3MGNA

D-peptide inhibitor pie71 in complex with iqn17
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
b'RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IQN17
publication title Design of a potent D-peptide HIV-1 entry inhibitor with a strong barrier to resistance.
pubmed doi rcsb
molecule tags Viral protein/viral protein inhibitor
total genus 20
structure length 45
sequence length 45
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3mgnA00
5APYA 3VYIA 2E42A 5AVYB 1GU5A 3P7KA 4GKGA 5AVRB 2WT7A 3HTKA 1MFZA 1CI6A 3UIAA 3TK1A 1HWTC 3SWFA 3NFQA 2VRSA 4GT1A 2H7HA 1GK4A 2JJLA 3M0DA 2WTYA 3OAKA 2ZFCA 1SP4A 2C9NY 3M9HA 2R32A 5AW9B 3HE5B 5AW4B 2IPPA 3LIEA 4JYCA 1S9KE 1S9KD 1GD2E 5APWA 3HE4A 4XE5B 4B86A 3I5CA 5AVQB 1H88A 3L36A 1HBWA 2P7JA 1MUUA 2N9BA 3LIDA 3M06A 1CSBA 1YYCA 3V5BA 4DZOA 2KP8A 2E43A 5AVZB 1JNMA 1X8YA 2WT7B 3A5TA 2Q3IA 3A2AA 3VTPC 1CI6B 1SLQA 3TNUA 3T97A 1J2JB 5AVTB 1T2KC 3VMYA 4AYCA 3A3YB 5APSA 2WWWA 3P8MC 4I6MC 4RESB 2R5BA 5AW3B 4C7NA 4AUWA 3O8ZA 1NAFA 3L37A 5AW0B 3V4WA 1FOSF 3L35A 2Z5IA 3TYYA 3VMXA 2WPRA 3NTNA 2Z5HA 5APUA 5AVUB 1GTWA 2BASA 3MGNA 5AVVB 1GU4A 3HE4B 1CZQA 1A02F 1KQLA 4HYTB 5AW2B 2Q7CA 1A02J 2W27A 4C46A 1G2CB 2QM8A 4M3LA 2R5DA 5APQA 3NMDA 5CMZA 5AW8B 1FAVA 2R3CA 2W6AA 2YO3A 5AW1B 2Q5UA 3KDPB 3NXSA 3M0AA 2P2UA 1DH3A 4I2LC 3TNUB 2YO2A 3M91A 1NWQA 1JUNA 2XU6A 3A7OA 5AVSB 2YNYA 3M9BA 1OWAA 3V4QA 4C7NB 5AW6B 1H8AA 3IR9A 1GZLA 3VN0A 5AW5B 5APTA 4LC1A 1FOSE 4EOTA 3VMZA 5AVXB 1HUCA 2C9LY 4JYBA 2WPQA 2QM7A 3KQGA 2ZXEB 3P32A 5AW7B 1OXZA 1MV8A 5AVWB 1GK6A 2P67A 5APVA 4AQRD 1H89A 1HJBA 2XV5A 4KHXA 3HE5A 2WPSA 3MD0A 3B8EB 1IO4A 2XZRA 5APXA 1T2KD
chains in the Genus database with same CATH superfamily
1LWUC 2Y0CA 5AVRB 1WMKA 3RBXA 2VRSA 3A0HH 3W67A 5CHXA 2ZFCA 2KYVA 1L4AB 3AEFC 2FBWC 2N9BA 3P8CD 3M06A 1S72P 1NTZE 1T3UA 2IZ0A 3MHVA 1J2JB 1K9MQ 2IBZG 1JTHB 4I7ZC 1N73B 1NAYA 1ZXGA 3L75J 1PV3A 1NU1G 3O6QB 2YIUB 1LTBC 5CMZA 4H0LD 1NOHA 1FZAA 1VQOP 2Q6QA 5AW5B 3CC2P 5KLVD 3CPWO 2IDBA 3H1KD 4EDFA 2Y0EA 3EFFK 3V2QA 1QVFO 4Y99C 2WPSA 5H2FH 1LT9A 1NTMJ 4WY4D 3CCJP 1S5LH 3CCRP 4OWFA 2AXCA 1NTZJ 5APXA 1UIIA 2KOGA 3RK2C 1OVRA 4PV1C 3BATA 1SQPE 3V6IA 1NGMB 3B5NB 2E76B 2ZVNB 3WU2E 1SQVK 2OARA 2B88A 1KYOE 4N3YB 1L0NK 3RGUA 5TISH 3VMAA 1M1JC 4RO0A 1G1IA 3CL3D 3RK3B 5CCGA 1RF1B 2V7QJ 1YYCA 2D2CB 3L72G 5C39A 3H1IJ 3R2PA 5CCHC 1LTTC 2PFXA 1LTJA 1P84D 1SQQG 2KNCA 2Y0DA 1VL2A 1LP1A 1G1JA 2Z5HA 2BASA 4OGQB 2M8RA 2BEZF 4ASWA 1M56D 1QEXA 4PD4E 2KSJA 2FXMA 4U7JA 2E74D 1XTGB 2QIWA 3CX5I 1IFDA 1JUNA 2XU6A 2PAJA 2WSCJ 1NVOA 3FX0A 2JO1A 3BCCG 3CCEP 3EQ2A 2FYNC 4JYBA 1L0LG 2QM7A 3KQGA 2OTKE 3PH0A 2IBZD 1E5WA 1MV8A 3U1CA 1RF0A 1HJBA 2WSFH 2XV5A 1S1CX 3AEGC 3HUSA 5KAIE 1NU1D 2QRXA 2XNXA 1AFOA 1OX3A 4GKGA 1RHZB 4IFFA 1CI6A 3CWBJ 3TK1A 4I1LA 1FZBA 1EQ7A 2H7HA 1IFNA 1VQMP 2WSEJ 3OAKA 1SP4A 5GTIE 2OYHC 3M9HA 1WT6A 5AW4B 1S9KE 4JYCA 3KXDA 3PHLA 3HE4A 5APWA 1USDA 1VF5D 4Y28J 4YXDC 2BCCJ 3GF7A 2A45H 3A2AA 4I7ZB 3T97A 1JY3P 3D70A 2R44A 2ZYGA 2R5BA 2KS1B 2FYUE 1LJ2A 3WMM0 4WWIA 4IOIH 2R5DA 1K05A 1RE4C 2IFNA 1KILC 5CCGC 3WU2H 2HYNA 5BU8B 4WBAA 1KYOH 2WQYC 3AE4C 3H32B 1ZR2A 4H44D 3L72D 1M8OB 2P67A 1BGYJ 2KIKA 1EZVE 1YJ9P 3B8EB 2XZRA 3HD7A 3JCUE 5APYA 1GW4A 2O1JA 4PD4H 1N2DC 4HH2A 3L75G 4XA4A 5M1BA 1KORA 3PLNA 2N9YB 1NU1J 1WRGA 1KILE 3BCCD 5EFWB 2E75D 4LGDE 3HUSC 2ZYDA 4GOEA 1L0LD 1VQ7P 2OYOA 1BE3E 5AW3B 2BEQD 1VPCA 1PP9E 5KAIH 1L4AC 4PD4I 1NTMG 1FC2C 3NMDA 1SQXE 1LTIC 1NTZG 1IFIA 1BDDA 1RY3A 5GTIH 4HB1A 2W6BA 2E74B 3C8VA 3M9BA 3V4QA 1QL1A 2K37A 2FYNB 1N73C 2FY8A 5AVXB 2WPQA 3P32A 5AW7B 1VQPP 1M7LA 3H1IG 4GIFA 3FWNA 4U3FE 1PIXA 1FS0E 4N78D 1SFCD 1SQQJ 3L70E 3ZDMA 3V2NA 4L73A 2A45G 5DJTB 2QA4P 4RKUJ 1FBMA 3CXHI 3AE5C 3M0DA 2GA1A 1SVFA 4KT0J 1GD2E 1LT9B 4XE5B 1SQBE 2CPBA 4IL6E 4W7ZA 1H88A 1YBKA 1SQXJ 4BXLA 2KXPB 3KZIE 4YXWH 3Q5RA 2KZJA 2KP8A 2OQQA 1BSHA 2IBZI 2LXBA 1FZCA 1S4XA 5AVTB 3MUDC 2K88A 2WWWA 3MP7B 3AEEC 3FXDA 3CX5D 1YJNP 3JCUH 1VQLP 1A02F 1JB0J 1CZQA 1KQLA 2YXRB 1LTGC 3GF3A 2PRRA 1Q81Q 3L75D 3GHGA 1LT1A 3RK3C 1RF1C 3VP8A 2D2CC 2Q5UA 2CK3H 2QJPC 2W90A 1DH3A 2YO2A 5L8RJ 3CWBG 4UB6E 1LTJB 3H25A 4K35A 3H1HE 5H2FE 2H8PD 2KNCB 1LP1B 4BWNA 4EIJA 2B9BA 2E5TA 2O3JA 3TGUJ 1DX7A 4H44B 5KJ7A 3IF4A 1Q90D 1R5LA 2BCCG 4DOJA 1Q82Q 2OYIA 2KZIA 2FFDA 1AVYA 5CBNA 1NTMD 2WZ7A 4WY4A 5GTHE 1ZOYC 2P10A 1NTZD 3HTKA 1VQ9P 2A06E 1NU1K 2ZT9D 3RK3E 1ZRTD 3HUSB 1HBWA 2NPSA 1VQ5P 3CCVP 2PGDA 2I1KA 3AEDC 2E75B 2WMMA 1DD4A 3LW5H 2QJKB 2I1JA 3CD6P 1CI6B 1GL2D 3H1ID 1KTMA 3I55P 1IFJA 1M1KQ 2R3SA 1NAFA 1D7MA 2WPRA 1FJKA 2QG4A 3HE4B 1BGYG 2AEMA 2H88C 2RMZA 1OW8A 1NTKE 3T97B 1FZCC 1FZGA 3PP5A 3L71E 4IL6H 1DEEG 2FYUG 3KZIH 1OW7A 1S5LX 3CCSP 1AV1A 1QX8A 3GHGC 2K3RA 1H89A 1JO5A 5TJHA 2L91A 2ZVOB 4GODA 3E1RA 1GW3A 1MKMA 2FYZA 2AEFA 4RJTA 4DCKA 1ZW0A 5KJ7D 2JWAA 1SQQK 4R4MA 4R4LA 2M5AA 2JKVA 1N7SD 1TU3F 3CWBD 1KQSO 4GOFA 4UB6H 1RE3C 2IPPA 2ZYAA 3H1LE 2UWJE 2OYIC 1J1EB 3P8CE 2QE7H 3HD7B 3L73E 4PD4D 4WY4C 2BCCD 1KV4A 1IK9A 3VMYA 2WSFJ 2E5YA 1HGVA 3L74E 3GG2A 3RL0g 1KC8Q 2NPSD 3FWLA 1LTSC 5GTHH 1H0TA 1L0LK 1ZP0C 3JSVC 4M3LA 5APQA 3G9RA 2QJPB 3Q5PA 1PPJG 4ZNCA 2XKMA 1Q86Q 1NWQA 1ZLLA 5CCHD 2P58A 4JPZB 3BASA 5KLVE 1HUCA 2B87A 2HG5D 3TDKA 1SQXG 2LR2A 1PZQA 3C9IA 2YKPA 3H1LJ 2QJYB 3CXHD 1K73Q 4C7RA 1BSNA 2M3BA 2N1TA 1URQD 1BGYD 2E74C 1T2KD 3Q5SA 2MKVA 2O01J 4KJMA 5AVYB 1SQPJ 2GUSA 5BU5A 4N6JA 4OVNF 1Q7YQ 1NKNA 2JJLA 1R5SA 5BVZA 3FXEA 1OIPA 2NRGA 1HTLC 4U3FG 2FYUD 1KB9E 1X22A 1G2CA 3LIDA 2O1KA 1QL2A 4BRYA 3IN6A 2E43A 2P1JA 3A5TA 1NKZB 3TGUG 1IC2A 1P84E 3D6ZA 1JMBA 4C7NA 3V4WA 2XNDH 1JM0A 4H13D 5AVUB 1KZUB 1LT9C 3EWKA 4NPFX 3MIWA 1VF5C 3TSIA 3R4YA 4HKZH 1FZCB 3CCUP 1GDTA 2Q3EA 3IR9A 3VN0A 2KSEA 3II6A 3VOPA 2SPZA 4Z1MH 2O01H 3GHGB 3CI9A 1JEKA 4H0LB 2GM4A 2PP6A 2J59M 1YIJP 3BRVB 1KD1Q 2K9JA 3O6QA 2FXOA 1LTJC 1OFCX 2Y9ZA 2G3AA 3QH9A 1YQ4C 1MFZA 3WUVA 2A45I 1PPJD 1HF9A 2FKWB 3RL0D 4H44C 3I56P 1SFCA 2YKOA 2WTYA 1SQQD 2N1TD 2C9NY 2OYIB 1NTMK 2FFDB 2ZJSE 1NTZK 2WITA 1J1DB 4ZMDA 1FZEA 4WY4B 1X79B 3M9QA 4K3AA 1SQXD 5AVZB 3HTKB 3AE3C 3WUTA 3IFMA 4WVZA 4I6MC 1KYOI 2A06G 2FYUJ 3O8ZA 1FOSF 3KYQA 3L35A 2Z5IA 2ZAEB 3GW6A 1RF0C 4IFMA 5AVVB 1N7LA 5AW2B 3K5BA 4C46A 2NPSB 1OVUA 3OW2O 3ITKA 1BDCA 1S2EA 2W6AA 2I8DA 2E75C 2QJKC 1FZFA 5KLIB 1KB9H 3AE9C 3CCQP 1OW6A 4D6TE 3L72E 5APTA 2RKLA 4EOTA 1OZHA 3USSA 4IFDK 3TGUD 1P84H 1L4AD 5CJ4A 1NTKG 2WSSH 3MD0A 3U1AA 1GU5A 1SQPK 1JY2N 2NZ2A 1IZNB 2ITAA 1EDKA 4GT1A 1GMJA 3H1JE 2H43A 1SQVE 3KHUA 3L4FA 3BCCE 1KB9I 2W8ZA 2K1AA 1E79H 1L0NE 1CSBA 2OTLP 4DZOA 1X8YA 1BE3J 2M5AB 1PP9J 5APSA 2Q9IA 3P8MC 1GL2A 1LWUA 4DJGA 3L37A 5B66E 1SFCC 1VQKP 4A7PA 3H1LG 3SSUA 3WUUA 3AE7C 2W27A 1J1EC 3L73G 1VF5B 3HD7C 5AW1B 4ZKUA 4PJ0E 1K04A 1SQPG 3RBZA 3TF5A 1QVGO 3F5HA 3L74G 5AVSB 1OWAA 2L5GB 2W83C 1DIPA 1AQTA 3B5ND 1H0TB 2E76D 3LW5J 4ZKPA 3H1JJ 1EXIA 1M90Q 2A06D 4U3FJ 1YITP 3RK3D 1HGZA 3C1LA 1HJ0A 5CJ0A 1KN7A 1QGKB 2POHA 1BCCE 1PGQA 1MZ9A 3N7NA 3F89A 1NO4A 3L70J 3Q3DA 1FDOA 3G6EP 1X0TA 2B87B 2Y9YA 2B89A 1ZR4A 2HODA 1LNQA 3MZWB 4OGQD 1EZVI 2HFED 1N7SA 1SQBJ 4OH8B 3RL0B 1JOCA 2AXTE 3LIEA 2QJYC 1IK7A 2N1TB 1YHQP 4L75A 2IX7C 1KFNA 3TNUA 1NTKD 4CPGA 1IJDB 4RESB 1S3JA 2FYUK 3CX5E 5APUA 3QWOC 2Q7CA 1G2CB 3L75E 4IL6X 2ZT9C 4BRYB 1VQNP 3H1HJ 1M1JA 3E7KA 4C7NB 5AW6B 3V2PA 3M0DC 1AA0A 4TT3H 4LC1A 3U59A 5CCHA 3W68A 5B66H 2RH0A 1AJYA 5B5EE 1ZMEC 3H1LD 2QSIA 3AEAC 2J58A 5DJUB 1NTME 1URQA 3L73D 3CMEP 1NJIQ 4PJ0H 1HWTC 5CBOA 1SQPD 4W7YA 3L74D 4ASVA 3CC4P 1AQ5A 4O9BA 5AW9B 1KYOD 4H0LC 1ZRTE 1JY2O 2K9JB 3SFDC 1MUUA 1LTAC 1M57D 5E79E 2KLVA 1PFIA 3V2RA 3BVHA 2IFMA 2M3EA 2AEJA 3H1IE 1Y9BA 3A3YB 1SFCB 2JP3A 5KJ7C 2W6JH 3NTNA 1EZVG 1Z56A 1GTWA 1N7SC 3MGNA 4JQ0D 1GU4A 1SQXK 1A02J 2FFDC 3AE2C 1J1DC 1R8EA 1AVOA 1NTKJ 4TLFA 2WVRA 3AEBC 2OYHA 1X9VA 3L71J 3PJSK 1ZN5A 2K9YA 3RK2D 2AXTH 1T3JA 3GLMA 4PV1D 3M91A 1PGJA 1DEBA 2YMKA 2ZXXA 2G8YA 3B71A 4LLHA 2C9LY 2NPSC 3HRNA 3S9OA 2HR3A 1VDFA 4EYYQ 3Q2YA 1RQVA 3A0BE 4KHXA 3HE5A 3CX5H 4W80A 1KFMA 2C0XA 1YTZI 1BE3G 1IO4A 1KB9D 1RE4A 1PP9G 5K5GB 5KLIC 1KILA 2KUBA 3CLQA 4D6TG 2WT7A 3H1KE 3SWFA 3NFQA 1GK4A 3CWBE 5KKZB 3AECC 3KPEA 1SQBK 2R32A 2M0BA 4HJGH 1K8AQ 1S9KD 3Q1MA 1ZV8A 3L73J 2P7JA 1XTCC 1VQ6P 3PTZA 1JNMA 2BCCE 1URQC 2KK7A 3L74J 1T2KC 2HPCA 1U57A 3B4SA 3CCMP 1EDJA 5B5EH 3H1JG 1U7MA 1EC5A 1JY3N 1SQVG 3VMXA 2KB7P 1FE6A 4HYTB 2ZT9B 3SFEC 1L0NG 2QM8A 1DD3A 3OA7A 5AW8B 1IFPA 3NXSA 2P2UA 3L70G 3H6PA 3E1IA 2IZ1A 4WB4A 1GL2B 1LWUB 5KLVJ 4JBZA 1VQ8P 1FDIA 1NHLA 1SQBG 3H1KJ 5E79H 1IFMA 2V7QH 4H13C 2ZXEB 1PGPA 5AVWB 5APVA 1LGHB 1W2BO 1FJPA 3CXHE 3GMAA 1EDIA 2CPSA 1EZVD 1L4AA 1BGYE 4YTPC 2XDJA 1USEA 2QEXP 3JC22 4UB8E 1JTHA 2LXCB 2IBZE 1L2PA 4L76A 1N73A 3D71A 1N86A 1KILD 5CCGD 2WSCH 1NU1E 3AE8C 3I5CA 5AVQB 4B86A 3H1HG 3L36A 5KAFE 1BCCG 1MFTA 1OMIA 3AE6C 3OJAB 1NH4A 4MN4C 2YMYA 2JEEA 3A0BH 2YKQA 2HODB 1BE3D 2O01N 2KI7B 1PP9D 4YPCA 1N7SB 3RL0C 4D6TD 2MJZA 1YJWP 2Q1KA 2N1TC 2J5UA 2YXQB 3PRJA 1NTKK 2H89C 2KLUA 3M0AA 4Y99B 3TNUB 1KQFB 2WSEH 3IAOA 2HLOA 1GZLA 2JR8A 3RK2B 4PV1B 3G71P 3VMZA 1JCCA 3MUDA 3B5NA 1RQUA 1RH5B 1OXZA 4AQRD 3H1JD 1U7JA 2JWDA 2RN0A 1SQVD 1NYHA 4NPEA 1M1JB 4U3FD 1FDMA 1RF1A 1T6AA 1L0ND 1Y8AA 3P7KA 1QLED 1W5CE 1PPJE 3L70D 1SQQE 4DT0A 2DW3A 1SQBD 3L71G 2FXPA 1OVVA 3V5BA 1EXJA 2OTJP 1URQB 2QVAA 2Q3IA 1SLQA 1UIXA 3CXHH 2WPVB 2GUVA 3CMAP 3VP9A 1EDLA 2OGUA 1L0LE 4UB8H 3G4SP 2YIUC 1FAVA 2R3CA 2LKMA 1JY3O 1PGOA 4I2LC 3A0HE 1P84I 3AE1C 2IYPA 3A7OA 4D6TJ 2YNYA 3L72J 1H8AA 3H1HD 3MTUE 1W2EA 5KAFH 1BCCD 5KLVK 1YTZT 1FOSE 3D6YA 4H13B 1T8ZA 3TGUE 3CC7P 2OYHB 1GK6A 1YQ3C 2C0WA 1YI2P 3HD7D 4QMAA 1JY2P 3VYIA 2E42A 2JDIH 3UIAA 1N8RQ 3B5NC 1SQVJ 2E76C 4L74A 3BCCJ 4XFJA 3G3ZA 2KS1A 4EI2A 3HE5B 1L0NJ 2V4HA 2D2CD 1L0LJ 3ABVC 1KILB 4N78E 3S4RA 5KLVG 2WT7B 3VTPC 3H1KG 1JMMA 4AYCA 1CW5A 3S1KA 3H32A 2Z4EA 5KKZC 4AUWA 5AW0B 3TYYA 3SWYA 1S5LE 1SS1A 4OGQC 4GDOA 3EFGA 1HH0A 1RE3A 2YO3A 3KDPB 1VQ4P 1HVVA 2HPCB 3SWKA 3L71D 4JF7A 5TISE 1FU1A 1JCDA 5KTBA 3FGAD 3N4XA 3CCLP 1KMIZ 4NPDA 1PL5A 1KQGB 3BRTB 2IYOA 1BCCJ 1Y47A 1Q2NA 1GL2C
chains in the Genus database with same CATH topology
1LWUC 3CLQA 5AVRB 4N78D 2WT7A 1MFZA 2A45I 1SFCD 3SWFA 2FKWB 2VRSA 3NFQA 1GK4A 3RL0D 3V2NA 2A45G 1SFCA 5CHXA 3KPEA 1FBMA 3M0DA 2YKOA 2WTYA 2ZFCA 2N1TD 2C9NY 1SQBK 1SVFA 2R32A 2KYVA 2OYIB 1NTMK 1GD2E 1S9KD 1LT9B 4XE5B 2FFDB 1ZV8A 1L4AB 2CPBA 4W7ZA 1H88A 1NTZK 2P7JA 2WITA 1J1DB 2N9BA 3P8CD 3M06A 1FZEA 1XTCC 4WY4B 1X79B 3M9QA 2KP8A 5AVZB 1T3UA 1JNMA 1URQC 3HTKB 1FZCA 1J2JB 5AVTB 1T2KC 1JTHB 3IFMA 2HPCA 2WWWA 4I6MC 3O8ZA 1N73B 1FOSF 3KYQA 3L35A 1JY3N 2Z5IA 3VMXA 1RF0C 4IFMA 2KB7P 5AVVB 1A02F 1CZQA 1KQLA 1N7LA 4HYTB 5AW2B 1LTGC 4C46A 2QM8A 2NPSB 3GHGA 3RK3C 1RF1C 1LTBC 3OA7A 5CMZA 5AW8B 3VP8A 1NOHA 2W6AA 2Q5UA 3NXSA 1FZAA 2P2UA 1DH3A 2YO2A 1FZFA 3H6PA 1LTJB 3E1IA 4WB4A 1GL2B 2H8PD 1LWUB 5AW5B 5APTA 4EIJA 1NHLA 4EOTA 1IFMA 1DX7A 5KJ7A 2ZXEB 4IFDK 5AVWB 5APVA 4DOJA 3V2QA 1L4AD 5CJ4A 1LGHB 1FJPA 2OYIA 4Y99C 2WPSA 1LT9A 2CPSA 2FFDA 3MD0A 1L4AA 4WY4D 5APXA 2WZ7A 4WY4A 3U1AA 2KOGA 2XDJA 1GU5A 1SQPK 3RK2C 1JY2N 3HTKA 3BATA 1JTHA 3B5NB 4GT1A 1SQVK 2OARA 1N73A 1NU1K 2H43A 4N3YB 3L4FA 1L0NK 1N86A 1KILD 5CCGD 2WSCH 4B86A 3I5CA 5AVQB 3HUSB 1M1JC 1HBWA 3L36A 2NPSA 1G1IA 3CL3D 3RK3B 5CCGA 1RF1B 1CSBA 1YYCA 4DZOA 2I1KA 3OJAB 1X8YA 1NH4A 3LW5H 2I1JA 3R2PA 5CCHC 1LTTC 1CI6B 2YMYA 1GL2D 2JEEA 1IFJA 1LTJA 2Q9IA 5APSA 3P8MC 2YKQA 2HODB 1GL2A 1LWUA 1NAFA 3L37A 1SFCC 1N7SB 2WPRA 1G1JA 2Z5HA 3RL0C 1FJKA 2BASA 3HE4B 2M8RA 2MJZA 2W27A 2N1TC 1J1EC 3HD7C 1NTKK 2KSJA 5AW1B 4ZKUA 2FXMA 3M0AA 4Y99B 1XTGB 3TNUB 2WSEH 1FZCC 1FZGA 1IFDA 3PP5A 1JUNA 2XU6A 2PAJA 5AVSB 2HLOA 1OWAA 2L5GB 1GZLA 3RK2B 3EQ2A 3B5ND 3VMZA 1JCCA 3MUDA 4JYBA 2QM7A 3B5NA 3KQGA 4ZKPA 1E5WA 1OXZA 3GHGC 1MV8A 3U1CA 4AQRD 1H89A 1RF0A 1HJBA 1JO5A 2WSFH 2XV5A 3RK3D 1HGZA 1M1JB 3HUSA 5CJ0A 2POHA 1FDMA 1RF1A 1GW3A 2FYZA 1MZ9A 3N7NA 2XNXA 1AFOA 3P7KA 4GKGA 1NO4A 5KJ7D 4IFFA 1CI6A 3TK1A 4I1LA 1SQQK 1FZBA 1EQ7A 2H7HA 1IFNA 1ZR4A 1N7SD 2HODA 1RE3C 3OAKA 1SP4A 2OYHC 2HFED 1N7SA 3M9HA 4OH8B 3RL0B 1JOCA 1WT6A 5AW4B 2IPPA 3LIEA 4JYCA 1S9KE 5APWA 3HE4A 2OYIC 2N1TB 1J1EB 3P8CE 2IX7C 1KFNA 3HD7B 3V5BA 1URQB 4WY4C 2A45H 2Q3IA 1IK9A 3A2AA 1SLQA 3TNUA 3T97A 3VMYA 1IJDB 1JY3P 1HGVA 4RESB 2GUVA 2R5BA 2FYUK 2NPSD 3VP9A 5APUA 1LTSC 1L0LK 2Q7CA 3WMM0 1G2CB 4M3LA 5APQA 2R5DA 1RE4C 2IFNA 1KILC 5CCGC 1FAVA 2R3CA 2HYNA 5BU8B 2LKMA 1JY3O 4I2LC 4WBAA 1M1JA 2XKMA 1NWQA 3H32B 1ZR2A 1ZLLA 3A7OA 2YNYA 1H8AA 4C7NB 5AW6B 5CCHD 3MTUE 3V2PA 1W2EA 3M0DC 5KLVK 1YTZT 4LC1A 3U59A 5CCHA 3BASA 1FOSE 1HUCA 2HG5D 1T8ZA 2OYHB 1GK6A 2P67A 2C0WA 3C9IA 2YKPA 4C7RA 3HD7D 2M3BA 2N1TA 2J58A 1URQD 3B8EB 1JY2P 2XZRA 3HD7A 1T2KD 5APYA 3VYIA 1GW4A 2E42A 5AVYB 1URQA 2O1JA 1N2DC 2GUSA 4HH2A 3UIAA 1HWTC 5BU5A 4N6JA 4XA4A 1NKNA 4W7YA 2JJLA 3B5NC 5BVZA 1AQ5A 3G3ZA 4O9BA 5AW9B 1WRGA 3HE5B 1HTLC 1JY2O 1G2CA 4LGDE 1MUUA 3LIDA 2O1KA 3HUSC 1QL2A 1KILB 1LTAC 4N78E 2E43A 2KLVA 1PFIA 2P1JA 2WT7B 3A5TA 1NKZB 3V2RA 3BVHA 2IFMA 3VTPC 1JMMA 4AYCA 3A3YB 1CW5A 3H32A 1IC2A 2Z4EA 1SFCB 5KJ7C 5AW3B 4C7NA 4AUWA 1VPCA 5AW0B 3V4WA 3TYYA 3NTNA 5AVUB 3SWYA 1Z56A 1GTWA 1N7SC 3MGNA 1GU4A 1SQXK 1KZUB 1LT9C 1A02J 2FFDC 1L4AC 1J1DC 3EFGA 1HH0A 3NMDA 1LTIC 1RE3A 3MIWA 2YO3A 3TSIA 2OYHA 1IFIA 3KDPB 1HVVA 1RY3A 1X9VA 1FZCB 1ZN5A 2HPCB 2W6BA 3RK2D 1T3JA 1GDTA 3M91A 3M9BA 3V4QA 1DEBA 3IR9A 1QL1A 4JF7A 3VN0A 1N73C 1FU1A 1JCDA 5KTBA 4LLHA 3II6A 3VOPA 5AVXB 2O01H 2C9LY 2WPQA 3N4XA 2NPSC 3HRNA 3GHGB 3P32A 1VDFA 5AW7B 3CI9A 1M7LA 4GIFA 4KHXA 3HE5A 2GM4A 2PP6A 3BRTB 2J59M 4W80A 1KFMA 2C0XA 3BRVB 1YTZI 1LTJC 1IO4A 1RE4A 1GL2C 1KILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5APY A;  3VYI A;  2E42 A;  5AVY B;  1GU5 A;  3P7K A;  4GKG A;  5AVR B;  2WT7 A;  3HTK A;  1MFZ A;  1CI6 A;  3UIA A;  3TK1 A;  1HWT C;  3SWF A;  3NFQ A;  2VRS A;  4GT1 A;  2H7H A;  1GK4 A;  2JJL A;  3M0D A;  2WTY A;  3OAK A;  2ZFC A;  1SP4 A;  2C9N Y;  3M9H A;  2R32 A;  5AW9 B;  3HE5 B;  5AW4 B;  2IPP A;  3LIE A;  4JYC A;  1S9K E;  1S9K D;  1GD2 E;  5APW A;  3HE4 A;  4XE5 B;  4B86 A;  3I5C A;  5AVQ B;  1H88 A;  3L36 A;  1HBW A;  2P7J A;  1MUU A;  2N9B A;  3LID A;  3M06 A;  1CSB A;  1YYC A;  3V5B A;  4DZO A;  2KP8 A;  2E43 A;  5AVZ B;  1JNM A;  1X8Y A;  2WT7 B;  3A5T A;  2Q3I A;  3A2A A;  3VTP C;  1CI6 B;  1SLQ A;  3TNU A;  3T97 A;  1J2J B;  5AVT B;  1T2K C;  3VMY A;  4AYC A;  3A3Y B;  5APS A;  2WWW A;  3P8M C;  4I6M C;  4RES B;  2R5B A;  5AW3 B;  4C7N A;  4AUW A;  3O8Z A;  1NAF A;  3L37 A;  5AW0 B;  3V4W A;  1FOS F;  3L35 A;  2Z5I A;  3TYY A;  3VMX A;  2WPR A;  3NTN A;  2Z5H A;  5APU A;  5AVU B;  1GTW A;  2BAS A;  3MGN A;  5AVV B;  1GU4 A;  3HE4 B;  1CZQ A;  1A02 F;  1KQL A;  4HYT B;  5AW2 B;  2Q7C A;  1A02 J;  2W27 A;  4C46 A;  1G2C B;  2QM8 A;  4M3L A;  2R5D A;  5APQ A;  3NMD A;  5CMZ A;  5AW8 B;  1FAV A;  2R3C A;  2W6A A;  2YO3 A;  5AW1 B;  2Q5U A;  3KDP B;  3NXS A;  3M0A A;  2P2U A;  1DH3 A;  4I2L C;  3TNU B;  2YO2 A;  3M91 A;  1NWQ A;  1JUN A;  2XU6 A;  3A7O A;  5AVS B;  2YNY A;  3M9B A;  1OWA A;  3V4Q A;  4C7N B;  5AW6 B;  1H8A A;  3IR9 A;  1GZL A;  3VN0 A;  5AW5 B;  5APT A;  4LC1 A;  1FOS E;  4EOT A;  3VMZ A;  5AVX B;  1HUC A;  2C9L Y;  4JYB A;  2WPQ A;  2QM7 A;  3KQG A;  2ZXE B;  3P32 A;  5AW7 B;  1OXZ A;  1MV8 A;  5AVW B;  1GK6 A;  2P67 A;  5APV A;  4AQR D;  1H89 A;  1HJB A;  2XV5 A;  4KHX A;  3HE5 A;  2WPS A;  3MD0 A;  3B8E B;  1IO4 A;  2XZR A;  5APX A;  1T2K D; 
#chains in the Genus database with same CATH topology
 1LWU C;  2Y0C A;  5AVR B;  1WMK A;  3RBX A;  2VRS A;  3A0H H;  3W67 A;  5CHX A;  2ZFC A;  2KYV A;  1L4A B;  3AEF C;  2FBW C;  2N9B A;  3P8C D;  3M06 A;  1S72 P;  1NTZ E;  1T3U A;  2IZ0 A;  3MHV A;  1J2J B;  1K9M Q;  2IBZ G;  1JTH B;  4I7Z C;  1N73 B;  1NAY A;  1ZXG A;  3L75 J;  1PV3 A;  1NU1 G;  3O6Q B;  2YIU B;  1LTB C;  5CMZ A;  4H0L D;  1NOH A;  1FZA A;  1VQO P;  2Q6Q A;  5AW5 B;  3CC2 P;  5KLV D;  3CPW O;  2IDB A;  3H1K D;  4EDF A;  2Y0E A;  3EFF K;  3V2Q A;  1QVF O;  4Y99 C;  2WPS A;  5H2F H;  1LT9 A;  1NTM J;  4WY4 D;  3CCJ P;  1S5L H;  3CCR P;  4OWF A;  2AXC A;  1NTZ J;  5APX A;  1UII A;  2KOG A;  3RK2 C;  1OVR A;  4PV1 C;  3BAT A;  1SQP E;  3V6I A;  1NGM B;  3B5N B;  2E76 B;  2ZVN B;  3WU2 E;  1SQV K;  2OAR A;  2B88 A;  1KYO E;  4N3Y B;  1L0N K;  3RGU A;  5TIS H;  3VMA A;  1M1J C;  4RO0 A;  1G1I A;  3CL3 D;  3RK3 B;  5CCG A;  1RF1 B;  2V7Q J;  1YYC A;  2D2C B;  3L72 G;  5C39 A;  3H1I J;  3R2P A;  5CCH C;  1LTT C;  2PFX A;  1LTJ A;  1P84 D;  1SQQ G;  2KNC A;  2Y0D A;  1VL2 A;  1LP1 A;  1G1J A;  2Z5H A;  2BAS A;  4OGQ B;  2M8R A;  2BEZ F;  4ASW A;  1M56 D;  1QEX A;  4PD4 E;  2KSJ A;  2FXM A;  4U7J A;  2E74 D;  1XTG B;  2QIW A;  3CX5 I;  1IFD A;  1JUN A;  2XU6 A;  2PAJ A;  2WSC J;  1NVO A;  3FX0 A;  2JO1 A;  3BCC G;  3CCE P;  3EQ2 A;  2FYN C;  4JYB A;  1L0L G;  2QM7 A;  3KQG A;  2OTK E;  3PH0 A;  2IBZ D;  1E5W A;  1MV8 A;  3U1C A;  1RF0 A;  1HJB A;  2WSF H;  2XV5 A;  1S1C X;  3AEG C;  3HUS A;  5KAI E;  1NU1 D;  2QRX A;  2XNX A;  1AFO A;  1OX3 A;  4GKG A;  1RHZ B;  4IFF A;  1CI6 A;  3CWB J;  3TK1 A;  4I1L A;  1FZB A;  1EQ7 A;  2H7H A;  1IFN A;  1VQM P;  2WSE J;  3OAK A;  1SP4 A;  5GTI E;  2OYH C;  3M9H A;  1WT6 A;  5AW4 B;  1S9K E;  4JYC A;  3KXD A;  3PHL A;  3HE4 A;  5APW A;  1USD A;  1VF5 D;  4Y28 J;  4YXD C;  2BCC J;  3GF7 A;  2A45 H;  3A2A A;  4I7Z B;  3T97 A;  1JY3 P;  3D70 A;  2R44 A;  2ZYG A;  2R5B A;  2KS1 B;  2FYU E;  1LJ2 A;  3WMM 0;  4WWI A;  4IOI H;  2R5D A;  1K05 A;  1RE4 C;  2IFN A;  1KIL C;  5CCG C;  3WU2 H;  2HYN A;  5BU8 B;  4WBA A;  1KYO H;  2WQY C;  3AE4 C;  3H32 B;  1ZR2 A;  4H44 D;  3L72 D;  1M8O B;  2P67 A;  1BGY J;  2KIK A;  1EZV E;  1YJ9 P;  3B8E B;  2XZR A;  3HD7 A;  3JCU E;  5APY A;  1GW4 A;  2O1J A;  4PD4 H;  1N2D C;  4HH2 A;  3L75 G;  4XA4 A;  5M1B A;  1KOR A;  3PLN A;  2N9Y B;  1NU1 J;  1WRG A;  1KIL E;  3BCC D;  5EFW B;  2E75 D;  4LGD E;  3HUS C;  2ZYD A;  4GOE A;  1L0L D;  1VQ7 P;  2OYO A;  1BE3 E;  5AW3 B;  2BEQ D;  1VPC A;  1PP9 E;  5KAI H;  1L4A C;  4PD4 I;  1NTM G;  1FC2 C;  3NMD A;  1SQX E;  1LTI C;  1NTZ G;  1IFI A;  1BDD A;  1RY3 A;  5GTI H;  4HB1 A;  2W6B A;  2E74 B;  3C8V A;  3M9B A;  3V4Q A;  1QL1 A;  2K37 A;  2FYN B;  1N73 C;  2FY8 A;  5AVX B;  2WPQ A;  3P32 A;  5AW7 B;  1VQP P;  1M7L A;  3H1I G;  4GIF A;  3FWN A;  4U3F E;  1PIX A;  1FS0 E;  4N78 D;  1SFC D;  1SQQ J;  3L70 E;  3ZDM A;  3V2N A;  4L73 A;  2A45 G;  5DJT B;  2QA4 P;  4RKU J;  1FBM A;  3CXH I;  3AE5 C;  3M0D A;  2GA1 A;  1SVF A;  4KT0 J;  1GD2 E;  1LT9 B;  4XE5 B;  1SQB E;  2CPB A;  4IL6 E;  4W7Z A;  1H88 A;  1YBK A;  1SQX J;  4BXL A;  2KXP B;  3KZI E;  4YXW H;  3Q5R A;  2KZJ A;  2KP8 A;  2OQQ A;  1BSH A;  2IBZ I;  2LXB A;  1FZC A;  1S4X A;  5AVT B;  3MUD C;  2K88 A;  2WWW A;  3MP7 B;  3AEE C;  3FXD A;  3CX5 D;  1YJN P;  3JCU H;  1VQL P;  1A02 F;  1JB0 J;  1CZQ A;  1KQL A;  2YXR B;  1LTG C;  3GF3 A;  2PRR A;  1Q81 Q;  3L75 D;  3GHG A;  1LT1 A;  3RK3 C;  1RF1 C;  3VP8 A;  2D2C C;  2Q5U A;  2CK3 H;  2QJP C;  2W90 A;  1DH3 A;  2YO2 A;  5L8R J;  3CWB G;  4UB6 E;  1LTJ B;  3H25 A;  4K35 A;  3H1H E;  5H2F E;  2H8P D;  2KNC B;  1LP1 B;  4BWN A;  4EIJ A;  2B9B A;  2E5T A;  2O3J A;  3TGU J;  1DX7 A;  4H44 B;  5KJ7 A;  3IF4 A;  1Q90 D;  1R5L A;  2BCC G;  4DOJ A;  1Q82 Q;  2OYI A;  2KZI A;  2FFD A;  1AVY A;  5CBN A;  1NTM D;  2WZ7 A;  4WY4 A;  5GTH E;  1ZOY C;  2P10 A;  1NTZ D;  3HTK A;  1VQ9 P;  2A06 E;  1NU1 K;  2ZT9 D;  3RK3 E;  1ZRT D;  3HUS B;  1HBW A;  2NPS A;  1VQ5 P;  3CCV P;  2PGD A;  2I1K A;  3AED C;  2E75 B;  2WMM A;  1DD4 A;  3LW5 H;  2QJK B;  2I1J A;  3CD6 P;  1CI6 B;  1GL2 D;  3H1I D;  1KTM A;  3I55 P;  1IFJ A;  1M1K Q;  2R3S A;  1NAF A;  1D7M A;  2WPR A;  1FJK A;  2QG4 A;  3HE4 B;  1BGY G;  2AEM A;  2H88 C;  2RMZ A;  1OW8 A;  1NTK E;  3T97 B;  1FZC C;  1FZG A;  3PP5 A;  3L71 E;  4IL6 H;  1DEE G;  2FYU G;  3KZI H;  1OW7 A;  1S5L X;  3CCS P;  1AV1 A;  1QX8 A;  3GHG C;  2K3R A;  1H89 A;  1JO5 A;  5TJH A;  2L91 A;  2ZVO B;  4GOD A;  3E1R A;  1GW3 A;  1MKM A;  2FYZ A;  2AEF A;  4RJT A;  4DCK A;  1ZW0 A;  5KJ7 D;  2JWA A;  1SQQ K;  4R4M A;  4R4L A;  2M5A A;  2JKV A;  1N7S D;  1TU3 F;  3CWB D;  1KQS O;  4GOF A;  4UB6 H;  1RE3 C;  2IPP A;  2ZYA A;  3H1L E;  2UWJ E;  2OYI C;  1J1E B;  3P8C E;  2QE7 H;  3HD7 B;  3L73 E;  4PD4 D;  4WY4 C;  2BCC D;  1KV4 A;  1IK9 A;  3VMY A;  2WSF J;  2E5Y A;  1HGV A;  3L74 E;  3GG2 A;  3RL0 g;  1KC8 Q;  2NPS D;  3FWL A;  1LTS C;  5GTH H;  1H0T A;  1L0L K;  1ZP0 C;  3JSV C;  4M3L A;  5APQ A;  3G9R A;  2QJP B;  3Q5P A;  1PPJ G;  4ZNC A;  2XKM A;  1Q86 Q;  1NWQ A;  1ZLL A;  5CCH D;  2P58 A;  4JPZ B;  3BAS A;  5KLV E;  1HUC A;  2B87 A;  2HG5 D;  3TDK A;  1SQX G;  2LR2 A;  1PZQ A;  3C9I A;  2YKP A;  3H1L J;  2QJY B;  3CXH D;  1K73 Q;  4C7R A;  1BSN A;  2M3B A;  2N1T A;  1URQ D;  1BGY D;  2E74 C;  1T2K D;  3Q5S A;  2MKV A;  2O01 J;  4KJM A;  5AVY B;  1SQP J;  2GUS A;  5BU5 A;  4N6J A;  4OVN F;  1Q7Y Q;  1NKN A;  2JJL A;  1R5S A;  5BVZ A;  3FXE A;  1OIP A;  2NRG A;  1HTL C;  4U3F G;  2FYU D;  1KB9 E;  1X22 A;  1G2C A;  3LID A;  2O1K A;  1QL2 A;  4BRY A;  3IN6 A;  2E43 A;  2P1J A;  3A5T A;  1NKZ B;  3TGU G;  1IC2 A;  1P84 E;  3D6Z A;  1JMB A;  4C7N A;  3V4W A;  2XND H;  1JM0 A;  4H13 D;  5AVU B;  1KZU B;  1LT9 C;  3EWK A;  4NPF X;  3MIW A;  1VF5 C;  3TSI A;  3R4Y A;  4HKZ H;  1FZC B;  3CCU P;  1GDT A;  2Q3E A;  3IR9 A;  3VN0 A;  2KSE A;  3II6 A;  3VOP A;  2SPZ A;  4Z1M H;  2O01 H;  3GHG B;  3CI9 A;  1JEK A;  4H0L B;  2GM4 A;  2PP6 A;  2J59 M;  1YIJ P;  3BRV B;  1KD1 Q;  2K9J A;  3O6Q A;  2FXO A;  1LTJ C;  1OFC X;  2Y9Z A;  2G3A A;  3QH9 A;  1YQ4 C;  1MFZ A;  3WUV A;  2A45 I;  1PPJ D;  1HF9 A;  2FKW B;  3RL0 D;  4H44 C;  3I56 P;  1SFC A;  2YKO A;  2WTY A;  1SQQ D;  2N1T D;  2C9N Y;  2OYI B;  1NTM K;  2FFD B;  2ZJS E;  1NTZ K;  2WIT A;  1J1D B;  4ZMD A;  1FZE A;  4WY4 B;  1X79 B;  3M9Q A;  4K3A A;  1SQX D;  5AVZ B;  3HTK B;  3AE3 C;  3WUT A;  3IFM A;  4WVZ A;  4I6M C;  1KYO I;  2A06 G;  2FYU J;  3O8Z A;  1FOS F;  3KYQ A;  3L35 A;  2Z5I A;  2ZAE B;  3GW6 A;  1RF0 C;  4IFM A;  5AVV B;  1N7L A;  5AW2 B;  3K5B A;  4C46 A;  2NPS B;  1OVU A;  3OW2 O;  3ITK A;  1BDC A;  1S2E A;  2W6A A;  2I8D A;  2E75 C;  2QJK C;  1FZF A;  5KLI B;  1KB9 H;  3AE9 C;  3CCQ P;  1OW6 A;  4D6T E;  3L72 E;  5APT A;  2RKL A;  4EOT A;  1OZH A;  3USS A;  4IFD K;  3TGU D;  1P84 H;  1L4A D;  5CJ4 A;  1NTK G;  2WSS H;  3MD0 A;  3U1A A;  1GU5 A;  1SQP K;  1JY2 N;  2NZ2 A;  1IZN B;  2ITA A;  1EDK A;  4GT1 A;  1GMJ A;  3H1J E;  2H43 A;  1SQV E;  3KHU A;  3L4F A;  3BCC E;  1KB9 I;  2W8Z A;  2K1A A;  1E79 H;  1L0N E;  1CSB A;  2OTL P;  4DZO A;  1X8Y A;  1BE3 J;  2M5A B;  1PP9 J;  5APS A;  2Q9I A;  3P8M C;  1GL2 A;  1LWU A;  4DJG A;  3L37 A;  5B66 E;  1SFC C;  1VQK P;  4A7P A;  3H1L G;  3SSU A;  3WUU A;  3AE7 C;  2W27 A;  1J1E C;  3L73 G;  1VF5 B;  3HD7 C;  5AW1 B;  4ZKU A;  4PJ0 E;  1K04 A;  1SQP G;  3RBZ A;  3TF5 A;  1QVG O;  3F5H A;  3L74 G;  5AVS B;  1OWA A;  2L5G B;  2W83 C;  1DIP A;  1AQT A;  3B5N D;  1H0T B;  2E76 D;  3LW5 J;  4ZKP A;  3H1J J;  1EXI A;  1M90 Q;  2A06 D;  4U3F J;  1YIT P;  3RK3 D;  1HGZ A;  3C1L A;  1HJ0 A;  5CJ0 A;  1KN7 A;  1QGK B;  2POH A;  1BCC E;  1PGQ A;  1MZ9 A;  3N7N A;  3F89 A;  1NO4 A;  3L70 J;  3Q3D A;  1FDO A;  3G6E P;  1X0T A;  2B87 B;  2Y9Y A;  2B89 A;  1ZR4 A;  2HOD A;  1LNQ A;  3MZW B;  4OGQ D;  1EZV I;  2HFE D;  1N7S A;  1SQB J;  4OH8 B;  3RL0 B;  1JOC A;  2AXT E;  3LIE A;  2QJY C;  1IK7 A;  2N1T B;  1YHQ P;  4L75 A;  2IX7 C;  1KFN A;  3TNU A;  1NTK D;  4CPG A;  1IJD B;  4RES B;  1S3J A;  2FYU K;  3CX5 E;  5APU A;  3QWO C;  2Q7C A;  1G2C B;  3L75 E;  4IL6 X;  2ZT9 C;  4BRY B;  1VQN P;  3H1H J;  1M1J A;  3E7K A;  4C7N B;  5AW6 B;  3V2P A;  3M0D C;  1AA0 A;  4TT3 H;  4LC1 A;  3U59 A;  5CCH A;  3W68 A;  5B66 H;  2RH0 A;  1AJY A;  5B5E E;  1ZME C;  3H1L D;  2QSI A;  3AEA C;  2J58 A;  5DJU B;  1NTM E;  1URQ A;  3L73 D;  3CME P;  1NJI Q;  4PJ0 H;  1HWT C;  5CBO A;  1SQP D;  4W7Y A;  3L74 D;  4ASV A;  3CC4 P;  1AQ5 A;  4O9B A;  5AW9 B;  1KYO D;  4H0L C;  1ZRT E;  1JY2 O;  2K9J B;  3SFD C;  1MUU A;  1LTA C;  1M57 D;  5E79 E;  2KLV A;  1PFI A;  3V2R A;  3BVH A;  2IFM A;  2M3E A;  2AEJ A;  3H1I E;  1Y9B A;  3A3Y B;  1SFC B;  2JP3 A;  5KJ7 C;  2W6J H;  3NTN A;  1EZV G;  1Z56 A;  1GTW A;  1N7S C;  3MGN A;  4JQ0 D;  1GU4 A;  1SQX K;  1A02 J;  2FFD C;  3AE2 C;  1J1D C;  1R8E A;  1AVO A;  1NTK J;  4TLF A;  2WVR A;  3AEB C;  2OYH A;  1X9V A;  3L71 J;  3PJS K;  1ZN5 A;  2K9Y A;  3RK2 D;  2AXT H;  1T3J A;  3GLM A;  4PV1 D;  3M91 A;  1PGJ A;  1DEB A;  2YMK A;  2ZXX A;  2G8Y A;  3B71 A;  4LLH A;  2C9L Y;  2NPS C;  3HRN A;  3S9O A;  2HR3 A;  1VDF A;  4EYY Q;  3Q2Y A;  1RQV A;  3A0B E;  4KHX A;  3HE5 A;  3CX5 H;  4W80 A;  1KFM A;  2C0X A;  1YTZ I;  1BE3 G;  1IO4 A;  1KB9 D;  1RE4 A;  1PP9 G;  5K5G B;  5KLI C;  1KIL A;  2KUB A;  3CLQ A;  4D6T G;  2WT7 A;  3H1K E;  3SWF A;  3NFQ A;  1GK4 A;  3CWB E;  5KKZ B;  3AEC C;  3KPE A;  1SQB K;  2R32 A;  2M0B A;  4HJG H;  1K8A Q;  1S9K D;  3Q1M A;  1ZV8 A;  3L73 J;  2P7J A;  1XTC C;  1VQ6 P;  3PTZ A;  1JNM A;  2BCC E;  1URQ C;  2KK7 A;  3L74 J;  1T2K C;  2HPC A;  1U57 A;  3B4S A;  3CCM P;  1EDJ A;  5B5E H;  3H1J G;  1U7M A;  1EC5 A;  1JY3 N;  1SQV G;  3VMX A;  2KB7 P;  1FE6 A;  4HYT B;  2ZT9 B;  3SFE C;  1L0N G;  2QM8 A;  1DD3 A;  3OA7 A;  5AW8 B;  1IFP A;  3NXS A;  2P2U A;  3L70 G;  3H6P A;  3E1I A;  2IZ1 A;  4WB4 A;  1GL2 B;  1LWU B;  5KLV J;  4JBZ A;  1VQ8 P;  1FDI A;  1NHL A;  1SQB G;  3H1K J;  5E79 H;  1IFM A;  2V7Q H;  4H13 C;  2ZXE B;  1PGP A;  5AVW B;  5APV A;  1LGH B;  1W2B O;  1FJP A;  3CXH E;  3GMA A;  1EDI A;  2CPS A;  1EZV D;  1L4A A;  1BGY E;  4YTP C;  2XDJ A;  1USE A;  2QEX P;  3JC2 2;  4UB8 E;  1JTH A;  2LXC B;  2IBZ E;  1L2P A;  4L76 A;  1N73 A;  3D71 A;  1N86 A;  1KIL D;  5CCG D;  2WSC H;  1NU1 E;  3AE8 C;  3I5C A;  5AVQ B;  4B86 A;  3H1H G;  3L36 A;  5KAF E;  1BCC G;  1MFT A;  1OMI A;  3AE6 C;  3OJA B;  1NH4 A;  4MN4 C;  2YMY A;  2JEE A;  3A0B H;  2YKQ A;  2HOD B;  1BE3 D;  2O01 N;  2KI7 B;  1PP9 D;  4YPC A;  1N7S B;  3RL0 C;  4D6T D;  2MJZ A;  1YJW P;  2Q1K A;  2N1T C;  2J5U A;  2YXQ B;  3PRJ A;  1NTK K;  2H89 C;  2KLU A;  3M0A A;  4Y99 B;  3TNU B;  1KQF B;  2WSE H;  3IAO A;  2HLO A;  1GZL A;  2JR8 A;  3RK2 B;  4PV1 B;  3G71 P;  3VMZ A;  1JCC A;  3MUD A;  3B5N A;  1RQU A;  1RH5 B;  1OXZ A;  4AQR D;  3H1J D;  1U7J A;  2JWD A;  2RN0 A;  1SQV D;  1NYH A;  4NPE A;  1M1J B;  4U3F D;  1FDM A;  1RF1 A;  1T6A A;  1L0N D;  1Y8A A;  3P7K A;  1QLE D;  1W5C E;  1PPJ E;  3L70 D;  1SQQ E;  4DT0 A;  2DW3 A;  1SQB D;  3L71 G;  2FXP A;  1OVV A;  3V5B A;  1EXJ A;  2OTJ P;  1URQ B;  2QVA A;  2Q3I A;  1SLQ A;  1UIX A;  3CXH H;  2WPV B;  2GUV A;  3CMA P;  3VP9 A;  1EDL A;  2OGU A;  1L0L E;  4UB8 H;  3G4S P;  2YIU C;  1FAV A;  2R3C A;  2LKM A;  1JY3 O;  1PGO A;  4I2L C;  3A0H E;  1P84 I;  3AE1 C;  2IYP A;  3A7O A;  4D6T J;  2YNY A;  3L72 J;  1H8A A;  3H1H D;  3MTU E;  1W2E A;  5KAF H;  1BCC D;  5KLV K;  1YTZ T;  1FOS E;  3D6Y A;  4H13 B;  1T8Z A;  3TGU E;  3CC7 P;  2OYH B;  1GK6 A;  1YQ3 C;  2C0W A;  1YI2 P;  3HD7 D;  4QMA A;  1JY2 P;  3VYI A;  2E42 A;  2JDI H;  3UIA A;  1N8R Q;  3B5N C;  1SQV J;  2E76 C;  4L74 A;  3BCC J;  4XFJ A;  3G3Z A;  2KS1 A;  4EI2 A;  3HE5 B;  1L0N J;  2V4H A;  2D2C D;  1L0L J;  3ABV C;  1KIL B;  4N78 E;  3S4R A;  5KLV G;  2WT7 B;  3VTP C;  3H1K G;  1JMM A;  4AYC A;  1CW5 A;  3S1K A;  3H32 A;  2Z4E A;  5KKZ C;  4AUW A;  5AW0 B;  3TYY A;  3SWY A;  1S5L E;  1SS1 A;  4OGQ C;  4GDO A;  3EFG A;  1HH0 A;  1RE3 A;  2YO3 A;  3KDP B;  1VQ4 P;  1HVV A;  2HPC B;  3SWK A;  3L71 D;  4JF7 A;  5TIS E;  1FU1 A;  1JCD A;  5KTB A;  3FGA D;  3N4X A;  3CCL P;  1KMI Z;  4NPD A;  1PL5 A;  1KQG B;  3BRT B;  2IYO A;  1BCC J;  1Y47 A;  1Q2N A;  1GL2 C; 
#chains in the Genus database with same CATH homology
 1LWU C;  3CLQ A;  5AVR B;  4N78 D;  2WT7 A;  1MFZ A;  2A45 I;  1SFC D;  3SWF A;  2FKW B;  2VRS A;  3NFQ A;  1GK4 A;  3RL0 D;  3V2N A;  2A45 G;  1SFC A;  5CHX A;  3KPE A;  1FBM A;  3M0D A;  2YKO A;  2WTY A;  2ZFC A;  2N1T D;  2C9N Y;  1SQB K;  1SVF A;  2R32 A;  2KYV A;  2OYI B;  1NTM K;  1GD2 E;  1S9K D;  1LT9 B;  4XE5 B;  2FFD B;  1ZV8 A;  1L4A B;  2CPB A;  4W7Z A;  1H88 A;  1NTZ K;  2P7J A;  2WIT A;  1J1D B;  2N9B A;  3P8C D;  3M06 A;  1FZE A;  1XTC C;  4WY4 B;  1X79 B;  3M9Q A;  2KP8 A;  5AVZ B;  1T3U A;  1JNM A;  1URQ C;  3HTK B;  1FZC A;  1J2J B;  5AVT B;  1T2K C;  1JTH B;  3IFM A;  2HPC A;  2WWW A;  4I6M C;  3O8Z A;  1N73 B;  1FOS F;  3KYQ A;  3L35 A;  1JY3 N;  2Z5I A;  3VMX A;  1RF0 C;  4IFM A;  2KB7 P;  5AVV B;  1A02 F;  1CZQ A;  1KQL A;  1N7L A;  4HYT B;  5AW2 B;  1LTG C;  4C46 A;  2QM8 A;  2NPS B;  3GHG A;  3RK3 C;  1RF1 C;  1LTB C;  3OA7 A;  5CMZ A;  5AW8 B;  3VP8 A;  1NOH A;  2W6A A;  2Q5U A;  3NXS A;  1FZA A;  2P2U A;  1DH3 A;  2YO2 A;  1FZF A;  3H6P A;  1LTJ B;  3E1I A;  4WB4 A;  1GL2 B;  2H8P D;  1LWU B;  5AW5 B;  5APT A;  4EIJ A;  1NHL A;  4EOT A;  1IFM A;  1DX7 A;  5KJ7 A;  2ZXE B;  4IFD K;  5AVW B;  5APV A;  4DOJ A;  3V2Q A;  1L4A D;  5CJ4 A;  1LGH B;  1FJP A;  2OYI A;  4Y99 C;  2WPS A;  1LT9 A;  2CPS A;  2FFD A;  3MD0 A;  1L4A A;  4WY4 D;  5APX A;  2WZ7 A;  4WY4 A;  3U1A A;  2KOG A;  2XDJ A;  1GU5 A;  1SQP K;  3RK2 C;  1JY2 N;  3HTK A;  3BAT A;  1JTH A;  3B5N B;  4GT1 A;  1SQV K;  2OAR A;  1N73 A;  1NU1 K;  2H43 A;  4N3Y B;  3L4F A;  1L0N K;  1N86 A;  1KIL D;  5CCG D;  2WSC H;  4B86 A;  3I5C A;  5AVQ B;  3HUS B;  1M1J C;  1HBW A;  3L36 A;  2NPS A;  1G1I A;  3CL3 D;  3RK3 B;  5CCG A;  1RF1 B;  1CSB A;  1YYC A;  4DZO A;  2I1K A;  3OJA B;  1X8Y A;  1NH4 A;  3LW5 H;  2I1J A;  3R2P A;  5CCH C;  1LTT C;  1CI6 B;  2YMY A;  1GL2 D;  2JEE A;  1IFJ A;  1LTJ A;  2Q9I A;  5APS A;  3P8M C;  2YKQ A;  2HOD B;  1GL2 A;  1LWU A;  1NAF A;  3L37 A;  1SFC C;  1N7S B;  2WPR A;  1G1J A;  2Z5H A;  3RL0 C;  1FJK A;  2BAS A;  3HE4 B;  2M8R A;  2MJZ A;  2W27 A;  2N1T C;  1J1E C;  3HD7 C;  1NTK K;  2KSJ A;  5AW1 B;  4ZKU A;  2FXM A;  3M0A A;  4Y99 B;  1XTG B;  3TNU B;  2WSE H;  1FZC C;  1FZG A;  1IFD A;  3PP5 A;  1JUN A;  2XU6 A;  2PAJ A;  5AVS B;  2HLO A;  1OWA A;  2L5G B;  1GZL A;  3RK2 B;  3EQ2 A;  3B5N D;  3VMZ A;  1JCC A;  3MUD A;  4JYB A;  2QM7 A;  3B5N A;  3KQG A;  4ZKP A;  1E5W A;  1OXZ A;  3GHG C;  1MV8 A;  3U1C A;  4AQR D;  1H89 A;  1RF0 A;  1HJB A;  1JO5 A;  2WSF H;  2XV5 A;  3RK3 D;  1HGZ A;  1M1J B;  3HUS A;  5CJ0 A;  2POH A;  1FDM A;  1RF1 A;  1GW3 A;  2FYZ A;  1MZ9 A;  3N7N A;  2XNX A;  1AFO A;  3P7K A;  4GKG A;  1NO4 A;  5KJ7 D;  4IFF A;  1CI6 A;  3TK1 A;  4I1L A;  1SQQ K;  1FZB A;  1EQ7 A;  2H7H A;  1IFN A;  1ZR4 A;  1N7S D;  2HOD A;  1RE3 C;  3OAK A;  1SP4 A;  2OYH C;  2HFE D;  1N7S A;  3M9H A;  4OH8 B;  3RL0 B;  1JOC A;  1WT6 A;  5AW4 B;  2IPP A;  3LIE A;  4JYC A;  1S9K E;  5APW A;  3HE4 A;  2OYI C;  2N1T B;  1J1E B;  3P8C E;  2IX7 C;  1KFN A;  3HD7 B;  3V5B A;  1URQ B;  4WY4 C;  2A45 H;  2Q3I A;  1IK9 A;  3A2A A;  1SLQ A;  3TNU A;  3T97 A;  3VMY A;  1IJD B;  1JY3 P;  1HGV A;  4RES B;  2GUV A;  2R5B A;  2FYU K;  2NPS D;  3VP9 A;  5APU A;  1LTS C;  1L0L K;  2Q7C A;  3WMM 0;  1G2C B;  4M3L A;  5APQ A;  2R5D A;  1RE4 C;  2IFN A;  1KIL C;  5CCG C;  1FAV A;  2R3C A;  2HYN A;  5BU8 B;  2LKM A;  1JY3 O;  4I2L C;  4WBA A;  1M1J A;  2XKM A;  1NWQ A;  3H32 B;  1ZR2 A;  1ZLL A;  3A7O A;  2YNY A;  1H8A A;  4C7N B;  5AW6 B;  5CCH D;  3MTU E;  3V2P A;  1W2E A;  3M0D C;  5KLV K;  1YTZ T;  4LC1 A;  3U59 A;  5CCH A;  3BAS A;  1FOS E;  1HUC A;  2HG5 D;  1T8Z A;  2OYH B;  1GK6 A;  2P67 A;  2C0W A;  3C9I A;  2YKP A;  4C7R A;  3HD7 D;  2M3B A;  2N1T A;  2J58 A;  1URQ D;  3B8E B;  1JY2 P;  2XZR A;  3HD7 A;  1T2K D;  5APY A;  3VYI A;  1GW4 A;  2E42 A;  5AVY B;  1URQ A;  2O1J A;  1N2D C;  2GUS A;  4HH2 A;  3UIA A;  1HWT C;  5BU5 A;  4N6J A;  4XA4 A;  1NKN A;  4W7Y A;  2JJL A;  3B5N C;  5BVZ A;  1AQ5 A;  3G3Z A;  4O9B A;  5AW9 B;  1WRG A;  3HE5 B;  1HTL C;  1JY2 O;  1G2C A;  4LGD E;  1MUU A;  3LID A;  2O1K A;  3HUS C;  1QL2 A;  1KIL B;  1LTA C;  4N78 E;  2E43 A;  2KLV A;  1PFI A;  2P1J A;  2WT7 B;  3A5T A;  1NKZ B;  3V2R A;  3BVH A;  2IFM A;  3VTP C;  1JMM A;  4AYC A;  3A3Y B;  1CW5 A;  3H32 A;  1IC2 A;  2Z4E A;  1SFC B;  5KJ7 C;  5AW3 B;  4C7N A;  4AUW A;  1VPC A;  5AW0 B;  3V4W A;  3TYY A;  3NTN A;  5AVU B;  3SWY A;  1Z56 A;  1GTW A;  1N7S C;  3MGN A;  1GU4 A;  1SQX K;  1KZU B;  1LT9 C;  1A02 J;  2FFD C;  1L4A C;  1J1D C;  3EFG A;  1HH0 A;  3NMD A;  1LTI C;  1RE3 A;  3MIW A;  2YO3 A;  3TSI A;  2OYH A;  1IFI A;  3KDP B;  1HVV A;  1RY3 A;  1X9V A;  1FZC B;  1ZN5 A;  2HPC B;  2W6B A;  3RK2 D;  1T3J A;  1GDT A;  3M91 A;  3M9B A;  3V4Q A;  1DEB A;  3IR9 A;  1QL1 A;  4JF7 A;  3VN0 A;  1N73 C;  1FU1 A;  1JCD A;  5KTB A;  4LLH A;  3II6 A;  3VOP A;  5AVX B;  2O01 H;  2C9L Y;  2WPQ A;  3N4X A;  2NPS C;  3HRN A;  3GHG B;  3P32 A;  1VDF A;  5AW7 B;  3CI9 A;  1M7L A;  4GIF A;  4KHX A;  3HE5 A;  2GM4 A;  2PP6 A;  3BRT B;  2J59 M;  4W80 A;  1KFM A;  2C0X A;  3BRV B;  1YTZ I;  1LTJ C;  1IO4 A;  1RE4 A;  1GL2 C;  1KIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...