1M57D

Structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i-286) mutant))
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
42
structure length
42
Chain Sequence
GHVAGSMDITQQEKTFAGFVRMVTWAAVVIVAALIFLALANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
publication title The X-ray crystal structures of wild-type and EQ(I-286) mutant cytochrome c oxidases from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 15
structure length 42
sequence length 42
chains with identical sequence J
ec nomenclature
pdb deposition date 2002-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07835 COX4_pro_2 Bacterial aa3 type cytochrome c oxidase subunit IV
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.160 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Bacterial aa3 type cytochrome c oxidase subunit IV 1m57D00
1M56D 1QLED 1M57D
chains in the Genus database with same CATH superfamily
2AEFA 2E76B 4HYTB 5AW4B 3V2PA 4D6TE 5AVZB 3HD7D 2GA1A 3CXHE 1SQBE 2QJKB 1AQ5A 5KAFH 1NAYA 3NTNA 2P10A 2HODA 3L70D 3IFMA 3S9OA 3A7OA 1RE3A 2QSIA 2P67A 2RN0A 1H0TB 1EDKA 1IFIA 1VF5D 1NHLA 3BCCD 2IZ0A 4M3LA 2OYHB 2JWDA 5H2FH 5AW6B 3L72D 2P1JA 1S1CX 1RQVA 4K3AA 4H0LC 5AW2B 3AEAC 3MUDA 2NZ2A 3RL0C 2JP3A 3L4FA 2ZVNB 3I55P 2FYUG 1T3JA 3A3YB 1OZHA 5CCGC 1EZVD 1P84D 2OARA 1YYCA 4QMAA 2K9JB 5EFWB 2QJYC 3GF7A 2WT7A 3L71G 1KQFB 2ZYGA 3TNUB 2BCCG 2V4HA 2IBZG 3OAKA 2WPRA 2N1TD 1VQ6P 2A06E 1Q86Q 1BCCE 1L0LD 3AE2C 1VQ4P 3H1JD 1G2CA 4PJ0H 2KZIA 2Q5UA 4I7ZC 4U3FJ 1JY2N 2E74C 2RMZA 3G9RA 3CCJP 1M7LA 1IFNA 2KS1B 3MIWA 1BSHA 3TGUJ 1JY3O 5AW8B 3H1IE 5KAFE 1IFDA 2O01J 3AEFC 1KILC 3I5CA 5KLIC 1M57D 1KB9D 1NH4A 1N8RQ 5GTIH 2M0BA 4RKUJ 2JR8A 3AECC 3L75E 1HTLC 3CWBG 1YTZI 1VPCA 4YTPC 1CI6B 2W6JH 5KKZB 1PGPA 2LXCB 4UB6H 5H2FE 1VQ8P 1IFMA 1RE3C 2Q7CA 2XNDH 4ASWA 5APXA 3NMDA 1SFCA 1J2JB 3G71P 2W6AA 3FXDA 1NKZB 1R5SA 3SWYA 1Y8AA 1A02F 3P32A 2FBWC 1GD2E 3PRJA 3NFQA 2OYIB 1R5LA 1ZW0A 1JM0A 2B87B 2M5AA 4C7RA 2E5TA 2WSCH 3M9QA 4DZOA 1L0ND 2ZAEB 3JSVC 1URQC 2AXCA 3O8ZA 1BGYG 1U57A 1S5LX 2YIUB 5KJ7A 3GF3A 1FU1A 3H1KE 3ITKA 4AUWA 3EFGA 1SQPK 2R3CA 3FGAD 3KZIE 1KORA 2DW3A 4IOIH 1IK9A 4JBZA 1HWTC 5CJ4A 1NTKJ 2BCCJ 5BU8B 1KYOD 1KV4A 2QRXA 1ZN5A 3H1LG 4MN4C 1YJNP 2KLUA 1NTMG 3HD7B 1LT1A 1PPJD 1H0TA 4GDOA 3NXSA 4PD4I 2OYHA 4KT0J 4H44D 4KJMA 1LTTC 1FZFA 1SQBJ 1PP9G 2JEEA 1JY2P 2I1KA 2HR3A 2Q1KA 3D71A 1OXZA 2BEZF 3A0BH 2Y0CA 2B9BA 3VMXA 3WMM0 1L0LE 4UB6E 3L73D 3RL0g 1GMJA 2CPSA 2R32A 5AVRB 1S4XA 3B8EB 2G8YA 3H32A 1SP4A 5DJTB 4OH8B 3H1HD 4LLHA 3FXEA 5APVA 3CX5D 3N7NA 1SQXG 1JCCA 3T97B 5B66H 4HB1A 2FYUD 1KB9E 1PIXA 1VQ9P 1SFCC 3BCCG 1N7SC 2A45G 3PHLA 3R4YA 2R5BA 3L72G 3JCUH 2NPSD 1S72P 2GUVA 2E42A 2M8RA 2Q6QA 3RBZA 1NTZG 5TISH 3M9HA 1JY3N 5KLVE 1VQNP 3L71D 2JKVA 1FBMA 1WT6A 4HH2A 1KMIZ 3O6QB 3TDKA 2Y0DA 2W6BA 4RO0A 2P7JA 1LTBC 1GU4A 2KS1A 1JMBA 4LC1A 1FOSF 1MFTA 3FX0A 1EZVG 1BCCJ 1KN7A 5KJ7C 2E76C 2JO1A 1IJDB 1FZAA 2WSFJ 1FE6A 2P58A 1M1JB 1JMMA 2WWWA 4DT0A 2D2CC 2MJZA 5APUA 4EYYQ 1YJ9P 1CI6A 2Q9IA 1L0NE 1KQSO 2E75D 3MP7B 1NOHA 2K1AA 3P8CE 1PL5A 3VYIA 3HE4B 5KAIH 3RGUA 3AE7C 3KPEA 1BDDA 3CWBD 3A0BE 3H1JG 2OYHC 3L75J 2B89A 4NPFX 1EDLA 3ABVC 2OYIA 1J1DB 1LJ2A 1LTJB 2WMMA 2B87A 2HPCB 2ZT9C 5E79H 4CPGA 2H43A 3CXHH 3W68A 2W90A 3FWLA 2O1JA 1K9MQ 1J1EB 1GTWA 1JB0J 5AVTB 2XZRA 2IX7C 1RF0A 2AXTE 1LTSC 3L70J 2P2UA 1K05A 4H13C 1JEKA 5AW7B 2SPZA 5TISE 1SQQK 2BEQD 3CCLP 4YPCA 4L73A 4OVNF 2KYVA 2M3BA 1X79B 3CC7P 3HD7A 2CPBA 3H1KJ 3S1KA 2Y9YA 3KQGA 1JY3P 1L4AC 3CPWO 2YKQA 2FYUE 1QVGO 3VN0A 1X22A 3RK3D 3R2PA 1RF1C 5APWA 3B5ND 4W80A 4EIJA 4GOEA 4ZNCA 1NWQA 3LIEA 5BVZA 2C9NY 1KQLA 3L71E 1WRGA 2OYOA 3CMAP 1PP9D 1AV1A 1SQVK 3CCEP 4H0LD 2BCCE 3HUSB 2IBZE 3Q2YA 1LGHB 4EDFA 3B71A 3ZDMA 3VTPC 1SQQD 1TU3F 4GOFA 4GIFA 3CCUP 1EXIA 1L0LJ 1PPJG 5E79E 1EDIA 3H1JJ 1T2KD 1DEBA 1N86A 2O1KA 3EWKA 2RH0A 3TYYA 1DIPA 1SQXD 2M3EA 4PV1C 3U1AA 1DD3A 1MFZA 1Y47A 3O6QA 1QL2A 2KSJA 3CCRP 2ZJSE 1IC2A 4PD4D 2LKMA 3L73G 2ZVOB 3E1RA 1N73C 1W2BO 3GW6A 2N1TA 2NPSB 2WSCJ 1SQPG 1RF0C 3IAOA 3M0DA 3H1HG 1NTZD 3L37A 1SQVD 1USEA 4ZMDA 1W2EA 5KLVJ 4RJTA 1M1JA 2XDJA 1JTHB 4U7JA 3MGNA 3CCQP 1ZOYC 2C0XA 1VQ5P 2KNCB 4I2LC 4KHXA 2FXOA 3AE1C 2QG4A 3AE3C 2FYNB 3U59A 1NGMB 2A45H 4WY4C 1G1JA 1OW6A 4ZKUA 1K73Q 1FOSE 1S5LH 5APYA 1VQOP 3V6IA 1Q90D 1BGYE 2E75B 3PLNA 1L0NJ 1SVFA 4K35A 1LTJA 3AEEC 2PP6A 4IFMA 3L74G 5CBNA 2L5GB 3KZIH 1G1IA 3OJAB 1VF5C 4DOJA 2FFDA 2K9YA 4AYCA 3BVHA 4Y99B 1MKMA 3V2RA 1FAVA 1P84H 5APTA 4C46A 3VMYA 1OMIA 5L8RJ 1NJIQ 3H1LE 3WUTA 1OVRA 2IFNA 4TLFA 1NTME 1KQGB 3GG2A 2QEXP 3A2AA 1PP9E 1KC8Q 4IL6X 4IL6E 2H89C 4JPZB 3M9BA 2KLVA 1A02J 2C9LY 2YXQB 1FZCA 1GL2D 3L73J 4JQ0D 2N1TC 3QWOC 4UB8E 5GTHE 3M0DC 3GHGB 3L70E 3MUDC 1VQKP 1KB9H 1SQXE 1VQ7P 1CW5A 1FC2C 4WVZA 1HGVA 4N3YB 2J58A 2LR2A 3BCCE 2I8DA 1S3JA 2HFED 3JC22 1PGJA 3MZWB 2FYUJ 3Q5PA 3RK3B 1S5LE 3TK1A 3D70A 3L72E 1JO5A 2AEMA 3B5NB 4NPDA 2PFXA 3EFFK 2AEJA 1NTZE 4OGQD 2OTLP 2I1JA 3L71J 1M1KQ 1HJBA 1YIJP 3G3ZA 1JCDA 4H0LB 2QJPC 3AEGC 1RE4A 1T8ZA 1LTJC 1EZVE 1GZLA 1P84E 2Z4EA 3QH9A 3TGUD 2Y0EA 2FFDC 1NU1K 1J1EC 2QIWA 1ZRTD 2NPSA 3AE4C 2QJYB 3LW5J 3AE6C 2R5DA 2QE7H 1R8EA 4L76A 1SQQG 1IO4A 3H1JE 1X8YA 2KXPB 3CWBJ 1NTKK 1OVVA 1KYOH 2Q3EA 1SQPD 2YO2A 1LP1B 2KNCA 2ZYAA 2K9JA 1HVVA 1MV8A 2D2CD 2E74B 3IN6A 2KB7P 5TJHA 1WMKA 2IZ1A 1FDIA 3FWNA 4TT3H 2KP8A 1SQBK 1FZCC 3TNUA 2AXTH 1GK6A 5KLIB 1KILB 1HGZA 1H88A 5CCHA 1NU1D 1Y9BA 3BRTB 4N78D 1BDCA 3VMAA 1SQVG 2ITAA 2LXBA 3E7KA 3H25A 1QX8A 1S9KD 1YQ4C 2HODB 2IYOA 4H44C 3D6ZA 1T3UA 1AJYA 3CX5H 4XA4A 1BGYJ 3L74D 2YKPA 3HE5B 4AQRD 3D6YA 1JNMA 1NKNA 4YXWH 1U7JA 3UIAA 2VRSA 1OX3A 1CSBA 4A7PA 3GLMA 4HKZH 1IFPA 1PFIA 2QA4P 1BE3G 4D6TD 1CZQA 1ZP0C 1JUNA 2QJKC 2KSEA 5APSA 1K8AQ 4DJGA 2POHA 4R4MA 3N4XA 1RE4C 4BRYB 1YJWP 5CCHD 3H1LJ 2ZFCA 1KFNA 4GT1A 1NTMJ 1URQB 2WSSH 1N7LA 2OTKE 3SSUA 4GKGA 2FXPA 1BSNA 4YXDC 2WSEJ 1E5WA 2NPSC 1PP9J 3A0HE 1VQLP 3GHGA 1KYOE 2FXMA 3G4SP 3MD0A 1FS0E 1L4AD 1PPJE 2HYNA 2IFMA 1VQMP 1GL2B 3LW5H 3OW2O 1AVOA 4XE5B 2IPPA 3B5NA 1ZRTE 3CCSP 5AVWB 5AW9B 3PH0A 3TSIA 1IK7A 3CCMP 3RK2D 1SQXJ 1PGOA 1N2DC 2KK7A 1QVFO 3M0AA 3L73E 3BCCJ 1YQ3C 1ZXGA 2Q3IA 4JF7A 3OA7A 3L72J 1SQPE 5M1BA 5KTBA 3H1HE 1Q2NA 3CX5E 3VMZA 1QEXA 4EOTA 4OGQB 1NTZJ 3CI9A 2GUSA 5AW3B 3KDPB 1YI2P 1Q7YQ 2A06D 1SQVJ 3SWKA 5C39A 3CMEP 5B5EE 1PGQA 2PRRA 1IZNB 1AVYA 1D7MA 1SFCB 1N7SB 3CL3D 5AW1B 3KHUA 1DD4A 1M90Q 1NAFA 1RH5B 2G3AA 1E79H 3H1ID 2QM7A 1S9KE 3CD6P 2MKVA 5KKZC 1LP1A 4NPEA 3RL0D 2WZ7A 1HUCA 3L74E 4IFDK 3T97A 4U3FG 3CC4P 3E1IA 3IR9A 3TGUG 1QGKB 5CCGD 1JOCA 1MUUA 4I1LA 1KILA 3VP8A 1LTGC 1OIPA 2XU6A 3A5TA 2OYIC 1LTIC 3H6PA 4WY4D 3GHGC 3C8VA 5AVSB 2D2CB 2HG5D 1H89A 2WSEH 1NVOA 4JYCA 3CWBE 2PAJA 4IL6H 2YMKA 1S2EA 4IFFA 2YXRB 3EQ2A 1GW4A 3RK3C 1AA0A 2JWAA 3B5NC 3HE5A 2YIUC 1OFCX 3SFEC 1L0LK 2IBZI 2E74D 3B4SA 4UB8H 2B88A 5GTHH 3AEBC 3H1KD 1KILD 2N9YB 2ZT9B 3II6A 1MZ9A 1LWUB 1DX7A 3CXHI 3CC2P 3HE4A 3PTZA 4BRYA 3HD7C 1NU1G 4PD4H 1URQA 1BE3D 1RQUA 1OW7A 3TF5A 3H32B 3WUVA 1T2KC 1M8OB 2K37A 3AEDC 4H13B 2HPCA 5AVVB 1FZBA 5KLVK 2E43A 5AVQB 1NTKG 1GL2A 2HLOA 3SFDC 2UWJE 4D6TG 1FZEA 1GDTA 1FDOA 1LT9B 3C1LA 2RKLA 1YTZT 4XFJA 3RK3E 3VOPA 3CLQA 3Q1MA 1L4AB 5AVUB 1EDJA 1SQBG 5AW5B 3SWFA 4LGDE 4I6MC 1URQD 2L91A 2JJLA 1RF1B 5CBOA 3PP5A 4Y28J 3L35A 1L0NK 3BASA 2ZYDA 3PJSK 3RK2B 2R44A 1SQQE 5AVXB 2QVAA 3VP9A 2O01N 4N6JA 4Z1MH 3F5HA 1QL1A 4OWFA 5CJ0A 5KLVD 1DH3A 1UIXA 5AVYB 4L74A 1SQPJ 5BU5A 3H1HJ 1N7SA 1DEEG 2H7HA 2OGUA 1QLED 2YNYA 1GW3A 3I56P 1M1JC 4GODA 4PD4E 4PV1B 4W7YA 3HUSA 2KI7B 2W83C 3Q5SA 2Z5HA 2IDBA 1OWAA 1HF9A 2XV5A 1SQVE 1N73B 1NU1J 2CK3H 3W67A 3P8CD 1HJ0A 3LIDA 2A06G 2J5UA 1BCCG 3CCVP 5AW0B 1EC5A 1VL2A 3RL0B 1J1DC 1KILE 3MTUE 4U3FD 2R3SA 1W5CE 1SFCD 3L74J 1N7SD 1EXJA 1YBKA 4PJ0E 2C0WA 5CMZA 3AE8C 3M06A 2FYUK 1KZUB 1GL2C 1BE3E 1VQPP 3H1IG 2QM8A 3U1CA 4D6TJ 3Q5RA 4WY4B 3P7KA 2A45I 3L75G 2K3RA 1U7MA 2WVRA 4WBAA 2W8ZA 3AE9C 4O9BA 5GTIE 1SLQA 1PZQA 1JTHA 1HH0A 3A0HH 4BXLA 5KJ7D 2E76D 1LWUA 2NRGA 2YKOA 4L75A 1VF5B 3Q3DA 3HTKB 3KYQA 1M56D 1GK4A 1UIIA 4I7ZB 1OVUA 2BASA 2O01H 3IF4A 4OGQC 1EZVI 1P84I 3MHVA 4C7NB 1PV3A 2OTJP 1YHQP 1XTGB 5DJUB 3L70G 2WPQA 1RY3A 1FJPA 1NYHA 2XNXA 2WTYA 4HJGH 3WU2H 1RHZB 3P8MC 2J59M 1GU5A 3BATA 1FJKA 2PGDA 3HUSC 2ZT9D 3H1KG 1LT9A 2V7QJ 1LTAC 1YITP 3V2QA 2JDIH 1L4AA 2WQYC 2Z5IA 1NTKD 2BCCD 3GMAA 5B5EH 2IBZD 2FYZA 1RF1A 2N1TB 4R4LA 3KXDA 4BWNA 2W27A 1KB9I 1VDFA 2FY8A 4H13D 3CXHD 1SQBD 4ZKPA 1Z56A 1KD1Q 2KUBA 1ZLLA 2H8PD 2ZXXA 3WUUA 2KOGA 1KFMA 3S4RA 3USSA 2KIKA 3V4QA 1L2PA 3H1IJ 1L0LG 1AFOA 1H8AA 2WT7B 3AE5C 1SS1A 4U3FE 1EQ7A 2K88A 2XKMA 3RBXA 1ZV8A 2ZXEB 2WPVB 2QJPB 2KZJA 3L36A 1SQQJ 4EI2A 3TGUE 1USDA 3G6EP 3V2NA 2YO3A 4B86A 5APQA 2OQQA 5CHXA 1Q81Q 1LWUC 3V5BA 1G2CB 2GM4A 2FFDB 1LNQA 1NTMK 5B66E 1T6AA 2FYNC 2FKWB 3HRNA 1N73A 2E5YA 4RESB 2O3JA 4W7ZA 2IYPA 1OW8A 1X9VA 2H88C 3WU2E 1ZR4A 1X0TA 2E75C 3JCUE 3K5BA 5K5GB 5KLVG 2WPSA 2YMYA 5CCHC 1JY2O 1FZGA 4WB4A 1BGYD 3BRVB 1BCCD 2WITA 1KYOI 4Y99C 5CCGA 1ZR2A 4DCKA 3M91A 3F89A 4PV1D 1ZMEC 4ASVA 2N9BA 1LT9C 4WY4A 3V4WA 1AQTA 1SQXK 1IFJA 1NU1E 1KTMA 1FZCB 4N78E 2V7QH 1L0NG 3H1LD 1BE3J 1NTMD 1HBWA 4JYBA 2M5AB 3L75D 3HTKA 5KAIE 1NO4A 3RK2C 1NTZK 4WWIA 1Q82Q 4H44B 1FDMA 1K04A 1NTKE 4C7NA 2Y9ZA 1XTCC 2WSFH 3CX5I 3C9IA
chains in the Genus database with same CATH topology
1M56D 1QLED 1M57D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M56 D;  1QLE D;  1M57 D; 
#chains in the Genus database with same CATH topology
 2AEF A;  2E76 B;  4HYT B;  5AW4 B;  3V2P A;  4D6T E;  5AVZ B;  3HD7 D;  2GA1 A;  3CXH E;  1SQB E;  2QJK B;  1AQ5 A;  5KAF H;  1NAY A;  3NTN A;  2P10 A;  2HOD A;  3L70 D;  3IFM A;  3S9O A;  3A7O A;  1RE3 A;  2QSI A;  2P67 A;  2RN0 A;  1H0T B;  1EDK A;  1IFI A;  1VF5 D;  1NHL A;  3BCC D;  2IZ0 A;  4M3L A;  2OYH B;  2JWD A;  5H2F H;  5AW6 B;  3L72 D;  2P1J A;  1S1C X;  1RQV A;  4K3A A;  4H0L C;  5AW2 B;  3AEA C;  3MUD A;  2NZ2 A;  3RL0 C;  2JP3 A;  3L4F A;  2ZVN B;  3I55 P;  2FYU G;  1T3J A;  3A3Y B;  1OZH A;  5CCG C;  1EZV D;  1P84 D;  2OAR A;  1YYC A;  4QMA A;  2K9J B;  5EFW B;  2QJY C;  3GF7 A;  2WT7 A;  3L71 G;  1KQF B;  2ZYG A;  3TNU B;  2BCC G;  2V4H A;  2IBZ G;  3OAK A;  2WPR A;  2N1T D;  1VQ6 P;  2A06 E;  1Q86 Q;  1BCC E;  1L0L D;  3AE2 C;  1VQ4 P;  3H1J D;  1G2C A;  4PJ0 H;  2KZI A;  2Q5U A;  4I7Z C;  4U3F J;  1JY2 N;  2E74 C;  2RMZ A;  3G9R A;  3CCJ P;  1M7L A;  1IFN A;  2KS1 B;  3MIW A;  1BSH A;  3TGU J;  1JY3 O;  5AW8 B;  3H1I E;  5KAF E;  1IFD A;  2O01 J;  3AEF C;  1KIL C;  3I5C A;  5KLI C;  1M57 D;  1KB9 D;  1NH4 A;  1N8R Q;  5GTI H;  2M0B A;  4RKU J;  2JR8 A;  3AEC C;  3L75 E;  1HTL C;  3CWB G;  1YTZ I;  1VPC A;  4YTP C;  1CI6 B;  2W6J H;  5KKZ B;  1PGP A;  2LXC B;  4UB6 H;  5H2F E;  1VQ8 P;  1IFM A;  1RE3 C;  2Q7C A;  2XND H;  4ASW A;  5APX A;  3NMD A;  1SFC A;  1J2J B;  3G71 P;  2W6A A;  3FXD A;  1NKZ B;  1R5S A;  3SWY A;  1Y8A A;  1A02 F;  3P32 A;  2FBW C;  1GD2 E;  3PRJ A;  3NFQ A;  2OYI B;  1R5L A;  1ZW0 A;  1JM0 A;  2B87 B;  2M5A A;  4C7R A;  2E5T A;  2WSC H;  3M9Q A;  4DZO A;  1L0N D;  2ZAE B;  3JSV C;  1URQ C;  2AXC A;  3O8Z A;  1BGY G;  1U57 A;  1S5L X;  2YIU B;  5KJ7 A;  3GF3 A;  1FU1 A;  3H1K E;  3ITK A;  4AUW A;  3EFG A;  1SQP K;  2R3C A;  3FGA D;  3KZI E;  1KOR A;  2DW3 A;  4IOI H;  1IK9 A;  4JBZ A;  1HWT C;  5CJ4 A;  1NTK J;  2BCC J;  5BU8 B;  1KYO D;  1KV4 A;  2QRX A;  1ZN5 A;  3H1L G;  4MN4 C;  1YJN P;  2KLU A;  1NTM G;  3HD7 B;  1LT1 A;  1PPJ D;  1H0T A;  4GDO A;  3NXS A;  4PD4 I;  2OYH A;  4KT0 J;  4H44 D;  4KJM A;  1LTT C;  1FZF A;  1SQB J;  1PP9 G;  2JEE A;  1JY2 P;  2I1K A;  2HR3 A;  2Q1K A;  3D71 A;  1OXZ A;  2BEZ F;  3A0B H;  2Y0C A;  2B9B A;  3VMX A;  3WMM 0;  1L0L E;  4UB6 E;  3L73 D;  3RL0 g;  1GMJ A;  2CPS A;  2R32 A;  5AVR B;  1S4X A;  3B8E B;  2G8Y A;  3H32 A;  1SP4 A;  5DJT B;  4OH8 B;  3H1H D;  4LLH A;  3FXE A;  5APV A;  3CX5 D;  3N7N A;  1SQX G;  1JCC A;  3T97 B;  5B66 H;  4HB1 A;  2FYU D;  1KB9 E;  1PIX A;  1VQ9 P;  1SFC C;  3BCC G;  1N7S C;  2A45 G;  3PHL A;  3R4Y A;  2R5B A;  3L72 G;  3JCU H;  2NPS D;  1S72 P;  2GUV A;  2E42 A;  2M8R A;  2Q6Q A;  3RBZ A;  1NTZ G;  5TIS H;  3M9H A;  1JY3 N;  5KLV E;  1VQN P;  3L71 D;  2JKV A;  1FBM A;  1WT6 A;  4HH2 A;  1KMI Z;  3O6Q B;  3TDK A;  2Y0D A;  2W6B A;  4RO0 A;  2P7J A;  1LTB C;  1GU4 A;  2KS1 A;  1JMB A;  4LC1 A;  1FOS F;  1MFT A;  3FX0 A;  1EZV G;  1BCC J;  1KN7 A;  5KJ7 C;  2E76 C;  2JO1 A;  1IJD B;  1FZA A;  2WSF J;  1FE6 A;  2P58 A;  1M1J B;  1JMM A;  2WWW A;  4DT0 A;  2D2C C;  2MJZ A;  5APU A;  4EYY Q;  1YJ9 P;  1CI6 A;  2Q9I A;  1L0N E;  1KQS O;  2E75 D;  3MP7 B;  1NOH A;  2K1A A;  3P8C E;  1PL5 A;  3VYI A;  3HE4 B;  5KAI H;  3RGU A;  3AE7 C;  3KPE A;  1BDD A;  3CWB D;  3A0B E;  3H1J G;  2OYH C;  3L75 J;  2B89 A;  4NPF X;  1EDL A;  3ABV C;  2OYI A;  1J1D B;  1LJ2 A;  1LTJ B;  2WMM A;  2B87 A;  2HPC B;  2ZT9 C;  5E79 H;  4CPG A;  2H43 A;  3CXH H;  3W68 A;  2W90 A;  3FWL A;  2O1J A;  1K9M Q;  1J1E B;  1GTW A;  1JB0 J;  5AVT B;  2XZR A;  2IX7 C;  1RF0 A;  2AXT E;  1LTS C;  3L70 J;  2P2U A;  1K05 A;  4H13 C;  1JEK A;  5AW7 B;  2SPZ A;  5TIS E;  1SQQ K;  2BEQ D;  3CCL P;  4YPC A;  4L73 A;  4OVN F;  2KYV A;  2M3B A;  1X79 B;  3CC7 P;  3HD7 A;  2CPB A;  3H1K J;  3S1K A;  2Y9Y A;  3KQG A;  1JY3 P;  1L4A C;  3CPW O;  2YKQ A;  2FYU E;  1QVG O;  3VN0 A;  1X22 A;  3RK3 D;  3R2P A;  1RF1 C;  5APW A;  3B5N D;  4W80 A;  4EIJ A;  4GOE A;  4ZNC A;  1NWQ A;  3LIE A;  5BVZ A;  2C9N Y;  1KQL A;  3L71 E;  1WRG A;  2OYO A;  3CMA P;  1PP9 D;  1AV1 A;  1SQV K;  3CCE P;  4H0L D;  2BCC E;  3HUS B;  2IBZ E;  3Q2Y A;  1LGH B;  4EDF A;  3B71 A;  3ZDM A;  3VTP C;  1SQQ D;  1TU3 F;  4GOF A;  4GIF A;  3CCU P;  1EXI A;  1L0L J;  1PPJ G;  5E79 E;  1EDI A;  3H1J J;  1T2K D;  1DEB A;  1N86 A;  2O1K A;  3EWK A;  2RH0 A;  3TYY A;  1DIP A;  1SQX D;  2M3E A;  4PV1 C;  3U1A A;  1DD3 A;  1MFZ A;  1Y47 A;  3O6Q A;  1QL2 A;  2KSJ A;  3CCR P;  2ZJS E;  1IC2 A;  4PD4 D;  2LKM A;  3L73 G;  2ZVO B;  3E1R A;  1N73 C;  1W2B O;  3GW6 A;  2N1T A;  2NPS B;  2WSC J;  1SQP G;  1RF0 C;  3IAO A;  3M0D A;  3H1H G;  1NTZ D;  3L37 A;  1SQV D;  1USE A;  4ZMD A;  1W2E A;  5KLV J;  4RJT A;  1M1J A;  2XDJ A;  1JTH B;  4U7J A;  3MGN A;  3CCQ P;  1ZOY C;  2C0X A;  1VQ5 P;  2KNC B;  4I2L C;  4KHX A;  2FXO A;  3AE1 C;  2QG4 A;  3AE3 C;  2FYN B;  3U59 A;  1NGM B;  2A45 H;  4WY4 C;  1G1J A;  1OW6 A;  4ZKU A;  1K73 Q;  1FOS E;  1S5L H;  5APY A;  1VQO P;  3V6I A;  1Q90 D;  1BGY E;  2E75 B;  3PLN A;  1L0N J;  1SVF A;  4K35 A;  1LTJ A;  3AEE C;  2PP6 A;  4IFM A;  3L74 G;  5CBN A;  2L5G B;  3KZI H;  1G1I A;  3OJA B;  1VF5 C;  4DOJ A;  2FFD A;  2K9Y A;  4AYC A;  3BVH A;  4Y99 B;  1MKM A;  3V2R A;  1FAV A;  1P84 H;  5APT A;  4C46 A;  3VMY A;  1OMI A;  5L8R J;  1NJI Q;  3H1L E;  3WUT A;  1OVR A;  2IFN A;  4TLF A;  1NTM E;  1KQG B;  3GG2 A;  2QEX P;  3A2A A;  1PP9 E;  1KC8 Q;  4IL6 X;  4IL6 E;  2H89 C;  4JPZ B;  3M9B A;  2KLV A;  1A02 J;  2C9L Y;  2YXQ B;  1FZC A;  1GL2 D;  3L73 J;  4JQ0 D;  2N1T C;  3QWO C;  4UB8 E;  5GTH E;  3M0D C;  3GHG B;  3L70 E;  3MUD C;  1VQK P;  1KB9 H;  1SQX E;  1VQ7 P;  1CW5 A;  1FC2 C;  4WVZ A;  1HGV A;  4N3Y B;  2J58 A;  2LR2 A;  3BCC E;  2I8D A;  1S3J A;  2HFE D;  3JC2 2;  1PGJ A;  3MZW B;  2FYU J;  3Q5P A;  3RK3 B;  1S5L E;  3TK1 A;  3D70 A;  3L72 E;  1JO5 A;  2AEM A;  3B5N B;  4NPD A;  2PFX A;  3EFF K;  2AEJ A;  1NTZ E;  4OGQ D;  2OTL P;  2I1J A;  3L71 J;  1M1K Q;  1HJB A;  1YIJ P;  3G3Z A;  1JCD A;  4H0L B;  2QJP C;  3AEG C;  1RE4 A;  1T8Z A;  1LTJ C;  1EZV E;  1GZL A;  1P84 E;  2Z4E A;  3QH9 A;  3TGU D;  2Y0E A;  2FFD C;  1NU1 K;  1J1E C;  2QIW A;  1ZRT D;  2NPS A;  3AE4 C;  2QJY B;  3LW5 J;  3AE6 C;  2R5D A;  2QE7 H;  1R8E A;  4L76 A;  1SQQ G;  1IO4 A;  3H1J E;  1X8Y A;  2KXP B;  3CWB J;  1NTK K;  1OVV A;  1KYO H;  2Q3E A;  1SQP D;  2YO2 A;  1LP1 B;  2KNC A;  2ZYA A;  2K9J A;  1HVV A;  1MV8 A;  2D2C D;  2E74 B;  3IN6 A;  2KB7 P;  5TJH A;  1WMK A;  2IZ1 A;  1FDI A;  3FWN A;  4TT3 H;  2KP8 A;  1SQB K;  1FZC C;  3TNU A;  2AXT H;  1GK6 A;  5KLI B;  1KIL B;  1HGZ A;  1H88 A;  5CCH A;  1NU1 D;  1Y9B A;  3BRT B;  4N78 D;  1BDC A;  3VMA A;  1SQV G;  2ITA A;  2LXB A;  3E7K A;  3H25 A;  1QX8 A;  1S9K D;  1YQ4 C;  2HOD B;  2IYO A;  4H44 C;  3D6Z A;  1T3U A;  1AJY A;  3CX5 H;  4XA4 A;  1BGY J;  3L74 D;  2YKP A;  3HE5 B;  4AQR D;  3D6Y A;  1JNM A;  1NKN A;  4YXW H;  1U7J A;  3UIA A;  2VRS A;  1OX3 A;  1CSB A;  4A7P A;  3GLM A;  4HKZ H;  1IFP A;  1PFI A;  2QA4 P;  1BE3 G;  4D6T D;  1CZQ A;  1ZP0 C;  1JUN A;  2QJK C;  2KSE A;  5APS A;  1K8A Q;  4DJG A;  2POH A;  4R4M A;  3N4X A;  1RE4 C;  4BRY B;  1YJW P;  5CCH D;  3H1L J;  2ZFC A;  1KFN A;  4GT1 A;  1NTM J;  1URQ B;  2WSS H;  1N7L A;  2OTK E;  3SSU A;  4GKG A;  2FXP A;  1BSN A;  4YXD C;  2WSE J;  1E5W A;  2NPS C;  1PP9 J;  3A0H E;  1VQL P;  3GHG A;  1KYO E;  2FXM A;  3G4S P;  3MD0 A;  1FS0 E;  1L4A D;  1PPJ E;  2HYN A;  2IFM A;  1VQM P;  1GL2 B;  3LW5 H;  3OW2 O;  1AVO A;  4XE5 B;  2IPP A;  3B5N A;  1ZRT E;  3CCS P;  5AVW B;  5AW9 B;  3PH0 A;  3TSI A;  1IK7 A;  3CCM P;  3RK2 D;  1SQX J;  1PGO A;  1N2D C;  2KK7 A;  1QVF O;  3M0A A;  3L73 E;  3BCC J;  1YQ3 C;  1ZXG A;  2Q3I A;  4JF7 A;  3OA7 A;  3L72 J;  1SQP E;  5M1B A;  5KTB A;  3H1H E;  1Q2N A;  3CX5 E;  3VMZ A;  1QEX A;  4EOT A;  4OGQ B;  1NTZ J;  3CI9 A;  2GUS A;  5AW3 B;  3KDP B;  1YI2 P;  1Q7Y Q;  2A06 D;  1SQV J;  3SWK A;  5C39 A;  3CME P;  5B5E E;  1PGQ A;  2PRR A;  1IZN B;  1AVY A;  1D7M A;  1SFC B;  1N7S B;  3CL3 D;  5AW1 B;  3KHU A;  1DD4 A;  1M90 Q;  1NAF A;  1RH5 B;  2G3A A;  1E79 H;  3H1I D;  2QM7 A;  1S9K E;  3CD6 P;  2MKV A;  5KKZ C;  1LP1 A;  4NPE A;  3RL0 D;  2WZ7 A;  1HUC A;  3L74 E;  4IFD K;  3T97 A;  4U3F G;  3CC4 P;  3E1I A;  3IR9 A;  3TGU G;  1QGK B;  5CCG D;  1JOC A;  1MUU A;  4I1L A;  1KIL A;  3VP8 A;  1LTG C;  1OIP A;  2XU6 A;  3A5T A;  2OYI C;  1LTI C;  3H6P A;  4WY4 D;  3GHG C;  3C8V A;  5AVS B;  2D2C B;  2HG5 D;  1H89 A;  2WSE H;  1NVO A;  4JYC A;  3CWB E;  2PAJ A;  4IL6 H;  2YMK A;  1S2E A;  4IFF A;  2YXR B;  3EQ2 A;  1GW4 A;  3RK3 C;  1AA0 A;  2JWA A;  3B5N C;  3HE5 A;  2YIU C;  1OFC X;  3SFE C;  1L0L K;  2IBZ I;  2E74 D;  3B4S A;  4UB8 H;  2B88 A;  5GTH H;  3AEB C;  3H1K D;  1KIL D;  2N9Y B;  2ZT9 B;  3II6 A;  1MZ9 A;  1LWU B;  1DX7 A;  3CXH I;  3CC2 P;  3HE4 A;  3PTZ A;  4BRY A;  3HD7 C;  1NU1 G;  4PD4 H;  1URQ A;  1BE3 D;  1RQU A;  1OW7 A;  3TF5 A;  3H32 B;  3WUV A;  1T2K C;  1M8O B;  2K37 A;  3AED C;  4H13 B;  2HPC A;  5AVV B;  1FZB A;  5KLV K;  2E43 A;  5AVQ B;  1NTK G;  1GL2 A;  2HLO A;  3SFD C;  2UWJ E;  4D6T G;  1FZE A;  1GDT A;  1FDO A;  1LT9 B;  3C1L A;  2RKL A;  1YTZ T;  4XFJ A;  3RK3 E;  3VOP A;  3CLQ A;  3Q1M A;  1L4A B;  5AVU B;  1EDJ A;  1SQB G;  5AW5 B;  3SWF A;  4LGD E;  4I6M C;  1URQ D;  2L91 A;  2JJL A;  1RF1 B;  5CBO A;  3PP5 A;  4Y28 J;  3L35 A;  1L0N K;  3BAS A;  2ZYD A;  3PJS K;  3RK2 B;  2R44 A;  1SQQ E;  5AVX B;  2QVA A;  3VP9 A;  2O01 N;  4N6J A;  4Z1M H;  3F5H A;  1QL1 A;  4OWF A;  5CJ0 A;  5KLV D;  1DH3 A;  1UIX A;  5AVY B;  4L74 A;  1SQP J;  5BU5 A;  3H1H J;  1N7S A;  1DEE G;  2H7H A;  2OGU A;  1QLE D;  2YNY A;  1GW3 A;  3I56 P;  1M1J C;  4GOD A;  4PD4 E;  4PV1 B;  4W7Y A;  3HUS A;  2KI7 B;  2W83 C;  3Q5S A;  2Z5H A;  2IDB A;  1OWA A;  1HF9 A;  2XV5 A;  1SQV E;  1N73 B;  1NU1 J;  2CK3 H;  3W67 A;  3P8C D;  1HJ0 A;  3LID A;  2A06 G;  2J5U A;  1BCC G;  3CCV P;  5AW0 B;  1EC5 A;  1VL2 A;  3RL0 B;  1J1D C;  1KIL E;  3MTU E;  4U3F D;  2R3S A;  1W5C E;  1SFC D;  3L74 J;  1N7S D;  1EXJ A;  1YBK A;  4PJ0 E;  2C0W A;  5CMZ A;  3AE8 C;  3M06 A;  2FYU K;  1KZU B;  1GL2 C;  1BE3 E;  1VQP P;  3H1I G;  2QM8 A;  3U1C A;  4D6T J;  3Q5R A;  4WY4 B;  3P7K A;  2A45 I;  3L75 G;  2K3R A;  1U7M A;  2WVR A;  4WBA A;  2W8Z A;  3AE9 C;  4O9B A;  5GTI E;  1SLQ A;  1PZQ A;  1JTH A;  1HH0 A;  3A0H H;  4BXL A;  5KJ7 D;  2E76 D;  1LWU A;  2NRG A;  2YKO A;  4L75 A;  1VF5 B;  3Q3D A;  3HTK B;  3KYQ A;  1M56 D;  1GK4 A;  1UII A;  4I7Z B;  1OVU A;  2BAS A;  2O01 H;  3IF4 A;  4OGQ C;  1EZV I;  1P84 I;  3MHV A;  4C7N B;  1PV3 A;  2OTJ P;  1YHQ P;  1XTG B;  5DJU B;  3L70 G;  2WPQ A;  1RY3 A;  1FJP A;  1NYH A;  2XNX A;  2WTY A;  4HJG H;  3WU2 H;  1RHZ B;  3P8M C;  2J59 M;  1GU5 A;  3BAT A;  1FJK A;  2PGD A;  3HUS C;  2ZT9 D;  3H1K G;  1LT9 A;  2V7Q J;  1LTA C;  1YIT P;  3V2Q A;  2JDI H;  1L4A A;  2WQY C;  2Z5I A;  1NTK D;  2BCC D;  3GMA A;  5B5E H;  2IBZ D;  2FYZ A;  1RF1 A;  2N1T B;  4R4L A;  3KXD A;  4BWN A;  2W27 A;  1KB9 I;  1VDF A;  2FY8 A;  4H13 D;  3CXH D;  1SQB D;  4ZKP A;  1Z56 A;  1KD1 Q;  2KUB A;  1ZLL A;  2H8P D;  2ZXX A;  3WUU A;  2KOG A;  1KFM A;  3S4R A;  3USS A;  2KIK A;  3V4Q A;  1L2P A;  3H1I J;  1L0L G;  1AFO A;  1H8A A;  2WT7 B;  3AE5 C;  1SS1 A;  4U3F E;  1EQ7 A;  2K88 A;  2XKM A;  3RBX A;  1ZV8 A;  2ZXE B;  2WPV B;  2QJP B;  2KZJ A;  3L36 A;  1SQQ J;  4EI2 A;  3TGU E;  1USD A;  3G6E P;  3V2N A;  2YO3 A;  4B86 A;  5APQ A;  2OQQ A;  5CHX A;  1Q81 Q;  1LWU C;  3V5B A;  1G2C B;  2GM4 A;  2FFD B;  1LNQ A;  1NTM K;  5B66 E;  1T6A A;  2FYN C;  2FKW B;  3HRN A;  1N73 A;  2E5Y A;  4RES B;  2O3J A;  4W7Z A;  2IYP A;  1OW8 A;  1X9V A;  2H88 C;  3WU2 E;  1ZR4 A;  1X0T A;  2E75 C;  3JCU E;  3K5B A;  5K5G B;  5KLV G;  2WPS A;  2YMY A;  5CCH C;  1JY2 O;  1FZG A;  4WB4 A;  1BGY D;  3BRV B;  1BCC D;  2WIT A;  1KYO I;  4Y99 C;  5CCG A;  1ZR2 A;  4DCK A;  3M91 A;  3F89 A;  4PV1 D;  1ZME C;  4ASV A;  2N9B A;  1LT9 C;  4WY4 A;  3V4W A;  1AQT A;  1SQX K;  1IFJ A;  1NU1 E;  1KTM A;  1FZC B;  4N78 E;  2V7Q H;  1L0N G;  3H1L D;  1BE3 J;  1NTM D;  1HBW A;  4JYB A;  2M5A B;  3L75 D;  3HTK A;  5KAI E;  1NO4 A;  3RK2 C;  1NTZ K;  4WWI A;  1Q82 Q;  4H44 B;  1FDM A;  1K04 A;  1NTK E;  4C7N A;  2Y9Z A;  1XTC C;  2WSF H;  3CX5 I;  3C9I A; 
#chains in the Genus database with same CATH homology
 1M56 D;  1QLE D;  1M57 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...