IFM A;  2VRS A;  1J1E C;  2OYI B;  3H6P A;  3GHG C;  1CZQ A;  1JCD A;  4RES B;  5CCH A;  2XKM A;  1KQL A;  1L4A B;  3OA7 A;  2C9L Y;  1OXZ A;  1T3J A;  1M1J C;  1DH3 A;  2WPR A;  2O1J A;  2NPS A;  1GL2 B;  1SQX K;  2WPQ A;  5CCG A;  5AW8 B;  3P7K A;  1URQ D;  1JO5 A;  2GM4 A;  4LLH A;  3P8C D;  3UIA A;  1FJP A;  2KOG A;  2WSC H;  4WB4 A;  2Q9I A;  3U1C A;  1QL2 A;  1NWQ A;  2CPS A;  2XV5 A;  5KLV K;  2A45 H;  1NU1 K;  1KIL B;  2QM8 A;  4XA4 A;  2KLV A;  1SLQ A;  3B5N B;  4OH8 B;  1HGV A;  1WRG A;  2P1J A;  1RE3 A;  1QL1 A;  3SWF A;  3L37 A;  4N78 D;  3U1A A;  1OWA A;  1RE4 A;  3KDP B;  1JY3 P;  3LID A;  3RK3 C;  1NTK K;  3C9I A;  2FKW B;  1ZV8 A;  1NTM K;  3BVH A;  4GIF A;  2YMY A;  3PP5 A;  3VMY A;  1VDF A;  5APX A;  4GT1 A;  3GHG B;  2OYI A;  3HD7 A;  1L4A C;  1T2K D;  1FZC A;  2E42 A;  5AVW B;  5AVY B;  1RF1 B;  1JMM A;  1FZE A;  2LKM A;  5AVU B;  1FZG A;  2HYN A;  4W7Z A;  1LT9 B;  3VN0 A;  1FOS E;  3T97 A;  1Z56 A;  1SP4 A;  1HGZ A;  1CW5 A;  5AVQ B;  3G3Z A;  3VP8 A;  2FYZ A;  3R2P A;  2IPP A;  1X8Y A;  2FXM A;  1MFZ A;  1JY3 O;  1RF0 C;  3LIE A;  3EQ2 A;  1AFO A;  5AW3 B;  3B5N D;  2BAS A;  1NKN A;  5KJ7 C;  1XTG B;  2WIT A;  1L4A A;  1FZC C;  3B8E B;  4AYC A;  5KTB A;  1G2C A;  1SFC D;  1HBW A;  3TK1 A;  1M7L A;  2WT7 B;  2WZ7 A;  3MGN A;  4JYB A;  3NTN A;  2HG5 D;  3A7O A;  1SQP K;  5AW6 B;  3RK3 B;  1G1J A;  5BU5 A;  5APU A;  2N1T C;  3VMX A;  1GTW A;  3BRV B;  4DOJ A;  2R5B A;  1URQ B;  3VYI A;  1MUU A;  3VTP C;  4GKG A;  4N6J A;  1RE3 C;  2JJL A;  2Z5I A;  2ZFC A;  5CCG D;  5AW2 B;  4Y99 C;  1H88 A;  1E5W A;  2IFN A;  1HWT C;  3NFQ A;  3V2R A;  4EIJ A;  2FFD A;  2M3B A;  3P8C E;  1JOC A;  4I6M C;  1NHL A;  5AW0 B;  5APV A;  3RK2 D;  1IFD A;  3RK2 B;  2YO2 A;  1JTH B;  1NOH A;  1GDT A;  2Z5H A;  1T8Z A;  3MD0 A;  1GL2 A;  1GW4 A;  1YTZ I;  1XTC C;  3L35 A;  2N9B A;  1NO4 A;  4JF7 A;  3O8Z A;  3V2N A;  1SFC A;  4WY4 C;  4LGD E;  1EQ7 A;  1X9V A;  2XDJ A;  1IFN A;  1SFC C;  4W80 A;  3BRT B;  1GK6 A;  1HUC A;  4EOT A;  1A02 F;  1IK9 A;  2HFE D;  1KFN A;  3OAK A;  1IJD B;  1HTL C;  1L0L K;  1LTS C;  5AVR B;  4HYT B;  2N1T B;  1KFM A;  2N1T D;  2H7H A;  2I1J A;  1LTT C;  4AQR D;  3CL3 D;  2KP8 A;  1FZA A;  3HD7 C;  1GD2 E;  1CSB A;  2CPB A;  2HLO A;  5KJ7 A;  1A02 J;  1JY2 P;  1SQV K;  2YNY A;  2FFD C;  2HPC A;  5AW7 B;  2KB7 P;  2WSF H;  5CCG C;  4N78 E;  1M1J B;  2E43 A;  1KIL D;  3HD7 B;  3NXS A;  3KYQ A;  1NTZ K;  2KYV A;  3V5B A;  2A45 I;  2NPS B;  2NPS D;  4WY4 D;  1IFM A;  1N2D C;  1HJB A;  1GW3 A;  2YKO A;  3B5N A;  1N7S A;  1G2C B;  5BVZ A;  4WY4 A;  3RL0 D;  3RL0 B;  4N3Y B;  1FAV A;  5AW9 B;  1JNM A;  4ZKP A;  2R5D A;  3BAT A;  2O1K A;  1G1I A;  5AVS B;  2XNX A;  1LGH B;  1GK4 A;  1ZR4 A;  3HE4 A;  1JTH A;  3HUS C;  1LT9 C;  2POH A;  1NKZ B;  2YKQ A;  2OAR A;  3U59 A;  2PAJ A;  2P67 A;  1S9K E;  1LT9 A;  5APT A;  5AVZ B;  1AQ5 A;  2HOD B;  2J59 M;  3M9Q A;  1ZR2 A;  1DEB A;  1PFI A;  2J58 A;  1RF1 A;  4HH2 A;  2MJZ A;  3V4W A;  5CJ0 A;  5APY A;  4XE5 B;  3HD7 D;  4B86 A;  1LWU B;  1N73 A;  4C7R A;  1J2J B;  3KQG A;  2C9N Y;  5CJ4 A;  2L5G B;  4C7N B;  5CCH C;  4IFF A;  1GU4 A;  1RY3 A;  2WWW A;  1FZC B;  2FYU K;  1N7L A;  1LTJ C;  5APQ A;  2YO3 A;  1LTB C;  3L36 A;  3V2Q A;  2QM7 A;  2WT7 A;  2Q3I A;  2Q7C A;  3IFM A;  2O01 H;  2W6B A;  1DX7 A;  1H8A A;  3H32 A;  2H43 A;  1YTZ T;  2OYI C;  3B5N C;  1J1E B;  1FDM A;  1GL2 D;  2A45 G;  3HE5 A;  1SVF A;  2JEE A;  4C46 A;  3BAS A;  1WT6 A;  2OYH B;  3RL0 C;  2KSJ A;  1SQQ K;  1N73 C;  4ZKU A;  5AW1 B;  3WMM 0;  3TSI A;  1N86 A;  3M06 A;  5AW5 B;  3VOP A;  1GL2 C;  2GUS A;  4M3L A;  3M9B A;  3V4Q A;  1IO4 A;  1FZB A;  1VPC A;  1ZN5 A;  1ZLL A;  2PP6 A;  1RF1 C;  4LC1 A;  2C0W A;  4KHX A;  4WY4 B;  3OJA B;  2XZR A;  3A2A A;  5CCH D;  2R32 A;  3HRN A;  1SFC B;  5CHX A;  1J1D C;  1MZ9 A;  4I1L A;  1LTI C;  3RK3 D;  2WPS A;  1GU5 A;  1MV8 A;  1URQ C;  2P7J A;  3LW5 H;  2Z4E A;  3P32 A;  1KIL A;  2HPC B;  3V2P A;  1CI6 B;  2GUV A;  2M8R A;  2WSE H;  1L0N K;  3M0A A;  5KJ7 D;  3N4X A;  2R3C A;  1LWU A;  5AVT B;  4Y99 B;  1T2K C;  1LTG C;  1S9K D;  1IFI A;  1T3U A;  5AVX B;  3TNU A;  1FBM A;  2OYH C;  2ZXE B;  1URQ A;  3L4F A;  3MTU E;  4DZO A;  1N73 B;  3RK2 C;  1NAF A;  1GZL A;  1N7S C;  2XU6 A;  3HE4 B;  3TNU B;  4IFD K;  3VP9 A;  1RE4 C;  2HOD A;  2NPS C;  3H32 B;  1HH0 A;  3CI9 A;  1JUN A;  2P2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...