3FX0A

Crystal structure of human nemo cc2_lz domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
LQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords NF-kappa-B essential modulator
publication title Structural basis for recognition of diubiquitins by NEMO.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 3fx0A00
3JSVC 4OWFA 3FX0A 2V4HA 4BWNA 3F89A 2ZVOB 2ZVNB
chains in the Genus database with same CATH superfamily
1EXJA 3H1LG 1N86A 1Q86Q 4C46A 2QJYC 3L70E 3IN6A 2WSEH 2RN0A 3U1CA 4IL6H 2E74C 1YITP 4HYTB 1NTME 1AVOA 1L0NG 3ABVC 2K9JB 3G71P 3HTKA 1JOCA 2XNXA 5KLIB 3BVHA 1AV1A 5KJ7C 5CCGD 4M3LA 1EZVG 5AVUB 1DD3A 2WTYA 1P84H 4DCKA 1W5CE 1VQKP 5KLIC 3V2PA 3A3YB 4BXLA 5GTIE 3P32A 5CCHA 3MHVA 2YO2A 2O3JA 2FXPA 3B5NB 2OYHA 1JTHB 4PD4E 2V4HA 2BEQD 5DJTB 2N1TD 4W7YA 1JEKA 1HTLC 3B5NC 1SQQE 4L75A 3M0AA 2VRSA 4PD4D 2Z5IA 2YO3A 5TISH 1A02J 3V2RA 3TGUG 3GG2A 2MKVA 1JY3N 3BCCG 1UIIA 2JJLA 1L0LG 1N73A 3ZDMA 1LGHB 1W2EA 3V4WA 1NTZJ 2OYIB 1YJ9P 1BSNA 2W27A 3WUUA 3AEAC 3GW6A 1XTGB 3FGAD 2OYIC 3CX5H 2Y0EA 2QJKB 3VMYA 2BASA 3HRNA 2B87B 3CCSP 2QJKC 2OTLP 1HBWA 4IFDK 3HUSA 3D6YA 3RGUA 2XU6A 4K35A 2IFMA 3CXHI 3M06A 3FXDA 3GMAA 5KLVG 4WB4A 1GTWA 3JCUH 1S5LE 3MUDC 2K3RA 4W80A 3RL0B 2AEMA 2QJPB 2IBZD 2N9BA 5KAFH 2FY8A 5M1BA 1NU1D 2KIKA 3RL0C 4GOFA 1D7MA 4TLFA 3R2PA 2JO1A 2KUBA 3F89A 3CWBD 3HTKB 1VQ9P 3SSUA 1LTJA 2UWJE 2Q1KA 1EZVI 1OMIA 3GF3A 3AE3C 4NPEA 3IR9A 3NFQA 1M8OB 1HH0A 4DOJA 1LWUA 1JY2O 3H1HE 1DX7A 2OYHB 1NTZG 2BCCJ 5CCHC 1PGPA 1JMBA 2BEZF 3KHUA 3L71J 1R8EA 1EDLA 2Q6QA 4GODA 5AVWB 1JCCA 2OYHC 1LTIC 4EIJA 3H1HD 4YXWH 1CSBA 3QH9A 1UIXA 1YJNP 2KZJA 1QLED 3HE4B 1GK6A 3H25A 1OVUA 3A0HH 1YQ4C 1GMJA 1M1JB 2NZ2A 4KT0J 2W83C 2B9BA 5B66E 3AEGC 1PZQA 3M0DA 3WUTA 1N73B 1M1JC 4EDFA 1AA0A 1SQBE 1ZN5A 1LP1A 4I2LC 3CCUP 3N4XA 3VP8A 1FZAA 4YPCA 1N73C 3VYIA 3CC4P 5CBNA 3TNUA 3U1AA 4K3AA 1BE3E 4C7NA 1N7SD 1SVFA 5BU8B 1DIPA 2XNDH 2I1JA 3FXEA 1NOHA 1M1KQ 4RJTA 1S72P 3CX5I 1PP9E 4LLHA 3L71D 3EFFK 3GHGB 3A5TA 1ZLLA 1KB9H 1NGMB 3H1JJ 5BVZA 3HUSB 2CPBA 3S9OA 2J59M 3H1IE 1VF5D 3GHGC 1Z56A 3HUSC 1VQ8P 2W90A 4D6TE 4GDOA 1ZR4A 5GTHH 3Q1MA 1EDKA 4U3FD 3L73E 1Q90D 1BCCE 2YMYA 1YTZI 4A7PA 2FKWB 5AVYB 3A0BE 2LR2A 3CCRP 2BCCG 1R5SA 1VQLP 2FYUK 2NPSD 3L73D 2YIUB 1KYOH 1SQVE 2QIWA 3PLNA 5B5EH 1N7SB 4H0LD 1L4AA 1OW8A 3CL3D 2E5YA 4UB6E 1LTJB 4O9BA 5TJHA 3V2QA 1SQVD 1N7SC 4LC1A 3OAKA 1LTJC 4KHXA 3P7KA 1NTMK 1LWUB 1T8ZA 2AEFA 2YNYA 1VF5B 4AUWA 1FOSE 2A45H 3FX0A 2IZ1A 2LXCB 2LXBA 1LWUC 2A45G 3TK1A 1LT9A 2I8DA 2JP3A 4IOIH 2KS1A 1KTMA 3L72G 1JTHA 2E76D 3B8EB 1KQFB 5APQA 1L0NJ 1J1DC 1NTKE 3RK2B 3L37A 3A0BH 2NPSB 2JDIH 2Q3IA 4IL6X 3AE2C 3PTZA 3L75J 2ZXXA 3RK2C 3H1JG 1JY3P 1NKZB 3G3ZA 1KILD 1U7MA 4H0LB 2NPSC 1SQQK 4ASWA 3E1IA 4EYYQ 2D2CD 1LP1B 1PV3A 1FJPA 3CXHD 3T97A 3D70A 3M0DC 5CCGA 1X79B 1KC8Q 1HGVA 3P8MC 3TNUB 1RF0A 1BGYE 1SQPK 2W6AA 4NPDA 4PV1D 2C0XA 1DEBA 2Z4EA 3E1RA 5AW9B 3H1LD 2PP6A 2MJZA 5AW0B 5AW5B 2O01H 4DT0A 1QVFO 1FDOA 4HJGH 2B87A 2N1TA 3L70J 1H88A 1L0ND 2AXTE 1KB9I 1J2JB 1SQXK 1NTMJ 5AW1B 2Q9IA 2OTJP 1EZVD 3CLQA 1E79H 3G4SP 1K9MQ 1GDTA 3CCMP 1WT6A 2KLVA 2WITA 2ZT9D 2ZYDA 3MGNA 1YTZT 2FXOA 3AEDC 1NHLA 4PJ0H 1PIXA 3AE5C 5AVSB 1QEXA 1L4AB 3W67A 2CK3H 1KYOI 1FC2C 1NKNA 2Y0DA 1RE4A 3TGUE 1JNMA 1E5WA 3AE7C 3CD6P 1L4AC 1H8AA 1VPCA 3BCCE 3I55P 1QVGO 3L75G 3TGUD 4R4LA 3GLMA 5KLVJ 1OVRA 2H89C 2J58A 2SPZA 2GUVA 2W6BA 1GK4A 1Q82Q 1EDIA 3BCCD 1L0LD 1SQPJ 1LT9B 1IFDA 2KS1B 1PGJA 2A45I 2L91A 3RK3D 2P7JA 2IDBA 1LT9C 1SLQA 2FYUG 2IZ0A 4HKZH 1JMMA 4L76A 5E79E 2ZT9B 4GKGA 3HE4A 3PP5A 5APUA 1X9VA 3TF5A 2XV5A 1ZRTD 3CX5D 1FZEA 1SFCD 1SP4A 1T3JA 2Y0CA 1M1JA 3L70G 1SQXJ 1BDDA 3ITKA 3AECC 1NTMG 2C0WA 3T97B 1KD1Q 4DJGA 1FDMA 2P10A 1RY3A 3W68A 1VDFA 2R5DA 5AW2B 1RE3A 1RF1B 1LNQA 5KLVD 1FS0E 2Q3EA 5CCGC 4WBAA 3PH0A 4WY4D 5GTIH 1MKMA 1RF0C 1X0TA 3MD0A 1SQBK 1VQ6P 2K88A 5AW4B 1CI6A 2N1TB 1KORA 4PD4H 3H1KJ 3GHGA 3VMZA 1K04A 2K1AA 4OGQD 1VQPP 4EOTA 2N1TC 1K8AQ 1IJDB 4Z1MH 4DZOA 2IBZE 1NU1E 3KPEA 4WWIA 1FAVA 3VP9A 2H8PD 5H2FE 2ZAEB 1LTTC 1GW3A 3CI9A 1IFJA 3O6QB 1SQPG 3HD7D 2B89A 3P8CE 2Q5UA 1OWAA 3CWBE 4IFFA 1NTZD 2KSJA 3D6ZA 2QJPC 2E5TA 1SS1A 3P8CD 3I5CA 1DEEG 5APXA 1N7SA 3O8ZA 2KI7B 3KDPB 1MFZA 1MV8A 3KQGA 1RE4C 2POHA 1USEA 3AEBC 1SQXG 1VQ4P 3KZIE 1ZXGA 3B71A 1P84I 4XE5B 2HPCB 2QSIA 4OGQB 1M7LA 3U59A 2FFDA 1JY2N 3TYYA 1RQVA 2M3BA 4ZMDA 3M91A 4OGQC 1FDIA 4EI2A 3JSVC 4H13D 1SQBJ 5H2FH 3SWYA 1S5LH 1MZ9A 5AW6B 3M9QA 5AVTB 2WPQA 2ZJSE 3HD7B 1HGZA 1DD4A 1PPJD 4OWFA 1BE3J 2NRGA 2NPSA 1OX3A 3H1KG 2DW3A 4UB8E 1H0TA 2IYPA 1NTKK 1KB9D 1IFMA 3AE1C 1PGOA 2E75D 5CJ0A 2H88C 1CZQA 1YBKA 3H1IJ 1KZUB 2N9YB 2WQYC 1U57A 1ZOYC 1GL2D 2BCCE 3L72J 3WUVA 5KAIE 1RE3C 3L71E 4D6TJ 1FE6A 1Y9BA 3I56P 1PPJG 1GU5A 1G2CA 2RMZA 1X22A 2BCCD 1BCCJ 5C39A 1LTSC 1CI6B 3BRTB 2R44A 3S4RA 1HUCA 4LGDE 1ZR2A 4U3FE 4PD4I 4RO0A 1J1EB 3IAOA 3CMAP 3QWOC 4MN4C 2JKVA 3CCEP 1EQ7A 4N6JA 1J1EC 1NO4A 4QMAA 1KILA 5B66H 2R3CA 4ASVA 2E42A 2WSFH 4OVNF 1S4XA 3EQ2A 3V4QA 2WSCH 3S1KA 1VQ5P 1YJWP 1FU1A 1S1CX 3RBXA 1QX8A 1SQBG 3MZWB 1HVVA 1PL5A 1GL2B 3L72D 2O01J 1S9KD 1GU4A 2YIUC 1PGQA 3EFGA 2WZ7A 2QM8A 1X8YA 1NWQA 4ZKPA 2B88A 2GUSA 1BE3G 4YTPC 2A06D 3BATA 3H6PA 2HODB 2KXPB 3H1JD 2AEJA 2FFDB 2M5AA 2XKMA 3AEFC 3H1IG 1VF5C 5APVA 2FFDC 2L5GB 3WU2E 3A2AA 2JEEA 2KP8A 2FYNB 3R4YA 4D6TG 4B86A 1IC2A 4N78E 5CMZA 5APWA 1KILE 2FYNC 1BGYJ 4H44D 1BCCG 2OTKE 2A06G 2ZYAA 4N78D 3CXHE 4YXDC 3HE5A 4I7ZB 5CJ4A 2V7QJ 1H0TB 3L35A 1EDJA 1QL2A 1NH4A 1KFNA 1ZV8A 4UB6H 2XDJA 4I7ZC 5KKZB 2JR8A 4H0LC 1NAYA 4AYCA 1LTAC 3AE4C 3H1LE 1K73Q 1RF1A 2AXCA 2FYUJ 2E74D 2G3AA 1ZW0A 1BDCA 1FZCA 3Q2YA 1G2CB 1M90Q 4IL6E 1L0NE 2GM4A 4Y99B 3L74J 5K5GB 3MIWA 5EFWB 5KJ7D 2E76B 1EZVE 5AW3B 5AVVB 1AQ5A 1DH3A 2E76C 1KQLA 4H44B 3TSIA 1QL1A 3OJAB 2K37A 2KNCB 3L75D 1SFCA 1U7JA 4H44C 5CHXA 1KILB 1HJBA 1VQNP 1P84D 3LIEA 1S2EA 1OXZA 3LIDA 2D2CB 2G8YA 3O6QA 1KILC 1OVVA 3CC2P 2WMMA 3B5ND 2ZVOB 1OFCX 3AEEC 1EC5A 4NPFX 3N7NA 2D2CC 1NU1K 1AFOA 1KMIZ 2FYUD 1T2KD 1URQD 4PV1B 2E74B 4WY4A 3D71A 1IZNB 2WVRA 1BGYG 5TISE 2W8ZA 3CCJP 3V2NA 3L74D 1OIPA 4XFJA 1LTBC 4PV1C 1SQQJ 2V7QH 3AE6C 1L0LE 3II6A 3IF4A 3L70D 1N7LA 3SFEC 1JY2P 2M5AB 1VQMP 3RK3E 1KQSO 2HPCA 2KOGA 2Y9ZA 2KK7A 2AXTH 1NTMD 2PGDA 4TT3H 2JWDA 4U7JA 4ZNCA 5AVRB 1ZRTE 3CX5E 1AJYA 3IFMA 1IO4A 3Q5PA 2WWWA 3HD7A 4L74A 4IFMA 3L74G 1OW6A 2YXQB 3VTPC 2R32A 3HE5B 1CW5A 2ZT9C 2OQQA 1MFTA 1FOSF 1URQB 1YHQP 2YKOA 1PFIA 5KLVE 5APYA 5KTBA 3MTUE 1T2KC 1URQC 1SQQD 3JCUE 1G1IA 3KYQA 1HWTC 1SQPE 3H32A 2QVAA 1VL2A 4W7ZA 1JY3O 2ZYGA 3RL0D 5DJUB 5KAFE 1FZCB 1RF1C 1EXIA 2Q7CA 1BSHA 2K9YA 1NU1J 1SQPD 1ZMEC 1H89A 4BWNA 1YYCA 4BRYA 3TDKA 1FZCC 3RK3B 3Q5SA 3RL0g 5BU5A 1KQGB 3CWBJ 2YMKA 1S5LX 2J5UA 3BASA 4HB1A 3RK3C 1SQXE 1YQ3C 5E79H 1SQQG 1QGKB 1SFCB 4L73A 4JQ0D 1OW7A 1SQXD 1NTZE 3L36A 2P2UA 1G1JA 2HYNA 5CCHD 1RH5B 2HFED 1NJIQ 2H7HA 1SFCC 1JUNA 4Y28J 1N2DC 2HG5D 1T3UA 2WSSH 3UIAA 2QRXA 4R4MA 1FZBA 2HLOA 2LKMA 3H1HJ 1L2PA 4WVZA 4WY4B 1GL2A 2KB7P 2WPVB 3A7OA 3NTNA 3SFDC 3A0HE 3H1KE 4RKUJ 3Q5RA 4JYBA 2KZIA 3E7KA 4WY4C 2FXMA 1NVOA 3MP7B 3C9IA 3FWLA 2HODA 1SQVK 3SWKA 3H1KD 4JPZB 4I1LA 3C1LA 1KV4A 1Q81Q 2P1JA 2ZFCA 3PHLA 4HH2A 1JCDA 2WSFJ 2WSCJ 4ZKUA 1PPJE 2OARA 4GOEA 1JM0A 2OGUA 1Y47A 1FZGA 1WMKA 2IBZG 2PFXA 1NU1G 1R5LA 1IK9A 5APSA 1USDA 1IFIA 3G9RA 1LT1A 1KB9E 1Q2NA 3HD7C 1JB0J 3CWBG 5AW8B 1IFPA 2O1JA 1YI2P 1PP9J 2IYOA 2YKQA 5AW7B 5GTHE 3EWKA 3BRVB 3H32B 2O1KA 4U3FJ 4CPGA 1Q7YQ 1LJ2A 3KXDA 2ITAA 3KZIH 2R3SA 5AVQB 1IK7A 3PJSK 4BRYB 1KYOE 3M9BA 3L73J 3USSA 2YXRB 5CBOA 5B5EE 2RH0A 3CCLP 3H1HG 4H13B 1SQBD 3FWNA 3VN0A 3JC22 1TU3F 1KYOD 2WT7A 2C9LY 4H13C 1SQVJ 1M57D 3M9HA 2JWAA 1BE3D 1L0NK 4GT1A 1GZLA 2KNCA 3K5BA 2KSEA 3RBZA 3V5BA 2OYOA 1PP9D 4RESB 4UB8H 3L72E 3OW2O 2E75B 1S9KE 3AE9C 5L8RJ 3VMAA 1HF9A 3V6IA 1T6AA 1YIJP 3H1ID 3CCVP 3Q3DA 1RQUA 2GA1A 1A02F 1N8RQ 2E75C 1XTCC 2A06E 2Z5HA 3SWFA 1W2BO 4D6TD 5KAIH 3CC7P 3RK2D 1LTGC 1M56D 3H1JE 1GL2C 2QM7A 2CPSA 2IFNA 3L71G 2O01N 5AVXB 1BCCD 2QG4A 1NTKJ 3OA7A 4GIFA 1VQ7P 2IX7C 5KJ7A 2R5BA 3F5HA 1PP9G 2K9JA 2FBWC 3B4SA 3VOPA 1AQTA 2I1KA 4U3FG 2E43A 2M3EA 2M0BA 1K05A 1L0LK 1GW4A 1JO5A 4JYCA 2Y9YA 3LW5J 2IBZI 2P58A 3H1LJ 2FYZA 1KN7A 3WMM0 4JBZA 1AVYA 3L73G 1NYHA 3GF7A 2IPPA 1J1DB 3B5NA 2XZRA 5AVZB 2WSEJ 2C9NY 3NXSA 1IFNA 1URQA 2PAJA 1FBMA 1SQVG 3G6EP 1ZP0C 2QA4P 3C8VA 4I6MC 2KYVA 2RKLA 2YKPA 1GD2E 1Y8AA 3NMDA 1NTKD 2HR3A 3CPWO 1FJKA 5KKZC 4JF7A 5KLVK 1OZHA 4PJ0E 3PRJA 2H43A 2OYIA 1RHZB 1VQOP 5APTA 4C7NB 2QE7H 2W6JH 1L4AD 2P67A 2ZXEB 1KFMA 3WU2H 2WT7B 4KJMA 4Y99C 3CMEP 3L75E 2WPRA 2KLUA 1BGYD 2WPSA 1P84E 4N3YB 3CCQP 3TGUJ 1NTKG 1S3JA 3VMXA 4XA4A 3CXHH 1HJ0A 3L4FA 3BCCJ 4OH8B 4C7RA 1WRGA 1L0LJ 1FZFA 2FYUE 3AE8C 2M8RA 1MUUA 1NAFA 3MUDA 4AQRD 2QEXP 2PRRA 3LW5H 2QJYB 1NTZK 3L74E 2ZVNB
chains in the Genus database with same CATH topology
3JSVC 4OWFA 3FX0A 2V4HA 4BWNA 3F89A 2ZVOB 2ZVNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSV C;  4OWF A;  3FX0 A;  2V4H A;  4BWN A;  3F89 A;  2ZVO B;  2ZVN B; 
#chains in the Genus database with same CATH topology
 1EXJ A;  3H1L G;  1N86 A;  1Q86 Q;  4C46 A;  2QJY C;  3L70 E;  3IN6 A;  2WSE H;  2RN0 A;  3U1C A;  4IL6 H;  2E74 C;  1YIT P;  4HYT B;  1NTM E;  1AVO A;  1L0N G;  3ABV C;  2K9J B;  3G71 P;  3HTK A;  1JOC A;  2XNX A;  5KLI B;  3BVH A;  1AV1 A;  5KJ7 C;  5CCG D;  4M3L A;  1EZV G;  5AVU B;  1DD3 A;  2WTY A;  1P84 H;  4DCK A;  1W5C E;  1VQK P;  5KLI C;  3V2P A;  3A3Y B;  4BXL A;  5GTI E;  3P32 A;  5CCH A;  3MHV A;  2YO2 A;  2O3J A;  2FXP A;  3B5N B;  2OYH A;  1JTH B;  4PD4 E;  2V4H A;  2BEQ D;  5DJT B;  2N1T D;  4W7Y A;  1JEK A;  1HTL C;  3B5N C;  1SQQ E;  4L75 A;  3M0A A;  2VRS A;  4PD4 D;  2Z5I A;  2YO3 A;  5TIS H;  1A02 J;  3V2R A;  3TGU G;  3GG2 A;  2MKV A;  1JY3 N;  3BCC G;  1UII A;  2JJL A;  1L0L G;  1N73 A;  3ZDM A;  1LGH B;  1W2E A;  3V4W A;  1NTZ J;  2OYI B;  1YJ9 P;  1BSN A;  2W27 A;  3WUU A;  3AEA C;  3GW6 A;  1XTG B;  3FGA D;  2OYI C;  3CX5 H;  2Y0E A;  2QJK B;  3VMY A;  2BAS A;  3HRN A;  2B87 B;  3CCS P;  2QJK C;  2OTL P;  1HBW A;  4IFD K;  3HUS A;  3D6Y A;  3RGU A;  2XU6 A;  4K35 A;  2IFM A;  3CXH I;  3M06 A;  3FXD A;  3GMA A;  5KLV G;  4WB4 A;  1GTW A;  3JCU H;  1S5L E;  3MUD C;  2K3R A;  4W80 A;  3RL0 B;  2AEM A;  2QJP B;  2IBZ D;  2N9B A;  5KAF H;  2FY8 A;  5M1B A;  1NU1 D;  2KIK A;  3RL0 C;  4GOF A;  1D7M A;  4TLF A;  3R2P A;  2JO1 A;  2KUB A;  3F89 A;  3CWB D;  3HTK B;  1VQ9 P;  3SSU A;  1LTJ A;  2UWJ E;  2Q1K A;  1EZV I;  1OMI A;  3GF3 A;  3AE3 C;  4NPE A;  3IR9 A;  3NFQ A;  1M8O B;  1HH0 A;  4DOJ A;  1LWU A;  1JY2 O;  3H1H E;  1DX7 A;  2OYH B;  1NTZ G;  2BCC J;  5CCH C;  1PGP A;  1JMB A;  2BEZ F;  3KHU A;  3L71 J;  1R8E A;  1EDL A;  2Q6Q A;  4GOD A;  5AVW B;  1JCC A;  2OYH C;  1LTI C;  4EIJ A;  3H1H D;  4YXW H;  1CSB A;  3QH9 A;  1UIX A;  1YJN P;  2KZJ A;  1QLE D;  3HE4 B;  1GK6 A;  3H25 A;  1OVU A;  3A0H H;  1YQ4 C;  1GMJ A;  1M1J B;  2NZ2 A;  4KT0 J;  2W83 C;  2B9B A;  5B66 E;  3AEG C;  1PZQ A;  3M0D A;  3WUT A;  1N73 B;  1M1J C;  4EDF A;  1AA0 A;  1SQB E;  1ZN5 A;  1LP1 A;  4I2L C;  3CCU P;  3N4X A;  3VP8 A;  1FZA A;  4YPC A;  1N73 C;  3VYI A;  3CC4 P;  5CBN A;  3TNU A;  3U1A A;  4K3A A;  1BE3 E;  4C7N A;  1N7S D;  1SVF A;  5BU8 B;  1DIP A;  2XND H;  2I1J A;  3FXE A;  1NOH A;  1M1K Q;  4RJT A;  1S72 P;  3CX5 I;  1PP9 E;  4LLH A;  3L71 D;  3EFF K;  3GHG B;  3A5T A;  1ZLL A;  1KB9 H;  1NGM B;  3H1J J;  5BVZ A;  3HUS B;  2CPB A;  3S9O A;  2J59 M;  3H1I E;  1VF5 D;  3GHG C;  1Z56 A;  3HUS C;  1VQ8 P;  2W90 A;  4D6T E;  4GDO A;  1ZR4 A;  5GTH H;  3Q1M A;  1EDK A;  4U3F D;  3L73 E;  1Q90 D;  1BCC E;  2YMY A;  1YTZ I;  4A7P A;  2FKW B;  5AVY B;  3A0B E;  2LR2 A;  3CCR P;  2BCC G;  1R5S A;  1VQL P;  2FYU K;  2NPS D;  3L73 D;  2YIU B;  1KYO H;  1SQV E;  2QIW A;  3PLN A;  5B5E H;  1N7S B;  4H0L D;  1L4A A;  1OW8 A;  3CL3 D;  2E5Y A;  4UB6 E;  1LTJ B;  4O9B A;  5TJH A;  3V2Q A;  1SQV D;  1N7S C;  4LC1 A;  3OAK A;  1LTJ C;  4KHX A;  3P7K A;  1NTM K;  1LWU B;  1T8Z A;  2AEF A;  2YNY A;  1VF5 B;  4AUW A;  1FOS E;  2A45 H;  3FX0 A;  2IZ1 A;  2LXC B;  2LXB A;  1LWU C;  2A45 G;  3TK1 A;  1LT9 A;  2I8D A;  2JP3 A;  4IOI H;  2KS1 A;  1KTM A;  3L72 G;  1JTH A;  2E76 D;  3B8E B;  1KQF B;  5APQ A;  1L0N J;  1J1D C;  1NTK E;  3RK2 B;  3L37 A;  3A0B H;  2NPS B;  2JDI H;  2Q3I A;  4IL6 X;  3AE2 C;  3PTZ A;  3L75 J;  2ZXX A;  3RK2 C;  3H1J G;  1JY3 P;  1NKZ B;  3G3Z A;  1KIL D;  1U7M A;  4H0L B;  2NPS C;  1SQQ K;  4ASW A;  3E1I A;  4EYY Q;  2D2C D;  1LP1 B;  1PV3 A;  1FJP A;  3CXH D;  3T97 A;  3D70 A;  3M0D C;  5CCG A;  1X79 B;  1KC8 Q;  1HGV A;  3P8M C;  3TNU B;  1RF0 A;  1BGY E;  1SQP K;  2W6A A;  4NPD A;  4PV1 D;  2C0X A;  1DEB A;  2Z4E A;  3E1R A;  5AW9 B;  3H1L D;  2PP6 A;  2MJZ A;  5AW0 B;  5AW5 B;  2O01 H;  4DT0 A;  1QVF O;  1FDO A;  4HJG H;  2B87 A;  2N1T A;  3L70 J;  1H88 A;  1L0N D;  2AXT E;  1KB9 I;  1J2J B;  1SQX K;  1NTM J;  5AW1 B;  2Q9I A;  2OTJ P;  1EZV D;  3CLQ A;  1E79 H;  3G4S P;  1K9M Q;  1GDT A;  3CCM P;  1WT6 A;  2KLV A;  2WIT A;  2ZT9 D;  2ZYD A;  3MGN A;  1YTZ T;  2FXO A;  3AED C;  1NHL A;  4PJ0 H;  1PIX A;  3AE5 C;  5AVS B;  1QEX A;  1L4A B;  3W67 A;  2CK3 H;  1KYO I;  1FC2 C;  1NKN A;  2Y0D A;  1RE4 A;  3TGU E;  1JNM A;  1E5W A;  3AE7 C;  3CD6 P;  1L4A C;  1H8A A;  1VPC A;  3BCC E;  3I55 P;  1QVG O;  3L75 G;  3TGU D;  4R4L A;  3GLM A;  5KLV J;  1OVR A;  2H89 C;  2J58 A;  2SPZ A;  2GUV A;  2W6B A;  1GK4 A;  1Q82 Q;  1EDI A;  3BCC D;  1L0L D;  1SQP J;  1LT9 B;  1IFD A;  2KS1 B;  1PGJ A;  2A45 I;  2L91 A;  3RK3 D;  2P7J A;  2IDB A;  1LT9 C;  1SLQ A;  2FYU G;  2IZ0 A;  4HKZ H;  1JMM A;  4L76 A;  5E79 E;  2ZT9 B;  4GKG A;  3HE4 A;  3PP5 A;  5APU A;  1X9V A;  3TF5 A;  2XV5 A;  1ZRT D;  3CX5 D;  1FZE A;  1SFC D;  1SP4 A;  1T3J A;  2Y0C A;  1M1J A;  3L70 G;  1SQX J;  1BDD A;  3ITK A;  3AEC C;  1NTM G;  2C0W A;  3T97 B;  1KD1 Q;  4DJG A;  1FDM A;  2P10 A;  1RY3 A;  3W68 A;  1VDF A;  2R5D A;  5AW2 B;  1RE3 A;  1RF1 B;  1LNQ A;  5KLV D;  1FS0 E;  2Q3E A;  5CCG C;  4WBA A;  3PH0 A;  4WY4 D;  5GTI H;  1MKM A;  1RF0 C;  1X0T A;  3MD0 A;  1SQB K;  1VQ6 P;  2K88 A;  5AW4 B;  1CI6 A;  2N1T B;  1KOR A;  4PD4 H;  3H1K J;  3GHG A;  3VMZ A;  1K04 A;  2K1A A;  4OGQ D;  1VQP P;  4EOT A;  2N1T C;  1K8A Q;  1IJD B;  4Z1M H;  4DZO A;  2IBZ E;  1NU1 E;  3KPE A;  4WWI A;  1FAV A;  3VP9 A;  2H8P D;  5H2F E;  2ZAE B;  1LTT C;  1GW3 A;  3CI9 A;  1IFJ A;  3O6Q B;  1SQP G;  3HD7 D;  2B89 A;  3P8C E;  2Q5U A;  1OWA A;  3CWB E;  4IFF A;  1NTZ D;  2KSJ A;  3D6Z A;  2QJP C;  2E5T A;  1SS1 A;  3P8C D;  3I5C A;  1DEE G;  5APX A;  1N7S A;  3O8Z A;  2KI7 B;  3KDP B;  1MFZ A;  1MV8 A;  3KQG A;  1RE4 C;  2POH A;  1USE A;  3AEB C;  1SQX G;  1VQ4 P;  3KZI E;  1ZXG A;  3B71 A;  1P84 I;  4XE5 B;  2HPC B;  2QSI A;  4OGQ B;  1M7L A;  3U59 A;  2FFD A;  1JY2 N;  3TYY A;  1RQV A;  2M3B A;  4ZMD A;  3M91 A;  4OGQ C;  1FDI A;  4EI2 A;  3JSV C;  4H13 D;  1SQB J;  5H2F H;  3SWY A;  1S5L H;  1MZ9 A;  5AW6 B;  3M9Q A;  5AVT B;  2WPQ A;  2ZJS E;  3HD7 B;  1HGZ A;  1DD4 A;  1PPJ D;  4OWF A;  1BE3 J;  2NRG A;  2NPS A;  1OX3 A;  3H1K G;  2DW3 A;  4UB8 E;  1H0T A;  2IYP A;  1NTK K;  1KB9 D;  1IFM A;  3AE1 C;  1PGO A;  2E75 D;  5CJ0 A;  2H88 C;  1CZQ A;  1YBK A;  3H1I J;  1KZU B;  2N9Y B;  2WQY C;  1U57 A;  1ZOY C;  1GL2 D;  2BCC E;  3L72 J;  3WUV A;  5KAI E;  1RE3 C;  3L71 E;  4D6T J;  1FE6 A;  1Y9B A;  3I56 P;  1PPJ G;  1GU5 A;  1G2C A;  2RMZ A;  1X22 A;  2BCC D;  1BCC J;  5C39 A;  1LTS C;  1CI6 B;  3BRT B;  2R44 A;  3S4R A;  1HUC A;  4LGD E;  1ZR2 A;  4U3F E;  4PD4 I;  4RO0 A;  1J1E B;  3IAO A;  3CMA P;  3QWO C;  4MN4 C;  2JKV A;  3CCE P;  1EQ7 A;  4N6J A;  1J1E C;  1NO4 A;  4QMA A;  1KIL A;  5B66 H;  2R3C A;  4ASV A;  2E42 A;  2WSF H;  4OVN F;  1S4X A;  3EQ2 A;  3V4Q A;  2WSC H;  3S1K A;  1VQ5 P;  1YJW P;  1FU1 A;  1S1C X;  3RBX A;  1QX8 A;  1SQB G;  3MZW B;  1HVV A;  1PL5 A;  1GL2 B;  3L72 D;  2O01 J;  1S9K D;  1GU4 A;  2YIU C;  1PGQ A;  3EFG A;  2WZ7 A;  2QM8 A;  1X8Y A;  1NWQ A;  4ZKP A;  2B88 A;  2GUS A;  1BE3 G;  4YTP C;  2A06 D;  3BAT A;  3H6P A;  2HOD B;  2KXP B;  3H1J D;  2AEJ A;  2FFD B;  2M5A A;  2XKM A;  3AEF C;  3H1I G;  1VF5 C;  5APV A;  2FFD C;  2L5G B;  3WU2 E;  3A2A A;  2JEE A;  2KP8 A;  2FYN B;  3R4Y A;  4D6T G;  4B86 A;  1IC2 A;  4N78 E;  5CMZ A;  5APW A;  1KIL E;  2FYN C;  1BGY J;  4H44 D;  1BCC G;  2OTK E;  2A06 G;  2ZYA A;  4N78 D;  3CXH E;  4YXD C;  3HE5 A;  4I7Z B;  5CJ4 A;  2V7Q J;  1H0T B;  3L35 A;  1EDJ A;  1QL2 A;  1NH4 A;  1KFN A;  1ZV8 A;  4UB6 H;  2XDJ A;  4I7Z C;  5KKZ B;  2JR8 A;  4H0L C;  1NAY A;  4AYC A;  1LTA C;  3AE4 C;  3H1L E;  1K73 Q;  1RF1 A;  2AXC A;  2FYU J;  2E74 D;  2G3A A;  1ZW0 A;  1BDC A;  1FZC A;  3Q2Y A;  1G2C B;  1M90 Q;  4IL6 E;  1L0N E;  2GM4 A;  4Y99 B;  3L74 J;  5K5G B;  3MIW A;  5EFW B;  5KJ7 D;  2E76 B;  1EZV E;  5AW3 B;  5AVV B;  1AQ5 A;  1DH3 A;  2E76 C;  1KQL A;  4H44 B;  3TSI A;  1QL1 A;  3OJA B;  2K37 A;  2KNC B;  3L75 D;  1SFC A;  1U7J A;  4H44 C;  5CHX A;  1KIL B;  1HJB A;  1VQN P;  1P84 D;  3LIE A;  1S2E A;  1OXZ A;  3LID A;  2D2C B;  2G8Y A;  3O6Q A;  1KIL C;  1OVV A;  3CC2 P;  2WMM A;  3B5N D;  2ZVO B;  1OFC X;  3AEE C;  1EC5 A;  4NPF X;  3N7N A;  2D2C C;  1NU1 K;  1AFO A;  1KMI Z;  2FYU D;  1T2K D;  1URQ D;  4PV1 B;  2E74 B;  4WY4 A;  3D71 A;  1IZN B;  2WVR A;  1BGY G;  5TIS E;  2W8Z A;  3CCJ P;  3V2N A;  3L74 D;  1OIP A;  4XFJ A;  1LTB C;  4PV1 C;  1SQQ J;  2V7Q H;  3AE6 C;  1L0L E;  3II6 A;  3IF4 A;  3L70 D;  1N7L A;  3SFE C;  1JY2 P;  2M5A B;  1VQM P;  3RK3 E;  1KQS O;  2HPC A;  2KOG A;  2Y9Z A;  2KK7 A;  2AXT H;  1NTM D;  2PGD A;  4TT3 H;  2JWD A;  4U7J A;  4ZNC A;  5AVR B;  1ZRT E;  3CX5 E;  1AJY A;  3IFM A;  1IO4 A;  3Q5P A;  2WWW A;  3HD7 A;  4L74 A;  4IFM A;  3L74 G;  1OW6 A;  2YXQ B;  3VTP C;  2R32 A;  3HE5 B;  1CW5 A;  2ZT9 C;  2OQQ A;  1MFT A;  1FOS F;  1URQ B;  1YHQ P;  2YKO A;  1PFI A;  5KLV E;  5APY A;  5KTB A;  3MTU E;  1T2K C;  1URQ C;  1SQQ D;  3JCU E;  1G1I A;  3KYQ A;  1HWT C;  1SQP E;  3H32 A;  2QVA A;  1VL2 A;  4W7Z A;  1JY3 O;  2ZYG A;  3RL0 D;  5DJU B;  5KAF E;  1FZC B;  1RF1 C;  1EXI A;  2Q7C A;  1BSH A;  2K9Y A;  1NU1 J;  1SQP D;  1ZME C;  1H89 A;  4BWN A;  1YYC A;  4BRY A;  3TDK A;  1FZC C;  3RK3 B;  3Q5S A;  3RL0 g;  5BU5 A;  1KQG B;  3CWB J;  2YMK A;  1S5L X;  2J5U A;  3BAS A;  4HB1 A;  3RK3 C;  1SQX E;  1YQ3 C;  5E79 H;  1SQQ G;  1QGK B;  1SFC B;  4L73 A;  4JQ0 D;  1OW7 A;  1SQX D;  1NTZ E;  3L36 A;  2P2U A;  1G1J A;  2HYN A;  5CCH D;  1RH5 B;  2HFE D;  1NJI Q;  2H7H A;  1SFC C;  1JUN A;  4Y28 J;  1N2D C;  2HG5 D;  1T3U A;  2WSS H;  3UIA A;  2QRX A;  4R4M A;  1FZB A;  2HLO A;  2LKM A;  3H1H J;  1L2P A;  4WVZ A;  4WY4 B;  1GL2 A;  2KB7 P;  2WPV B;  3A7O A;  3NTN A;  3SFD C;  3A0H E;  3H1K E;  4RKU J;  3Q5R A;  4JYB A;  2KZI A;  3E7K A;  4WY4 C;  2FXM A;  1NVO A;  3MP7 B;  3C9I A;  3FWL A;  2HOD A;  1SQV K;  3SWK A;  3H1K D;  4JPZ B;  4I1L A;  3C1L A;  1KV4 A;  1Q81 Q;  2P1J A;  2ZFC A;  3PHL A;  4HH2 A;  1JCD A;  2WSF J;  2WSC J;  4ZKU A;  1PPJ E;  2OAR A;  4GOE A;  1JM0 A;  2OGU A;  1Y47 A;  1FZG A;  1WMK A;  2IBZ G;  2PFX A;  1NU1 G;  1R5L A;  1IK9 A;  5APS A;  1USD A;  1IFI A;  3G9R A;  1LT1 A;  1KB9 E;  1Q2N A;  3HD7 C;  1JB0 J;  3CWB G;  5AW8 B;  1IFP A;  2O1J A;  1YI2 P;  1PP9 J;  2IYO A;  2YKQ A;  5AW7 B;  5GTH E;  3EWK A;  3BRV B;  3H32 B;  2O1K A;  4U3F J;  4CPG A;  1Q7Y Q;  1LJ2 A;  3KXD A;  2ITA A;  3KZI H;  2R3S A;  5AVQ B;  1IK7 A;  3PJS K;  4BRY B;  1KYO E;  3M9B A;  3L73 J;  3USS A;  2YXR B;  5CBO A;  5B5E E;  2RH0 A;  3CCL P;  3H1H G;  4H13 B;  1SQB D;  3FWN A;  3VN0 A;  3JC2 2;  1TU3 F;  1KYO D;  2WT7 A;  2C9L Y;  4H13 C;  1SQV J;  1M57 D;  3M9H A;  2JWA A;  1BE3 D;  1L0N K;  4GT1 A;  1GZL A;  2KNC A;  3K5B A;  2KSE A;  3RBZ A;  3V5B A;  2OYO A;  1PP9 D;  4RES B;  4UB8 H;  3L72 E;  3OW2 O;  2E75 B;  1S9K E;  3AE9 C;  5L8R J;  3VMA A;  1HF9 A;  3V6I A;  1T6A A;  1YIJ P;  3H1I D;  3CCV P;  3Q3D A;  1RQU A;  2GA1 A;  1A02 F;  1N8R Q;  2E75 C;  1XTC C;  2A06 E;  2Z5H A;  3SWF A;  1W2B O;  4D6T D;  5KAI H;  3CC7 P;  3RK2 D;  1LTG C;  1M56 D;  3H1J E;  1GL2 C;  2QM7 A;  2CPS A;  2IFN A;  3L71 G;  2O01 N;  5AVX B;  1BCC D;  2QG4 A;  1NTK J;  3OA7 A;  4GIF A;  1VQ7 P;  2IX7 C;  5KJ7 A;  2R5B A;  3F5H A;  1PP9 G;  2K9J A;  2FBW C;  3B4S A;  3VOP A;  1AQT A;  2I1K A;  4U3F G;  2E43 A;  2M3E A;  2M0B A;  1K05 A;  1L0L K;  1GW4 A;  1JO5 A;  4JYC A;  2Y9Y A;  3LW5 J;  2IBZ I;  2P58 A;  3H1L J;  2FYZ A;  1KN7 A;  3WMM 0;  4JBZ A;  1AVY A;  3L73 G;  1NYH A;  3GF7 A;  2IPP A;  1J1D B;  3B5N A;  2XZR A;  5AVZ B;  2WSE J;  2C9N Y;  3NXS A;  1IFN A;  1URQ A;  2PAJ A;  1FBM A;  1SQV G;  3G6E P;  1ZP0 C;  2QA4 P;  3C8V A;  4I6M C;  2KYV A;  2RKL A;  2YKP A;  1GD2 E;  1Y8A A;  3NMD A;  1NTK D;  2HR3 A;  3CPW O;  1FJK A;  5KKZ C;  4JF7 A;  5KLV K;  1OZH A;  4PJ0 E;  3PRJ A;  2H43 A;  2OYI A;  1RHZ B;  1VQO P;  5APT A;  4C7N B;  2QE7 H;  2W6J H;  1L4A D;  2P67 A;  2ZXE B;  1KFM A;  3WU2 H;  2WT7 B;  4KJM A;  4Y99 C;  3CME P;  3L75 E;  2WPR A;  2KLU A;  1BGY D;  2WPS A;  1P84 E;  4N3Y B;  3CCQ P;  3TGU J;  1NTK G;  1S3J A;  3VMX A;  4XA4 A;  3CXH H;  1HJ0 A;  3L4F A;  3BCC J;  4OH8 B;  4C7R A;  1WRG A;  1L0L J;  1FZF A;  2FYU E;  3AE8 C;  2M8R A;  1MUU A;  1NAF A;  3MUD A;  4AQR D;  2QEX P;  2PRR A;  3LW5 H;  2QJY B;  1NTZ K;  3L74 E;  2ZVN B; 
#chains in the Genus database with same CATH homology
 3JSV C;  4OWF A;  3FX0 A;  2V4H A;  4BWN A;  3F89 A;  2ZVO B;  2ZVN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...