4AUWA

Crystal structure of the bzip homodimeric mafb in complex with the c- mare binding site
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
87
structure length
87
Chain Sequence
SDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTION FACTOR MAFB
publication title Expression, purification, crystallization and preliminary crystallographic analysis of the mouse transcription factor MafB in complex with its DNA-recognition motif Cmare
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 37
structure length 87
sequence length 87
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03131 bZIP_Maf bZIP Maf transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4auwA00
2WWWA 3M0DA 2JJLA 1SLQA 2WTYA 2E43A 4B86A 1CI6A 3V4WA 4C7NA 1GK6A 3TNUB 3M91A 3MD0A 3HE5B 3VMZA 4LC1A 3P32A 2ZFCA 3NTNA 1CSBA 1HWTC 1CI6B 5APWA 4C7NB 5AW8B 2IPPA 2Q3IA 3VTPC 3VN0A 3M06A 1GU4A 3SWFA 3LIEA 4KHXA 5APVA 2YO2A 3A2AA 5AW0B 4XE5B 1T2KD 3L37A 4AUWA 5AVUB 1FAVA 1JUNA 2P67A 1HBWA 3MGNA 2XU6A 3P8MC 4AQRD 1HUCA 3OAKA 5APXA 5AVRB 5AW7B 2XV5A 3VMYA 1GD2E 1G2CB 4JYCA 3A7OA 2W6AA 1OWAA 2QM8A 2Q5UA 2YNYA 4DZOA 3B8EB 3NMDA 5AW1B 1H88A 2WPSA 2R3CA 5AW5B 4M3LA 1KQLA 1X8YA 3L35A 4GT1A 1H89A 2Q7CA 4JYBA 2Z5IA 3TK1A 1FOSF 1S9KD 2C9LY 5APQA 1GZLA 3L36A 3NFQA 3M9BA 5APYA 1CZQA 1A02J 5AVZB 2E42A 3TYYA 1GTWA 2WPRA 5APTA 3V5BA 2C9NY 2R32A 3VYIA 5CMZA 1GU5A 1A02F 2WT7A 1MUUA 4HYTB 5AVQB 1S9KE 1HJBA 3T97A 1IO4A 4C46A 2W27A 3IR9A 2VRSA 2WPQA 4EOTA 2WT7B 1SP4A 1NWQA 5AVXB 5AW2B 1JNMA 4I2LC 5AVSB 3A3YB 1FOSE 2P7JA 1NAFA 3VMXA 3V4QA 3M0AA 3A5TA 1J2JB 5AW4B 1H8AA 3HE4A 4RESB 3KDPB 2R5DA 1MV8A 5APUA 2ZXEB 2QM7A 5AVYB 4AYCA 3O8ZA 2YO3A 1T2KC 2N9BA 3HE4B 3P7KA 3I5CA 2H7HA 3HTKA 5AVVB 3M9HA 1MFZA 5AW9B 1YYCA 2KP8A 2R5BA 4GKGA 3NXSA 5AW6B 2P2UA 2BASA 3KQGA 2Z5HA 4I6MC 1DH3A 3UIAA 5AVWB 5APSA 1GK4A 5AW3B 5AVTB 3TNUA 2XZRA 3LIDA 3HE5A 1OXZA
chains in the Genus database with same CATH superfamily
1NGMB 1X79B 3TNUB 1KD1Q 2ZFCA 1JY2O 1SQXK 4UB8E 1N7SB 2IPPA 3G9RA 1SQVD 2O3JA 4YXDC 3M06A 3V2NA 1LWUA 1KB9H 3L70D 4XE5B 1NTZK 1NU1G 1YJWP 4GOEA 2P67A 1Q82Q 1LT1A 1K05A 1IFPA 1VQ7P 1OW6A 4JYCA 5KAFE 4BRYB 2ZVNB 1E79H 1RHZB 2Z5IA 1YQ3C 1LTJA 1IK9A 3CD6P 1LP1B 3V5BA 3MIWA 3VP9A 1IK7A 1A02F 2Y0CA 4W7ZA 4UB6E 3HUSB 1URQA 1R8EA 5B66H 1DD3A 3A5TA 5AW4B 4RESB 1AVYA 2QJPB 1MV8A 3EQ2A 2M5AA 4YTPC 3RL0C 1M1JA 3GHGA 2JO1A 4PV1C 2R3SA 3O8ZA 3L72G 2P1JA 1QVFO 3L71D 1JEKA 4R4LA 1URQD 2Z5HA 3FGAD 2WSFJ 1VQ9P 3C9IA 5APSA 1XTCC 1T3UA 1ZR4A 3TNUA 1HJ0A 4ZMDA 2WPVB 1P84D 4ASWA 1N7SA 4PV1B 5EFWB 3AE4C 3GLMA 1CSBA 2K37A 1SQQE 3P8CD 1Q2NA 3FX0A 2FXMA 4BRYA 3W67A 3RK2B 3CXHH 1N7SD 2HR3A 1PGOA 3GF3A 3AEDC 1PZQA 1LTBC 1H89A 1LP1A 3CCUP 2GUVA 2QRXA 5CCGC 1SQXG 3BVHA 1P84H 1Z56A 2I1KA 3II6A 4JF7A 1KQFB 1GU5A 5DJUB 1OZHA 1NTZG 3ABVC 3HUSA 4GIFA 2ZVOB 2KB7P 2KK7A 1SQQK 2KZJA 2W6BA 1JMBA 3T97B 2QJYB 3MZWB 2KS1B 2FYUJ 2IFMA 5KLVJ 1MFZA 5E79H 1NAYA 5AW6B 1DH3A 1OMIA 1VQOP 3H1JG 4D6TJ 1ZRTD 3V4WA 2Q3EA 2A06E 4KJMA 1WRGA 3MD0A 1M56D 2WSEJ 4QMAA 3CX5I 1RF1C 2E76C 3VN0A 3AE7C 4H44C 3H1LE 4KHXA 2OTJP 1FAVA 4Y99C 3MGNA 1KC8Q 1VQ6P 2M3EA 3S1KA 2Q5UA 5GTHH 1FDOA 1BGYG 2A45H 1M1KQ 5B5EH 1RY3A 3L35A 4GODA 2KIKA 1R5SA 1KYOI 1RF1B 3OW2O 3RK2D 1L0LD 5APTA 2C9NY 4Y99B 5KAIE 2WSFH 4H13C 3VYIA 1W2EA 2YKOA 1SQPG 3T97A 4ZKPA 5CCGA 2OTLP 1SQBJ 2OYHB 3A3YB 2G3AA 3VMXA 3L74D 2M8RA 2KS1A 1H8AA 1PL5A 1JOCA 1FZEA 4H13B 2M3BA 2J59M 2QE7H 5CCGD 1OVRA 1LNQA 4PJ0H 5C39A 1Q86Q 2FYUD 1BCCJ 5KLVD 1MFTA 3CWBJ 2Z4EA 3VP8A 1X9VA 1FZCC 4D6TD 5AW8B 3H1IJ 1RE3C 4N78D 3S4RA 3RBZA 4NPDA 2KUBA 3P8MC 1HUCA 2Y0DA 5AVRB 3VMYA 4EI2A 1K73Q 1RF1A 3F89A 3L73E 1VQKP 1FZCB 3L36A 1N73B 2CPSA 3M9BA 3N7NA 1NTMG 1A02J 5AVZB 1GTWA 2ZXXA 3KPEA 4U7JA 4ZKUA 1EXJA 2PFXA 3IN6A 2E75C 1NOHA 1VF5C 2OYHA 2YMYA 1HJBA 3AE8C 3CMEP 1LT9C 3CI9A 4L76A 3GF7A 1QVGO 2WPQA 1AQ5A 4HH2A 1NU1E 2RMZA 2NRGA 1VQ5P 2WSEH 3JSVC 1T6AA 1JY2N 2E75B 1GL2C 2A06G 1SQBD 1VF5B 5K5GB 3G3ZA 3TGUJ 4PD4I 3B5NB 1TU3F 4H13D 3B71A 2E43A 3A0BE 3H1LG 1PP9E 3M91A 2AXCA 1BDDA 2G8YA 3SFDC 1GL2B 1OVVA 4Z1MH 2NZ2A 2IBZG 1BCCD 1QL2A 1NU1K 1J1DC 3SWFA 1S5LH 3G4SP 3CWBD 2QJKC 3OAKA 1DD4A 3O6QB 1FZCA 3BRVB 2B87B 1N73A 3H1KG 3H1ID 1FJKA 1VQ8P 4U3FE 1RE3A 3AEAC 2LXBA 1YITP 1CZQA 2HG5D 2O01J 2QJKB 4EYYQ 4A7PA 4L73A 2ZJSE 1S5LX 4MN4C 4N6JA 3CX5D 1KMIZ 2N1TC 3SWYA 2W27A 2VRSA 3W68A 5TISH 2W8ZA 3R4YA 4I7ZB 5AW2B 1IFDA 1G1JA 2P7JA 1J1EB 1DEBA 1EZVI 3L73J 5BU8B 3D6YA 3B5NA 3V6IA 1USDA 1KYOD 3VMAA 5AW9B 3L75J 2N1TB 2JWAA 1KILE 2RN0A 3NXSA 3KQGA 1SQVG 3UIAA 1IC2A 4K3AA 3L70G 3D70A 2E75D 4EDFA 5H2FH 1VF5D 1GL2A 5GTIH 2L5GB 1AJYA 3TGUD 4B86A 3BCCJ 2YMKA 3B5ND 1HF9A 1YJNP 1NU1J 1KFMA 1RH5B 4ZNCA 4DT0A 5KJ7A 1K9MQ 2CK3H 3O6QA 2HYNA 2B87A 3CC4P 5AVUB 1GL2D 3I56P 5AW7B 1KYOH 3MUDC 2V4HA 3NMDA 3USSA 4BWNA 1DX7A 3H25A 1FE6A 3CLQA 3G71P 5KJ7D 5CBOA 3HRNA 1KQSO 3H1JE 1FZFA 2KSEA 1W5CE 2M0BA 1Y9BA 1R5LA 4DCKA 1YI2P 2WSSH 1OX3A 1EXIA 2P58A 2PAJA 3IR9A 4EOTA 1IFIA 3L72J 1Y47A 4GOFA 5CHXA 3EFGA 1EDJA 2K9YA 1NTKE 2N1TA 1BGYE 3M0DC 2RKLA 2R5BA 3KZIH 1PP9G 2I1JA 2P2UA 3L73D 5CBNA 2JDIH 2OYOA 4WWIA 1BE3D 1SQPE 2N1TD 3L75D 1KILC 1GK6A 2O01H 3HE5B 1YTZI 3V2PA 2PGDA 3GW6A 5CCHC 2L91A 3CC2P 1NKZB 2C0XA 1L0NE 4U3FG 3BCCD 1N7LA 4AQRD 1NTKK 2FXOA 5APXA 4PD4D 3PLNA 3D71A 3RL0B 1SQXJ 3WU2H 2UWJE 2W6AA 1YJ9P 1NTZJ 2WQYC 3AE1C 1ZV8A 5M1BA 1M90Q 1EDLA 1LTIC 1ZN5A 3V2QA 5APYA 3MUDA 2OTKE 1NYHA 3PH0A 2ZYGA 2WPRA 1YTZT 2W90A 1ZXGA 1SQPK 3H1HE 2AXTE 1IO4A 3OJAB 1GDTA 1M57D 4TLFA 2A45G 3AE5C 1S5LE 3CL3D 1L0NK 1PGJA 4PD4H 3U59A 2QM7A 2IX7C 5KKZC 3QWOC 2FFDC 1WT6A 3L72D 2H7HA 1NKNA 1T8ZA 1NTME 2K9JB 2WSCJ 3AE2C 1PPJG 2JWDA 3LW5J 4JQ0D 5L8RJ 5AVTB 1QLED 3HE5A 2FYZA 3M0DA 2IDBA 3EFFK 2Q6QA 2FFDB 2B88A 1W2BO 3P32A 2YIUC 2FKWB 1EZVD 2FYNC 2QG4A 2Q3IA 1L0LG 3C8VA 3IAOA 2XKMA 3E1IA 5CCHA 1YIJP 4H0LC 2AEMA 4M3LA 2HFED 2Q9IA 1NTMK 1UIXA 3L74G 2QA4P 1SQPJ 5H2FE 3RL0D 4OWFA 1SQXD 4PV1D 1VQPP 3I55P 1NTZD 5CCHD 1S9KE 2H43A 2IBZE 1IZNB 1NTKG 1JCCA 4GDOA 3G6EP 5BVZA 4WY4C 1OIPA 4HKZH 2E76B 4H44B 2R5DA 5KLVG 2ZXEB 3H1KE 2K9JA 4OVNF 2ZYAA 1SQQJ 3F5HA 4JBZA 2R44A 2ZYDA 4CPGA 2KP8A 3QH9A 2WZ7A 4I6MC 3RBXA 1KB9E 3WMM0 3LIDA 2FFDA 1HGZA 4KT0J 1GW3A 1E5WA 2O1JA 1OW8A 1L0NG 1JMMA 3CMAP 3BATA 4HB1A 3JCUH 3U1CA 3Q5SA 2K3RA 2SPZA 4IL6H 2O1KA 2W83C 2BEQD 3IF4A 1FZBA 2KNCB 1JY3P 2XV5A 4L74A 3CCMP 4W7YA 1SQVE 3RGUA 3MP7B 3S9OA 3CCSP 3L70E 1JY2P 2ZT9C 3AE6C 2J58A 3CCJP 5B66E 4UB8H 3H1HG 1QL1A 1GZLA 3KHUA 2FBWC 2WSCH 1NJIQ 3FWLA 1K04A 2Q1KA 3Q5RA 4IL6X 4OGQC 5AVQB 5KAFH 2ZT9B 2D2CC 3Q1MA 1IFMA 3HD7C 1T2KC 2WITA 1SQVK 2E76D 4UB6H 1YYCA 3H1LJ 4H44D 2OARA 2E74C 4HJGH 2D2CB 2K1AA 5AW3B 1L4AC 1NHLA 1SQQD 1RE4C 1EC5A 3CXHE 3HD7B 3L71E 2OYIC 1HWTC 2IFNA 1LT9B 1IJDB 2E74B 3VTPC 3CXHI 2KNCA 1KORA 3L4FA 1P84E 3A2AA 1L4AB 2AEFA 2GA1A 1GD2E 4RO0A 3P8CE 2HPCB 3CCRP 5AW1B 1AFOA 1M7LA 1X8YA 5KTBA 2WMMA 4IFMA 3TSIA 3E7KA 2R32A 2YXQB 5CJ4A 3BRTB 3CCLP 2JKVA 5E79E 2K88A 1H0TB 1HGVA 1FOSE 1WMKA 3FWNA 3M0AA 1J2JB 1J1DB 1SQVJ 3TGUG 3H6PA 3L70J 4IFFA 2ZT9D 1KTMA 2N9BA 1QX8A 2A06D 2BCCG 1ZLLA 1S4XA 4W80A 3HD7A 2KXPB 2LR2A 3AEEC 2XNDH 1OXZA 2OGUA 1LT9A 3ZDMA 3H1LD 3B4SA 5GTHE 3SFEC 1EQ7A 3A0HH 3VMZA 1T3JA 2D2CD 4LC1A 5B5EE 1L4AA 1ZRTE 1MZ9A 3HD7D 1VL2A 2FY8A 1OW7A 2HPCA 1URQC 4JPZB 1T2KD 1YQ4C 2A45I 1K8AQ 2B89A 1EDKA 3CX5H 2W6JH 1PPJE 2E74D 4R4MA 2R3CA 1L4AD 2IZ0A 4NPEA 4BXLA 3PP5A 5APQA 1AA0A 3NFQA 1L2PA 3PJSK 2RH0A 2JP3A 1H0TA 1AQTA 1VPCA 4C46A 2QEXP 3WUVA 1IFJA 1L0LE 4PJ0E 1CW5A 2Y9YA 1NAFA 2H89C 4YPCA 1LTGC 1PP9J 2H8PD 1AVOA 4WB4A 1JY3O 1BE3G 3L75G 5KAIH 4AYCA 1D7MA 4DJGA 2XDJA 1OVUA 1FU1A 3JC22 3P7KA 3L74E 3M9HA 5TJHA 3L71G 3IFMA 2YKQA 3BCCG 3HTKB 3CC7P 3KXDA 2XZRA 5DJTB 1RQUA 1IFNA 2JJLA 4U3FJ 3E1RA 1JB0J 1PGPA 3HUSC 4N3YB 1CI6B 1EDIA 5APWA 4IOIH 1L0LK 2FYUE 4XA4A 2KLVA 5KLVE 2P10A 5APVA 2QJPC 1JUNA 2WVRA 3PTZA 1HBWA 2QSIA 1S3JA 4D6TE 1OWAA 2J5UA 3Q5PA 4C7RA 4N78E 2DW3A 2N9YB 1LTAC 2XNXA 4IFDK 1QEXA 2E42A 2KI7B 1NU1D 1RF0C 2QVAA 2Y0EA 3EWKA 1KILB 3CXHD 3AECC 2WT7B 3GMAA 5AVSB 1ZOYC 2FYUK 1YBKA 5KLVK 3AE3C 3RK2C 5AVYB 1LJ2A 3HE4B 3HTKA 5AVVB 4K35A 1AV1A 1EZVG 1BDCA 4WBAA 1PP9D 2BASA 3AEFC 1SQBE 1PGQA 1SLQA 1G1IA 1CI6A 1L0LJ 2OQQA 3H1JJ 1BSHA 1Q7YQ 1ZMEC 4C7NB 4YXWH 2JR8A 3AE9C 2QJYC 3AEBC 4U3FD 3BASA 3L37A 4AUWA 4XFJA 3L74J 1QGKB 3PHLA 2XU6A 2IZ1A 3R2PA 2Y9ZA 3A0BH 5KKZB 2ITAA 1FC2C 1BCCE 3K5BA 5TISE 4NPFX 4GT1A 3CWBE 1X22A 3TK1A 1PFIA 2C9LY 1Q81Q 1NTKJ 1BGYJ 1KILA 1ZW0A 1SQBK 3H1IE 2GUSA 2WT7A 3A0HE 1MUUA 1PV3A 1JO5A 1U7JA 3OA7A 2YIUB 1NWQA 2NPSC 2FYNB 1RF0A 2HODB 4TT3H 3RK3E 1ZR2A 1KILD 3HE4A 2O01N 5GTIE 3CX5E 2AEJA 2KLUA 1HTLC 3I5CA 1VDFA 4H0LB 1L0NJ 1HH0A 1PPJD 2NPSB 2E5TA 3Q3DA 3D6ZA 2FYUG 2IBZI 1KYOE 4C7NA 1SS1A 1UIIA 1JCDA 5KLIC 3H32B 1KZUB 2V7QJ 2IYOA 2OYHC 4D6TG 3V2RA 1OFCX 1DIPA 1M8OB 1JM0A 3TGUE 4WY4B 3FXEA 3FXDA 2CPBA 3H1JD 1ZP0C 3H1HJ 1DEEG 2BCCE 1U7MA 1NO4A 3A7OA 1H88A 2WPSA 1KB9I 5KLIB 1PIXA 2E5YA 3U1AA 1JTHB 3ITKA 1FOSF 1FZGA 1KN7A 1LTSC 2LKMA 4Y28J 3C1LA 4I1LA 1NTMJ 4HYTB 1FZAA 1HVVA 2YXRB 1LTTC 2HODA 1NTKD 4LLHA 3Q2YA 1BGYD 3KZIE 1JNMA 1LGHB 1SQQG 1S2EA 5BU5A 3KYQA 5APUA 3LW5H 3SWKA 2I8DA 3PRJA 2NPSA 1SQBG 3RK3C 1SQPD 2JEEA 1N73C 1NH4A 2POHA 2YKPA 1BSNA 1MKMA 3H32A 4H0LD 1L0ND 3WU2E 1FS0E 1USEA 1Q90D 2GM4A 2LXCB 2NPSD 4OGQB 4WY4A 3RK3B 1N2DC 3AEGC 3CCVP 1BCCG 1BE3E 1GU4A 4RKUJ 3L75E 3CWBG 1VQ4P 1JTHA 1G2CB 5CJ0A 2KSJA 1S72P 2QM8A 2YNYA 4DZOA 3B8EB 3H1IG 4WY4D 3BCCE 3B5NC 1GW4A 3TDKA 1JY3N 3H1HD 4WVZA 4PD4E 3H1KJ 3TYYA 2PP6A 1SFCC 5CMZA 4O9BA 2KZIA 3TF5A 2PRRA 2OYIB 1P84I 2KOGA 3M9QA 1SP4A 4I2LC 2BCCJ 5KJ7C 3MTUE 1NTMD 3WUTA 2V7QH 4OH8B 1KQGB 1SFCB 2YO3A 1S1CX 3GG2A 2QIWA 2AXTH 4GKGA 4EIJA 3VOPA 1GK4A 3CCQP 3L72E 2WWWA 3CCEP 2WTYA 2C0WA 1LWUC 1VQMP 2MJZA 4RJTA 1N86A 3NTNA 4I7ZC 1SVFA 2IYPA 2MKVA 2B9BA 3CPWO 3RL0g 1J1EC 1G2CA 3LIEA 2YO2A 5AW0B 1LTJC 2KYVA 4OGQD 3RK3D 1X0TA 1LWUB 1EZVE 2HLOA 5AW5B 3N4XA 1KQLA 2Q7CA 4JYBA 4DOJA 2FXPA 1S9KD 2IBZD 1RE4A 4LGDE 1NVOA 2OYIA 1FDMA 1VQLP 1LTJB 3MHVA 2ZAEB 4L75A 1RQVA 2H88C 1BE3J 1FJPA 1M1JC 3WUUA 3H1KD 3GHGC 1SQXE 5AVXB 1FBMA 1SFCA 1N8RQ 1VQNP 3V4QA 2BEZF 1NTZE 3L71J 3SSUA 1FDIA 3KDPB 1GMJA 1URQB 1KB9D 1KV4A 1KFNA 1U57A 2BCCD 3JCUE 4ASVA 1XTGB 2M5AB 1M1JB 3GHGB 1YHQP 1N7SC 1Y8AA 3L73G 1SFCD 5AVWB 4IL6E
chains in the Genus database with same CATH topology
1GW3A 1E5WA 2O1JA 1SLQA 1X79B 1G1IA 2E43A 1CI6A 1JMMA 3TNUB 3M91A 3BATA 1GL2B 2ZFCA 1JY2O 1SQXK 4C7NB 1N7SB 2IPPA 3U1CA 1QL2A 1NU1K 1J1DC 3M06A 3V2NA 1LWUA 3SWFA 4XE5B 1NTZK 3BASA 2O1KA 3L37A 4AUWA 2P67A 2XU6A 3OAKA 1FZBA 3R2PA 2XV5A 1JY3P 4JYCA 1FZCA 3BRVB 1N73A 4W7YA 1FJKA 1RE3A 1JY2P 4GT1A 2J58A 2Z5IA 3TK1A 1LTJA 1PFIA 2C9LY 1QL1A 1GZLA 1IK9A 1CZQA 1KILA 2HG5D 2WSCH 3V5BA 3MIWA 3VP9A 1SQBK 1A02F 2GUSA 4W7ZA 2WT7A 1MUUA 5AVQB 4N6JA 2N1TC 1JO5A 3SWYA 2W27A 2VRSA 3HUSB 3OA7A 1URQA 1NWQA 5AW2B 1IFDA 2NPSC 1G1JA 2P7JA 1RF0A 2HODB 3A5TA 5AW4B 1J1EB 1DEBA 1ZR2A 1KILD 3HE4A 4RESB 1MV8A 3EQ2A 3RL0C 1IFMA 1M1JA 3HD7C 3GHGA 5BU8B 3B5NA 3O8ZA 1T2KC 2WITA 1HTLC 3I5CA 2P1JA 1VDFA 1SQVK 5AW9B 2N1TB 1YYCA 1HH0A 3NXSA 2OARA 1URQD 3KQGA 2Z5HA 3UIAA 3C9IA 2NPSB 1IC2A 5APSA 1XTCC 1T3UA 5AW3B 1ZR4A 1L4AC 1NHLA 3TNUA 1RE4C 1GL2A 2L5GB 4B86A 4C7NA 3HD7B 3B5ND 1N7SA 2OYIC 1KFMA 1JCDA 3H32B 1CSBA 1KZUB 5KJ7A 2IFNA 1HWTC 1LT9B 2OYHC 3P8CD 3V2RA 1IJDB 3VTPC 4WY4B 3L4FA 3A2AA 1L4AB 2HYNA 2FXMA 5AVUB 2CPBA 1GL2D 5AW7B 1GD2E 3RK2B 1NO4A 1N7SD 3A7OA 3P8CE 2HPCB 3NMDA 5AW1B 1AFOA 1H88A 1DX7A 2WPSA 3CLQA 1LTBC 1M7LA 5KJ7D 1X8YA 1H89A 3HRNA 3U1AA 1JTHB 5KTBA 1FOSF 1FZFA 2GUVA 4IFMA 1FZGA 3TSIA 5CCGC 3BVHA 1LTSC 2LKMA 1Z56A 2R32A 2I1KA 3II6A 4JF7A 1GU5A 5CJ4A 4I1LA 3HUSA 3BRTB 4GIFA 4HYTB 1FZAA 1HVVA 1LTTC 2HODA 4LLHA 2KB7P 2PAJA 3IR9A 1HGVA 4EOTA 1IFIA 1SQQK 1JNMA 1LGHB 2W6BA 1FOSE 5CHXA 3EFGA 3M0AA 1J2JB 1J1DB 5BU5A 3KYQA 5APUA 2N1TA 3LW5H 3H6PA 4IFFA 2N9BA 2NPSA 2IFMA 3M0DC 1MFZA 3RK3C 2JEEA 2R5BA 5AW6B 2I1JA 1NH4A 1ZLLA 2P2UA 1N73C 1DH3A 4W80A 3HD7A 2POHA 2YKPA 3V4WA 1OXZA 3H32A 2N1TD 1LT9A 1KILC 1WRGA 1GK6A 2GM4A 3MD0A 1EQ7A 2NPSD 2O01H 1T3JA 3HE5B 3VMZA 4LC1A 4WY4A 1YTZI 3V2PA 1L4AA 3RK3B 1N2DC 5CCHC 1MZ9A 1RF1C 1NKZB 3VN0A 2C0XA 1GU4A 3HD7D 4KHXA 2HPCA 1URQC 1T2KD 2A45I 1FAVA 1N7LA 4Y99C 3MGNA 4AQRD 1NTKK 5APXA 1JTHA 3RL0B 1G2CB 5CJ0A 2KSJA 2W6AA 2QM8A 2Q5UA 2YNYA 4DZOA 3B8EB 2A45H 2R3CA 4WY4D 1RY3A 3B5NC 1L4AD 1GW4A 3L35A 1ZV8A 1LTIC 1JY3N 3PP5A 1ZN5A 5APQA 1RF1B 3V2QA 3NFQA 5APYA 3MUDA 3RK2D 3TYYA 2WPRA 1YTZT 5APTA 2C9NY 2PP6A 1SFCC 4Y99B 2WSFH 3VYIA 5CMZA 1W2EA 4O9BA 1SQPK 2YKOA 1VPCA 3T97A 2OYIB 1IO4A 4C46A 4ZKPA 5CCGA 3OJAB 1GDTA 2KOGA 1IFJA 3M9QA 1SP4A 2A45G 4I2LC 1CW5A 2OYHB 3A3YB 3CL3D 1NAFA 2M8RA 3VMXA 5KJ7C 3MTUE 1LTGC 1L0NK 1H8AA 2H8PD 4OH8B 4WB4A 1JY3O 1JOCA 3U59A 2QM7A 1SFCB 2IX7C 1FZEA 2M3BA 4AYCA 2FFDC 1WT6A 2YO3A 2XDJA 2J59M 1FU1A 3P7KA 1NKNA 2H7HA 3M9HA 5CCGD 1T8ZA 3IFMA 4GKGA 4EIJA 2YKQA 3VOPA 1GK4A 3HTKB 5AVTB 2XZRA 3HE5A 2FYZA 2WWWA 3M0DA 1IFNA 2JJLA 2WTYA 2C0WA 1LWUC 2MJZA 2FFDB 2Z4EA 3P32A 1N86A 3NTNA 3VP8A 3HUSC 1SVFA 1X9VA 4N3YB 1CI6B 2FKWB 1FZCC 5APWA 5AW8B 1L0LK 2Q3IA 4XA4A 2KLVA 1J1EC 1G2CA 1RE3C 4N78D 3LIEA 5APVA 2YO2A 5AW0B 1JUNA 1LTJC 2KYVA 1HBWA 3P8MC 1HUCA 3RK3D 5AVRB 2XKMA 3VMYA 1LWUB 3E1IA 5CCHA 1OWAA 2HLOA 1RF1A 5AW5B 4C7RA 4M3LA 3N4XA 4N78E 1KQLA 2HFED 2Q9IA 2Q7CA 4JYBA 4DOJA 1NTMK 1FZCB 1S9KD 1RE4A 1LTAC 3L36A 2CPSA 2XNXA 1N73B 4IFDK 3M9BA 3N7NA 4LGDE 3RL0D 1A02J 5AVZB 2E42A 1GTWA 3KPEA 2OYIA 1FDMA 4ZKUA 1RF0C 1LTJB 1NOHA 5CCHD 2OYHA 1KILB 2YMYA 1S9KE 2H43A 1HJBA 1FJPA 1LT9C 1M1JC 1JCCA 3GHGC 3CI9A 1AQ5A 2WPQA 2WT7B 4HH2A 5AVXB 5BVZA 5AVSB 1FBMA 1SFCA 4WY4C 2FYUK 3V4QA 5KLVK 2WSEH 3KDPB 2R5DA 1URQB 2ZXEB 3RK2C 5AVYB 1JY2N 1KFNA 3HE4B 1GL2C 3HTKA 3G3ZA 5AVVB 1XTGB 1M1JB 2KP8A 3GHGB 1N7SC 4WBAA 3B5NB 2BASA 2WZ7A 4I6MC 1SFCD 5AVWB 3WMM0 3LIDA 2FFDA 1HGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WWW A;  3M0D A;  2JJL A;  1SLQ A;  2WTY A;  2E43 A;  4B86 A;  1CI6 A;  3V4W A;  4C7N A;  1GK6 A;  3TNU B;  3M91 A;  3MD0 A;  3HE5 B;  3VMZ A;  4LC1 A;  3P32 A;  2ZFC A;  3NTN A;  1CSB A;  1HWT C;  1CI6 B;  5APW A;  4C7N B;  5AW8 B;  2IPP A;  2Q3I A;  3VTP C;  3VN0 A;  3M06 A;  1GU4 A;  3SWF A;  3LIE A;  4KHX A;  5APV A;  2YO2 A;  3A2A A;  5AW0 B;  4XE5 B;  1T2K D;  3L37 A;  4AUW A;  5AVU B;  1FAV A;  1JUN A;  2P67 A;  1HBW A;  3MGN A;  2XU6 A;  3P8M C;  4AQR D;  1HUC A;  3OAK A;  5APX A;  5AVR B;  5AW7 B;  2XV5 A;  3VMY A;  1GD2 E;  1G2C B;  4JYC A;  3A7O A;  2W6A A;  1OWA A;  2QM8 A;  2Q5U A;  2YNY A;  4DZO A;  3B8E B;  3NMD A;  5AW1 B;  1H88 A;  2WPS A;  2R3C A;  5AW5 B;  4M3L A;  1KQL A;  1X8Y A;  3L35 A;  4GT1 A;  1H89 A;  2Q7C A;  4JYB A;  2Z5I A;  3TK1 A;  1FOS F;  1S9K D;  2C9L Y;  5APQ A;  1GZL A;  3L36 A;  3NFQ A;  3M9B A;  5APY A;  1CZQ A;  1A02 J;  5AVZ B;  2E42 A;  3TYY A;  1GTW A;  2WPR A;  5APT A;  3V5B A;  2C9N Y;  2R32 A;  3VYI A;  5CMZ A;  1GU5 A;  1A02 F;  2WT7 A;  1MUU A;  4HYT B;  5AVQ B;  1S9K E;  1HJB A;  3T97 A;  1IO4 A;  4C46 A;  2W27 A;  3IR9 A;  2VRS A;  2WPQ A;  4EOT A;  2WT7 B;  1SP4 A;  1NWQ A;  5AVX B;  5AW2 B;  1JNM A;  4I2L C;  5AVS B;  3A3Y B;  1FOS E;  2P7J A;  1NAF A;  3VMX A;  3V4Q A;  3M0A A;  3A5T A;  1J2J B;  5AW4 B;  1H8A A;  3HE4 A;  4RES B;  3KDP B;  2R5D A;  1MV8 A;  5APU A;  2ZXE B;  2QM7 A;  5AVY B;  4AYC A;  3O8Z A;  2YO3 A;  1T2K C;  2N9B A;  3HE4 B;  3P7K A;  3I5C A;  2H7H A;  3HTK A;  5AVV B;  3M9H A;  1MFZ A;  5AW9 B;  1YYC A;  2KP8 A;  2R5B A;  4GKG A;  3NXS A;  5AW6 B;  2P2U A;  2BAS A;  3KQG A;  2Z5H A;  4I6M C;  1DH3 A;  3UIA A;  5AVW B;  5APS A;  1GK4 A;  5AW3 B;  5AVT B;  3TNU A;  2XZR A;  3LID A;  3HE5 A;  1OXZ A; 
#chains in the Genus database with same CATH topology
 1NGM B;  1X79 B;  3TNU B;  1KD1 Q;  2ZFC A;  1JY2 O;  1SQX K;  4UB8 E;  1N7S B;  2IPP A;  3G9R A;  1SQV D;  2O3J A;  4YXD C;  3M06 A;  3V2N A;  1LWU A;  1KB9 H;  3L70 D;  4XE5 B;  1NTZ K;  1NU1 G;  1YJW P;  4GOE A;  2P67 A;  1Q82 Q;  1LT1 A;  1K05 A;  1IFP A;  1VQ7 P;  1OW6 A;  4JYC A;  5KAF E;  4BRY B;  2ZVN B;  1E79 H;  1RHZ B;  2Z5I A;  1YQ3 C;  1LTJ A;  1IK9 A;  3CD6 P;  1LP1 B;  3V5B A;  3MIW A;  3VP9 A;  1IK7 A;  1A02 F;  2Y0C A;  4W7Z A;  4UB6 E;  3HUS B;  1URQ A;  1R8E A;  5B66 H;  1DD3 A;  3A5T A;  5AW4 B;  4RES B;  1AVY A;  2QJP B;  1MV8 A;  3EQ2 A;  2M5A A;  4YTP C;  3RL0 C;  1M1J A;  3GHG A;  2JO1 A;  4PV1 C;  2R3S A;  3O8Z A;  3L72 G;  2P1J A;  1QVF O;  3L71 D;  1JEK A;  4R4L A;  1URQ D;  2Z5H A;  3FGA D;  2WSF J;  1VQ9 P;  3C9I A;  5APS A;  1XTC C;  1T3U A;  1ZR4 A;  3TNU A;  1HJ0 A;  4ZMD A;  2WPV B;  1P84 D;  4ASW A;  1N7S A;  4PV1 B;  5EFW B;  3AE4 C;  3GLM A;  1CSB A;  2K37 A;  1SQQ E;  3P8C D;  1Q2N A;  3FX0 A;  2FXM A;  4BRY A;  3W67 A;  3RK2 B;  3CXH H;  1N7S D;  2HR3 A;  1PGO A;  3GF3 A;  3AED C;  1PZQ A;  1LTB C;  1H89 A;  1LP1 A;  3CCU P;  2GUV A;  2QRX A;  5CCG C;  1SQX G;  3BVH A;  1P84 H;  1Z56 A;  2I1K A;  3II6 A;  4JF7 A;  1KQF B;  1GU5 A;  5DJU B;  1OZH A;  1NTZ G;  3ABV C;  3HUS A;  4GIF A;  2ZVO B;  2KB7 P;  2KK7 A;  1SQQ K;  2KZJ A;  2W6B A;  1JMB A;  3T97 B;  2QJY B;  3MZW B;  2KS1 B;  2FYU J;  2IFM A;  5KLV J;  1MFZ A;  5E79 H;  1NAY A;  5AW6 B;  1DH3 A;  1OMI A;  1VQO P;  3H1J G;  4D6T J;  1ZRT D;  3V4W A;  2Q3E A;  2A06 E;  4KJM A;  1WRG A;  3MD0 A;  1M56 D;  2WSE J;  4QMA A;  3CX5 I;  1RF1 C;  2E76 C;  3VN0 A;  3AE7 C;  4H44 C;  3H1L E;  4KHX A;  2OTJ P;  1FAV A;  4Y99 C;  3MGN A;  1KC8 Q;  1VQ6 P;  2M3E A;  3S1K A;  2Q5U A;  5GTH H;  1FDO A;  1BGY G;  2A45 H;  1M1K Q;  5B5E H;  1RY3 A;  3L35 A;  4GOD A;  2KIK A;  1R5S A;  1KYO I;  1RF1 B;  3OW2 O;  3RK2 D;  1L0L D;  5APT A;  2C9N Y;  4Y99 B;  5KAI E;  2WSF H;  4H13 C;  3VYI A;  1W2E A;  2YKO A;  1SQP G;  3T97 A;  4ZKP A;  5CCG A;  2OTL P;  1SQB J;  2OYH B;  3A3Y B;  2G3A A;  3VMX A;  3L74 D;  2M8R A;  2KS1 A;  1H8A A;  1PL5 A;  1JOC A;  1FZE A;  4H13 B;  2M3B A;  2J59 M;  2QE7 H;  5CCG D;  1OVR A;  1LNQ A;  4PJ0 H;  5C39 A;  1Q86 Q;  2FYU D;  1BCC J;  5KLV D;  1MFT A;  3CWB J;  2Z4E A;  3VP8 A;  1X9V A;  1FZC C;  4D6T D;  5AW8 B;  3H1I J;  1RE3 C;  4N78 D;  3S4R A;  3RBZ A;  4NPD A;  2KUB A;  3P8M C;  1HUC A;  2Y0D A;  5AVR B;  3VMY A;  4EI2 A;  1K73 Q;  1RF1 A;  3F89 A;  3L73 E;  1VQK P;  1FZC B;  3L36 A;  1N73 B;  2CPS A;  3M9B A;  3N7N A;  1NTM G;  1A02 J;  5AVZ B;  1GTW A;  2ZXX A;  3KPE A;  4U7J A;  4ZKU A;  1EXJ A;  2PFX A;  3IN6 A;  2E75 C;  1NOH A;  1VF5 C;  2OYH A;  2YMY A;  1HJB A;  3AE8 C;  3CME P;  1LT9 C;  3CI9 A;  4L76 A;  3GF7 A;  1QVG O;  2WPQ A;  1AQ5 A;  4HH2 A;  1NU1 E;  2RMZ A;  2NRG A;  1VQ5 P;  2WSE H;  3JSV C;  1T6A A;  1JY2 N;  2E75 B;  1GL2 C;  2A06 G;  1SQB D;  1VF5 B;  5K5G B;  3G3Z A;  3TGU J;  4PD4 I;  3B5N B;  1TU3 F;  4H13 D;  3B71 A;  2E43 A;  3A0B E;  3H1L G;  1PP9 E;  3M91 A;  2AXC A;  1BDD A;  2G8Y A;  3SFD C;  1GL2 B;  1OVV A;  4Z1M H;  2NZ2 A;  2IBZ G;  1BCC D;  1QL2 A;  1NU1 K;  1J1D C;  3SWF A;  1S5L H;  3G4S P;  3CWB D;  2QJK C;  3OAK A;  1DD4 A;  3O6Q B;  1FZC A;  3BRV B;  2B87 B;  1N73 A;  3H1K G;  3H1I D;  1FJK A;  1VQ8 P;  4U3F E;  1RE3 A;  3AEA C;  2LXB A;  1YIT P;  1CZQ A;  2HG5 D;  2O01 J;  2QJK B;  4EYY Q;  4A7P A;  4L73 A;  2ZJS E;  1S5L X;  4MN4 C;  4N6J A;  3CX5 D;  1KMI Z;  2N1T C;  3SWY A;  2W27 A;  2VRS A;  3W68 A;  5TIS H;  2W8Z A;  3R4Y A;  4I7Z B;  5AW2 B;  1IFD A;  1G1J A;  2P7J A;  1J1E B;  1DEB A;  1EZV I;  3L73 J;  5BU8 B;  3D6Y A;  3B5N A;  3V6I A;  1USD A;  1KYO D;  3VMA A;  5AW9 B;  3L75 J;  2N1T B;  2JWA A;  1KIL E;  2RN0 A;  3NXS A;  3KQG A;  1SQV G;  3UIA A;  1IC2 A;  4K3A A;  3L70 G;  3D70 A;  2E75 D;  4EDF A;  5H2F H;  1VF5 D;  1GL2 A;  5GTI H;  2L5G B;  1AJY A;  3TGU D;  4B86 A;  3BCC J;  2YMK A;  3B5N D;  1HF9 A;  1YJN P;  1NU1 J;  1KFM A;  1RH5 B;  4ZNC A;  4DT0 A;  5KJ7 A;  1K9M Q;  2CK3 H;  3O6Q A;  2HYN A;  2B87 A;  3CC4 P;  5AVU B;  1GL2 D;  3I56 P;  5AW7 B;  1KYO H;  3MUD C;  2V4H A;  3NMD A;  3USS A;  4BWN A;  1DX7 A;  3H25 A;  1FE6 A;  3CLQ A;  3G71 P;  5KJ7 D;  5CBO A;  3HRN A;  1KQS O;  3H1J E;  1FZF A;  2KSE A;  1W5C E;  2M0B A;  1Y9B A;  1R5L A;  4DCK A;  1YI2 P;  2WSS H;  1OX3 A;  1EXI A;  2P58 A;  2PAJ A;  3IR9 A;  4EOT A;  1IFI A;  3L72 J;  1Y47 A;  4GOF A;  5CHX A;  3EFG A;  1EDJ A;  2K9Y A;  1NTK E;  2N1T A;  1BGY E;  3M0D C;  2RKL A;  2R5B A;  3KZI H;  1PP9 G;  2I1J A;  2P2U A;  3L73 D;  5CBN A;  2JDI H;  2OYO A;  4WWI A;  1BE3 D;  1SQP E;  2N1T D;  3L75 D;  1KIL C;  1GK6 A;  2O01 H;  3HE5 B;  1YTZ I;  3V2P A;  2PGD A;  3GW6 A;  5CCH C;  2L91 A;  3CC2 P;  1NKZ B;  2C0X A;  1L0N E;  4U3F G;  3BCC D;  1N7L A;  4AQR D;  1NTK K;  2FXO A;  5APX A;  4PD4 D;  3PLN A;  3D71 A;  3RL0 B;  1SQX J;  3WU2 H;  2UWJ E;  2W6A A;  1YJ9 P;  1NTZ J;  2WQY C;  3AE1 C;  1ZV8 A;  5M1B A;  1M90 Q;  1EDL A;  1LTI C;  1ZN5 A;  3V2Q A;  5APY A;  3MUD A;  2OTK E;  1NYH A;  3PH0 A;  2ZYG A;  2WPR A;  1YTZ T;  2W90 A;  1ZXG A;  1SQP K;  3H1H E;  2AXT E;  1IO4 A;  3OJA B;  1GDT A;  1M57 D;  4TLF A;  2A45 G;  3AE5 C;  1S5L E;  3CL3 D;  1L0N K;  1PGJ A;  4PD4 H;  3U59 A;  2QM7 A;  2IX7 C;  5KKZ C;  3QWO C;  2FFD C;  1WT6 A;  3L72 D;  2H7H A;  1NKN A;  1T8Z A;  1NTM E;  2K9J B;  2WSC J;  3AE2 C;  1PPJ G;  2JWD A;  3LW5 J;  4JQ0 D;  5L8R J;  5AVT B;  1QLE D;  3HE5 A;  2FYZ A;  3M0D A;  2IDB A;  3EFF K;  2Q6Q A;  2FFD B;  2B88 A;  1W2B O;  3P32 A;  2YIU C;  2FKW B;  1EZV D;  2FYN C;  2QG4 A;  2Q3I A;  1L0L G;  3C8V A;  3IAO A;  2XKM A;  3E1I A;  5CCH A;  1YIJ P;  4H0L C;  2AEM A;  4M3L A;  2HFE D;  2Q9I A;  1NTM K;  1UIX A;  3L74 G;  2QA4 P;  1SQP J;  5H2F E;  3RL0 D;  4OWF A;  1SQX D;  4PV1 D;  1VQP P;  3I55 P;  1NTZ D;  5CCH D;  1S9K E;  2H43 A;  2IBZ E;  1IZN B;  1NTK G;  1JCC A;  4GDO A;  3G6E P;  5BVZ A;  4WY4 C;  1OIP A;  4HKZ H;  2E76 B;  4H44 B;  2R5D A;  5KLV G;  2ZXE B;  3H1K E;  2K9J A;  4OVN F;  2ZYA A;  1SQQ J;  3F5H A;  4JBZ A;  2R44 A;  2ZYD A;  4CPG A;  2KP8 A;  3QH9 A;  2WZ7 A;  4I6M C;  3RBX A;  1KB9 E;  3WMM 0;  3LID A;  2FFD A;  1HGZ A;  4KT0 J;  1GW3 A;  1E5W A;  2O1J A;  1OW8 A;  1L0N G;  1JMM A;  3CMA P;  3BAT A;  4HB1 A;  3JCU H;  3U1C A;  3Q5S A;  2K3R A;  2SPZ A;  4IL6 H;  2O1K A;  2W83 C;  2BEQ D;  3IF4 A;  1FZB A;  2KNC B;  1JY3 P;  2XV5 A;  4L74 A;  3CCM P;  4W7Y A;  1SQV E;  3RGU A;  3MP7 B;  3S9O A;  3CCS P;  3L70 E;  1JY2 P;  2ZT9 C;  3AE6 C;  2J58 A;  3CCJ P;  5B66 E;  4UB8 H;  3H1H G;  1QL1 A;  1GZL A;  3KHU A;  2FBW C;  2WSC H;  1NJI Q;  3FWL A;  1K04 A;  2Q1K A;  3Q5R A;  4IL6 X;  4OGQ C;  5AVQ B;  5KAF H;  2ZT9 B;  2D2C C;  3Q1M A;  1IFM A;  3HD7 C;  1T2K C;  2WIT A;  1SQV K;  2E76 D;  4UB6 H;  1YYC A;  3H1L J;  4H44 D;  2OAR A;  2E74 C;  4HJG H;  2D2C B;  2K1A A;  5AW3 B;  1L4A C;  1NHL A;  1SQQ D;  1RE4 C;  1EC5 A;  3CXH E;  3HD7 B;  3L71 E;  2OYI C;  1HWT C;  2IFN A;  1LT9 B;  1IJD B;  2E74 B;  3VTP C;  3CXH I;  2KNC A;  1KOR A;  3L4F A;  1P84 E;  3A2A A;  1L4A B;  2AEF A;  2GA1 A;  1GD2 E;  4RO0 A;  3P8C E;  2HPC B;  3CCR P;  5AW1 B;  1AFO A;  1M7L A;  1X8Y A;  5KTB A;  2WMM A;  4IFM A;  3TSI A;  3E7K A;  2R32 A;  2YXQ B;  5CJ4 A;  3BRT B;  3CCL P;  2JKV A;  5E79 E;  2K88 A;  1H0T B;  1HGV A;  1FOS E;  1WMK A;  3FWN A;  3M0A A;  1J2J B;  1J1D B;  1SQV J;  3TGU G;  3H6P A;  3L70 J;  4IFF A;  2ZT9 D;  1KTM A;  2N9B A;  1QX8 A;  2A06 D;  2BCC G;  1ZLL A;  1S4X A;  4W80 A;  3HD7 A;  2KXP B;  2LR2 A;  3AEE C;  2XND H;  1OXZ A;  2OGU A;  1LT9 A;  3ZDM A;  3H1L D;  3B4S A;  5GTH E;  3SFE C;  1EQ7 A;  3A0H H;  3VMZ A;  1T3J A;  2D2C D;  4LC1 A;  5B5E E;  1L4A A;  1ZRT E;  1MZ9 A;  3HD7 D;  1VL2 A;  2FY8 A;  1OW7 A;  2HPC A;  1URQ C;  4JPZ B;  1T2K D;  1YQ4 C;  2A45 I;  1K8A Q;  2B89 A;  1EDK A;  3CX5 H;  2W6J H;  1PPJ E;  2E74 D;  4R4M A;  2R3C A;  1L4A D;  2IZ0 A;  4NPE A;  4BXL A;  3PP5 A;  5APQ A;  1AA0 A;  3NFQ A;  1L2P A;  3PJS K;  2RH0 A;  2JP3 A;  1H0T A;  1AQT A;  1VPC A;  4C46 A;  2QEX P;  3WUV A;  1IFJ A;  1L0L E;  4PJ0 E;  1CW5 A;  2Y9Y A;  1NAF A;  2H89 C;  4YPC A;  1LTG C;  1PP9 J;  2H8P D;  1AVO A;  4WB4 A;  1JY3 O;  1BE3 G;  3L75 G;  5KAI H;  4AYC A;  1D7M A;  4DJG A;  2XDJ A;  1OVU A;  1FU1 A;  3JC2 2;  3P7K A;  3L74 E;  3M9H A;  5TJH A;  3L71 G;  3IFM A;  2YKQ A;  3BCC G;  3HTK B;  3CC7 P;  3KXD A;  2XZR A;  5DJT B;  1RQU A;  1IFN A;  2JJL A;  4U3F J;  3E1R A;  1JB0 J;  1PGP A;  3HUS C;  4N3Y B;  1CI6 B;  1EDI A;  5APW A;  4IOI H;  1L0L K;  2FYU E;  4XA4 A;  2KLV A;  5KLV E;  2P10 A;  5APV A;  2QJP C;  1JUN A;  2WVR A;  3PTZ A;  1HBW A;  2QSI A;  1S3J A;  4D6T E;  1OWA A;  2J5U A;  3Q5P A;  4C7R A;  4N78 E;  2DW3 A;  2N9Y B;  1LTA C;  2XNX A;  4IFD K;  1QEX A;  2E42 A;  2KI7 B;  1NU1 D;  1RF0 C;  2QVA A;  2Y0E A;  3EWK A;  1KIL B;  3CXH D;  3AEC C;  2WT7 B;  3GMA A;  5AVS B;  1ZOY C;  2FYU K;  1YBK A;  5KLV K;  3AE3 C;  3RK2 C;  5AVY B;  1LJ2 A;  3HE4 B;  3HTK A;  5AVV B;  4K35 A;  1AV1 A;  1EZV G;  1BDC A;  4WBA A;  1PP9 D;  2BAS A;  3AEF C;  1SQB E;  1PGQ A;  1SLQ A;  1G1I A;  1CI6 A;  1L0L J;  2OQQ A;  3H1J J;  1BSH A;  1Q7Y Q;  1ZME C;  4C7N B;  4YXW H;  2JR8 A;  3AE9 C;  2QJY C;  3AEB C;  4U3F D;  3BAS A;  3L37 A;  4AUW A;  4XFJ A;  3L74 J;  1QGK B;  3PHL A;  2XU6 A;  2IZ1 A;  3R2P A;  2Y9Z A;  3A0B H;  5KKZ B;  2ITA A;  1FC2 C;  1BCC E;  3K5B A;  5TIS E;  4NPF X;  4GT1 A;  3CWB E;  1X22 A;  3TK1 A;  1PFI A;  2C9L Y;  1Q81 Q;  1NTK J;  1BGY J;  1KIL A;  1ZW0 A;  1SQB K;  3H1I E;  2GUS A;  2WT7 A;  3A0H E;  1MUU A;  1PV3 A;  1JO5 A;  1U7J A;  3OA7 A;  2YIU B;  1NWQ A;  2NPS C;  2FYN B;  1RF0 A;  2HOD B;  4TT3 H;  3RK3 E;  1ZR2 A;  1KIL D;  3HE4 A;  2O01 N;  5GTI E;  3CX5 E;  2AEJ A;  2KLU A;  1HTL C;  3I5C A;  1VDF A;  4H0L B;  1L0N J;  1HH0 A;  1PPJ D;  2NPS B;  2E5T A;  3Q3D A;  3D6Z A;  2FYU G;  2IBZ I;  1KYO E;  4C7N A;  1SS1 A;  1UII A;  1JCD A;  5KLI C;  3H32 B;  1KZU B;  2V7Q J;  2IYO A;  2OYH C;  4D6T G;  3V2R A;  1OFC X;  1DIP A;  1M8O B;  1JM0 A;  3TGU E;  4WY4 B;  3FXE A;  3FXD A;  2CPB A;  3H1J D;  1ZP0 C;  3H1H J;  1DEE G;  2BCC E;  1U7M A;  1NO4 A;  3A7O A;  1H88 A;  2WPS A;  1KB9 I;  5KLI B;  1PIX A;  2E5Y A;  3U1A A;  1JTH B;  3ITK A;  1FOS F;  1FZG A;  1KN7 A;  1LTS C;  2LKM A;  4Y28 J;  3C1L A;  4I1L A;  1NTM J;  4HYT B;  1FZA A;  1HVV A;  2YXR B;  1LTT C;  2HOD A;  1NTK D;  4LLH A;  3Q2Y A;  1BGY D;  3KZI E;  1JNM A;  1LGH B;  1SQQ G;  1S2E A;  5BU5 A;  3KYQ A;  5APU A;  3LW5 H;  3SWK A;  2I8D A;  3PRJ A;  2NPS A;  1SQB G;  3RK3 C;  1SQP D;  2JEE A;  1N73 C;  1NH4 A;  2POH A;  2YKP A;  1BSN A;  1MKM A;  3H32 A;  4H0L D;  1L0N D;  3WU2 E;  1FS0 E;  1USE A;  1Q90 D;  2GM4 A;  2LXC B;  2NPS D;  4OGQ B;  4WY4 A;  3RK3 B;  1N2D C;  3AEG C;  3CCV P;  1BCC G;  1BE3 E;  1GU4 A;  4RKU J;  3L75 E;  3CWB G;  1VQ4 P;  1JTH A;  1G2C B;  5CJ0 A;  2KSJ A;  1S72 P;  2QM8 A;  2YNY A;  4DZO A;  3B8E B;  3H1I G;  4WY4 D;  3BCC E;  3B5N C;  1GW4 A;  3TDK A;  1JY3 N;  3H1H D;  4WVZ A;  4PD4 E;  3H1K J;  3TYY A;  2PP6 A;  1SFC C;  5CMZ A;  4O9B A;  2KZI A;  3TF5 A;  2PRR A;  2OYI B;  1P84 I;  2KOG A;  3M9Q A;  1SP4 A;  4I2L C;  2BCC J;  5KJ7 C;  3MTU E;  1NTM D;  3WUT A;  2V7Q H;  4OH8 B;  1KQG B;  1SFC B;  2YO3 A;  1S1C X;  3GG2 A;  2QIW A;  2AXT H;  4GKG A;  4EIJ A;  3VOP A;  1GK4 A;  3CCQ P;  3L72 E;  2WWW A;  3CCE P;  2WTY A;  2C0W A;  1LWU C;  1VQM P;  2MJZ A;  4RJT A;  1N86 A;  3NTN A;  4I7Z C;  1SVF A;  2IYP A;  2MKV A;  2B9B A;  3CPW O;  3RL0 g;  1J1E C;  1G2C A;  3LIE A;  2YO2 A;  5AW0 B;  1LTJ C;  2KYV A;  4OGQ D;  3RK3 D;  1X0T A;  1LWU B;  1EZV E;  2HLO A;  5AW5 B;  3N4X A;  1KQL A;  2Q7C A;  4JYB A;  4DOJ A;  2FXP A;  1S9K D;  2IBZ D;  1RE4 A;  4LGD E;  1NVO A;  2OYI A;  1FDM A;  1VQL P;  1LTJ B;  3MHV A;  2ZAE B;  4L75 A;  1RQV A;  2H88 C;  1BE3 J;  1FJP A;  1M1J C;  3WUU A;  3H1K D;  3GHG C;  1SQX E;  5AVX B;  1FBM A;  1SFC A;  1N8R Q;  1VQN P;  3V4Q A;  2BEZ F;  1NTZ E;  3L71 J;  3SSU A;  1FDI A;  3KDP B;  1GMJ A;  1URQ B;  1KB9 D;  1KV4 A;  1KFN A;  1U57 A;  2BCC D;  3JCU E;  4ASV A;  1XTG B;  2M5A B;  1M1J B;  3GHG B;  1YHQ P;  1N7S C;  1Y8A A;  3L73 G;  1SFC D;  5AVW B;  4IL6 E; 
#chains in the Genus database with same CATH homology
 1GW3 A;  1E5W A;  2O1J A;  1SLQ A;  1X79 B;  1G1I A;  2E43 A;  1CI6 A;  1JMM A;  3TNU B;  3M91 A;  3BAT A;  1GL2 B;  2ZFC A;  1JY2 O;  1SQX K;  4C7N B;  1N7S B;  2IPP A;  3U1C A;  1QL2 A;  1NU1 K;  1J1D C;  3M06 A;  3V2N A;  1LWU A;  3SWF A;  4XE5 B;  1NTZ K;  3BAS A;  2O1K A;  3L37 A;  4AUW A;  2P67 A;  2XU6 A;  3OAK A;  1FZB A;  3R2P A;  2XV5 A;  1JY3 P;  4JYC A;  1FZC A;  3BRV B;  1N73 A;  4W7Y A;  1FJK A;  1RE3 A;  1JY2 P;  4GT1 A;  2J58 A;  2Z5I A;  3TK1 A;  1LTJ A;  1PFI A;  2C9L Y;  1QL1 A;  1GZL A;  1IK9 A;  1CZQ A;  1KIL A;  2HG5 D;  2WSC H;  3V5B A;  3MIW A;  3VP9 A;  1SQB K;  1A02 F;  2GUS A;  4W7Z A;  2WT7 A;  1MUU A;  5AVQ B;  4N6J A;  2N1T C;  1JO5 A;  3SWY A;  2W27 A;  2VRS A;  3HUS B;  3OA7 A;  1URQ A;  1NWQ A;  5AW2 B;  1IFD A;  2NPS C;  1G1J A;  2P7J A;  1RF0 A;  2HOD B;  3A5T A;  5AW4 B;  1J1E B;  1DEB A;  1ZR2 A;  1KIL D;  3HE4 A;  4RES B;  1MV8 A;  3EQ2 A;  3RL0 C;  1IFM A;  1M1J A;  3HD7 C;  3GHG A;  5BU8 B;  3B5N A;  3O8Z A;  1T2K C;  2WIT A;  1HTL C;  3I5C A;  2P1J A;  1VDF A;  1SQV K;  5AW9 B;  2N1T B;  1YYC A;  1HH0 A;  3NXS A;  2OAR A;  1URQ D;  3KQG A;  2Z5H A;  3UIA A;  3C9I A;  2NPS B;  1IC2 A;  5APS A;  1XTC C;  1T3U A;  5AW3 B;  1ZR4 A;  1L4A C;  1NHL A;  3TNU A;  1RE4 C;  1GL2 A;  2L5G B;  4B86 A;  4C7N A;  3HD7 B;  3B5N D;  1N7S A;  2OYI C;  1KFM A;  1JCD A;  3H32 B;  1CSB A;  1KZU B;  5KJ7 A;  2IFN A;  1HWT C;  1LT9 B;  2OYH C;  3P8C D;  3V2R A;  1IJD B;  3VTP C;  4WY4 B;  3L4F A;  3A2A A;  1L4A B;  2HYN A;  2FXM A;  5AVU B;  2CPB A;  1GL2 D;  5AW7 B;  1GD2 E;  3RK2 B;  1NO4 A;  1N7S D;  3A7O A;  3P8C E;  2HPC B;  3NMD A;  5AW1 B;  1AFO A;  1H88 A;  1DX7 A;  2WPS A;  3CLQ A;  1LTB C;  1M7L A;  5KJ7 D;  1X8Y A;  1H89 A;  3HRN A;  3U1A A;  1JTH B;  5KTB A;  1FOS F;  1FZF A;  2GUV A;  4IFM A;  1FZG A;  3TSI A;  5CCG C;  3BVH A;  1LTS C;  2LKM A;  1Z56 A;  2R32 A;  2I1K A;  3II6 A;  4JF7 A;  1GU5 A;  5CJ4 A;  4I1L A;  3HUS A;  3BRT B;  4GIF A;  4HYT B;  1FZA A;  1HVV A;  1LTT C;  2HOD A;  4LLH A;  2KB7 P;  2PAJ A;  3IR9 A;  1HGV A;  4EOT A;  1IFI A;  1SQQ K;  1JNM A;  1LGH B;  2W6B A;  1FOS E;  5CHX A;  3EFG A;  3M0A A;  1J2J B;  1J1D B;  5BU5 A;  3KYQ A;  5APU A;  2N1T A;  3LW5 H;  3H6P A;  4IFF A;  2N9B A;  2NPS A;  2IFM A;  3M0D C;  1MFZ A;  3RK3 C;  2JEE A;  2R5B A;  5AW6 B;  2I1J A;  1NH4 A;  1ZLL A;  2P2U A;  1N73 C;  1DH3 A;  4W80 A;  3HD7 A;  2POH A;  2YKP A;  3V4W A;  1OXZ A;  3H32 A;  2N1T D;  1LT9 A;  1KIL C;  1WRG A;  1GK6 A;  2GM4 A;  3MD0 A;  1EQ7 A;  2NPS D;  2O01 H;  1T3J A;  3HE5 B;  3VMZ A;  4LC1 A;  4WY4 A;  1YTZ I;  3V2P A;  1L4A A;  3RK3 B;  1N2D C;  5CCH C;  1MZ9 A;  1RF1 C;  1NKZ B;  3VN0 A;  2C0X A;  1GU4 A;  3HD7 D;  4KHX A;  2HPC A;  1URQ C;  1T2K D;  2A45 I;  1FAV A;  1N7L A;  4Y99 C;  3MGN A;  4AQR D;  1NTK K;  5APX A;  1JTH A;  3RL0 B;  1G2C B;  5CJ0 A;  2KSJ A;  2W6A A;  2QM8 A;  2Q5U A;  2YNY A;  4DZO A;  3B8E B;  2A45 H;  2R3C A;  4WY4 D;  1RY3 A;  3B5N C;  1L4A D;  1GW4 A;  3L35 A;  1ZV8 A;  1LTI C;  1JY3 N;  3PP5 A;  1ZN5 A;  5APQ A;  1RF1 B;  3V2Q A;  3NFQ A;  5APY A;  3MUD A;  3RK2 D;  3TYY A;  2WPR A;  1YTZ T;  5APT A;  2C9N Y;  2PP6 A;  1SFC C;  4Y99 B;  2WSF H;  3VYI A;  5CMZ A;  1W2E A;  4O9B A;  1SQP K;  2YKO A;  1VPC A;  3T97 A;  2OYI B;  1IO4 A;  4C46 A;  4ZKP A;  5CCG A;  3OJA B;  1GDT A;  2KOG A;  1IFJ A;  3M9Q A;  1SP4 A;  2A45 G;  4I2L C;  1CW5 A;  2OYH B;  3A3Y B;  3CL3 D;  1NAF A;  2M8R A;  3VMX A;  5KJ7 C;  3MTU E;  1LTG C;  1L0N K;  1H8A A;  2H8P D;  4OH8 B;  4WB4 A;  1JY3 O;  1JOC A;  3U59 A;  2QM7 A;  1SFC B;  2IX7 C;  1FZE A;  2M3B A;  4AYC A;  2FFD C;  1WT6 A;  2YO3 A;  2XDJ A;  2J59 M;  1FU1 A;  3P7K A;  1NKN A;  2H7H A;  3M9H A;  5CCG D;  1T8Z A;  3IFM A;  4GKG A;  4EIJ A;  2YKQ A;  3VOP A;  1GK4 A;  3HTK B;  5AVT B;  2XZR A;  3HE5 A;  2FYZ A;  2WWW A;  3M0D A;  1IFN A;  2JJL A;  2WTY A;  2C0W A;  1LWU C;  2MJZ A;  2FFD B;  2Z4E A;  3P32 A;  1N86 A;  3NTN A;  3VP8 A;  3HUS C;  1SVF A;  1X9V A;  4N3Y B;  1CI6 B;  2FKW B;  1FZC C;  5APW A;  5AW8 B;  1L0L K;  2Q3I A;  4XA4 A;  2KLV A;  1J1E C;  1G2C A;  1RE3 C;  4N78 D;  3LIE A;  5APV A;  2YO2 A;  5AW0 B;  1JUN A;  1LTJ C;  2KYV A;  1HBW A;  3P8M C;  1HUC A;  3RK3 D;  5AVR B;  2XKM A;  3VMY A;  1LWU B;  3E1I A;  5CCH A;  1OWA A;  2HLO A;  1RF1 A;  5AW5 B;  4C7R A;  4M3L A;  3N4X A;  4N78 E;  1KQL A;  2HFE D;  2Q9I A;  2Q7C A;  4JYB A;  4DOJ A;  1NTM K;  1FZC B;  1S9K D;  1RE4 A;  1LTA C;  3L36 A;  2CPS A;  2XNX A;  1N73 B;  4IFD K;  3M9B A;  3N7N A;  4LGD E;  3RL0 D;  1A02 J;  5AVZ B;  2E42 A;  1GTW A;  3KPE A;  2OYI A;  1FDM A;  4ZKU A;  1RF0 C;  1LTJ B;  1NOH A;  5CCH D;  2OYH A;  1KIL B;  2YMY A;  1S9K E;  2H43 A;  1HJB A;  1FJP A;  1LT9 C;  1M1J C;  1JCC A;  3GHG C;  3CI9 A;  1AQ5 A;  2WPQ A;  2WT7 B;  4HH2 A;  5AVX B;  5BVZ A;  5AVS B;  1FBM A;  1SFC A;  4WY4 C;  2FYU K;  3V4Q A;  5KLV K;  2WSE H;  3KDP B;  2R5D A;  1URQ B;  2ZXE B;  3RK2 C;  5AVY B;  1JY2 N;  1KFN A;  3HE4 B;  1GL2 C;  3HTK A;  3G3Z A;  5AVV B;  1XTG B;  1M1J B;  2KP8 A;  3GHG B;  1N7S C;  4WBA A;  3B5N B;  2BAS A;  2WZ7 A;  4I6M C;  1SFC D;  5AVW B;  3WMM 0;  3LID A;  2FFD A;  1HGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...