3FX0A

Crystal structure of human nemo cc2_lz domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
LQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NF-kappa-B essential modulator
publication title Structural basis for recognition of diubiquitins by NEMO.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 19
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 3fx0A00
4BWNA 3JSVC 3F89A 3FX0A 2V4HA 4OWFA 2ZVNB 2ZVOB
chains in the Genus database with same CATH superfamily
1KN7A 3M9HA 1RF0A 2WSEJ 2YXRB 5AW6B 3B5ND 2ZT9D 1A02F 3H1JD 3H1KE 5AVXB 5AW8B 1KB9H 3ABVC 1LTJA 4ASWA 2G8YA 2A06E 3ZDMA 1PPJG 2JO1A 2M8RA 3HTKA 3MHVA 3FX0A 2AEMA 5APUA 2A45I 2P1JA 2KZIA 5KAFH 5H2FH 1KILE 2MJZA 3E1RA 2Y9YA 1GK4A 3B71A 4JPZB 5AVRB 2NPSC 1MKMA 1BCCD 1URQA 4YTPC 5AW1B 3D6ZA 3CX5H 1KD1Q 4GT1A 2FYUJ 1OIPA 2W27A 4W7ZA 1SQQK 5APQA 1U7JA 2WSFJ 2ZFCA 2D2CB 1KMIZ 2IBZI 1EZVG 1YJNP 1UIXA 2H89C 2E76B 2AXTH 1VQ4P 1SFCB 3GF7A 1G1IA 2KOGA 2OYIB 4CPGA 2E75B 2HODA 3QWOC 2WPQA 4I1LA 3HUSB 3RL0D 3KDPB 1BGYE 2PGDA 1GMJA 2M3BA 3R2PA 4Z1MH 1PPJD 1CSBA 1ZRTD 3EFFK 4YPCA 3CMEP 1NTKD 1OW8A 1M57D 1SQXK 2PAJA 2ZVOB 1NTMJ 1W5CE 3Q1MA 1AVYA 2WSCH 4M3LA 1P84H 4AUWA 3H1LG 3H1IG 1PGPA 3G3ZA 4EYYQ 1GL2D 2P7JA 4PD4D 1NU1G 4AYCA 3V4WA 3Q2YA 2ZXEB 3L70G 2BEZF 2YO3A 5KAIE 3L71J 1S3JA 3BVHA 1FC2C 4H0LC 1EZVD 1RQUA 4B86A 2YIUB 5E79H 3CC7P 1L0LJ 3CC2P 4L75A 3B5NB 2NZ2A 3HD7D 2ZT9B 4C46A 5KLIC 4RKUJ 1T2KC 1KV4A 4UB6E 2M5AB 2AXCA 1T3JA 1JEKA 3O6QA 4N78D 4DT0A 4U3FG 1N7SA 1JY3N 1JCDA 3H1LD 3H1ID 2FXOA 3MUDA 4L74A 3KZIE 2N1TA 4WB4A 2YKQA 3AE7C 1NU1D 5CCHC 2A45G 3PH0A 1BE3D 1HTLC 3L70D 1KYOH 1KORA 4KHXA 1X9VA 1L4AC 2IX7C 3AE2C 4GKGA 1GW3A 3HE4A 5AW7B 3L72D 4H44C 4PJ0H 3CCLP 3R4YA 1L0LK 1L0NG 2PP6A 3P32A 5B66E 2LKMA 1BGYJ 5C39A 2YKPA 5KLVD 1FBMA 2OQQA 1J1DC 3VMYA 2J59M 3NXSA 1BSHA 3M06A 3RK2D 5GTHE 5AW0B 2FYZA 1S5LX 2J5UA 3RL0B 1LWUB 1NTZG 3CCEP 2H8PD 4Y99B 3H32A 4U3FD 3CCRP 3EFGA 1QGKB 2KLVA 5CMZA 4H13D 1HH0A 1IO4A 1IFPA 3LIEA 1Q2NA 3M0AA 3LW5J 2P58A 1NAFA 1NWQA 1SQVJ 2Y0EA 5KJ7D 4XFJA 4R4MA 2FYUG 4WVZA 1VQ8P 1GL2B 2K37A 3GG2A 1FOSE 1QL1A 2BEQD 2QE7H 1GK6A 2FBWC 2I1KA 2RKLA 1RE4A 3N7NA 2YKOA 2QIWA 1M56D 1L0ND 3TSIA 2E5YA 1KILC 1SQQE 3V2NA 5CJ4A 1PP9G 4H0LD 1HBWA 2IBZD 2P67A 4KJMA 2JJLA 5H2FE 3HD7B 3L74E 2FY8A 2H7HA 1SVFA 1NTZD 1RF0C 1Z56A 1ZN5A 1VQOP 2KIKA 3FGAD 5AVQB 2QG4A 1NTMG 1LTJC 2P10A 1ZXGA 4OGQD 4ZNCA 1HWTC 3P8MC 1IFJA 1SS1A 4PD4H 1KQGB 3SFEC 1SQXE 2FXPA 1GD2E 1NTKK 3IR9A 2QA4P 1AA0A 2Y9ZA 1FOSF 1FZCA 1R8EA 1JMBA 5AVVB 2O01H 2O1KA 3OW2O 1SFCA 4BRYA 1URQC 3V6IA 1R5SA 2OYHB 2V7QJ 5APSA 2OYIA 3H1KG 5CCHD 1RE3A 3HUSA 1RQVA 2O1JA 1PL5A 3KQGA 3MTUE 4IFDK 1S1CX 3A3YB 2A06G 5CJ0A 3CCSP 1PP9D 3FWLA 4H44D 3MP7B 2WPRA 3GHGC 3HE5B 1N7LA 4YXDC 3RK2B 1EDKA 4EDFA 1NTMD 3CI9A 3TGUD 3A7OA 2LXCB 1JO5A 3BRVB 4RO0A 4RESB 4H13B 3JC22 3T97A 3G6EP 5CBOA 1T8ZA 4DZOA 1PFIA 1GDTA 4IL6X 1OXZA 5EFWB 2ZVNB 5APTA 3UIAA 1AJYA 2E42A 4WY4D 1Q7YQ 1XTCC 1SQPK 2YMYA 3H1KD 1SQQJ 3W68A 4W7YA 3U1CA 3S4RA 1JY2P 3B5NA 3RK3E 1SQBK 1USEA 2SPZA 3MD0A 1BSNA 1J1EB 1RY3A 1NU1K 1CI6B 2A06D 3L71E 1BGYG 2B87B 3L74J 1VQ6P 1NGMB 2M5AA 3L4FA 2WT7B 1EQ7A 3P8CE 1QLED 2K9JB 4H0LB 3RBZA 1R5LA 4I7ZC 3S1KA 1KILD 1MFZA 3CCMP 4BWNA 3AECC 2PRRA 1L0LE 3D6YA 1BDDA 3AE5C 2Q3EA 1KFNA 1LT1A 1SQXJ 5KLVK 1H88A 3OJAB 5BU5A 4OGQB 4TLFA 1NO4A 1RF1B 3L75J 2OTJP 1NVOA 4PJ0E 1KTMA 1M1JA 2ITAA 1FDIA 1N7SC 2I1JA 3L73E 2Y0DA 3PJSK 2FKWB 2M0BA 1GZLA 2Q7CA 3I55P 3OA7A 2WVRA 1YTZT 4LC1A 2YXQB 3WUTA 4C7NB 2AEFA 1EDLA 4U7JA 5KKZC 3H1HE 1BGYD 4OH8B 2YNYA 4Y28J 3NFQA 1LT9A 1Q82Q 1PZQA 2W6AA 1FJKA 1QVFO 1LWUA 1USDA 1KQSO 3D71A 1H8AA 1DH3A 1HF9A 2NRGA 3TK1A 3F5HA 3A5TA 3PTZA 4H44B 5CCGD 1QEXA 3TDKA 2I8DA 1L0NK 4HH2A 3AEFC 1MFTA 2WTYA 2J58A 1S9KE 1EXJA 3I5CA 3C1LA 1S72P 3CWBE 1NOHA 1FDOA 1NTZK 3AEGC 2JDIH 2R44A 4PV1C 2KSJA 2B89A 2IPPA 2E43A 2OARA 3CXHH 3M9BA 5B5EE 1QL2A 2OTKE 4IOIH 3BCCJ 3H25A 4UB8H 1JUNA 1FZEA 1SQVE 1LTAC 3G9RA 5AVYB 1EC5A 4EI2A 2KSEA 4WY4B 1NKZB 1KQFB 1S5LH 3A0BH 1S4XA 1NTKE 4GDOA 2WITA 3L36A 2WPSA 3HD7A 2GUVA 5AVUB 2FXMA 3IAOA 3VP9A 1IC2A 1RE4C 3G71P 1NHLA 2HYNA 1VQ7P 1H0TB 2KLUA 4K35A 1VF5C 5APWA 5AVTB 2K3RA 1JOCA 1YJ9P 5TISH 2FYNB 4JYBA 1KILB 1RHZB 2KI7B 5DJTB 2IFNA 3I56P 2L5GB 3KHUA 3EQ2A 1FZFA 1LP1B 1K05A 2GA1A 4OWFA 3L73J 2C0WA 3PLNA 1S2EA 5DJUB 2OYHA 2Q6QA 4DJGA 1YJWP 1IFMA 3H1HJ 4JQ0D 1LJ2A 1KC8Q 1SQQG 2NPSD 5AVSB 3KPEA 1ZP0C 5CBNA 1N73B 2D2CC 3VMAA 3D70A 1XTGB 1OWAA 1YQ3C 1FZCC 1OZHA 3U59A 3L74G 3JSVC 2E76C 3HE5A 1LTBC 1OMIA 1K04A 1SFCC 1SQPE 1VDFA 2B9BA 3Q5RA 5AW9B 2OYIC 5AW5B 1SQBE 1RE3C 3M9QA 3HUSC 1NJIQ 3USSA 1JY3O 2HPCB 3A0HH 3G4SP 3C8VA 5GTIE 3CWBJ 1CZQA 1SQXG 3RK3C 5KJ7A 1X79B 2RH0A 3L72E 1NYHA 3GHGB 4NPDA 2QJKB 4W80A 3F89A 4L73A 2QJPB 3VMZA 3B4SA 3TYYA 4GOEA 4IFMA 1HVVA 3SFDC 1LTIC 5KLVE 2JEEA 1NTKJ 5APYA 2K1AA 3VMXA 1SQQD 1DD3A 1NH4A 2B87A 4PV1D 2L91A 1Q81Q 1KB9E 2VRSA 2R3SA 2WT7A 2K9JA 1EXIA 4NPEA 3AE6C 1DX7A 1E79H 3AE4C 2Y0CA 3V4QA 4HJGH 1PGQA 4GODA 2FFDB 2G3AA 1HUCA 2KS1B 2OYOA 2UWJE 1DEEG 3B5NC 3RGUA 2ZT9C 2N9BA 3II6A 2XV5A 3N4XA 5KAFE 2IDBA 4IL6H 2N9YB 1FE6A 1N2DC 1MZ9A 2XDJA 3M0DA 1SLQA 2O01J 1SQXD 2KYVA 1RF1A 1VF5D 3CD6P 2JWAA 4EIJA 3CX5E 2HG5D 3MZWB 1IK7A 4I7ZB 4WBAA 1T2KD 2BCCE 1PGOA 4D6TE 1OFCX 2M3EA 1JM0A 2QVAA 1M7LA 2FYUD 1JMMA 4KT0J 4C7NA 1NAYA 4HYTB 2Z5HA 1LGHB 2W6BA 3CCVP 3L75E 2AXTE 2IFMA 3L71G 1G2CB 3WUUA 5BU8B 1Q86Q 2Z4EA 2AEJA 3O6QB 2BASA 3SWFA 4UB6H 1M1JC 2C9LY 2NPSB 1SQPJ 1VPCA 3H1LJ 4QMAA 1FZBA 1YYCA 1SQBJ 1JTHB 1L4AD 1ZR2A 1L0LG 3FWNA 2H88C 1NU1J 3MIWA 2O3JA 1BE3J 2K88A 2R3CA 3A2AA 2V4HA 3KZIH 1M1KQ 2KK7A 1L2PA 1LT9C 1P84E 3AE1C 1KZUB 1K8AQ 2GUSA 3L72J 1LWUC 4GOFA 1JY2N 3AE3C 3CXHE 5TJHA 2WZ7A 2R32A 3CLQA 1MUUA 1VQKP 3Q5SA 3L73G 1MV8A 1J2JB 1IJDB 5KLVJ 1HJ0A 2KXPB 3A0BE 2WPVB 4WY4A 3VP8A 1YIJP 5B66H 2XNXA 3RK3D 2IZ1A 2LR2A 3H1HG 3QH9A 3L71D 5CHXA 2HFED 4U3FJ 5E79E 4JF7A 5GTHH 2Q9IA 4PV1B 3P8CD 2HLOA 2R5DA 3BCCE 3TGUE 1H0TA 1LTTC 5AW4B 1W2EA 1L0LD 4NPFX 4JBZA 1JY2O 1WMKA 2JKVA 1IZNB 1OW7A 1QVGO 1DEBA 2OGUA 1N86A 2XKMA 1LP1A 2W6JH 4O9BA 3CWBG 2R5BA 2Z5IA 2BCCJ 1ZV8A 1L0NJ 3PHLA 1GW4A 4R4LA 4D6TJ 1VF5B 1KB9I 1KYOE 3L73D 1GU5A 2QSIA 3AEAC 2A45H 5KLIB 3VYIA 1SQVG 2YO2A 1ZW0A 2QJYC 1NTZJ 1NTKG 3H1JE 2QRXA 2ZYDA 3H1HD 1N73A 1EDJA 2OTLP 4WWIA 3V2RA 3MUDC 2E74C 2WSEH 2Q5UA 2CPBA 2N1TC 2OYHC 3VN0A 3KYQA 3GMAA 4IFFA 1EDIA 3AE8C 3CX5I 3E1IA 4I2LC 3CCJP 3A0HE 1WT6A 2WSCJ 5CCGA 1AQ5A 4K3AA 1L4AB 1URQD 2HPCA 1S9KD 3CCUP 1GU4A 4ZKUA 1BCCE 1FZCB 3FXEA 1A02J 3CWBD 3GHGA 3L35A 3RK2C 1DD4A 1OW6A 4MN4C 4BRYB 2ZAEB 3U1AA 1Y9BA 1E5WA 3Q3DA 1CW5A 5KTBA 3E7KA 3CPWO 4LGDE 1Q90D 3GF3A 2K9YA 1VQ5P 1PP9J 1J1DB 1D7MA 3O8ZA 3AEDC 1SQVD 1GL2A 4H13C 3SWKA 1K73Q 2KUBA 5AW2B 4L76A 2WSFH 3FXDA 3JCUH 2WMMA 1PGJA 5KJ7C 3RK3B 3CL3D 4HB1A 3TGUJ 1P84I 1VL2A 2W8ZA 2XZRA 3AEBC 2CPSA 3B8EB 1AQTA 2KNCB 1SQPG 2FFDA 1PPJE 4JYCA 1ZRTE 2KS1A 3CXHI 1TU3F 1YITP 1LNQA 4IL6E 2IYOA 1SQBG 2FYUK 3AE9C 1NKNA 1J1EC 3GLMA 4EOTA 3TNUB 3T97B 1BE3G 5K5GB 4TT3H 3W67A 2RMZA 4BXLA 1HGZA 3L72G 3GW6A 3H1KJ 1YTZI 4PD4E 1U7MA 3P7KA 2MKVA 5BVZA 1M8OB 3IN6A 1W2BO 2E5TA 1VQPP 3WU2H 1GTWA 1EZVE 5KLVG 4LLHA 1T3UA 3H1JJ 2H43A 2C0XA 4OGQC 1FAVA 3M0DC 2ZJSE 1IFDA 1RF1C 1G2CA 1NTMK 2KP8A 2NPSA 1LTJB 1OVVA 5AVWB 1M90Q 2B88A 2KZJA 2YMKA 4N6JA 1SQPD 3H6PA 1JTHA 4OVNF 3NMDA 3HTKB 2W90A 1LTGC 4ZMDA 1SQBD 1VQMP 1N7SD 4N78E 1KYOI 2KB7P 1BCCJ 2E74D 2WQYC 3C9IA 2JP3A 1HJBA 1Y8AA 2N1TD 4ZKPA 3H1LE 3H1IE 1FU1A 1AVOA 3WMM0 3BATA 1FZGA 1URQB 1UIIA 1M1JB 3PRJA 2E75C 3SSUA 3OAKA 2QM8A 3S9OA 1NU1E 2IYPA 4C7RA 1BE3E 3L70E 2BCCG 3RL0g 3VTPC 4D6TG 3CC4P 2HR3A 5AW3B 3RBXA 1JY3P 3IFMA 2CK3H 2IBZG 2XU6A 1X22A 1YI2P 3V2PA 1LT9B 1WRGA 3L75G 3VOPA 2W83C 2PFXA 2C9NY 1KB9D 3IF4A 2QEXP 2HODB 3K5BA 1YBKA 3KXDA 1AV1A 1CI6A 4WY4C 3ITKA 1OVRA 1PIXA 1LTSC 1OX3A 3L74D 4DCKA 4U3FE 3EWKA 2GM4A 1JB0J 2WSSH 1Y47A 2YIUC 1H89A 1HGVA 3WUVA 1JCCA 3CX5D 4RJTA 2QM7A 1ZOYC 2BCCD 5B5EH 2ZYGA 3M91A 2FYNC 4XA4A 3SWYA 4D6TD 3BRTB 4HKZH 3LW5H 3BASA 1U57A 1X8YA 1RH5B 3TF5A 5KAIH 1OVUA 4AQRD 3L75D 1L0NE 1PV3A 4YXWH 3V2QA 2ZYAA 3AEEC 1VQ9P 1YQ4C 3BCCG 3TGUG 4DOJA 2IBZE 2Q1KA 5CCHA 1SQVK 4PD4I 1NTZE 3HRNA 2JR8A 1K9MQ 2DW3A 1L4AA 1N73C 3CMAP 1G1JA 2QJYB 3CCQP 2WWWA 3H1IJ 1P84D 1ZMEC 1N7SB 1EZVI 2Q3IA 2E74B 3CXHD 5L8RJ 3L70J 2N1TB 2D2CD 1T6AA 3MGNA 2P2UA 1DIPA 2FYUE 2XNDH 1X0TA 5KKZB 2E76D 1FS0E 3Q5PA 5CCGC 1SFCD 5AVZB 3RL0C 2ZXXA 1ZR4A 1FJPA 3JCUE 2JWDA 1IK9A 4Y99C 2E75D 1SP4A 3HE4B 4ASVA 3PP5A 3H1JG 4UB8E 2QJKC 5M1BA 5APXA 1AFOA 2QJPC 4N3YB 1VQNP 1S5LE 2KNCA 2LXBA 1PP9E 1IFIA 3BCCD 2V7QH 1N8RQ 1GL2C 1VQLP 3L37A 3NTNA 3TNUA 1JNMA 1NTME 3V5BA 3H32B 2RN0A 5APVA 5GTIH 2POHA 1BCCG 4GIFA 5TISE 1YHQP 1QX8A 1BDCA 2IZ0A 2FFDC 1KFMA 4I6MC 1KILA 1ZLLA 3WU2E 1IFNA 1FZAA 3LIDA 1KYOD 4XE5B 3HD7C 1KQLA 2O01N 4A7PA 1FDMA
chains in the Genus database with same CATH topology
4BWNA 3JSVC 3F89A 3FX0A 2V4HA 4OWFA 2ZVNB 2ZVOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BWN A;  3JSV C;  3F89 A;  3FX0 A;  2V4H A;  4OWF A;  2ZVN B;  2ZVO B; 
#chains in the Genus database with same CATH topology
 1KN7 A;  3M9H A;  1RF0 A;  2WSE J;  2YXR B;  5AW6 B;  3B5N D;  2ZT9 D;  1A02 F;  3H1J D;  3H1K E;  5AVX B;  5AW8 B;  1KB9 H;  3ABV C;  1LTJ A;  4ASW A;  2G8Y A;  2A06 E;  3ZDM A;  1PPJ G;  2JO1 A;  2M8R A;  3HTK A;  3MHV A;  3FX0 A;  2AEM A;  5APU A;  2A45 I;  2P1J A;  2KZI A;  5KAF H;  5H2F H;  1KIL E;  2MJZ A;  3E1R A;  2Y9Y A;  1GK4 A;  3B71 A;  4JPZ B;  5AVR B;  2NPS C;  1MKM A;  1BCC D;  1URQ A;  4YTP C;  5AW1 B;  3D6Z A;  3CX5 H;  1KD1 Q;  4GT1 A;  2FYU J;  1OIP A;  2W27 A;  4W7Z A;  1SQQ K;  5APQ A;  1U7J A;  2WSF J;  2ZFC A;  2D2C B;  1KMI Z;  2IBZ I;  1EZV G;  1YJN P;  1UIX A;  2H89 C;  2E76 B;  2AXT H;  1VQ4 P;  1SFC B;  3GF7 A;  1G1I A;  2KOG A;  2OYI B;  4CPG A;  2E75 B;  2HOD A;  3QWO C;  2WPQ A;  4I1L A;  3HUS B;  3RL0 D;  3KDP B;  1BGY E;  2PGD A;  1GMJ A;  2M3B A;  3R2P A;  4Z1M H;  1PPJ D;  1CSB A;  1ZRT D;  3EFF K;  4YPC A;  3CME P;  1NTK D;  1OW8 A;  1M57 D;  1SQX K;  2PAJ A;  2ZVO B;  1NTM J;  1W5C E;  3Q1M A;  1AVY A;  2WSC H;  4M3L A;  1P84 H;  4AUW A;  3H1L G;  3H1I G;  1PGP A;  3G3Z A;  4EYY Q;  1GL2 D;  2P7J A;  4PD4 D;  1NU1 G;  4AYC A;  3V4W A;  3Q2Y A;  2ZXE B;  3L70 G;  2BEZ F;  2YO3 A;  5KAI E;  3L71 J;  1S3J A;  3BVH A;  1FC2 C;  4H0L C;  1EZV D;  1RQU A;  4B86 A;  2YIU B;  5E79 H;  3CC7 P;  1L0L J;  3CC2 P;  4L75 A;  3B5N B;  2NZ2 A;  3HD7 D;  2ZT9 B;  4C46 A;  5KLI C;  4RKU J;  1T2K C;  1KV4 A;  4UB6 E;  2M5A B;  2AXC A;  1T3J A;  1JEK A;  3O6Q A;  4N78 D;  4DT0 A;  4U3F G;  1N7S A;  1JY3 N;  1JCD A;  3H1L D;  3H1I D;  2FXO A;  3MUD A;  4L74 A;  3KZI E;  2N1T A;  4WB4 A;  2YKQ A;  3AE7 C;  1NU1 D;  5CCH C;  2A45 G;  3PH0 A;  1BE3 D;  1HTL C;  3L70 D;  1KYO H;  1KOR A;  4KHX A;  1X9V A;  1L4A C;  2IX7 C;  3AE2 C;  4GKG A;  1GW3 A;  3HE4 A;  5AW7 B;  3L72 D;  4H44 C;  4PJ0 H;  3CCL P;  3R4Y A;  1L0L K;  1L0N G;  2PP6 A;  3P32 A;  5B66 E;  2LKM A;  1BGY J;  5C39 A;  2YKP A;  5KLV D;  1FBM A;  2OQQ A;  1J1D C;  3VMY A;  2J59 M;  3NXS A;  1BSH A;  3M06 A;  3RK2 D;  5GTH E;  5AW0 B;  2FYZ A;  1S5L X;  2J5U A;  3RL0 B;  1LWU B;  1NTZ G;  3CCE P;  2H8P D;  4Y99 B;  3H32 A;  4U3F D;  3CCR P;  3EFG A;  1QGK B;  2KLV A;  5CMZ A;  4H13 D;  1HH0 A;  1IO4 A;  1IFP A;  3LIE A;  1Q2N A;  3M0A A;  3LW5 J;  2P58 A;  1NAF A;  1NWQ A;  1SQV J;  2Y0E A;  5KJ7 D;  4XFJ A;  4R4M A;  2FYU G;  4WVZ A;  1VQ8 P;  1GL2 B;  2K37 A;  3GG2 A;  1FOS E;  1QL1 A;  2BEQ D;  2QE7 H;  1GK6 A;  2FBW C;  2I1K A;  2RKL A;  1RE4 A;  3N7N A;  2YKO A;  2QIW A;  1M56 D;  1L0N D;  3TSI A;  2E5Y A;  1KIL C;  1SQQ E;  3V2N A;  5CJ4 A;  1PP9 G;  4H0L D;  1HBW A;  2IBZ D;  2P67 A;  4KJM A;  2JJL A;  5H2F E;  3HD7 B;  3L74 E;  2FY8 A;  2H7H A;  1SVF A;  1NTZ D;  1RF0 C;  1Z56 A;  1ZN5 A;  1VQO P;  2KIK A;  3FGA D;  5AVQ B;  2QG4 A;  1NTM G;  1LTJ C;  2P10 A;  1ZXG A;  4OGQ D;  4ZNC A;  1HWT C;  3P8M C;  1IFJ A;  1SS1 A;  4PD4 H;  1KQG B;  3SFE C;  1SQX E;  2FXP A;  1GD2 E;  1NTK K;  3IR9 A;  2QA4 P;  1AA0 A;  2Y9Z A;  1FOS F;  1FZC A;  1R8E A;  1JMB A;  5AVV B;  2O01 H;  2O1K A;  3OW2 O;  1SFC A;  4BRY A;  1URQ C;  3V6I A;  1R5S A;  2OYH B;  2V7Q J;  5APS A;  2OYI A;  3H1K G;  5CCH D;  1RE3 A;  3HUS A;  1RQV A;  2O1J A;  1PL5 A;  3KQG A;  3MTU E;  4IFD K;  1S1C X;  3A3Y B;  2A06 G;  5CJ0 A;  3CCS P;  1PP9 D;  3FWL A;  4H44 D;  3MP7 B;  2WPR A;  3GHG C;  3HE5 B;  1N7L A;  4YXD C;  3RK2 B;  1EDK A;  4EDF A;  1NTM D;  3CI9 A;  3TGU D;  3A7O A;  2LXC B;  1JO5 A;  3BRV B;  4RO0 A;  4RES B;  4H13 B;  3JC2 2;  3T97 A;  3G6E P;  5CBO A;  1T8Z A;  4DZO A;  1PFI A;  1GDT A;  4IL6 X;  1OXZ A;  5EFW B;  2ZVN B;  5APT A;  3UIA A;  1AJY A;  2E42 A;  4WY4 D;  1Q7Y Q;  1XTC C;  1SQP K;  2YMY A;  3H1K D;  1SQQ J;  3W68 A;  4W7Y A;  3U1C A;  3S4R A;  1JY2 P;  3B5N A;  3RK3 E;  1SQB K;  1USE A;  2SPZ A;  3MD0 A;  1BSN A;  1J1E B;  1RY3 A;  1NU1 K;  1CI6 B;  2A06 D;  3L71 E;  1BGY G;  2B87 B;  3L74 J;  1VQ6 P;  1NGM B;  2M5A A;  3L4F A;  2WT7 B;  1EQ7 A;  3P8C E;  1QLE D;  2K9J B;  4H0L B;  3RBZ A;  1R5L A;  4I7Z C;  3S1K A;  1KIL D;  1MFZ A;  3CCM P;  4BWN A;  3AEC C;  2PRR A;  1L0L E;  3D6Y A;  1BDD A;  3AE5 C;  2Q3E A;  1KFN A;  1LT1 A;  1SQX J;  5KLV K;  1H88 A;  3OJA B;  5BU5 A;  4OGQ B;  4TLF A;  1NO4 A;  1RF1 B;  3L75 J;  2OTJ P;  1NVO A;  4PJ0 E;  1KTM A;  1M1J A;  2ITA A;  1FDI A;  1N7S C;  2I1J A;  3L73 E;  2Y0D A;  3PJS K;  2FKW B;  2M0B A;  1GZL A;  2Q7C A;  3I55 P;  3OA7 A;  2WVR A;  1YTZ T;  4LC1 A;  2YXQ B;  3WUT A;  4C7N B;  2AEF A;  1EDL A;  4U7J A;  5KKZ C;  3H1H E;  1BGY D;  4OH8 B;  2YNY A;  4Y28 J;  3NFQ A;  1LT9 A;  1Q82 Q;  1PZQ A;  2W6A A;  1FJK A;  1QVF O;  1LWU A;  1USD A;  1KQS O;  3D71 A;  1H8A A;  1DH3 A;  1HF9 A;  2NRG A;  3TK1 A;  3F5H A;  3A5T A;  3PTZ A;  4H44 B;  5CCG D;  1QEX A;  3TDK A;  2I8D A;  1L0N K;  4HH2 A;  3AEF C;  1MFT A;  2WTY A;  2J58 A;  1S9K E;  1EXJ A;  3I5C A;  3C1L A;  1S72 P;  3CWB E;  1NOH A;  1FDO A;  1NTZ K;  3AEG C;  2JDI H;  2R44 A;  4PV1 C;  2KSJ A;  2B89 A;  2IPP A;  2E43 A;  2OAR A;  3CXH H;  3M9B A;  5B5E E;  1QL2 A;  2OTK E;  4IOI H;  3BCC J;  3H25 A;  4UB8 H;  1JUN A;  1FZE A;  1SQV E;  1LTA C;  3G9R A;  5AVY B;  1EC5 A;  4EI2 A;  2KSE A;  4WY4 B;  1NKZ B;  1KQF B;  1S5L H;  3A0B H;  1S4X A;  1NTK E;  4GDO A;  2WIT A;  3L36 A;  2WPS A;  3HD7 A;  2GUV A;  5AVU B;  2FXM A;  3IAO A;  3VP9 A;  1IC2 A;  1RE4 C;  3G71 P;  1NHL A;  2HYN A;  1VQ7 P;  1H0T B;  2KLU A;  4K35 A;  1VF5 C;  5APW A;  5AVT B;  2K3R A;  1JOC A;  1YJ9 P;  5TIS H;  2FYN B;  4JYB A;  1KIL B;  1RHZ B;  2KI7 B;  5DJT B;  2IFN A;  3I56 P;  2L5G B;  3KHU A;  3EQ2 A;  1FZF A;  1LP1 B;  1K05 A;  2GA1 A;  4OWF A;  3L73 J;  2C0W A;  3PLN A;  1S2E A;  5DJU B;  2OYH A;  2Q6Q A;  4DJG A;  1YJW P;  1IFM A;  3H1H J;  4JQ0 D;  1LJ2 A;  1KC8 Q;  1SQQ G;  2NPS D;  5AVS B;  3KPE A;  1ZP0 C;  5CBN A;  1N73 B;  2D2C C;  3VMA A;  3D70 A;  1XTG B;  1OWA A;  1YQ3 C;  1FZC C;  1OZH A;  3U59 A;  3L74 G;  3JSV C;  2E76 C;  3HE5 A;  1LTB C;  1OMI A;  1K04 A;  1SFC C;  1SQP E;  1VDF A;  2B9B A;  3Q5R A;  5AW9 B;  2OYI C;  5AW5 B;  1SQB E;  1RE3 C;  3M9Q A;  3HUS C;  1NJI Q;  3USS A;  1JY3 O;  2HPC B;  3A0H H;  3G4S P;  3C8V A;  5GTI E;  3CWB J;  1CZQ A;  1SQX G;  3RK3 C;  5KJ7 A;  1X79 B;  2RH0 A;  3L72 E;  1NYH A;  3GHG B;  4NPD A;  2QJK B;  4W80 A;  3F89 A;  4L73 A;  2QJP B;  3VMZ A;  3B4S A;  3TYY A;  4GOE A;  4IFM A;  1HVV A;  3SFD C;  1LTI C;  5KLV E;  2JEE A;  1NTK J;  5APY A;  2K1A A;  3VMX A;  1SQQ D;  1DD3 A;  1NH4 A;  2B87 A;  4PV1 D;  2L91 A;  1Q81 Q;  1KB9 E;  2VRS A;  2R3S A;  2WT7 A;  2K9J A;  1EXI A;  4NPE A;  3AE6 C;  1DX7 A;  1E79 H;  3AE4 C;  2Y0C A;  3V4Q A;  4HJG H;  1PGQ A;  4GOD A;  2FFD B;  2G3A A;  1HUC A;  2KS1 B;  2OYO A;  2UWJ E;  1DEE G;  3B5N C;  3RGU A;  2ZT9 C;  2N9B A;  3II6 A;  2XV5 A;  3N4X A;  5KAF E;  2IDB A;  4IL6 H;  2N9Y B;  1FE6 A;  1N2D C;  1MZ9 A;  2XDJ A;  3M0D A;  1SLQ A;  2O01 J;  1SQX D;  2KYV A;  1RF1 A;  1VF5 D;  3CD6 P;  2JWA A;  4EIJ A;  3CX5 E;  2HG5 D;  3MZW B;  1IK7 A;  4I7Z B;  4WBA A;  1T2K D;  2BCC E;  1PGO A;  4D6T E;  1OFC X;  2M3E A;  1JM0 A;  2QVA A;  1M7L A;  2FYU D;  1JMM A;  4KT0 J;  4C7N A;  1NAY A;  4HYT B;  2Z5H A;  1LGH B;  2W6B A;  3CCV P;  3L75 E;  2AXT E;  2IFM A;  3L71 G;  1G2C B;  3WUU A;  5BU8 B;  1Q86 Q;  2Z4E A;  2AEJ A;  3O6Q B;  2BAS A;  3SWF A;  4UB6 H;  1M1J C;  2C9L Y;  2NPS B;  1SQP J;  1VPC A;  3H1L J;  4QMA A;  1FZB A;  1YYC A;  1SQB J;  1JTH B;  1L4A D;  1ZR2 A;  1L0L G;  3FWN A;  2H88 C;  1NU1 J;  3MIW A;  2O3J A;  1BE3 J;  2K88 A;  2R3C A;  3A2A A;  2V4H A;  3KZI H;  1M1K Q;  2KK7 A;  1L2P A;  1LT9 C;  1P84 E;  3AE1 C;  1KZU B;  1K8A Q;  2GUS A;  3L72 J;  1LWU C;  4GOF A;  1JY2 N;  3AE3 C;  3CXH E;  5TJH A;  2WZ7 A;  2R32 A;  3CLQ A;  1MUU A;  1VQK P;  3Q5S A;  3L73 G;  1MV8 A;  1J2J B;  1IJD B;  5KLV J;  1HJ0 A;  2KXP B;  3A0B E;  2WPV B;  4WY4 A;  3VP8 A;  1YIJ P;  5B66 H;  2XNX A;  3RK3 D;  2IZ1 A;  2LR2 A;  3H1H G;  3QH9 A;  3L71 D;  5CHX A;  2HFE D;  4U3F J;  5E79 E;  4JF7 A;  5GTH H;  2Q9I A;  4PV1 B;  3P8C D;  2HLO A;  2R5D A;  3BCC E;  3TGU E;  1H0T A;  1LTT C;  5AW4 B;  1W2E A;  1L0L D;  4NPF X;  4JBZ A;  1JY2 O;  1WMK A;  2JKV A;  1IZN B;  1OW7 A;  1QVG O;  1DEB A;  2OGU A;  1N86 A;  2XKM A;  1LP1 A;  2W6J H;  4O9B A;  3CWB G;  2R5B A;  2Z5I A;  2BCC J;  1ZV8 A;  1L0N J;  3PHL A;  1GW4 A;  4R4L A;  4D6T J;  1VF5 B;  1KB9 I;  1KYO E;  3L73 D;  1GU5 A;  2QSI A;  3AEA C;  2A45 H;  5KLI B;  3VYI A;  1SQV G;  2YO2 A;  1ZW0 A;  2QJY C;  1NTZ J;  1NTK G;  3H1J E;  2QRX A;  2ZYD A;  3H1H D;  1N73 A;  1EDJ A;  2OTL P;  4WWI A;  3V2R A;  3MUD C;  2E74 C;  2WSE H;  2Q5U A;  2CPB A;  2N1T C;  2OYH C;  3VN0 A;  3KYQ A;  3GMA A;  4IFF A;  1EDI A;  3AE8 C;  3CX5 I;  3E1I A;  4I2L C;  3CCJ P;  3A0H E;  1WT6 A;  2WSC J;  5CCG A;  1AQ5 A;  4K3A A;  1L4A B;  1URQ D;  2HPC A;  1S9K D;  3CCU P;  1GU4 A;  4ZKU A;  1BCC E;  1FZC B;  3FXE A;  1A02 J;  3CWB D;  3GHG A;  3L35 A;  3RK2 C;  1DD4 A;  1OW6 A;  4MN4 C;  4BRY B;  2ZAE B;  3U1A A;  1Y9B A;  1E5W A;  3Q3D A;  1CW5 A;  5KTB A;  3E7K A;  3CPW O;  4LGD E;  1Q90 D;  3GF3 A;  2K9Y A;  1VQ5 P;  1PP9 J;  1J1D B;  1D7M A;  3O8Z A;  3AED C;  1SQV D;  1GL2 A;  4H13 C;  3SWK A;  1K73 Q;  2KUB A;  5AW2 B;  4L76 A;  2WSF H;  3FXD A;  3JCU H;  2WMM A;  1PGJ A;  5KJ7 C;  3RK3 B;  3CL3 D;  4HB1 A;  3TGU J;  1P84 I;  1VL2 A;  2W8Z A;  2XZR A;  3AEB C;  2CPS A;  3B8E B;  1AQT A;  2KNC B;  1SQP G;  2FFD A;  1PPJ E;  4JYC A;  1ZRT E;  2KS1 A;  3CXH I;  1TU3 F;  1YIT P;  1LNQ A;  4IL6 E;  2IYO A;  1SQB G;  2FYU K;  3AE9 C;  1NKN A;  1J1E C;  3GLM A;  4EOT A;  3TNU B;  3T97 B;  1BE3 G;  5K5G B;  4TT3 H;  3W67 A;  2RMZ A;  4BXL A;  1HGZ A;  3L72 G;  3GW6 A;  3H1K J;  1YTZ I;  4PD4 E;  1U7M A;  3P7K A;  2MKV A;  5BVZ A;  1M8O B;  3IN6 A;  1W2B O;  2E5T A;  1VQP P;  3WU2 H;  1GTW A;  1EZV E;  5KLV G;  4LLH A;  1T3U A;  3H1J J;  2H43 A;  2C0X A;  4OGQ C;  1FAV A;  3M0D C;  2ZJS E;  1IFD A;  1RF1 C;  1G2C A;  1NTM K;  2KP8 A;  2NPS A;  1LTJ B;  1OVV A;  5AVW B;  1M90 Q;  2B88 A;  2KZJ A;  2YMK A;  4N6J A;  1SQP D;  3H6P A;  1JTH A;  4OVN F;  3NMD A;  3HTK B;  2W90 A;  1LTG C;  4ZMD A;  1SQB D;  1VQM P;  1N7S D;  4N78 E;  1KYO I;  2KB7 P;  1BCC J;  2E74 D;  2WQY C;  3C9I A;  2JP3 A;  1HJB A;  1Y8A A;  2N1T D;  4ZKP A;  3H1L E;  3H1I E;  1FU1 A;  1AVO A;  3WMM 0;  3BAT A;  1FZG A;  1URQ B;  1UII A;  1M1J B;  3PRJ A;  2E75 C;  3SSU A;  3OAK A;  2QM8 A;  3S9O A;  1NU1 E;  2IYP A;  4C7R A;  1BE3 E;  3L70 E;  2BCC G;  3RL0 g;  3VTP C;  4D6T G;  3CC4 P;  2HR3 A;  5AW3 B;  3RBX A;  1JY3 P;  3IFM A;  2CK3 H;  2IBZ G;  2XU6 A;  1X22 A;  1YI2 P;  3V2P A;  1LT9 B;  1WRG A;  3L75 G;  3VOP A;  2W83 C;  2PFX A;  2C9N Y;  1KB9 D;  3IF4 A;  2QEX P;  2HOD B;  3K5B A;  1YBK A;  3KXD A;  1AV1 A;  1CI6 A;  4WY4 C;  3ITK A;  1OVR A;  1PIX A;  1LTS C;  1OX3 A;  3L74 D;  4DCK A;  4U3F E;  3EWK A;  2GM4 A;  1JB0 J;  2WSS H;  1Y47 A;  2YIU C;  1H89 A;  1HGV A;  3WUV A;  1JCC A;  3CX5 D;  4RJT A;  2QM7 A;  1ZOY C;  2BCC D;  5B5E H;  2ZYG A;  3M91 A;  2FYN C;  4XA4 A;  3SWY A;  4D6T D;  3BRT B;  4HKZ H;  3LW5 H;  3BAS A;  1U57 A;  1X8Y A;  1RH5 B;  3TF5 A;  5KAI H;  1OVU A;  4AQR D;  3L75 D;  1L0N E;  1PV3 A;  4YXW H;  3V2Q A;  2ZYA A;  3AEE C;  1VQ9 P;  1YQ4 C;  3BCC G;  3TGU G;  4DOJ A;  2IBZ E;  2Q1K A;  5CCH A;  1SQV K;  4PD4 I;  1NTZ E;  3HRN A;  2JR8 A;  1K9M Q;  2DW3 A;  1L4A A;  1N73 C;  3CMA P;  1G1J A;  2QJY B;  3CCQ P;  2WWW A;  3H1I J;  1P84 D;  1ZME C;  1N7S B;  1EZV I;  2Q3I A;  2E74 B;  3CXH D;  5L8R J;  3L70 J;  2N1T B;  2D2C D;  1T6A A;  3MGN A;  2P2U A;  1DIP A;  2FYU E;  2XND H;  1X0T A;  5KKZ B;  2E76 D;  1FS0 E;  3Q5P A;  5CCG C;  1SFC D;  5AVZ B;  3RL0 C;  2ZXX A;  1ZR4 A;  1FJP A;  3JCU E;  2JWD A;  1IK9 A;  4Y99 C;  2E75 D;  1SP4 A;  3HE4 B;  4ASV A;  3PP5 A;  3H1J G;  4UB8 E;  2QJK C;  5M1B A;  5APX A;  1AFO A;  2QJP C;  4N3Y B;  1VQN P;  1S5L E;  2KNC A;  2LXB A;  1PP9 E;  1IFI A;  3BCC D;  2V7Q H;  1N8R Q;  1GL2 C;  1VQL P;  3L37 A;  3NTN A;  3TNU A;  1JNM A;  1NTM E;  3V5B A;  3H32 B;  2RN0 A;  5APV A;  5GTI H;  2POH A;  1BCC G;  4GIF A;  5TIS E;  1YHQ P;  1QX8 A;  1BDC A;  2IZ0 A;  2FFD C;  1KFM A;  4I6M C;  1KIL A;  1ZLL A;  3WU2 E;  1IFN A;  1FZA A;  3LID A;  1KYO D;  4XE5 B;  3HD7 C;  1KQL A;  2O01 N;  4A7P A;  1FDM A; 
#chains in the Genus database with same CATH homology
 4BWN A;  3JSV C;  3F89 A;  3FX0 A;  2V4H A;  4OWF A;  2ZVN B;  2ZVO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...