3MGNA

D-peptide inhibitor pie71 in complex with iqn17
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/viral protein inhibitor
molecule keywords IQN17
publication title Design of a potent D-peptide HIV-1 entry inhibitor with a strong barrier to resistance.
pubmed doi rcsb
total genus 20
structure length 45
sequence length 45
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3mgnA00
2N9BA 3TK1A 1T2KC 3O8ZA 2QM8A 1SLQA 5AVRB 4GT1A 5AVSB 2VRSA 1OWAA 3OAKA 3A2AA 3NXSA 5AVXB 3KDPB 4AUWA 1MUUA 3LIEA 4JYCA 3HE5A 1CI6A 5AVUB 2WT7B 4C46A 3T97A 4C7NB 5AW5B 1GU4A 3A5TA 2YO3A 4XE5B 1H88A 4B86A 1IO4A 1A02F 3HE4A 5APSA 3VMZA 5AVTB 3KQGA 2YO2A 1JNMA 1A02J 3NFQA 5AVVB 3B8EB 2BASA 4M3LA 3V4WA 1H89A 2E43A 3M06A 2P7JA 1CZQA 4GKGA 5AW4B 5APXA 3VN0A 3A3YB 1GK6A 5AW2B 5AVWB 3M9HA 3SWFA 4EOTA 3LIDA 2KP8A 3M91A 4LC1A 3TNUA 1S9KE 3IR9A 2WTYA 5APUA 1SP4A 1CI6B 5AW7B 5AW8B 2Q7CA 4I2LC 1GK4A 2C9NY 5APWA 2WPRA 2YNYA 1H8AA 3P8MC 3HE4B 4RESB 2WPQA 2ZXEB 1FOSE 2Q3IA 5AVZB 3NMDA 1HJBA 2H7HA 2R3CA 2P2UA 2ZFCA 4KHXA 2W6AA 1G2CB 5APYA 3HTKA 4AQRD 3MD0A 5AW1B 5CMZA 1NAFA 2XZRA 5AW6B 1JUNA 1X8YA 3VMXA 2WT7A 2XV5A 2P67A 4JYBA 1NWQA 1HBWA 2WPSA 1GZLA 5APVA 2R32A 3I5CA 2R5BA 3MGNA 2XU6A 5AW9B 2W27A 5AVQB 3HE5B 1HUCA 1T2KD 1FOSF 2QM7A 3A7OA 2Q5UA 4DZOA 5APQA 1YYCA 3VYIA 2WWWA 3P32A 1GTWA 1HWTC 2R5DA 3L35A 3VTPC 3L37A 4AYCA 5AW0B 1OXZA 3M9BA 1J2JB 2Z5IA 3P7KA 3M0AA 4HYTB 5AVYB 3V5BA 2JJLA 3NTNA 3L36A 3UIAA 2C9LY 5APTA 1MV8A 1FAVA 4C7NA 3M0DA 3VMYA 5AW3B 4I6MC 1GD2E 3TNUB 2E42A 3V4QA 1GU5A 1MFZA 2Z5HA 1DH3A 2IPPA 1CSBA 1S9KD 1KQLA 3TYYA
chains in the Genus database with same CATH superfamily
3JCUE 2VRSA 3CC7P 4IOIH 3VMAA 1RE3C 3QH9A 4O9BA 5AW5B 1H88A 1MZ9A 2IFMA 5APSA 2I1KA 3CCVP 5GTIH 2YKQA 3H1LE 5AVVB 3AEBC 1NTMK 2I1JA 2OARA 5KLVG 1NOHA 3M9QA 1N73C 1RQVA 2OGUA 3HUSC 2E76C 3MIWA 5APUA 1N2DC 3H1HG 3H1IG 2AXTH 3L74G 4OGQD 3O6QA 3H25A 3II6A 5CCHD 1XTGB 2FXMA 1OVRA 5KKZC 1JUNA 4KT0J 1GZLA 2OTLP 1RF1B 1FOSF 2QM7A 1SVFA 1T3JA 3L4FA 1L0NG 3EFFK 2Q3EA 4PD4H 3JC22 4UB6E 1FS0E 1SFCB 2SPZA 1X0TA 3L71G 1IK7A 2K9JB 3H1IJ 4PD4I 2XNDH 3PTZA 1GW3A 1H0TA 3FXDA 3L75E 3CCMP 5AVSB 2QG4A 2GM4A 4MN4C 2RN0A 2J58A 3RBXA 1HGZA 3L75J 3BVHA 1X22A 1XTCC 1IFJA 3BCCG 3L71J 4U7JA 2V4HA 1FZCA 1U57A 1SQVD 2WPQA 1FOSE 3WU2H 5KAIH 4I7ZC 4TT3H 5AW1B 2IBZD 3CX5E 2WSEH 3I5CA 2AEMA 4NPDA 1P84H 3K5BA 1L0LG 2K1AA 3H1JG 3O6QB 4XFJA 2IZ1A 3L37A 1KILA 3TGUG 2Z5IA 4Y99B 4OGQC 3VP9A 1URQA 3V5BA 3RL0B 1Q82Q 3AE6C 1FAVA 5CCHC 3KXDA 2YMYA 1P84I 4H13D 4YPCA 5KTBA 4ASVA 5TISH 4PV1D 1ZXGA 4IFDK 3FX0A 1OW6A 2HODA 2KIKA 4ZMDA 2E74B 1Q90D 2YKPA 1NTME 3VMZA 1L0LJ 1JB0J 1KFNA 4UB8E 1IFDA 2ZYAA 3L72D 2OYIC 1H0TB 1NU1D 3AE1C 3V4WA 2E43A 1DEEG 4GKGA 2P7JA 1CZQA 1YTZT 2RH0A 1NYHA 2O01N 2KZJA 2P10A 2P1JA 2B9BA 3TSIA 1NTMJ 1FDOA 5B5EE 2Q3IA 3HRNA 2ZVNB 2R3CA 1PFIA 2POHA 1PP9G 2WPSA 3CX5H 1LP1B 2DW3A 3SWKA 1JM0A 2QJKB 1PIXA 1JY3P 3GHGB 1T8ZA 1FZCB 2A06D 1LT9C 1NTKG 1S1CX 2R44A 2LXBA 3U1AA 3JSVC 1YHQP 1PV3A 1YITP 2WSCH 4RKUJ 1RE3A 3AEAC 3RK3E 3KZIE 3TDKA 1MFZA 1EZVE 1NVOA 2M3BA 2QM8A 1WT6A 3U59A 3CWBD 1PP9J 1N73A 3A5TA 4JF7A 3A0HE 3CXHE 3HUSA 2M3EA 1LGHB 4H0LD 4H13C 1BE3D 4M3LA 4PV1C 2QJYB 3AE3C 3KPEA 3LIDA 1FZAA 2FFDC 1SQXK 1KTMA 2FXOA 1OFCX 1D7MA 1L2PA 2JDIH 2P2UA 5CBOA 5CCGD 3HTKA 1SQBG 2JKVA 1RF0C 1HBWA 5APVA 2PAJA 4RJTA 1KQGB 2KSJA 3EWKA 5KAFH 1T2KD 4IFMA 1X9VA 2FYNB 2AEFA 1FU1A 1Y47A 2BEQD 1VQOP 3NTNA 1NTZG 5EFWB 1VQLP 1VQKP 1GD2E 1N7SB 5KLVD 1GU5A 4BWNA 1HGVA 2Y0CA 3Q3DA 1BGYE 2BEZF 2YIUC 3H1HD 3H1ID 2AXCA 3L74D 4GT1A 3I56P 3G3ZA 1R8EA 4WVZA 3H32A 1ZOYC 3D70A 3GW6A 1VPCA 4XE5B 4D6TG 4ZNCA 1BDDA 1SQPE 1LWUC 3I55P 2J59M 1BGYJ 1QGKB 1GDTA 2JEEA 2QEXP 1L0ND 5APXA 2O1JA 3P8CD 2FYUE 3S4RA 1NHLA 3IR9A 3IN6A 3A0BH 1N73B 1SQPJ 1K05A 3HUSB 1QX8A 2E76B 5GTIE 3B5ND 1MKMA 5CJ4A 1HJBA 3H1KG 4HJGH 5CMZA 2FYUJ 4H0LC 4JYBA 4QMAA 4N3YB 5KKZB 2AXTE 4DZOA 5CCHA 1KB9D 5B66H 1QEXA 2G3AA 3RL0g 1S5LH 3N7NA 4RO0A 1IFMA 5CHXA 5CCGC 3TNUB 2IBZI 3BCCD 4PD4E 2NPSD 3LW5H 1VQPP 1T2KC 1KILE 1AQ5A 3H1KJ 1NKNA 3CLQA 2OYIA 2KB7P 3BRVB 1EDIA 2OTJP 4C46A 4U3FE 1DEBA 2L5GB 3BRTB 4I1LA 3AEGC 3H1LG 5KLIC 3SWYA 3Q5SA 3E7KA 1AQTA 1SQXE 5AW2B 3H1JD 5H2FE 3F89A 3H32B 4U3FJ 2WMMA 1S9KE 1VQNP 3TGUD 2FKWB 5GTHE 4I2LC 4WBAA 1H8AA 1SQQK 1JY2N 1KMIZ 1NJIQ 1S4XA 1JO5A 1M1JC 4AQRD 1KFMA 1LT9A 3PP5A 5AW6B 2KNCA 2CPBA 3ZDMA 2R5BA 1S3JA 2E5TA 1GL2D 3AE4C 3V2PA 4I7ZB 2QRXA 3HE5B 3EFGA 5APQA 2PFXA 1KYOD 2A45G 1M1KQ 3H1LJ 1QL1A 4GOEA 1W5CE 1UIXA 4WY4D 4IL6X 3WU2E 5KAIE 2D2CD 2KS1A 1Y8AA 3P7KA 2L91A 1NO4A 1J1DC 1M8OB 4EDFA 1EDKA 3L36A 3HD7D 3B5NC 4C7NA 2V7QH 1YTZI 4OGQB 2O01H 3AECC 1P84E 1DH3A 1PPJE 3V2NA 2WITA 4BXLA 1OVVA 3L75G 1IZNB 2W90A 2WSEJ 1USEA 4JYCA 1K73Q 2WT7B 3T97A 4A7PA 4B86A 3L70E 2FFDA 1ZMEC 2HR3A 5TISE 2PRRA 3L74E 1A02F 4GODA 1LJ2A 3RK3B 2KOGA 2IZ0A 1VDFA 1LTJC 2W6JH 1OMIA 2NPSC 1GMJA 5H2FH 2OYIB 1NTKD 3L73E 1SP4A 5GTHH 3L70J 5AW7B 5AW8B 1RF0A 3PH0A 2QE7H 2YNYA 5BU5A 4NPEA 2N9YB 1HVVA 4EYYQ 3MP7B 1KZUB 1DD3A 2XZRA 2I8DA 1IK9A 2PGDA 2JP3A 2QIWA 1KORA 2JWDA 3L73J 3SSUA 5AW9B 1IFNA 1QVFO 1YYCA 3FWLA 1ZLLA 1JY2O 4AYCA 5AW0B 1M56D 1J2JB 3RK2D 1IFIA 1LTAC 2KNCB 1GW4A 2OYOA 5AW3B 2E42A 2HYNA 3AE8C 3MUDC 1UIIA 3AE7C 3R2PA 1SQVK 2QVAA 1Y9BA 1BCCE 1GL2C 1YIJP 1LWUA 2OQQA 1SLQA 4R4MA 2KS1B 3A2AA 4OVNF 4WY4C 1VQ4P 3LIEA 2FBWC 3RL0D 2D2CC 4C7NB 3OA7A 1SQBD 2IFNA 2M0BA 3HD7C 2HPCA 1ZRTD 1NTMG 2LKMA 1BCCJ 2E5YA 1JNMA 2OYHC 1A02J 2KZIA 3B8EB 2BCCE 3GG2A 1E5WA 3GMAA 3MTUE 1L4AD 1OW8A 4H13B 1SQBK 2GUVA 1PGJA 2WSCJ 1SQQE 1EDJA 1NTZD 3OJAB 1MFTA 2FFDB 2KSEA 4L76A 3AEDC 3CCSP 1N8RQ 2BCCJ 1AA0A 1KN7A 3CCJP 1KC8Q 2XU6A 1YI2P 3CD6P 1FDIA 5CCGA 4DJGA 3WUVA 1G1IA 1NU1K 4D6TD 1VQ5P 2K9YA 1EXIA 3SFDC 1KV4A 2B89A 4KJMA 1RQUA 5KAFE 1VF5D 2ZT9B 1EZVG 1J1EC 3AE2C 1IJDB 5AVRB 2YKOA 1KB9I 1RE4C 5AVXB 2YIUB 2WZ7A 2B87A 4C7RA 1LNQA 3H1KD 2WSFH 1NH4A 3RK2C 3GLMA 2YXRB 2KK7A 1NKZB 3KQGA 2GA1A 3IAOA 3M06A 1KILB 2R3SA 3M9HA 1M1JA 1URQB 2HG5D 4N78D 1QVGO 3H6PA 2ZYDA 3C9IA 1KQSO 2HPCB 2XNXA 3RL0C 3AE9C 1FE6A 1N7LA 2HODB 1BSHA 1WRGA 3B5NA 2H88C 3A0BE 1L4AC 2Q5UA 4H0LB 2Y9YA 1WMKA 3WMM0 3P32A 3D6YA 1HJ0A 3G4SP 2QJPC 2ZYGA 3FXEA 2JJLA 3H1LD 1S72P 2W6BA 1DX7A 1KYOH 1MV8A 1SQVE 3CMAP 3V4QA 3D6ZA 1Z56A 1EXJA 1CW5A 5B66E 1BGYG 2NRGA 1FJPA 2IBZE 1LTTC 5E79H 1S5LE 3E1IA 1OWAA 2HFED 2JO1A 1KYOI 5M1BA 1LTJA 1AV1A 1PL5A 3AEEC 3N4XA 2NPSA 2K3RA 1SQPG 1YBKA 1N7SD 3S9OA 4YTPC 2XKMA 3CI9A 4H44D 1VF5C 4OWFA 1GK6A 2OTKE 2Y9ZA 2FYUG 5KLIB 4GOFA 3IF4A 3GHGC 2Q9IA 2WTYA 5KLVK 5APWA 3AE5C 1JTHA 3C1LA 4HB1A 3MZWB 3LW5J 2H7HA 4XA4A 4K35A 1NWQA 3L75D 1HF9A 2IX7C 1M1JB 3L72E 1ZW0A 2N1TD 1NU1E 1GTWA 3L71D 3MUDA 2WQYC 1L0NK 3V6IA 2KLUA 1GL2A 3M0AA 4BRYA 3B71A 2ZVOB 3L72J 1J1DB 1NU1J 4WY4A 2Z5HA 2WSSH 2N9BA 3TYYA 1AVYA 3HD7A 1BSNA 2C0XA 3O8ZA 3PHLA 2KYVA 2OYHA 3HTKB 4L74A 1MUUA 1LTBC 4WWIA 3CCRP 4U3FG 2A06E 2CPSA 3CX5D 2HLOA 3FWNA 1G2CA 2K37A 1FDMA 5AW4B 1LTSC 1SQXG 5C39A 4HKZH 3RGUA 2V7QJ 1E79H 1KQFB 1LTJB 4GDOA 2O01J 2C9NY 3GF3A 3S1KA 3PJSK 1JMMA 5KJ7C 1JY3N 2E75D 3CWBE 1FC2C 1ZR4A 4N78E 1N7SC 3MD0A 3Q5PA 1L0LD 4OH8B 4H44C 1U7MA 1BE3E 3G71P 3OW2O 3CWBJ 1JTHB 3R4YA 4DOJA 1HWTC 4L75A 1TU3F 1OXZA 1L0LK 2B88A 1NTMD 1SQXJ 5AVYB 1ZN5A 5DJUB 2RMZA 4HH2A 2C9LY 4EIJA 1RE4A 3U1CA 3ITKA 1JCDA 1BE3J 1PPJG 1CSBA 1T6AA 2M5AA 4Z1MH 5K5GB 2N1TC 1NGMB 4IL6H 1GL2B 2J5UA 4AUWA 4BRYB 1CI6A 1OIPA 2XDJA 1IC2A 3L70G 1IO4A 4WY4B 2YO2A 2D2CB 1JMBA 2ZXXA 5L8RJ 3HD7B 1ZP0C 3CL3D 2Z4EA 3A3YB 2OYHB 5KLVE 4PJ0E 3SWFA 1PGQA 3L73G 1SFCD 2K88A 2W83C 3H1HE 3H1IE 2KI7B 2MKVA 5CJ0A 1PP9D 1PZQA 4JBZA 4RESB 1L4AA 2WPVB 3CCQP 3RK3D 3NMDA 2AEJA 1VQMP 4KHXA 1G2CB 1W2EA 2QA4P 5KLVJ 1EZVD 2P67A 4YXDC 3G9RA 3H1HJ 3L74J 1L0NE 2WWWA 3KYQA 3P8CE 1FZFA 3JCUH 3AEFC 3CXHD 1JY3O 1M57D 3M9BA 4NPFX 3Q1MA 2H89C 2E75C 1NTKK 3CCLP 2W8ZA 1K9MQ 3L71E 3G6EP 5BVZA 2NZ2A 1L0NJ 1R5LA 4W7ZA 1BCCG 3GF7A 1BDCA 4N6JA 2ZAEB 3M0DC 1J1EB 3OAKA 1LP1A 3CC2P 1KB9E 1LT9B 1IFPA 2YO3A 1U7JA 2H8PD 3GHGA 2ZJSE 3NFQA 3RK2B 2M5AB 2BCCG 2YXQB 1HH0A 3SFEC 1X79B 4PJ0H 1YJWP 2KP8A 2PP6A 3BCCE 1SQQG 1CI6B 4JPZB 1DD4A 4LGDE 3P8MC 2A45H 1VQ8P 5AVZB 3E1RA 1FZEA 1AFOA 4UB6H 2ZFCA 3FGAD 2KUBA 1RF1C 1BGYD 3WUTA 2XV5A 1RY3A 3BCCJ 4EI2A 3VP8A 2WSFJ 4PV1B 4CPGA 3V2RA 2W27A 5AVQB 2A45I 3T97B 4W7YA 2E74D 1SFCC 1L0LE 3H1JE 2R5DA 3L35A 5TJHA 1L4AB 1Q86Q 1SQPD 3TGUE 1Q7YQ 2ITAA 4HYTB 3RK3C 2QJPB 3VMYA 1NTZK 1SQQJ 4WB4A 2JWAA 2FYUD 4K3AA 2IPPA 1KQLA 1R5SA 3H1JJ 1SQPK 3TGUJ 3PLNA 3F5HA 1S2EA 1YQ4C 3NXSA 1KB9H 1KYOE 2CK3H 5AVUB 2FYUK 1GU4A 3QWOC 3HE4A 5E79E 3TF5A 2IDBA 2ZT9D 5KJ7A 2C0WA 1Q81Q 3VN0A 2UWJE 3CPWO 1OZHA 1N7SA 3KHUA 1VF5B 4W80A 4DCKA 2Y0EA 2WPRA 3CCEP 2Q6QA 3Q5RA 1OW7A 3USSA 3V2QA 2ZXEB 2P58A 2G8YA 3CMEP 3PRJA 2W6AA 1LWUB 3CX5I 4PD4D 1PP9E 1LT1A 1KILD 4JQ0D 1URQD 4Y99C 1W2BO 1JY2P 3VYIA 4U3FD 3MHVA 1NTKE 3CC4P 1RH5B 1VQ7P 2N1TA 4L73A 5APTA 3VOPA 1SQVG 1USDA 1SQXD 2Y0DA 2H43A 3C8VA 2LR2A 1S9KD 2IBZG 2YMKA 4UB8H 3TK1A 1NTKJ 2GUSA 3RBZA 3WUUA 1JCCA 2M8RA 3ABVC 2E74C 3D71A 4Y28J 1AVOA 5B5EH 2IYPA 5AVTB 1PGOA 1YJ9P 1H89A 2LXCB 1Q2NA 1FZGA 4GIFA 1QL2A 3M91A 3B4SA 3TNUA 2WVRA 1SQVJ 1M7LA 5KJ7D 1KD1Q 1GK4A 2FY8A 3IFMA 4YXWH 3HE4B 1OVUA 1P84D 1FZBA 1PPJD 1SQBE 1NAFA 1X8YA 2QJKC 2ZT9C 1ZRTE 1ZR2A 3MGNA 1FZCC 2B87B 3L72G 1QLED 1HUCA 1NU1G 3A7OA 3KZIH 1AJYA 3EQ2A 1RHZB 1EDLA 4H44B 3W67A 2QSIA 3L70D 2FYZA 1SQBJ 1EC5A 4DT0A 3BATA 1NTZE 3UIAA 3M0DA 2Q1KA 1JOCA 3A0HH 3CXHH 2MJZA 1EZVI 1KILC 3L73D 1URQC 4ASWA 2O3JA 2E76D 1NTZJ 5BU8B 3KDPB 1NAYA 5DJTB 2N1TB 3HE5A 1K8AQ 3CXHI 2A06G 2FXPA 5CBNA 4D6TE 1LTIC 4TLFA 1OX3A 3B5NB 2QJYC 3CCUP 1VL2A 1T3UA 1VQ9P 2KLVA 1M90Q 2BASA 4IL6E 5AVWB 4EOTA 4LLHA 4LC1A 1RF1A 4D6TJ 2KXPB 2Q7CA 4ZKUA 1DIPA 1YQ3C 1VQ6P 3CWBG 1FBMA 1S5LX 1HTLC 4ZKPA 3Q2YA 1JEKA 1SFCA 3H1KE 5APYA 1G1JA 1BCCD 1N86A 3VMXA 2O1KA 2WT7A 2FYNC 1LTGC 2R32A 2JR8A 2K9JA 3W68A 1SS1A 1BE3G 1YJNP 2NPSB 1EQ7A 1FJKA 3VTPC 2IYOA 3BASA 1PGPA 2RKLA 1K04A 2BCCD 4I6MC 2E75B 4IFFA 1ZV8A 4R4LA 1SQQD
chains in the Genus database with same CATH topology
1IJDB 5AVRB 4N6JA 2YKOA 4GT1A 2VRSA 3M0DC 3G3ZA 1RE4C 1J1EB 3OAKA 3H32A 5AVXB 1RE3C 2WZ7A 4O9BA 1LT9B 4C7RA 5AW5B 2WSFH 1VPCA 1NH4A 2YO3A 2H8PD 4XE5B 3RK2C 1H88A 1MZ9A 3GHGA 2IFMA 5APSA 1LWUC 2J59M 2I1KA 1NKZB 3KQGA 1GDTA 3NFQA 3RK2B 2YKQA 5AVVB 2JEEA 1NTMK 2I1JA 3M06A 2OARA 1HH0A 5APXA 1KILB 1NOHA 3M9QA 1X79B 1N73C 2O1JA 3P8CD 3M9HA 3HUSC 1M1JA 1URQB 2KP8A 2HG5D 2PP6A 1NHLA 4N78D 3IR9A 3MIWA 5APUA 1CI6B 1N2DC 3H6PA 1N73B 3HUSB 4LGDE 3C9IA 3P8MC 2A45H 2HPCB 2XNXA 3RL0C 3II6A 3B5ND 5AVZB 1FZEA 5CJ4A 1N7LA 1HJBA 1AFOA 5CCHD 1XTGB 2ZFCA 2FXMA 1RF1C 2HODB 5CMZA 1JUNA 2XV5A 4JYBA 1RY3A 1GZLA 3VP8A 1WRGA 4N3YB 3V2RA 2W27A 5AVQB 1RF1B 3B5NA 1L4AC 2QM7A 1FOSF 2A45I 2Q5UA 4DZOA 4W7YA 5CCHA 1SVFA 1T3JA 3L4FA 3WMM0 1SFCC 3P32A 2R5DA 3L35A 1L4AB 3N7NA 4HYTB 1SFCB 2JJLA 1IFMA 3RK3C 2W6BA 1DX7A 1MV8A 5CHXA 5CCGC 1NTZK 4WB4A 3VMYA 3TNUB 3V4QA 1Z56A 1CW5A 2IPPA 1KQLA 1FJPA 1GW3A 1LTTC 1SQPK 2NPSD 3LW5H 1T2KC 1AQ5A 5AVSB 3E1IA 1OWAA 1NKNA 2HFED 3CLQA 2OYIA 3NXSA 2KB7P 1LTJA 3BRVB 5AVUB 2FYUK 4C46A 3N4XA 1GU4A 2GM4A 2NPSA 1DEBA 2L5GB 3BRTB 2J58A 3HE4A 1N7SD 4I1LA 1HGZA 3SWYA 2XKMA 3CI9A 3BVHA 5KJ7A 1XTCC 2C0WA 1IFJA 3VN0A 1GK6A 5AW2B 3H32B 1N7SA 3GHGC 2Q9IA 1S9KE 2WTYA 5KLVK 2FKWB 4W80A 4I2LC 5APWA 4WBAA 2WPRA 1JTHA 1H8AA 1SQQK 1FZCA 1JY2N 2WPQA 2ZXEB 3V2QA 1FOSE 2H7HA 2W6AA 4XA4A 1M1JC 1JO5A 1LWUB 4AQRD 5AW1B 1KFMA 1LT9A 3PP5A 5AW6B 2CPBA 1NWQA 2WSEH 1KILD 3I5CA 2IX7C 2R5BA 1M1JB 1GL2D 3V2PA 1URQD 3HE5B 2N1TD 3EFGA 5APQA 4Y99C 2A45G 1JY2P 3VYIA 1GTWA 3MUDA 1QL1A 4WY4D 3L37A 1L0NK 1KILA 2Z5IA 3P7KA 4Y99B 1GL2A 1J1DC 1NO4A 3M0AA 3VP9A 1URQA 3V5BA 2N1TA 3L36A 3RL0B 3HD7D 3B5NC 5APTA 3VOPA 4C7NA 1FAVA 5CCHC 1YTZI 1J1DB 2YMYA 2H43A 5KTBA 4WY4A 2O01H 2Z5HA 1DH3A 4IFDK 1S9KD 3V2NA 2WITA 3TYYA 2N9BA 3TK1A 3HD7A 2GUSA 2C0XA 2HODA 3O8ZA 2KYVA 2OYHA 1JCCA 2M8RA 3HTKB 1MUUA 1LTBC 4JYCA 2WT7B 3T97A 2CPSA 4B86A 2FFDA 1A02F 2HLOA 3RK3B 2YKPA 3VMZA 5AVTB 2KOGA 1KFNA 1IFDA 2OYIC 1G2CA 1VDFA 3V4WA 1H89A 2E43A 1LTJC 2P7JA 1CZQA 4GKGA 1FDMA 1YTZT 5AW4B 1LTSC 1FZGA 2NPSC 4GIFA 1QL2A 2OYIB 3M91A 3TNUA 1LTJB 1M7LA 5KJ7D 1SP4A 2P1JA 5AW7B 5AW8B 1RF0A 1GK4A 2C9NY 3TSIA 3IFMA 2YNYA 5BU5A 1JMMA 3HE4B 5KJ7C 1JY3N 1HVVA 2Q3IA 3HRNA 1ZR4A 4N78E 2R3CA 1N7SC 1FZBA 1KZUB 3MD0A 1PFIA 1NAFA 2POHA 2XZRA 1IK9A 1X8YA 4OH8B 2WPSA 1ZR2A 3MGNA 1FZCC 5AW9B 1IFNA 1HUCA 3A7OA 3EQ2A 1YYCA 1JY3P 3GHGB 1JTHB 1T8ZA 1FZCB 1ZLLA 4DOJA 1HWTC 1JY2O 1LT9C 4AYCA 5AW0B 1OXZA 1J2JB 1L0LK 2FYZA 3RK2D 5AVYB 1ZN5A 3BATA 1IFIA 1LTAC 3U1AA 4HH2A 3UIAA 2C9LY 4EIJA 3M0DA 1GW4A 1RE4A 3U1CA 2WSCH 5AW3B 1JOCA 1RE3A 1JCDA 2E42A 2HYNA 2MJZA 3R2PA 1MFZA 1SQVK 1CSBA 1KILC 2M3BA 1GL2C 1URQC 1LWUA 2N1TC 2QM8A 1SLQA 1WT6A 3U59A 3A2AA 5BU8B 1GL2B 3KDPB 4AUWA 4WY4C 2N1TB 3LIEA 3HE5A 1CI6A 3RL0D 2XDJA 1N73A 4C7NB 1IC2A 3OA7A 3A5TA 2IFNA 4JF7A 3HUSA 1IO4A 1LTIC 3HD7C 2HPCA 4WY4B 2LKMA 3B5NB 1LGHB 2OYHC 2YO2A 1JNMA 1A02J 1T3UA 2KLVA 3B8EB 2BASA 4M3LA 3HD7B 1E5WA 3CL3D 2Z4EA 3A3YB 3MTUE 2OYHB 1L4AD 5AVWB 4EOTA 3SWFA 4LLHA 3KPEA 3LIDA 1FZAA 2FFDC 1SQBK 2GUVA 4LC1A 1SQXK 1RF1A 1SFCD 2Q7CA 3OJAB 5CJ0A 4ZKUA 2FFDB 4RESB 1L4AA 1FBMA 1HTLC 3RK3D 3NMDA 4ZKPA 2P2UA 4KHXA 5CCGD 1G2CB 1SFCA 1W2EA 5APYA 3HTKA 1G1JA 1N86A 3VMXA 2O1KA 2WT7A 1RF0C 2P67A 1HBWA 1LTGC 5APVA 2R32A 2PAJA 2XU6A 2KSJA 1T2KD 4IFMA 1X9VA 2NPSB 5CCGA 2WWWA 1FU1A 1G1IA 1NU1K 1EQ7A 3KYQA 3P8CE 1FZFA 1FJKA 3VTPC 1JY3O 3M9BA 3NTNA 3BASA 1NTKK 5BVZA 4I6MC 1GD2E 1N7SB 4IFFA 1GU5A 1HGVA 1ZV8A 4W7ZA 1J1EC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N9B A;  3TK1 A;  1T2K C;  3O8Z A;  2QM8 A;  1SLQ A;  5AVR B;  4GT1 A;  5AVS B;  2VRS A;  1OWA A;  3OAK A;  3A2A A;  3NXS A;  5AVX B;  3KDP B;  4AUW A;  1MUU A;  3LIE A;  4JYC A;  3HE5 A;  1CI6 A;  5AVU B;  2WT7 B;  4C46 A;  3T97 A;  4C7N B;  5AW5 B;  1GU4 A;  3A5T A;  2YO3 A;  4XE5 B;  1H88 A;  4B86 A;  1IO4 A;  1A02 F;  3HE4 A;  5APS A;  3VMZ A;  5AVT B;  3KQG A;  2YO2 A;  1JNM A;  1A02 J;  3NFQ A;  5AVV B;  3B8E B;  2BAS A;  4M3L A;  3V4W A;  1H89 A;  2E43 A;  3M06 A;  2P7J A;  1CZQ A;  4GKG A;  5AW4 B;  5APX A;  3VN0 A;  3A3Y B;  1GK6 A;  5AW2 B;  5AVW B;  3M9H A;  3SWF A;  4EOT A;  3LID A;  2KP8 A;  3M91 A;  4LC1 A;  3TNU A;  1S9K E;  3IR9 A;  2WTY A;  5APU A;  1SP4 A;  1CI6 B;  5AW7 B;  5AW8 B;  2Q7C A;  4I2L C;  1GK4 A;  2C9N Y;  5APW A;  2WPR A;  2YNY A;  1H8A A;  3P8M C;  3HE4 B;  4RES B;  2WPQ A;  2ZXE B;  1FOS E;  2Q3I A;  5AVZ B;  3NMD A;  1HJB A;  2H7H A;  2R3C A;  2P2U A;  2ZFC A;  4KHX A;  2W6A A;  1G2C B;  5APY A;  3HTK A;  4AQR D;  3MD0 A;  5AW1 B;  5CMZ A;  1NAF A;  2XZR A;  5AW6 B;  1JUN A;  1X8Y A;  3VMX A;  2WT7 A;  2XV5 A;  2P67 A;  4JYB A;  1NWQ A;  1HBW A;  2WPS A;  1GZL A;  5APV A;  2R32 A;  3I5C A;  2R5B A;  3MGN A;  2XU6 A;  5AW9 B;  2W27 A;  5AVQ B;  3HE5 B;  1HUC A;  1T2K D;  1FOS F;  2QM7 A;  3A7O A;  2Q5U A;  4DZO A;  5APQ A;  1YYC A;  3VYI A;  2WWW A;  3P32 A;  1GTW A;  1HWT C;  2R5D A;  3L35 A;  3VTP C;  3L37 A;  4AYC A;  5AW0 B;  1OXZ A;  3M9B A;  1J2J B;  2Z5I A;  3P7K A;  3M0A A;  4HYT B;  5AVY B;  3V5B A;  2JJL A;  3NTN A;  3L36 A;  3UIA A;  2C9L Y;  5APT A;  1MV8 A;  1FAV A;  4C7N A;  3M0D A;  3VMY A;  5AW3 B;  4I6M C;  1GD2 E;  3TNU B;  2E42 A;  3V4Q A;  1GU5 A;  1MFZ A;  2Z5H A;  1DH3 A;  2IPP A;  1CSB A;  1S9K D;  1KQL A;  3TYY A; 
#chains in the Genus database with same CATH topology
 3JCU E;  2VRS A;  3CC7 P;  4IOI H;  3VMA A;  1RE3 C;  3QH9 A;  4O9B A;  5AW5 B;  1H88 A;  1MZ9 A;  2IFM A;  5APS A;  2I1K A;  3CCV P;  5GTI H;  2YKQ A;  3H1L E;  5AVV B;  3AEB C;  1NTM K;  2I1J A;  2OAR A;  5KLV G;  1NOH A;  3M9Q A;  1N73 C;  1RQV A;  2OGU A;  3HUS C;  2E76 C;  3MIW A;  5APU A;  1N2D C;  3H1H G;  3H1I G;  2AXT H;  3L74 G;  4OGQ D;  3O6Q A;  3H25 A;  3II6 A;  5CCH D;  1XTG B;  2FXM A;  1OVR A;  5KKZ C;  1JUN A;  4KT0 J;  1GZL A;  2OTL P;  1RF1 B;  1FOS F;  2QM7 A;  1SVF A;  1T3J A;  3L4F A;  1L0N G;  3EFF K;  2Q3E A;  4PD4 H;  3JC2 2;  4UB6 E;  1FS0 E;  1SFC B;  2SPZ A;  1X0T A;  3L71 G;  1IK7 A;  2K9J B;  3H1I J;  4PD4 I;  2XND H;  3PTZ A;  1GW3 A;  1H0T A;  3FXD A;  3L75 E;  3CCM P;  5AVS B;  2QG4 A;  2GM4 A;  4MN4 C;  2RN0 A;  2J58 A;  3RBX A;  1HGZ A;  3L75 J;  3BVH A;  1X22 A;  1XTC C;  1IFJ A;  3BCC G;  3L71 J;  4U7J A;  2V4H A;  1FZC A;  1U57 A;  1SQV D;  2WPQ A;  1FOS E;  3WU2 H;  5KAI H;  4I7Z C;  4TT3 H;  5AW1 B;  2IBZ D;  3CX5 E;  2WSE H;  3I5C A;  2AEM A;  4NPD A;  1P84 H;  3K5B A;  1L0L G;  2K1A A;  3H1J G;  3O6Q B;  4XFJ A;  2IZ1 A;  3L37 A;  1KIL A;  3TGU G;  2Z5I A;  4Y99 B;  4OGQ C;  3VP9 A;  1URQ A;  3V5B A;  3RL0 B;  1Q82 Q;  3AE6 C;  1FAV A;  5CCH C;  3KXD A;  2YMY A;  1P84 I;  4H13 D;  4YPC A;  5KTB A;  4ASV A;  5TIS H;  4PV1 D;  1ZXG A;  4IFD K;  3FX0 A;  1OW6 A;  2HOD A;  2KIK A;  4ZMD A;  2E74 B;  1Q90 D;  2YKP A;  1NTM E;  3VMZ A;  1L0L J;  1JB0 J;  1KFN A;  4UB8 E;  1IFD A;  2ZYA A;  3L72 D;  2OYI C;  1H0T B;  1NU1 D;  3AE1 C;  3V4W A;  2E43 A;  1DEE G;  4GKG A;  2P7J A;  1CZQ A;  1YTZ T;  2RH0 A;  1NYH A;  2O01 N;  2KZJ A;  2P10 A;  2P1J A;  2B9B A;  3TSI A;  1NTM J;  1FDO A;  5B5E E;  2Q3I A;  3HRN A;  2ZVN B;  2R3C A;  1PFI A;  2POH A;  1PP9 G;  2WPS A;  3CX5 H;  1LP1 B;  2DW3 A;  3SWK A;  1JM0 A;  2QJK B;  1PIX A;  1JY3 P;  3GHG B;  1T8Z A;  1FZC B;  2A06 D;  1LT9 C;  1NTK G;  1S1C X;  2R44 A;  2LXB A;  3U1A A;  3JSV C;  1YHQ P;  1PV3 A;  1YIT P;  2WSC H;  4RKU J;  1RE3 A;  3AEA C;  3RK3 E;  3KZI E;  3TDK A;  1MFZ A;  1EZV E;  1NVO A;  2M3B A;  2QM8 A;  1WT6 A;  3U59 A;  3CWB D;  1PP9 J;  1N73 A;  3A5T A;  4JF7 A;  3A0H E;  3CXH E;  3HUS A;  2M3E A;  1LGH B;  4H0L D;  4H13 C;  1BE3 D;  4M3L A;  4PV1 C;  2QJY B;  3AE3 C;  3KPE A;  3LID A;  1FZA A;  2FFD C;  1SQX K;  1KTM A;  2FXO A;  1OFC X;  1D7M A;  1L2P A;  2JDI H;  2P2U A;  5CBO A;  5CCG D;  3HTK A;  1SQB G;  2JKV A;  1RF0 C;  1HBW A;  5APV A;  2PAJ A;  4RJT A;  1KQG B;  2KSJ A;  3EWK A;  5KAF H;  1T2K D;  4IFM A;  1X9V A;  2FYN B;  2AEF A;  1FU1 A;  1Y47 A;  2BEQ D;  1VQO P;  3NTN A;  1NTZ G;  5EFW B;  1VQL P;  1VQK P;  1GD2 E;  1N7S B;  5KLV D;  1GU5 A;  4BWN A;  1HGV A;  2Y0C A;  3Q3D A;  1BGY E;  2BEZ F;  2YIU C;  3H1H D;  3H1I D;  2AXC A;  3L74 D;  4GT1 A;  3I56 P;  3G3Z A;  1R8E A;  4WVZ A;  3H32 A;  1ZOY C;  3D70 A;  3GW6 A;  1VPC A;  4XE5 B;  4D6T G;  4ZNC A;  1BDD A;  1SQP E;  1LWU C;  3I55 P;  2J59 M;  1BGY J;  1QGK B;  1GDT A;  2JEE A;  2QEX P;  1L0N D;  5APX A;  2O1J A;  3P8C D;  2FYU E;  3S4R A;  1NHL A;  3IR9 A;  3IN6 A;  3A0B H;  1N73 B;  1SQP J;  1K05 A;  3HUS B;  1QX8 A;  2E76 B;  5GTI E;  3B5N D;  1MKM A;  5CJ4 A;  1HJB A;  3H1K G;  4HJG H;  5CMZ A;  2FYU J;  4H0L C;  4JYB A;  4QMA A;  4N3Y B;  5KKZ B;  2AXT E;  4DZO A;  5CCH A;  1KB9 D;  5B66 H;  1QEX A;  2G3A A;  3RL0 g;  1S5L H;  3N7N A;  4RO0 A;  1IFM A;  5CHX A;  5CCG C;  3TNU B;  2IBZ I;  3BCC D;  4PD4 E;  2NPS D;  3LW5 H;  1VQP P;  1T2K C;  1KIL E;  1AQ5 A;  3H1K J;  1NKN A;  3CLQ A;  2OYI A;  2KB7 P;  3BRV B;  1EDI A;  2OTJ P;  4C46 A;  4U3F E;  1DEB A;  2L5G B;  3BRT B;  4I1L A;  3AEG C;  3H1L G;  5KLI C;  3SWY A;  3Q5S A;  3E7K A;  1AQT A;  1SQX E;  5AW2 B;  3H1J D;  5H2F E;  3F89 A;  3H32 B;  4U3F J;  2WMM A;  1S9K E;  1VQN P;  3TGU D;  2FKW B;  5GTH E;  4I2L C;  4WBA A;  1H8A A;  1SQQ K;  1JY2 N;  1KMI Z;  1NJI Q;  1S4X A;  1JO5 A;  1M1J C;  4AQR D;  1KFM A;  1LT9 A;  3PP5 A;  5AW6 B;  2KNC A;  2CPB A;  3ZDM A;  2R5B A;  1S3J A;  2E5T A;  1GL2 D;  3AE4 C;  3V2P A;  4I7Z B;  2QRX A;  3HE5 B;  3EFG A;  5APQ A;  2PFX A;  1KYO D;  2A45 G;  1M1K Q;  3H1L J;  1QL1 A;  4GOE A;  1W5C E;  1UIX A;  4WY4 D;  4IL6 X;  3WU2 E;  5KAI E;  2D2C D;  2KS1 A;  1Y8A A;  3P7K A;  2L91 A;  1NO4 A;  1J1D C;  1M8O B;  4EDF A;  1EDK A;  3L36 A;  3HD7 D;  3B5N C;  4C7N A;  2V7Q H;  1YTZ I;  4OGQ B;  2O01 H;  3AEC C;  1P84 E;  1DH3 A;  1PPJ E;  3V2N A;  2WIT A;  4BXL A;  1OVV A;  3L75 G;  1IZN B;  2W90 A;  2WSE J;  1USE A;  4JYC A;  1K73 Q;  2WT7 B;  3T97 A;  4A7P A;  4B86 A;  3L70 E;  2FFD A;  1ZME C;  2HR3 A;  5TIS E;  2PRR A;  3L74 E;  1A02 F;  4GOD A;  1LJ2 A;  3RK3 B;  2KOG A;  2IZ0 A;  1VDF A;  1LTJ C;  2W6J H;  1OMI A;  2NPS C;  1GMJ A;  5H2F H;  2OYI B;  1NTK D;  3L73 E;  1SP4 A;  5GTH H;  3L70 J;  5AW7 B;  5AW8 B;  1RF0 A;  3PH0 A;  2QE7 H;  2YNY A;  5BU5 A;  4NPE A;  2N9Y B;  1HVV A;  4EYY Q;  3MP7 B;  1KZU B;  1DD3 A;  2XZR A;  2I8D A;  1IK9 A;  2PGD A;  2JP3 A;  2QIW A;  1KOR A;  2JWD A;  3L73 J;  3SSU A;  5AW9 B;  1IFN A;  1QVF O;  1YYC A;  3FWL A;  1ZLL A;  1JY2 O;  4AYC A;  5AW0 B;  1M56 D;  1J2J B;  3RK2 D;  1IFI A;  1LTA C;  2KNC B;  1GW4 A;  2OYO A;  5AW3 B;  2E42 A;  2HYN A;  3AE8 C;  3MUD C;  1UII A;  3AE7 C;  3R2P A;  1SQV K;  2QVA A;  1Y9B A;  1BCC E;  1GL2 C;  1YIJ P;  1LWU A;  2OQQ A;  1SLQ A;  4R4M A;  2KS1 B;  3A2A A;  4OVN F;  4WY4 C;  1VQ4 P;  3LIE A;  2FBW C;  3RL0 D;  2D2C C;  4C7N B;  3OA7 A;  1SQB D;  2IFN A;  2M0B A;  3HD7 C;  2HPC A;  1ZRT D;  1NTM G;  2LKM A;  1BCC J;  2E5Y A;  1JNM A;  2OYH C;  1A02 J;  2KZI A;  3B8E B;  2BCC E;  3GG2 A;  1E5W A;  3GMA A;  3MTU E;  1L4A D;  1OW8 A;  4H13 B;  1SQB K;  2GUV A;  1PGJ A;  2WSC J;  1SQQ E;  1EDJ A;  1NTZ D;  3OJA B;  1MFT A;  2FFD B;  2KSE A;  4L76 A;  3AED C;  3CCS P;  1N8R Q;  2BCC J;  1AA0 A;  1KN7 A;  3CCJ P;  1KC8 Q;  2XU6 A;  1YI2 P;  3CD6 P;  1FDI A;  5CCG A;  4DJG A;  3WUV A;  1G1I A;  1NU1 K;  4D6T D;  1VQ5 P;  2K9Y A;  1EXI A;  3SFD C;  1KV4 A;  2B89 A;  4KJM A;  1RQU A;  5KAF E;  1VF5 D;  2ZT9 B;  1EZV G;  1J1E C;  3AE2 C;  1IJD B;  5AVR B;  2YKO A;  1KB9 I;  1RE4 C;  5AVX B;  2YIU B;  2WZ7 A;  2B87 A;  4C7R A;  1LNQ A;  3H1K D;  2WSF H;  1NH4 A;  3RK2 C;  3GLM A;  2YXR B;  2KK7 A;  1NKZ B;  3KQG A;  2GA1 A;  3IAO A;  3M06 A;  1KIL B;  2R3S A;  3M9H A;  1M1J A;  1URQ B;  2HG5 D;  4N78 D;  1QVG O;  3H6P A;  2ZYD A;  3C9I A;  1KQS O;  2HPC B;  2XNX A;  3RL0 C;  3AE9 C;  1FE6 A;  1N7L A;  2HOD B;  1BSH A;  1WRG A;  3B5N A;  2H88 C;  3A0B E;  1L4A C;  2Q5U A;  4H0L B;  2Y9Y A;  1WMK A;  3WMM 0;  3P32 A;  3D6Y A;  1HJ0 A;  3G4S P;  2QJP C;  2ZYG A;  3FXE A;  2JJL A;  3H1L D;  1S72 P;  2W6B A;  1DX7 A;  1KYO H;  1MV8 A;  1SQV E;  3CMA P;  3V4Q A;  3D6Z A;  1Z56 A;  1EXJ A;  1CW5 A;  5B66 E;  1BGY G;  2NRG A;  1FJP A;  2IBZ E;  1LTT C;  5E79 H;  1S5L E;  3E1I A;  1OWA A;  2HFE D;  2JO1 A;  1KYO I;  5M1B A;  1LTJ A;  1AV1 A;  1PL5 A;  3AEE C;  3N4X A;  2NPS A;  2K3R A;  1SQP G;  1YBK A;  1N7S D;  3S9O A;  4YTP C;  2XKM A;  3CI9 A;  4H44 D;  1VF5 C;  4OWF A;  1GK6 A;  2OTK E;  2Y9Z A;  2FYU G;  5KLI B;  4GOF A;  3IF4 A;  3GHG C;  2Q9I A;  2WTY A;  5KLV K;  5APW A;  3AE5 C;  1JTH A;  3C1L A;  4HB1 A;  3MZW B;  3LW5 J;  2H7H A;  4XA4 A;  4K35 A;  1NWQ A;  3L75 D;  1HF9 A;  2IX7 C;  1M1J B;  3L72 E;  1ZW0 A;  2N1T D;  1NU1 E;  1GTW A;  3L71 D;  3MUD A;  2WQY C;  1L0N K;  3V6I A;  2KLU A;  1GL2 A;  3M0A A;  4BRY A;  3B71 A;  2ZVO B;  3L72 J;  1J1D B;  1NU1 J;  4WY4 A;  2Z5H A;  2WSS H;  2N9B A;  3TYY A;  1AVY A;  3HD7 A;  1BSN A;  2C0X A;  3O8Z A;  3PHL A;  2KYV A;  2OYH A;  3HTK B;  4L74 A;  1MUU A;  1LTB C;  4WWI A;  3CCR P;  4U3F G;  2A06 E;  2CPS A;  3CX5 D;  2HLO A;  3FWN A;  1G2C A;  2K37 A;  1FDM A;  5AW4 B;  1LTS C;  1SQX G;  5C39 A;  4HKZ H;  3RGU A;  2V7Q J;  1E79 H;  1KQF B;  1LTJ B;  4GDO A;  2O01 J;  2C9N Y;  3GF3 A;  3S1K A;  3PJS K;  1JMM A;  5KJ7 C;  1JY3 N;  2E75 D;  3CWB E;  1FC2 C;  1ZR4 A;  4N78 E;  1N7S C;  3MD0 A;  3Q5P A;  1L0L D;  4OH8 B;  4H44 C;  1U7M A;  1BE3 E;  3G71 P;  3OW2 O;  3CWB J;  1JTH B;  3R4Y A;  4DOJ A;  1HWT C;  4L75 A;  1TU3 F;  1OXZ A;  1L0L K;  2B88 A;  1NTM D;  1SQX J;  5AVY B;  1ZN5 A;  5DJU B;  2RMZ A;  4HH2 A;  2C9L Y;  4EIJ A;  1RE4 A;  3U1C A;  3ITK A;  1JCD A;  1BE3 J;  1PPJ G;  1CSB A;  1T6A A;  2M5A A;  4Z1M H;  5K5G B;  2N1T C;  1NGM B;  4IL6 H;  1GL2 B;  2J5U A;  4AUW A;  4BRY B;  1CI6 A;  1OIP A;  2XDJ A;  1IC2 A;  3L70 G;  1IO4 A;  4WY4 B;  2YO2 A;  2D2C B;  1JMB A;  2ZXX A;  5L8R J;  3HD7 B;  1ZP0 C;  3CL3 D;  2Z4E A;  3A3Y B;  2OYH B;  5KLV E;  4PJ0 E;  3SWF A;  1PGQ A;  3L73 G;  1SFC D;  2K88 A;  2W83 C;  3H1H E;  3H1I E;  2KI7 B;  2MKV A;  5CJ0 A;  1PP9 D;  1PZQ A;  4JBZ A;  4RES B;  1L4A A;  2WPV B;  3CCQ P;  3RK3 D;  3NMD A;  2AEJ A;  1VQM P;  4KHX A;  1G2C B;  1W2E A;  2QA4 P;  5KLV J;  1EZV D;  2P67 A;  4YXD C;  3G9R A;  3H1H J;  3L74 J;  1L0N E;  2WWW A;  3KYQ A;  3P8C E;  1FZF A;  3JCU H;  3AEF C;  3CXH D;  1JY3 O;  1M57 D;  3M9B A;  4NPF X;  3Q1M A;  2H89 C;  2E75 C;  1NTK K;  3CCL P;  2W8Z A;  1K9M Q;  3L71 E;  3G6E P;  5BVZ A;  2NZ2 A;  1L0N J;  1R5L A;  4W7Z A;  1BCC G;  3GF7 A;  1BDC A;  4N6J A;  2ZAE B;  3M0D C;  1J1E B;  3OAK A;  1LP1 A;  3CC2 P;  1KB9 E;  1LT9 B;  1IFP A;  2YO3 A;  1U7J A;  2H8P D;  3GHG A;  2ZJS E;  3NFQ A;  3RK2 B;  2M5A B;  2BCC G;  2YXQ B;  1HH0 A;  3SFE C;  1X79 B;  4PJ0 H;  1YJW P;  2KP8 A;  2PP6 A;  3BCC E;  1SQQ G;  1CI6 B;  4JPZ B;  1DD4 A;  4LGD E;  3P8M C;  2A45 H;  1VQ8 P;  5AVZ B;  3E1R A;  1FZE A;  1AFO A;  4UB6 H;  2ZFC A;  3FGA D;  2KUB A;  1RF1 C;  1BGY D;  3WUT A;  2XV5 A;  1RY3 A;  3BCC J;  4EI2 A;  3VP8 A;  2WSF J;  4PV1 B;  4CPG A;  3V2R A;  2W27 A;  5AVQ B;  2A45 I;  3T97 B;  4W7Y A;  2E74 D;  1SFC C;  1L0L E;  3H1J E;  2R5D A;  3L35 A;  5TJH A;  1L4A B;  1Q86 Q;  1SQP D;  3TGU E;  1Q7Y Q;  2ITA A;  4HYT B;  3RK3 C;  2QJP B;  3VMY A;  1NTZ K;  1SQQ J;  4WB4 A;  2JWA A;  2FYU D;  4K3A A;  2IPP A;  1KQL A;  1R5S A;  3H1J J;  1SQP K;  3TGU J;  3PLN A;  3F5H A;  1S2E A;  1YQ4 C;  3NXS A;  1KB9 H;  1KYO E;  2CK3 H;  5AVU B;  2FYU K;  1GU4 A;  3QWO C;  3HE4 A;  5E79 E;  3TF5 A;  2IDB A;  2ZT9 D;  5KJ7 A;  2C0W A;  1Q81 Q;  3VN0 A;  2UWJ E;  3CPW O;  1OZH A;  1N7S A;  3KHU A;  1VF5 B;  4W80 A;  4DCK A;  2Y0E A;  2WPR A;  3CCE P;  2Q6Q A;  3Q5R A;  1OW7 A;  3USS A;  3V2Q A;  2ZXE B;  2P58 A;  2G8Y A;  3CME P;  3PRJ A;  2W6A A;  1LWU B;  3CX5 I;  4PD4 D;  1PP9 E;  1LT1 A;  1KIL D;  4JQ0 D;  1URQ D;  4Y99 C;  1W2B O;  1JY2 P;  3VYI A;  4U3F D;  3MHV A;  1NTK E;  3CC4 P;  1RH5 B;  1VQ7 P;  2N1T A;  4L73 A;  5APT A;  3VOP A;  1SQV G;  1USD A;  1SQX D;  2Y0D A;  2H43 A;  3C8V A;  2LR2 A;  1S9K D;  2IBZ G;  2YMK A;  4UB8 H;  3TK1 A;  1NTK J;  2GUS A;  3RBZ A;  3WUU A;  1JCC A;  2M8R A;  3ABV C;  2E74 C;  3D71 A;  4Y28 J;  1AVO A;  5B5E H;  2IYP A;  5AVT B;  1PGO A;  1YJ9 P;  1H89 A;  2LXC B;  1Q2N A;  1FZG A;  4GIF A;  1QL2 A;  3M91 A;  3B4S A;  3TNU A;  2WVR A;  1SQV J;  1M7L A;  5KJ7 D;  1KD1 Q;  1GK4 A;  2FY8 A;  3IFM A;  4YXW H;  3HE4 B;  1OVU A;  1P84 D;  1FZB A;  1PPJ D;  1SQB E;  1NAF A;  1X8Y A;  2QJK C;  2ZT9 C;  1ZRT E;  1ZR2 A;  3MGN A;  1FZC C;  2B87 B;  3L72 G;  1QLE D;  1HUC A;  1NU1 G;  3A7O A;  3KZI H;  1AJY A;  3EQ2 A;  1RHZ B;  1EDL A;  4H44 B;  3W67 A;  2QSI A;  3L70 D;  2FYZ A;  1SQB J;  1EC5 A;  4DT0 A;  3BAT A;  1NTZ E;  3UIA A;  3M0D A;  2Q1K A;  1JOC A;  3A0H H;  3CXH H;  2MJZ A;  1EZV I;  1KIL C;  3L73 D;  1URQ C;  4ASW A;  2O3J A;  2E76 D;  1NTZ J;  5BU8 B;  3KDP B;  1NAY A;  5DJT B;  2N1T B;  3HE5 A;  1K8A Q;  3CXH I;  2A06 G;  2FXP A;  5CBN A;  4D6T E;  1LTI C;  4TLF A;  1OX3 A;  3B5N B;  2QJY C;  3CCU P;  1VL2 A;  1T3U A;  1VQ9 P;  2KLV A;  1M90 Q;  2BAS A;  4IL6 E;  5AVW B;  4EOT A;  4LLH A;  4LC1 A;  1RF1 A;  4D6T J;  2KXP B;  2Q7C A;  4ZKU A;  1DIP A;  1YQ3 C;  1VQ6 P;  3CWB G;  1FBM A;  1S5L X;  1HTL C;  4ZKP A;  3Q2Y A;  1JEK A;  1SFC A;  3H1K E;  5APY A;  1G1J A;  1BCC D;  1N86 A;  3VMX A;  2O1K A;  2WT7 A;  2FYN C;  1LTG C;  2R32 A;  2JR8 A;  2K9J A;  3W68 A;  1SS1 A;  1BE3 G;  1YJN P;  2NPS B;  1EQ7 A;  1FJK A;  3VTP C;  2IYO A;  3BAS A;  1PGP A;  2RKL A;  1K04 A;  2BCC D;  4I6M C;  2E75 B;  4IFF A;  1ZV8 A;  4R4L A;  1SQQ D; 
#chains in the Genus database with same CATH homology
 1IJD B;  5AVR B;  4N6J A;  2YKO A;  4GT1 A;  2VRS A;  3M0D C;  3G3Z A;  1RE4 C;  1J1E B;  3OAK A;  3H32 A;  5AVX B;  1RE3 C;  2WZ7 A;  4O9B A;  1LT9 B;  4C7R A;  5AW5 B;  2WSF H;  1VPC A;  1NH4 A;  2YO3 A;  2H8P D;  4XE5 B;  3RK2 C;  1H88 A;  1MZ9 A;  3GHG A;  2IFM A;  5APS A;  1LWU C;  2J59 M;  2I1K A;  1NKZ B;  3KQG A;  1GDT A;  3NFQ A;  3RK2 B;  2YKQ A;  5AVV B;  2JEE A;  1NTM K;  2I1J A;  3M06 A;  2OAR A;  1HH0 A;  5APX A;  1KIL B;  1NOH A;  3M9Q A;  1X79 B;  1N73 C;  2O1J A;  3P8C D;  3M9H A;  3HUS C;  1M1J A;  1URQ B;  2KP8 A;  2HG5 D;  2PP6 A;  1NHL A;  4N78 D;  3IR9 A;  3MIW A;  5APU A;  1CI6 B;  1N2D C;  3H6P A;  1N73 B;  3HUS B;  4LGD E;  3C9I A;  3P8M C;  2A45 H;  2HPC B;  2XNX A;  3RL0 C;  3II6 A;  3B5N D;  5AVZ B;  1FZE A;  5CJ4 A;  1N7L A;  1HJB A;  1AFO A;  5CCH D;  1XTG B;  2ZFC A;  2FXM A;  1RF1 C;  2HOD B;  5CMZ A;  1JUN A;  2XV5 A;  4JYB A;  1RY3 A;  1GZL A;  3VP8 A;  1WRG A;  4N3Y B;  3V2R A;  2W27 A;  5AVQ B;  1RF1 B;  3B5N A;  1L4A C;  2QM7 A;  1FOS F;  2A45 I;  2Q5U A;  4DZO A;  4W7Y A;  5CCH A;  1SVF A;  1T3J A;  3L4F A;  3WMM 0;  1SFC C;  3P32 A;  2R5D A;  3L35 A;  1L4A B;  3N7N A;  4HYT B;  1SFC B;  2JJL A;  1IFM A;  3RK3 C;  2W6B A;  1DX7 A;  1MV8 A;  5CHX A;  5CCG C;  1NTZ K;  4WB4 A;  3VMY A;  3TNU B;  3V4Q A;  1Z56 A;  1CW5 A;  2IPP A;  1KQL A;  1FJP A;  1GW3 A;  1LTT C;  1SQP K;  2NPS D;  3LW5 H;  1T2K C;  1AQ5 A;  5AVS B;  3E1I A;  1OWA A;  1NKN A;  2HFE D;  3CLQ A;  2OYI A;  3NXS A;  2KB7 P;  1LTJ A;  3BRV B;  5AVU B;  2FYU K;  4C46 A;  3N4X A;  1GU4 A;  2GM4 A;  2NPS A;  1DEB A;  2L5G B;  3BRT B;  2J58 A;  3HE4 A;  1N7S D;  4I1L A;  1HGZ A;  3SWY A;  2XKM A;  3CI9 A;  3BVH A;  5KJ7 A;  1XTC C;  2C0W A;  1IFJ A;  3VN0 A;  1GK6 A;  5AW2 B;  3H32 B;  1N7S A;  3GHG C;  2Q9I A;  1S9K E;  2WTY A;  5KLV K;  2FKW B;  4W80 A;  4I2L C;  5APW A;  4WBA A;  2WPR A;  1JTH A;  1H8A A;  1SQQ K;  1FZC A;  1JY2 N;  2WPQ A;  2ZXE B;  3V2Q A;  1FOS E;  2H7H A;  2W6A A;  4XA4 A;  1M1J C;  1JO5 A;  1LWU B;  4AQR D;  5AW1 B;  1KFM A;  1LT9 A;  3PP5 A;  5AW6 B;  2CPB A;  1NWQ A;  2WSE H;  1KIL D;  3I5C A;  2IX7 C;  2R5B A;  1M1J B;  1GL2 D;  3V2P A;  1URQ D;  3HE5 B;  2N1T D;  3EFG A;  5APQ A;  4Y99 C;  2A45 G;  1JY2 P;  3VYI A;  1GTW A;  3MUD A;  1QL1 A;  4WY4 D;  3L37 A;  1L0N K;  1KIL A;  2Z5I A;  3P7K A;  4Y99 B;  1GL2 A;  1J1D C;  1NO4 A;  3M0A A;  3VP9 A;  1URQ A;  3V5B A;  2N1T A;  3L36 A;  3RL0 B;  3HD7 D;  3B5N C;  5APT A;  3VOP A;  4C7N A;  1FAV A;  5CCH C;  1YTZ I;  1J1D B;  2YMY A;  2H43 A;  5KTB A;  4WY4 A;  2O01 H;  2Z5H A;  1DH3 A;  4IFD K;  1S9K D;  3V2N A;  2WIT A;  3TYY A;  2N9B A;  3TK1 A;  3HD7 A;  2GUS A;  2C0X A;  2HOD A;  3O8Z A;  2KYV A;  2OYH A;  1JCC A;  2M8R A;  3HTK B;  1MUU A;  1LTB C;  4JYC A;  2WT7 B;  3T97 A;  2CPS A;  4B86 A;  2FFD A;  1A02 F;  2HLO A;  3RK3 B;  2YKP A;  3VMZ A;  5AVT B;  2KOG A;  1KFN A;  1IFD A;  2OYI C;  1G2C A;  1VDF A;  3V4W A;  1H89 A;  2E43 A;  1LTJ C;  2P7J A;  1CZQ A;  4GKG A;  1FDM A;  1YTZ T;  5AW4 B;  1LTS C;  1FZG A;  2NPS C;  4GIF A;  1QL2 A;  2OYI B;  3M91 A;  3TNU A;  1LTJ B;  1M7L A;  5KJ7 D;  1SP4 A;  2P1J A;  5AW7 B;  5AW8 B;  1RF0 A;  1GK4 A;  2C9N Y;  3TSI A;  3IFM A;  2YNY A;  5BU5 A;  1JMM A;  3HE4 B;  5KJ7 C;  1JY3 N;  1HVV A;  2Q3I A;  3HRN A;  1ZR4 A;  4N78 E;  2R3C A;  1N7S C;  1FZB A;  1KZU B;  3MD0 A;  1PFI A;  1NAF A;  2POH A;  2XZR A;  1IK9 A;  1X8Y A;  4OH8 B;  2WPS A;  1ZR2 A;  3MGN A;  1FZC C;  5AW9 B;  1IFN A;  1HUC A;  3A7O A;  3EQ2 A;  1YYC A;  1JY3 P;  3GHG B;  1JTH B;  1T8Z A;  1FZC B;  1ZLL A;  4DOJ A;  1HWT C;  1JY2 O;  1LT9 C;  4AYC A;  5AW0 B;  1OXZ A;  1J2J B;  1L0L K;  2FYZ A;  3RK2 D;  5AVY B;  1ZN5 A;  3BAT A;  1IFI A;  1LTA C;  3U1A A;  4HH2 A;  3UIA A;  2C9L Y;  4EIJ A;  3M0D A;  1GW4 A;  1RE4 A;  3U1C A;  2WSC H;  5AW3 B;  1JOC A;  1RE3 A;  1JCD A;  2E42 A;  2HYN A;  2MJZ A;  3R2P A;  1MFZ A;  1SQV K;  1CSB A;  1KIL C;  2M3B A;  1GL2 C;  1URQ C;  1LWU A;  2N1T C;  2QM8 A;  1SLQ A;  1WT6 A;  3U59 A;  3A2A A;  5BU8 B;  1GL2 B;  3KDP B;  4AUW A;  4WY4 C;  2N1T B;  3LIE A;  3HE5 A;  1CI6 A;  3RL0 D;  2XDJ A;  1N73 A;  4C7N B;  1IC2 A;  3OA7 A;  3A5T A;  2IFN A;  4JF7 A;  3HUS A;  1IO4 A;  1LTI C;  3HD7 C;  2HPC A;  4WY4 B;  2LKM A;  3B5N B;  1LGH B;  2OYH C;  2YO2 A;  1JNM A;  1A02 J;  1T3U A;  2KLV A;  3B8E B;  2BAS A;  4M3L A;  3HD7 B;  1E5W A;  3CL3 D;  2Z4E A;  3A3Y B;  3MTU E;  2OYH B;  1L4A D;  5AVW B;  4EOT A;  3SWF A;  4LLH A;  3KPE A;  3LID A;  1FZA A;  2FFD C;  1SQB K;  2GUV A;  4LC1 A;  1SQX K;  1RF1 A;  1SFC D;  2Q7C A;  3OJA B;  5CJ0 A;  4ZKU A;  2FFD B;  4RES B;  1L4A A;  1FBM A;  1HTL C;  3RK3 D;  3NMD A;  4ZKP A;  2P2U A;  4KHX A;  5CCG D;  1G2C B;  1SFC A;  1W2E A;  5APY A;  3HTK A;  1G1J A;  1N86 A;  3VMX A;  2O1K A;  2WT7 A;  1RF0 C;  2P67 A;  1HBW A;  1LTG C;  5APV A;  2R32 A;  2PAJ A;  2XU6 A;  2KSJ A;  1T2K D;  4IFM A;  1X9V A;  2NPS B;  5CCG A;  2WWW A;  1FU1 A;  1G1I A;  1NU1 K;  1EQ7 A;  3KYQ A;  3P8C E;  1FZF A;  1FJK A;  3VTP C;  1JY3 O;  3M9B A;  3NTN A;  3BAS A;  1NTK K;  5BVZ A;  4I6M C;  1GD2 E;  1N7S B;  4IFF A;  1GU5 A;  1HGV A;  1ZV8 A;  4W7Z A;  1J1E C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...