3FX0A

Crystal structure of human nemo cc2_lz domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
b'LQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NF-kappa-B essential modulator
publication title Structural basis for recognition of diubiquitins by NEMO.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 19
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 3fx0A00
2ZVOB 2ZVNB 3JSVC 4BWNA 2V4HA 3FX0A 4OWFA 3F89A
chains in the Genus database with same CATH superfamily
3B8EB 1J2JB 1G1JA 3L36A 5KAIE 1SQBJ 2WMMA 3TGUE 2WPQA 3P7KA 1GL2B 2FYNB 2XNXA 3H1HJ 2WSCH 2XZRA 4Z1MH 1M1JA 2ZT9C 5AVSB 5AW6B 3HE5B 2QRXA 1URQC 3VTPC 3RK3B 3RK2C 1RF1B 3L73E 1BGYD 1NU1D 4IL6E 2IZ0A 3U59A 3BCCJ 1L0NK 3USSA 3D6ZA 1SQPD 2YIUB 3H1JJ 2IYOA 1LWUC 1WRGA 1XTCC 1FOSF 4OH8B 3CWBD 4C46A 3PHLA 5KAFH 2FYUK 1Q7YQ 1SQVG 3FGAD 1VQ9P 3EQ2A 1IK9A 2JKVA 1M1JB 3N7NA 3GHGC 3IFMA 1VQPP 1NTZJ 5CCHA 1OFCX 2XKMA 2N1TA 4GDOA 2ZYGA 4O9BA 1IFMA 3P8CD 3H1LD 2M3BA 2FYZA 3OJAB 1NU1J 1GU4A 2IX7C 1FJPA 3AE1C 1IJDB 1SQQJ 3Q3DA 3NXSA 1SQVE 1EZVI 1U7MA 1AVYA 1EDJA 3P32A 3VP8A 3KPEA 4KHXA 2N1TB 1Q86Q 2AEFA 2B89A 1KC8Q 1SQXD 2WSEJ 1JY2N 1LTGC 4IFFA 1R5LA 2Q9IA 4U7JA 2W6AA 3LW5J 1JMBA 1Y47A 3TGUD 1YHQP 4I7ZB 1SQPK 2H89C 2OYIC 1KILA 4OGQB 1VQKP 4W7YA 2IPPA 4PJ0E 1RH5B 3UIAA 2H43A 3F89A 3A0BE 5AW9B 4AUWA 1FE6A 3L73D 4BWNA 4BXLA 1CW5A 1VQMP 3BRVB 2KS1A 2H88C 2M5AB 1ZN5A 3VP9A 1JM0A 4LGDE 3K5BA 3RGUA 1KILB 4R4MA 5B5EH 2FKWB 3O6QA 4GOFA 1PP9G 1URQA 1HWTC 2JR8A 4IFMA 1T8ZA 1YJ9P 2OYHB 2K3RA 1LTBC 3PH0A 5AVVB 1HTLC 2E75C 5KLVG 1KORA 2KS1B 1LWUA 1VF5D 2O3JA 1SQXK 3V2QA 1SQVD 5AVXB 5CJ0A 3OAKA 4JYCA 3O6QB 2I1JA 4GOEA 1FZCC 3CCQP 1URQB 1PP9E 3GHGA 2HODA 1NJIQ 5APQA 2OTKE 4WY4B 2HFED 4H13C 3M06A 3E1RA 1VF5C 1LTJA 1EXIA 3RBXA 1HGVA 1SFCC 1USEA 1S3JA 1LWUB 3M0DA 2WQYC 2DW3A 2KLVA 1PV3A 3TNUA 2M8RA 3MZWB 1JEKA 1ZR2A 3GHGB 2YXQB 1SQVJ 2NRGA 5KLIB 3WMM0 1X22A 2HODB 1T3JA 1P84E 3H1HG 2KUBA 1J1EC 1RY3A 2P58A 2Y0EA 5BVZA 1LTJB 3VMAA 3B5NA 3WUUA 5APXA 2D2CC 2Q3IA 3BCCG 1ZMEC 1L0LG 4RESB 2FXPA 3GF3A 3H1JG 4W80A 3TNUB 3R2PA 2XDJA 4HB1A 3V2NA 2YO2A 2A45I 1CI6A 2WZ7A 1EZVE 1SVFA 1M90Q 1OZHA 3H1HE 1NAYA 2XNDH 1K73Q 2V7QH 2KYVA 1X9VA 3U1AA 1NTZG 1FC2C 3B5NB 5KAIH 1NTKG 1L4AB 1T2KC 2XU6A 2OTLP 3BCCE 2YNYA 4AQRD 1L0LE 3BATA 4L75A 3CC7P 2LXBA 4N3YB 3VOPA 2JWDA 4YPCA 2K88A 3H1JE 2OTJP 5EFWB 3L74J 1CI6B 1SQQG 1QEXA 3T97A 4IL6H 1YQ3C 5TISE 3M9HA 3C8VA 5C39A 3PTZA 2WPSA 3CCMP 3IAOA 3L75G 3G4SP 1NTZE 3GF7A 4C7RA 1NTMG 5AW1B 2KIKA 2RKLA 1QVGO 3F5HA 3I5CA 2PP6A 2E43A 3V2RA 2E76B 4GKGA 3AEFC 2QSIA 3FWLA 3T97B 3CCSP 3L70G 1SQQE 3CCVP 1FS0E 4DJGA 1Q90D 1BDDA 1JY2P 1ZP0C 1M57D 1IFNA 1P84D 3M91A 2J59M 2Q1KA 3L75E 5BU8B 3HD7A 1W5CE 1PP9J 1NTME 4HYTB 2K9YA 4NPDA 1GW3A 1PPJG 3FXDA 2I1KA 2IYPA 2Z5IA 1KB9I 1X8YA 2WSFH 2QIWA 1Y8AA 2QJYC 2FY8A 5KLVJ 2BEZF 2IDBA 1VQNP 3L70E 3V4WA 1NKNA 3HUSC 1MZ9A 3CC2P 3E7KA 1N7SA 3V4QA 3Q5SA 1EZVD 3H1HD 4AYCA 5APUA 3HD7B 3OA7A 2L91A 1M8OB 2WPRA 2C0WA 5CHXA 1PPJE 5AW5B 1S1CX 1S72P 3GW6A 1HF9A 3H32A 1K05A 3BCCD 1LT9A 1PGPA 1L0LD 1NKZB 4D6TG 2H8PD 1ZV8A 2AXCA 4PJ0H 1JY2O 2BCCG 1AQTA 3H1JD 2Q7CA 1RF0C 3RK2D 3A0BH 4LC1A 4YTPC 4EI2A 3G3ZA 1N7SB 4H0LC 1X79B 3Q2YA 1L0NJ 3PJSK 1KQSO 1J1EB 2A45G 5AW8B 1AJYA 3RBZA 5KKZB 2HR3A 2WPVB 1YQ4C 1NTZD 3KYQA 4N6JA 3L37A 3H32B 4GT1A 5CJ4A 1LT9B 2IFNA 1DH3A 2M0BA 2N9YB 5APVA 1GK4A 4OWFA 3O8ZA 4EIJA 3MIWA 2Z5HA 1L0LJ 4GIFA 1U57A 1SQQD 3RL0D 2P7JA 5APSA 5TJHA 4UB8E 4U3FJ 1ZRTE 4IOIH 1QL1A 2O01N 3L72J 1S2EA 1K8AQ 3KQGA 3L75D 1P84I 1SQBK 2KSJA 1AQ5A 3A7OA 1NTMD 5KJ7D 3MHVA 3CC4P 1BCCG 2E42A 2NPSA 1GD2E 1NTKJ 2LXCB 3RL0C 2Z4EA 2BASA 5APWA 1KYOE 1KD1Q 4XA4A 3L70D 2POHA 1N7LA 2GUSA 2QJKC 2KI7B 1OWAA 3CCLP 2C9NY 1MFTA 3S9OA 1H0TA 1M7LA 5KJ7C 3W68A 1H89A 1PZQA 1A02J 1PPJD 1BCCE 2NPSB 3L75J 2UWJE 1ZXGA 1FAVA 3SSUA 1NTMJ 4L76A 3L35A 1E79H 3CCRP 3AE8C 3W67A 3HUSA 3L74G 1NU1K 1H0TB 3L70J 1LNQA 5BU5A 4DCKA 4N78E 1U7JA 4I6MC 1NOHA 3ZDMA 2R5DA 2HPCA 2IBZI 3AEGC 5GTIE 2ITAA 1NVOA 3AE7C 3BASA 3JCUE 1JTHA 2QJYB 1RE4C 3RK3E 1KB9E 1GU5A 2ZFCA 1HVVA 3HUSB 3V2PA 1K04A 3LIDA 4H44D 1SLQA 2P67A 3L74E 1BSNA 2ZJSE 2JP3A 3OW2O 1ZR4A 2ZVNB 2GA1A 1ZRTD 2HPCB 3ABVC 4PV1D 2E75D 1JO5A 1HJBA 1VPCA 1VQ7P 1DX7A 2WTYA 3QWOC 1JTHB 1QLED 3WUTA 5TISH 2QE7H 4L73A 2VRSA 4L74A 1JY3N 1L2PA 4H44C 2QVAA 1S5LE 4D6TJ 1BSHA 1KYOD 2Q5UA 4PV1C 2YKQA 2E5TA 4H13D 4GODA 2BCCJ 1J1DC 2R5BA 1GW4A 1ZOYC 2W83C 1SFCD 2E74D 2I8DA 4HH2A 1DEBA 2W90A 2ZT9B 2P1JA 2O01J 5AVRB 1OW7A 5CBNA 1T3UA 1BCCD 1E5WA 3RK2B 1DIPA 3EFFK 4Y99C 4IL6X 4Y28J 2QEXP 5AW2B 4I1LA 2FFDC 2WWWA 5CCGC 2K9JA 3MUDC 2E74C 5KLVE 5GTHE 2P2UA 5AW7B 2Y9YA 2R44A 3MD0A 1FDOA 1FZAA 3I56P 1EDIA 2QJPC 2D2CD 4N78D 1L0NG 3VMXA 2WSEH 3WU2H 2E5YA 4MN4C 3PLNA 1UIXA 4YXWH 1IK7A 2CK3H 4BRYA 1GL2D 1IZNB 3AEEC 3LW5H 5K5GB 1AFOA 2FYUG 1BCCJ 3A3YB 2K9JB 3RK3D 1KB9D 1LT1A 4LLHA 2QJKB 1QL2A 2JJLA 3CX5I 4TT3H 1NHLA 3L74D 3AEDC 1T2KD 1Q2NA 1G1IA 1GL2C 1L0NE 2FYNC 4KT0J 1MFZA 2C9LY 1RQVA 4U3FG 1CSBA 4BRYB 2OYIA 4CPGA 3L72G 4JPZB 3RK3C 1KILE 2IBZG 3G71P 3H1IG 3G6EP 1RF1C 2FYUE 1ZLLA 1SQVK 2JDIH 1EXJA 4IFDK 3KDPB 3KXDA 1VL2A 3L71G 2R3CA 2YIUC 3JSVC 5H2FE 1Z56A 1KYOI 3PRJA 3I55P 3H25A 2W8ZA 4K35A 1LTSC 1M1JC 4U3FE 2OYIB 3L72E 1SP4A 1FZGA 2IBZE 1PP9D 1R8EA 3VYIA 1RQUA 2YKPA 1H8AA 3R4YA 3LIEA 1YJNP 4UB8H 2A45H 2K1AA 1NTKE 3L71E 2JO1A 2GUVA 3M9BA 1SQPG 4JYBA 2Y0CA 2WSCJ 1KV4A 2KB7P 5L8RJ 3CWBG 4XE5B 3CXHI 2ZYDA 5KLVD 1N73C 2R3SA 5AVWB 3CMEP 3E1IA 3VMZA 3A0HE 3NTNA 3Q1MA 1W2EA 2M3EA 1FZCA 1HH0A 1OX3A 3TF5A 1KYOH 2N1TC 2CPSA 3D71A 3H1KJ 3H1LG 4OGQD 1YJWP 1SFCA 1NGMB 1OVVA 3EFGA 3KZIE 2E75B 2AEMA 3MTUE 1NWQA 2B87A 3S4RA 1VQ5P 2YKOA 1N2DC 3ITKA 1QVFO 4I7ZC 3TSIA 1L0ND 2RH0A 4OGQC 1FZCB 5DJTB 1GK6A 3IR9A 1HBWA 5AVUB 3D6YA 1FZFA 1KILD 4H13B 1SQXG 2FYUD 4H0LD 1VF5B 1LTIC 1SFCB 1N8RQ 1JUNA 1VQOP 1KN7A 1FOSE 5E79E 1AVOA 2JWAA 2WVRA 2YO3A 4JBZA 1MUUA 5GTIH 1IFPA 1JY3P 5B66E 5AVYB 2LKMA 1KQGB 1GL2A 1BE3J 3JCUH 1G2CA 1KILC 4WB4A 5AW3B 4WWIA 2FXMA 1KQLA 4U3FD 3A2AA 1KB9H 1PGOA 5CBOA 3L72D 3RL0g 3L73G 2IBZD 1A02F 3AEAC 3BVHA 2OYHC 2YMYA 3IN6A 1IFIA 1NTKD 2FYUJ 3L71D 3G9RA 4WY4D 3NMDA 2D2CB 1RE3C 2IFMA 3GG2A 4D6TE 3CPWO 4A7PA 1LTTC 3CX5E 2BCCE 1G2CB 2A06G 5KTBA 4PD4E 1JMMA 1ZW0A 1S5LH 4WY4C 1KFNA 2NZ2A 1Q82Q 3S1KA 3H1IJ 1N86A 1JY3O 2HYNA 3B4SA 3L71J 2ZXEB 3VN0A 4ZKPA 1N73A 3Q5RA 3C1LA 2A06E 4DZOA 5APYA 4NPEA 5KLIC 2PAJA 1L0LK 3GLMA 2IZ1A 1GTWA 5GTHH 1LTJC 1BGYJ 2L5GB 2RN0A 4C7NA 2W6BA 3CD6P 2PRRA 3M0DC 3AECC 1JNMA 4I2LC 2QM8A 3B5ND 1N73B 2J5UA 1L4AD 1SQPJ 1P84H 1NTZK 3CWBJ 3CXHE 1NTKK 1PFIA 5M1BA 4JF7A 3MP7B 2ZAEB 2G8YA 3KHUA 2KSEA 2HG5D 3FWNA 3V6IA 2W27A 2BEQD 4EDFA 4UB6E 1HUCA 3A5TA 1YTZT 2KOGA 3B5NC 1L4AC 3SWKA 1BDCA 4C7NB 1SQQK 1IO4A 3AE4C 1EC5A 2Q3EA 3H1LJ 1KQFB 3CMAP 4RKUJ 2HLOA 2QM7A 2MKVA 1LJ2A 2M5AA 1MKMA 2J58A 4D6TD 1NTMK 2Q6QA 3CX5D 2YMKA 2BCCD 2KP8A 2E76D 1RF0A 1FBMA 1OW6A 3Q5PA 1OW8A 2AXTE 4PD4D 2ZXXA 4B86A 1Q81Q 1OVRA 3SFEC 1LP1A 2O1KA 2O1JA 5H2FH 2OYHA 1FU1A 3H1KG 1S4XA 2Y0DA 1M1KQ 1VQ6P 1SQXJ 3U1CA 1RE3A 2E76C 1VQ4P 2V7QJ 1D7MA 1NAFA 4DT0A 1R5SA 4ZNCA 1XTGB 2A06D 2JEEA 3TGUJ 4H0LB 4YXDC 1YYCA 1LP1B 3NFQA 1YITP 5CCGD 1EDKA 4WY4A 1OXZA 2OQQA 1W2BO 3H1KE 3L73J 5KAFE 3HE4A 3HD7D 2B9BA 3AE2C 5AW4B 2QA4P 3A0HH 1YBKA 2OYOA 1JCDA 2XV5A 1VQ8P 1DD4A 2W6JH 1M56D 1KTMA 3IF4A 3CXHD 1BE3G 1TU3F 1EQ7A 4W7ZA 4NPFX 2CPBA 1DD3A 4ASWA 3CCJP 1FDIA 3HD7C 3KZIH 1OVUA 5KJ7A 3AE3C 1K9MQ 4RO0A 1N7SD 3PP5A 1OMIA 2P10A 3HE4B 1PGJA 1PGQA 2OGUA 2KLUA 1FDMA 3V5BA 1UIIA 3SFDC 3RL0B 3VMYA 3B71A 4R4LA 1DEEG 1SQBG 1SS1A 2KK7A 1N7SC 1YTZI 1EZVG 1QGKB 1BE3E 4EYYQ 2WSFJ 2C0XA 2R32A 1LGHB 2ZYAA 2H7HA 5KKZC 5AW0B 5E79H 4PD4I 1S9KE 4TLFA 3C9IA 1LTAC 1VDFA 1L4AA 4ZKUA 5B66H 4K3AA 3TK1A 1VQLP 1KFMA 1LT9C 2KZIA 4XFJA 2YXRB 2K37A 2RMZA 1JCCA 1RE4A 1FZEA 1SQBE 3HTKA 1H88A 2PGDA 2AEJA 3FXEA 1YIJP 2FBWC 4HKZH 5AVQB 2KNCA 3WUVA 5AVZB 3CL3D 3BRTB 3GMAA 2KXPB 4WBAA 3CX5H 1NO4A 1JB0J 3H1KD 1WMKA 5APTA 2SPZA 1BGYG 1NU1G 3H1IE 4PD4H 5B5EE 3SWFA 2NPSD 3AE6C 3HTKB 5CCHD 3AE5C 1IFJA 2O01H 3D70A 2WITA 2N1TD 1GZLA 1Y9BA 4KJMA 3M0AA 1X0TA 2KNCB 3JC22 1AA0A 1FJKA 2B88A 3P8MC 2QG4A 2GM4A 1PIXA 3CCEP 3N4XA 4HJGH 2NPSC 5CCHC 1BGYE 4ZMDA 1NU1E 3AEBC 3TYYA 4JQ0D 2V4HA 4H44B 2Y9ZA 5AVTB 1S5LX 1GDTA 4ASVA 2WT7A 2FFDA 1SQPE 5CCGA 2WSSH 1EDLA 3MUDA 3CWBE 4PV1B 3QH9A 1J1DB 4OVNF 3TDKA 1BE3D 4DOJA 3CI9A 4RJTA 3M9QA 1T6AA 3EWKA 1S9KD 1MV8A 1CZQA 3CXHH 1HJ0A 3H6PA 1GMJA 4WVZA 5CMZA 3SWYA 1OIPA 1KMIZ 1USDA 1WT6A 3WU2E 3P8CE 4Y99B 3H1LE 2MJZA 1AV1A 4EOTA 3II6A 1PL5A 1IFDA 2WT7B 2FFDB 1QX8A 2PFXA 1RHZB 1SQBD 1NYHA 2E74B 2N9BA 4UB6H 1KZUB 2ZVOB 2B87B 3MGNA 1NH4A 3CCUP 2G3AA 3TGUG 1HGZA 3FX0A 2QJPB 4QMAA 1YI2P 5DJUB 4M3LA 2FXOA 3L4FA 3HE5A 5KLVK 3HRNA 1FZBA 3AE9C 3CLQA 1IC2A 2ZT9D 1RF1A 3H1ID 1SQXE 2AXTH 1URQD 2KZJA 2OARA 1JOCA 2LR2A
chains in the Genus database with same CATH topology
2ZVOB 2ZVNB 3JSVC 4BWNA 2V4HA 3FX0A 4OWFA 3F89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVO B;  2ZVN B;  3JSV C;  4BWN A;  2V4H A;  3FX0 A;  4OWF A;  3F89 A; 
#chains in the Genus database with same CATH topology
 3B8E B;  1J2J B;  1G1J A;  3L36 A;  5KAI E;  1SQB J;  2WMM A;  3TGU E;  2WPQ A;  3P7K A;  1GL2 B;  2FYN B;  2XNX A;  3H1H J;  2WSC H;  2XZR A;  4Z1M H;  1M1J A;  2ZT9 C;  5AVS B;  5AW6 B;  3HE5 B;  2QRX A;  1URQ C;  3VTP C;  3RK3 B;  3RK2 C;  1RF1 B;  3L73 E;  1BGY D;  1NU1 D;  4IL6 E;  2IZ0 A;  3U59 A;  3BCC J;  1L0N K;  3USS A;  3D6Z A;  1SQP D;  2YIU B;  3H1J J;  2IYO A;  1LWU C;  1WRG A;  1XTC C;  1FOS F;  4OH8 B;  3CWB D;  4C46 A;  3PHL A;  5KAF H;  2FYU K;  1Q7Y Q;  1SQV G;  3FGA D;  1VQ9 P;  3EQ2 A;  1IK9 A;  2JKV A;  1M1J B;  3N7N A;  3GHG C;  3IFM A;  1VQP P;  1NTZ J;  5CCH A;  1OFC X;  2XKM A;  2N1T A;  4GDO A;  2ZYG A;  4O9B A;  1IFM A;  3P8C D;  3H1L D;  2M3B A;  2FYZ A;  3OJA B;  1NU1 J;  1GU4 A;  2IX7 C;  1FJP A;  3AE1 C;  1IJD B;  1SQQ J;  3Q3D A;  3NXS A;  1SQV E;  1EZV I;  1U7M A;  1AVY A;  1EDJ A;  3P32 A;  3VP8 A;  3KPE A;  4KHX A;  2N1T B;  1Q86 Q;  2AEF A;  2B89 A;  1KC8 Q;  1SQX D;  2WSE J;  1JY2 N;  1LTG C;  4IFF A;  1R5L A;  2Q9I A;  4U7J A;  2W6A A;  3LW5 J;  1JMB A;  1Y47 A;  3TGU D;  1YHQ P;  4I7Z B;  1SQP K;  2H89 C;  2OYI C;  1KIL A;  4OGQ B;  1VQK P;  4W7Y A;  2IPP A;  4PJ0 E;  1RH5 B;  3UIA A;  2H43 A;  3F89 A;  3A0B E;  5AW9 B;  4AUW A;  1FE6 A;  3L73 D;  4BWN A;  4BXL A;  1CW5 A;  1VQM P;  3BRV B;  2KS1 A;  2H88 C;  2M5A B;  1ZN5 A;  3VP9 A;  1JM0 A;  4LGD E;  3K5B A;  3RGU A;  1KIL B;  4R4M A;  5B5E H;  2FKW B;  3O6Q A;  4GOF A;  1PP9 G;  1URQ A;  1HWT C;  2JR8 A;  4IFM A;  1T8Z A;  1YJ9 P;  2OYH B;  2K3R A;  1LTB C;  3PH0 A;  5AVV B;  1HTL C;  2E75 C;  5KLV G;  1KOR A;  2KS1 B;  1LWU A;  1VF5 D;  2O3J A;  1SQX K;  3V2Q A;  1SQV D;  5AVX B;  5CJ0 A;  3OAK A;  4JYC A;  3O6Q B;  2I1J A;  4GOE A;  1FZC C;  3CCQ P;  1URQ B;  1PP9 E;  3GHG A;  2HOD A;  1NJI Q;  5APQ A;  2OTK E;  4WY4 B;  2HFE D;  4H13 C;  3M06 A;  3E1R A;  1VF5 C;  1LTJ A;  1EXI A;  3RBX A;  1HGV A;  1SFC C;  1USE A;  1S3J A;  1LWU B;  3M0D A;  2WQY C;  2DW3 A;  2KLV A;  1PV3 A;  3TNU A;  2M8R A;  3MZW B;  1JEK A;  1ZR2 A;  3GHG B;  2YXQ B;  1SQV J;  2NRG A;  5KLI B;  3WMM 0;  1X22 A;  2HOD B;  1T3J A;  1P84 E;  3H1H G;  2KUB A;  1J1E C;  1RY3 A;  2P58 A;  2Y0E A;  5BVZ A;  1LTJ B;  3VMA A;  3B5N A;  3WUU A;  5APX A;  2D2C C;  2Q3I A;  3BCC G;  1ZME C;  1L0L G;  4RES B;  2FXP A;  3GF3 A;  3H1J G;  4W80 A;  3TNU B;  3R2P A;  2XDJ A;  4HB1 A;  3V2N A;  2YO2 A;  2A45 I;  1CI6 A;  2WZ7 A;  1EZV E;  1SVF A;  1M90 Q;  1OZH A;  3H1H E;  1NAY A;  2XND H;  1K73 Q;  2V7Q H;  2KYV A;  1X9V A;  3U1A A;  1NTZ G;  1FC2 C;  3B5N B;  5KAI H;  1NTK G;  1L4A B;  1T2K C;  2XU6 A;  2OTL P;  3BCC E;  2YNY A;  4AQR D;  1L0L E;  3BAT A;  4L75 A;  3CC7 P;  2LXB A;  4N3Y B;  3VOP A;  2JWD A;  4YPC A;  2K88 A;  3H1J E;  2OTJ P;  5EFW B;  3L74 J;  1CI6 B;  1SQQ G;  1QEX A;  3T97 A;  4IL6 H;  1YQ3 C;  5TIS E;  3M9H A;  3C8V A;  5C39 A;  3PTZ A;  2WPS A;  3CCM P;  3IAO A;  3L75 G;  3G4S P;  1NTZ E;  3GF7 A;  4C7R A;  1NTM G;  5AW1 B;  2KIK A;  2RKL A;  1QVG O;  3F5H A;  3I5C A;  2PP6 A;  2E43 A;  3V2R A;  2E76 B;  4GKG A;  3AEF C;  2QSI A;  3FWL A;  3T97 B;  3CCS P;  3L70 G;  1SQQ E;  3CCV P;  1FS0 E;  4DJG A;  1Q90 D;  1BDD A;  1JY2 P;  1ZP0 C;  1M57 D;  1IFN A;  1P84 D;  3M91 A;  2J59 M;  2Q1K A;  3L75 E;  5BU8 B;  3HD7 A;  1W5C E;  1PP9 J;  1NTM E;  4HYT B;  2K9Y A;  4NPD A;  1GW3 A;  1PPJ G;  3FXD A;  2I1K A;  2IYP A;  2Z5I A;  1KB9 I;  1X8Y A;  2WSF H;  2QIW A;  1Y8A A;  2QJY C;  2FY8 A;  5KLV J;  2BEZ F;  2IDB A;  1VQN P;  3L70 E;  3V4W A;  1NKN A;  3HUS C;  1MZ9 A;  3CC2 P;  3E7K A;  1N7S A;  3V4Q A;  3Q5S A;  1EZV D;  3H1H D;  4AYC A;  5APU A;  3HD7 B;  3OA7 A;  2L91 A;  1M8O B;  2WPR A;  2C0W A;  5CHX A;  1PPJ E;  5AW5 B;  1S1C X;  1S72 P;  3GW6 A;  1HF9 A;  3H32 A;  1K05 A;  3BCC D;  1LT9 A;  1PGP A;  1L0L D;  1NKZ B;  4D6T G;  2H8P D;  1ZV8 A;  2AXC A;  4PJ0 H;  1JY2 O;  2BCC G;  1AQT A;  3H1J D;  2Q7C A;  1RF0 C;  3RK2 D;  3A0B H;  4LC1 A;  4YTP C;  4EI2 A;  3G3Z A;  1N7S B;  4H0L C;  1X79 B;  3Q2Y A;  1L0N J;  3PJS K;  1KQS O;  1J1E B;  2A45 G;  5AW8 B;  1AJY A;  3RBZ A;  5KKZ B;  2HR3 A;  2WPV B;  1YQ4 C;  1NTZ D;  3KYQ A;  4N6J A;  3L37 A;  3H32 B;  4GT1 A;  5CJ4 A;  1LT9 B;  2IFN A;  1DH3 A;  2M0B A;  2N9Y B;  5APV A;  1GK4 A;  4OWF A;  3O8Z A;  4EIJ A;  3MIW A;  2Z5H A;  1L0L J;  4GIF A;  1U57 A;  1SQQ D;  3RL0 D;  2P7J A;  5APS A;  5TJH A;  4UB8 E;  4U3F J;  1ZRT E;  4IOI H;  1QL1 A;  2O01 N;  3L72 J;  1S2E A;  1K8A Q;  3KQG A;  3L75 D;  1P84 I;  1SQB K;  2KSJ A;  1AQ5 A;  3A7O A;  1NTM D;  5KJ7 D;  3MHV A;  3CC4 P;  1BCC G;  2E42 A;  2NPS A;  1GD2 E;  1NTK J;  2LXC B;  3RL0 C;  2Z4E A;  2BAS A;  5APW A;  1KYO E;  1KD1 Q;  4XA4 A;  3L70 D;  2POH A;  1N7L A;  2GUS A;  2QJK C;  2KI7 B;  1OWA A;  3CCL P;  2C9N Y;  1MFT A;  3S9O A;  1H0T A;  1M7L A;  5KJ7 C;  3W68 A;  1H89 A;  1PZQ A;  1A02 J;  1PPJ D;  1BCC E;  2NPS B;  3L75 J;  2UWJ E;  1ZXG A;  1FAV A;  3SSU A;  1NTM J;  4L76 A;  3L35 A;  1E79 H;  3CCR P;  3AE8 C;  3W67 A;  3HUS A;  3L74 G;  1NU1 K;  1H0T B;  3L70 J;  1LNQ A;  5BU5 A;  4DCK A;  4N78 E;  1U7J A;  4I6M C;  1NOH A;  3ZDM A;  2R5D A;  2HPC A;  2IBZ I;  3AEG C;  5GTI E;  2ITA A;  1NVO A;  3AE7 C;  3BAS A;  3JCU E;  1JTH A;  2QJY B;  1RE4 C;  3RK3 E;  1KB9 E;  1GU5 A;  2ZFC A;  1HVV A;  3HUS B;  3V2P A;  1K04 A;  3LID A;  4H44 D;  1SLQ A;  2P67 A;  3L74 E;  1BSN A;  2ZJS E;  2JP3 A;  3OW2 O;  1ZR4 A;  2ZVN B;  2GA1 A;  1ZRT D;  2HPC B;  3ABV C;  4PV1 D;  2E75 D;  1JO5 A;  1HJB A;  1VPC A;  1VQ7 P;  1DX7 A;  2WTY A;  3QWO C;  1JTH B;  1QLE D;  3WUT A;  5TIS H;  2QE7 H;  4L73 A;  2VRS A;  4L74 A;  1JY3 N;  1L2P A;  4H44 C;  2QVA A;  1S5L E;  4D6T J;  1BSH A;  1KYO D;  2Q5U A;  4PV1 C;  2YKQ A;  2E5T A;  4H13 D;  4GOD A;  2BCC J;  1J1D C;  2R5B A;  1GW4 A;  1ZOY C;  2W83 C;  1SFC D;  2E74 D;  2I8D A;  4HH2 A;  1DEB A;  2W90 A;  2ZT9 B;  2P1J A;  2O01 J;  5AVR B;  1OW7 A;  5CBN A;  1T3U A;  1BCC D;  1E5W A;  3RK2 B;  1DIP A;  3EFF K;  4Y99 C;  4IL6 X;  4Y28 J;  2QEX P;  5AW2 B;  4I1L A;  2FFD C;  2WWW A;  5CCG C;  2K9J A;  3MUD C;  2E74 C;  5KLV E;  5GTH E;  2P2U A;  5AW7 B;  2Y9Y A;  2R44 A;  3MD0 A;  1FDO A;  1FZA A;  3I56 P;  1EDI A;  2QJP C;  2D2C D;  4N78 D;  1L0N G;  3VMX A;  2WSE H;  3WU2 H;  2E5Y A;  4MN4 C;  3PLN A;  1UIX A;  4YXW H;  1IK7 A;  2CK3 H;  4BRY A;  1GL2 D;  1IZN B;  3AEE C;  3LW5 H;  5K5G B;  1AFO A;  2FYU G;  1BCC J;  3A3Y B;  2K9J B;  3RK3 D;  1KB9 D;  1LT1 A;  4LLH A;  2QJK B;  1QL2 A;  2JJL A;  3CX5 I;  4TT3 H;  1NHL A;  3L74 D;  3AED C;  1T2K D;  1Q2N A;  1G1I A;  1GL2 C;  1L0N E;  2FYN C;  4KT0 J;  1MFZ A;  2C9L Y;  1RQV A;  4U3F G;  1CSB A;  4BRY B;  2OYI A;  4CPG A;  3L72 G;  4JPZ B;  3RK3 C;  1KIL E;  2IBZ G;  3G71 P;  3H1I G;  3G6E P;  1RF1 C;  2FYU E;  1ZLL A;  1SQV K;  2JDI H;  1EXJ A;  4IFD K;  3KDP B;  3KXD A;  1VL2 A;  3L71 G;  2R3C A;  2YIU C;  3JSV C;  5H2F E;  1Z56 A;  1KYO I;  3PRJ A;  3I55 P;  3H25 A;  2W8Z A;  4K35 A;  1LTS C;  1M1J C;  4U3F E;  2OYI B;  3L72 E;  1SP4 A;  1FZG A;  2IBZ E;  1PP9 D;  1R8E A;  3VYI A;  1RQU A;  2YKP A;  1H8A A;  3R4Y A;  3LIE A;  1YJN P;  4UB8 H;  2A45 H;  2K1A A;  1NTK E;  3L71 E;  2JO1 A;  2GUV A;  3M9B A;  1SQP G;  4JYB A;  2Y0C A;  2WSC J;  1KV4 A;  2KB7 P;  5L8R J;  3CWB G;  4XE5 B;  3CXH I;  2ZYD A;  5KLV D;  1N73 C;  2R3S A;  5AVW B;  3CME P;  3E1I A;  3VMZ A;  3A0H E;  3NTN A;  3Q1M A;  1W2E A;  2M3E A;  1FZC A;  1HH0 A;  1OX3 A;  3TF5 A;  1KYO H;  2N1T C;  2CPS A;  3D71 A;  3H1K J;  3H1L G;  4OGQ D;  1YJW P;  1SFC A;  1NGM B;  1OVV A;  3EFG A;  3KZI E;  2E75 B;  2AEM A;  3MTU E;  1NWQ A;  2B87 A;  3S4R A;  1VQ5 P;  2YKO A;  1N2D C;  3ITK A;  1QVF O;  4I7Z C;  3TSI A;  1L0N D;  2RH0 A;  4OGQ C;  1FZC B;  5DJT B;  1GK6 A;  3IR9 A;  1HBW A;  5AVU B;  3D6Y A;  1FZF A;  1KIL D;  4H13 B;  1SQX G;  2FYU D;  4H0L D;  1VF5 B;  1LTI C;  1SFC B;  1N8R Q;  1JUN A;  1VQO P;  1KN7 A;  1FOS E;  5E79 E;  1AVO A;  2JWA A;  2WVR A;  2YO3 A;  4JBZ A;  1MUU A;  5GTI H;  1IFP A;  1JY3 P;  5B66 E;  5AVY B;  2LKM A;  1KQG B;  1GL2 A;  1BE3 J;  3JCU H;  1G2C A;  1KIL C;  4WB4 A;  5AW3 B;  4WWI A;  2FXM A;  1KQL A;  4U3F D;  3A2A A;  1KB9 H;  1PGO A;  5CBO A;  3L72 D;  3RL0 g;  3L73 G;  2IBZ D;  1A02 F;  3AEA C;  3BVH A;  2OYH C;  2YMY A;  3IN6 A;  1IFI A;  1NTK D;  2FYU J;  3L71 D;  3G9R A;  4WY4 D;  3NMD A;  2D2C B;  1RE3 C;  2IFM A;  3GG2 A;  4D6T E;  3CPW O;  4A7P A;  1LTT C;  3CX5 E;  2BCC E;  1G2C B;  2A06 G;  5KTB A;  4PD4 E;  1JMM A;  1ZW0 A;  1S5L H;  4WY4 C;  1KFN A;  2NZ2 A;  1Q82 Q;  3S1K A;  3H1I J;  1N86 A;  1JY3 O;  2HYN A;  3B4S A;  3L71 J;  2ZXE B;  3VN0 A;  4ZKP A;  1N73 A;  3Q5R A;  3C1L A;  2A06 E;  4DZO A;  5APY A;  4NPE A;  5KLI C;  2PAJ A;  1L0L K;  3GLM A;  2IZ1 A;  1GTW A;  5GTH H;  1LTJ C;  1BGY J;  2L5G B;  2RN0 A;  4C7N A;  2W6B A;  3CD6 P;  2PRR A;  3M0D C;  3AEC C;  1JNM A;  4I2L C;  2QM8 A;  3B5N D;  1N73 B;  2J5U A;  1L4A D;  1SQP J;  1P84 H;  1NTZ K;  3CWB J;  3CXH E;  1NTK K;  1PFI A;  5M1B A;  4JF7 A;  3MP7 B;  2ZAE B;  2G8Y A;  3KHU A;  2KSE A;  2HG5 D;  3FWN A;  3V6I A;  2W27 A;  2BEQ D;  4EDF A;  4UB6 E;  1HUC A;  3A5T A;  1YTZ T;  2KOG A;  3B5N C;  1L4A C;  3SWK A;  1BDC A;  4C7N B;  1SQQ K;  1IO4 A;  3AE4 C;  1EC5 A;  2Q3E A;  3H1L J;  1KQF B;  3CMA P;  4RKU J;  2HLO A;  2QM7 A;  2MKV A;  1LJ2 A;  2M5A A;  1MKM A;  2J58 A;  4D6T D;  1NTM K;  2Q6Q A;  3CX5 D;  2YMK A;  2BCC D;  2KP8 A;  2E76 D;  1RF0 A;  1FBM A;  1OW6 A;  3Q5P A;  1OW8 A;  2AXT E;  4PD4 D;  2ZXX A;  4B86 A;  1Q81 Q;  1OVR A;  3SFE C;  1LP1 A;  2O1K A;  2O1J A;  5H2F H;  2OYH A;  1FU1 A;  3H1K G;  1S4X A;  2Y0D A;  1M1K Q;  1VQ6 P;  1SQX J;  3U1C A;  1RE3 A;  2E76 C;  1VQ4 P;  2V7Q J;  1D7M A;  1NAF A;  4DT0 A;  1R5S A;  4ZNC A;  1XTG B;  2A06 D;  2JEE A;  3TGU J;  4H0L B;  4YXD C;  1YYC A;  1LP1 B;  3NFQ A;  1YIT P;  5CCG D;  1EDK A;  4WY4 A;  1OXZ A;  2OQQ A;  1W2B O;  3H1K E;  3L73 J;  5KAF E;  3HE4 A;  3HD7 D;  2B9B A;  3AE2 C;  5AW4 B;  2QA4 P;  3A0H H;  1YBK A;  2OYO A;  1JCD A;  2XV5 A;  1VQ8 P;  1DD4 A;  2W6J H;  1M56 D;  1KTM A;  3IF4 A;  3CXH D;  1BE3 G;  1TU3 F;  1EQ7 A;  4W7Z A;  4NPF X;  2CPB A;  1DD3 A;  4ASW A;  3CCJ P;  1FDI A;  3HD7 C;  3KZI H;  1OVU A;  5KJ7 A;  3AE3 C;  1K9M Q;  4RO0 A;  1N7S D;  3PP5 A;  1OMI A;  2P10 A;  3HE4 B;  1PGJ A;  1PGQ A;  2OGU A;  2KLU A;  1FDM A;  3V5B A;  1UII A;  3SFD C;  3RL0 B;  3VMY A;  3B71 A;  4R4L A;  1DEE G;  1SQB G;  1SS1 A;  2KK7 A;  1N7S C;  1YTZ I;  1EZV G;  1QGK B;  1BE3 E;  4EYY Q;  2WSF J;  2C0X A;  2R32 A;  1LGH B;  2ZYA A;  2H7H A;  5KKZ C;  5AW0 B;  5E79 H;  4PD4 I;  1S9K E;  4TLF A;  3C9I A;  1LTA C;  1VDF A;  1L4A A;  4ZKU A;  5B66 H;  4K3A A;  3TK1 A;  1VQL P;  1KFM A;  1LT9 C;  2KZI A;  4XFJ A;  2YXR B;  2K37 A;  2RMZ A;  1JCC A;  1RE4 A;  1FZE A;  1SQB E;  3HTK A;  1H88 A;  2PGD A;  2AEJ A;  3FXE A;  1YIJ P;  2FBW C;  4HKZ H;  5AVQ B;  2KNC A;  3WUV A;  5AVZ B;  3CL3 D;  3BRT B;  3GMA A;  2KXP B;  4WBA A;  3CX5 H;  1NO4 A;  1JB0 J;  3H1K D;  1WMK A;  5APT A;  2SPZ A;  1BGY G;  1NU1 G;  3H1I E;  4PD4 H;  5B5E E;  3SWF A;  2NPS D;  3AE6 C;  3HTK B;  5CCH D;  3AE5 C;  1IFJ A;  2O01 H;  3D70 A;  2WIT A;  2N1T D;  1GZL A;  1Y9B A;  4KJM A;  3M0A A;  1X0T A;  2KNC B;  3JC2 2;  1AA0 A;  1FJK A;  2B88 A;  3P8M C;  2QG4 A;  2GM4 A;  1PIX A;  3CCE P;  3N4X A;  4HJG H;  2NPS C;  5CCH C;  1BGY E;  4ZMD A;  1NU1 E;  3AEB C;  3TYY A;  4JQ0 D;  2V4H A;  4H44 B;  2Y9Z A;  5AVT B;  1S5L X;  1GDT A;  4ASV A;  2WT7 A;  2FFD A;  1SQP E;  5CCG A;  2WSS H;  1EDL A;  3MUD A;  3CWB E;  4PV1 B;  3QH9 A;  1J1D B;  4OVN F;  3TDK A;  1BE3 D;  4DOJ A;  3CI9 A;  4RJT A;  3M9Q A;  1T6A A;  3EWK A;  1S9K D;  1MV8 A;  1CZQ A;  3CXH H;  1HJ0 A;  3H6P A;  1GMJ A;  4WVZ A;  5CMZ A;  3SWY A;  1OIP A;  1KMI Z;  1USD A;  1WT6 A;  3WU2 E;  3P8C E;  4Y99 B;  3H1L E;  2MJZ A;  1AV1 A;  4EOT A;  3II6 A;  1PL5 A;  1IFD A;  2WT7 B;  2FFD B;  1QX8 A;  2PFX A;  1RHZ B;  1SQB D;  1NYH A;  2E74 B;  2N9B A;  4UB6 H;  1KZU B;  2ZVO B;  2B87 B;  3MGN A;  1NH4 A;  3CCU P;  2G3A A;  3TGU G;  1HGZ A;  3FX0 A;  2QJP B;  4QMA A;  1YI2 P;  5DJU B;  4M3L A;  2FXO A;  3L4F A;  3HE5 A;  5KLV K;  3HRN A;  1FZB A;  3AE9 C;  3CLQ A;  1IC2 A;  2ZT9 D;  1RF1 A;  3H1I D;  1SQX E;  2AXT H;  1URQ D;  2KZJ A;  2OAR A;  1JOC A;  2LR2 A; 
#chains in the Genus database with same CATH homology
 2ZVO B;  2ZVN B;  3JSV C;  4BWN A;  2V4H A;  3FX0 A;  4OWF A;  3F89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...