4AUWA

Crystal structure of the bzip homodimeric mafb in complex with the c- mare binding site
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
87
structure length
87
Chain Sequence
b'SDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTION FACTOR MAFB
publication title Expression, purification, crystallization and preliminary crystallographic analysis of the mouse transcription factor MafB in complex with its DNA-recognition motif Cmare
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 37
structure length 87
sequence length 87
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03131 bZIP_Maf bZIP Maf transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4auwA00
3P8MC 4C46A 1MUUA 1SLQA 2YNYA 2P2UA 4RESB 2Z5IA 5AW0B 5AW6B 1A02F 2YO2A 3LIEA 2VRSA 2WPRA 1HJBA 1OXZA 4AUWA 1HBWA 1JUNA 3I5CA 2WWWA 3M0DA 2XV5A 3HE5A 5AVRB 3A5TA 1S9KE 1A02J 4KHXA 5AW8B 5APYA 1GK4A 2R5BA 5AVQB 1GK6A 1T2KC 3VMXA 5AW3B 1GTWA 2Q5UA 2KP8A 5AVUB 2R3CA 3P32A 1FAVA 3NFQA 4M3LA 3M9HA 2WTYA 2BASA 2Z5HA 3A2AA 3M0AA 3A7OA 4HYTB 2WT7A 3M9BA 1G2CB 1H88A 2C9LY 5APXA 3SWFA 1GZLA 4LC1A 1CZQA 3VYIA 2C9NY 1HUCA 2R5DA 1CI6B 5AVTB 3TNUB 5AW1B 3L36A 5APSA 1HWTC 3KQGA 3V4QA 1JNMA 3HE5B 2W6AA 1CI6A 1J2JB 2IPPA 1MV8A 3TNUA 2Q3IA 5APWA 3LIDA 1MFZA 2XZRA 3VMZA 3M06A 3V4WA 4JYCA 1IO4A 1SP4A 2Q7CA 3A3YB 2WT7B 2E42A 3O8ZA 1S9KD 2XU6A 1NAFA 1GU4A 5AW9B 1FOSF 2H7HA 2JJLA 1X8YA 5APTA 4GKGA 5APUA 3L37A 3P7KA 3NMDA 5AVSB 5AVVB 1T2KD 4I2LC 4I6MC 3IR9A 4EOTA 1FOSE 3B8EB 3VTPC 4GT1A 2WPSA 3TK1A 1YYCA 5AW4B 3NXSA 3HE4B 5AVZB 3L35A 2ZXEB 5AW2B 1OWAA 2P67A 3T97A 3TYYA 4B86A 3KDPB 5CMZA 3HE4A 2N9BA 2QM8A 4C7NB 5APQA 4DZOA 3MGNA 1GD2E 3HTKA 4C7NA 3M91A 3NTNA 5AW5B 4XE5B 3VN0A 1H89A 5APVA 1GU5A 2R32A 5AVXB 2YO3A 3MD0A 3VMYA 3V5BA 4AQRD 2QM7A 2E43A 4AYCA 1NWQA 1CSBA 3OAKA 2ZFCA 5AVWB 2P7JA 2WPQA 3UIAA 5AVYB 4JYBA 1KQLA 1DH3A 5AW7B 1H8AA 2W27A
chains in the Genus database with same CATH superfamily
2ZXXA 3H1LD 4WY4D 5EFWB 1L0LK 3L70E 1EQ7A 4W80A 2IBZI 2B87B 3RK3B 3TGUD 1DX7A 2UWJE 1ZLLA 1YQ4C 4EI2A 2KLVA 2BASA 3M9BA 1Q2NA 3L74E 2C9NY 3HUSA 4H13C 1HUCA 2JEEA 2OARA 1M1KQ 2IDBA 4R4MA 4N78E 1DEEG 1BCCD 1FZCC 1OVVA 1NTZK 1RF1A 1DD4A 2PFXA 3U59A 2K1AA 3GLMA 2AEFA 4WY4C 1KYOE 1ZW0A 1KQFB 5B5EH 4PD4D 2HG5D 1L0NE 3CCLP 2NZ2A 2C0XA 2N9BA 3HTKB 4XE5B 1PP9J 3D6YA 3TF5A 1M1JC 3H1IJ 1GL2D 3V2QA 1BGYJ 4DT0A 2OYIC 1MFTA 1S3JA 3IAOA 2FYUG 2Y0EA 3KHUA 3SWKA 3I55P 1A02J 1YJ9P 2I8DA 3L73D 2IFMA 3SFEC 1PP9D 3H1KJ 3RL0B 1IK7A 2Z5HA 3A2AA 3A7OA 1G2CB 3HUSB 3H1ID 1KB9D 1NTKD 3CL3D 1BGYD 1S5LH 5KJ7A 1J2JB 1MV8A 4ZKPA 1L4AA 3VMZA 1Q82Q 4C7RA 1RF1B 1R8EA 1GL2C 2XU6A 1OVRA 3AE7C 1NKNA 5KLVJ 3S1KA 1QX8A 2KYVA 1SQBG 3AEBC 1JMMA 2WPSA 1R5LA 1KD1Q 3L35A 1K9MQ 3B5ND 4DZOA 1L0LG 1SQXJ 3NTNA 2E75D 3L71J 1E5WA 2RH0A 3RK2B 1P84H 1URQB 2A06D 2RN0A 5KLVD 2POHA 5CCHD 3CPWO 2HODA 2YMKA 3Q2YA 1OZHA 3L70J 2QEXP 2YMYA 4HJGH 2WMMA 5KAFH 3AEGC 1S72P 5AW8B 4PV1D 2B88A 2WSCH 3L71D 3VMXA 1VQOP 1NTZG 1RQVA 2QSIA 1SQQE 3WMM0 2K88A 4H44B 4M3LA 1Q7YQ 2LR2A 1LWUC 4D6TG 4YXDC 2ZT9D 5KLIC 3L74J 3B5NC 1OX3A 3C9IA 1NU1E 1Z56A 1CI6A 3U1CA 3MUDA 5GTHH 1VF5D 2E75C 1KV4A 3VP9A 5CJ0A 1SQVD 1BE3D 3L70D 1L4AD 2NPSA 1IFIA 2W8ZA 1LTJB 1L2PA 3GMAA 5CCHC 2W90A 3CMEP 3KZIH 2CK3H 1YHQP 1DIPA 1VQ5P 1FJPA 2V7QJ 1L0NJ 1FOSE 2Q9IA 3L74D 3II6A 4JQ0D 2JR8A 3H1JG 4LLHA 4PV1C 2M3EA 4N78D 1BSNA 2KS1B 4WWIA 2P58A 2ZT9C 1FZGA 4GOEA 5B66E 3V2PA 3CX5I 1VF5C 3CCJP 1KYOD 3P8MC 2BCCE 1PL5A 3GHGA 1RE3C 1L0ND 3CXHH 2PAJA 1L4AC 3RGUA 1JUNA 1K04A 1SQPK 2O01N 3W67A 1T3UA 4UB6E 2J5UA 2KP8A 1N2DC 3M9HA 1LNQA 4ZNCA 4U3FG 1YJNP 1HWTC 2G8YA 1CI6B 5AW1B 3E7KA 1BCCE 1K05A 2IPPA 1ZRTE 2IZ1A 1MFZA 1Q90D 2OYHA 3KXDA 1IO4A 1YITP 3WU2E 2WT7B 1LTBC 3HD7D 2AXTH 4HH2A 1JTHA 2NPSD 2WITA 1K73Q 1FZBA 1USDA 1KORA 3RBXA 3IR9A 2WSSH 4BRYA 1ZR2A 2H89C 5AW2B 3T97A 2M3BA 3D71A 4PJ0E 2KNCB 2KSEA 1N8RQ 3FX0A 2XDJA 5BU5A 1XTCC 2GUSA 2QM7A 4AYCA 4OGQC 3L72D 1KILE 3SWYA 4WBAA 4L76A 3MP7B 2YKOA 1DH3A 3PTZA 1T3JA 4RJTA 3IF4A 1FZCA 1FU1A 3L73E 1EZVG 3HD7C 2E76B 2NPSC 2R5BA 1FZAA 2JWDA 1GK6A 4JPZB 1S2EA 1SQQJ 1NTKE 2WSFJ 1NTMK 3CLQA 4HKZH 1KC8Q 3VYIA 3EFGA 2J59M 1NU1J 3HE5B 4W7YA 1QL2A 3EWKA 4JF7A 3CCQP 1DD3A 3A3YB 1JO5A 1N7SB 1M1JA 3M0DC 2YXRB 1GU4A 2YIUB 5APTA 1K8AQ 2O01H 2WSEJ 4BRYB 2IZ0A 1JY3N 3CX5E 3T97B 5AVZB 2FYNC 1NU1D 3GG2A 2QJPC 1VPCA 1N73C 1VQMP 4A7PA 2GUVA 3MD0A 3CWBG 1SQPG 4H13B 1PFIA 1NWQA 3OAKA 2WPQA 1L0LE 2K9JB 3IFMA 2P2UA 4RESB 5AW6B 4I1LA 3TGUJ 4OVNF 5E79H 2OYHC 2B89A 1GL2A 1J1DC 5APYA 4WY4B 3AE5C 1BDDA 1SQBK 2QE7H 2ZYDA 2YKQA 1SFCD 3VOPA 3SWFA 1XTGB 3H25A 1SQVE 1BE3E 1BCCJ 2WSFH 1JB0J 1G1IA 2BCCD 2O3JA 5APWA 5M1BA 4NPDA 1VQNP 3PRJA 1M1JB 1MKMA 1EZVI 1YTZT 2OYIB 3G6EP 1HF9A 2XNXA 1SQXK 3FXEA 2H43A 2XNDH 1ZRTD 2Y9YA 1SFCC 3AEEC 2E5YA 1LWUA 3PLNA 1IFJA 4LGDE 3H1JE 3B5NA 2WZ7A 2JO1A 4Z1MH 1NTMG 2O1JA 2ZJSE 3E1RA 1VQKP 1WT6A 2Z5IA 3JCUH 2VRSA 3L73J 2KK7A 1GL2B 2KOGA 1HBWA 1S5LX 5CCHA 1Q86Q 3H6PA 1NTKJ 5TJHA 1FAVA 1S1CX 1OW6A 3FGAD 2NRGA 1KILD 4K3AA 4U7JA 1HGZA 3Q5RA 1J1EC 3KQGA 1JNMA 2QJYC 1FJKA 5CBNA 1OW8A 3M06A 3RL0g 1ZOYC 3BRVB 3O6QA 5AW9B 3AE1C 4BXLA 1M7LA 4L75A 1X8YA 3L37A 3P7KA 4EIJA 1RQUA 2BEQD 1VQ7P 2IFNA 2FYUD 1RE3A 1SS1A 2HR3A 4PD4H 3B8EB 5DJUB 3TK1A 2FKWB 1OWAA 2LKMA 3KDPB 1Y9BA 2E74D 1FDMA 4DOJA 3CC7P 1NHLA 3H1KG 2IYPA 1LWUB 3L72E 3VN0A 5CCGD 1KN7A 2Z4EA 3CD6P 5KLIB 4N3YB 2P1JA 1KILC 2PP6A 3B5NB 2KZJA 5AVWB 1NH4A 1LTAC 2KB7P 3VMAA 1L0LJ 1LT1A 2E75B 2V4HA 3BRTB 4OWFA 1MUUA 3KPEA 3CX5D 3L4FA 2IBZE 1UIXA 2WWWA 5H2FE 3CC2P 5KAIE 2WTYA 2HLOA 4HYTB 4DJGA 4Y99C 5K5GB 3AE6C 4PD4I 1IFMA 1BE3J 1KB9H 1L0LD 1SQVJ 3QH9A 4PV1B 2E74C 1LJ2A 2W83C 4IL6H 1SQXG 2P10A 5CCGC 3V2NA 4EDFA 4H0LD 2ZT9B 3S9OA 1SP4A 1PGOA 1OW7A 1JCCA 4KJMA 1VF5B 1IJDB 1W2EA 2JJLA 3NMDA 4NPEA 5AVSB 1FS0E 1L4AB 1N7LA 3BCCG 3GF7A 1Y8AA 4EOTA 2RMZA 2ZXEB 3HD7A 2B9BA 5KTBA 1NTZD 1P84I 5APQA 1JCDA 1T6AA 1JY2P 2M0BA 2J58A 4K35A 2K3RA 3B4SA 4R4LA 3H1JJ 3EQ2A 3QWOC 3D6ZA 2JWAA 2IX7C 3N7NA 2W27A 4H0LC 2YNYA 3CWBE 1SQPE 1LT9C 4NPFX 1SQQK 3AEAC 2FXPA 1EDJA 4WVZA 1W5CE 2WQYC 2CPBA 3M0DA 1U7MA 1VQPP 2D2CD 3MTUE 2HODB 1AVYA 3A0BE 1RF0C 1HGVA 1ZR4A 4W7ZA 4QMAA 5B5EE 1AV1A 5KKZC 3H1JD 2QJKC 2M8RA 4LC1A 1AQTA 2IYOA 1JY3P 2FYZA 3MZWB 3L75G 1N73A 3PJSK 2Q7CA 1UIIA 4OGQB 3R4YA 1LP1A 2ZYAA 2K9YA 1IK9A 4GKGA 5APUA 2GA1A 4OGQD 3OA7A 1NKZB 1T2KD 1EDLA 3RK3E 4TLFA 3HD7B 2NPSB 3H1HG 1ZMEC 2P67A 1PPJG 3Q5PA 2D2CC 3Q1MA 1X22A 4U3FD 4C7NA 1QL1A 1FDOA 3L72J 5AW5B 5APVA 2O1KA 2E43A 1CSBA 2FFDA 3F89A 4YTPC 4L73A 3CXHI 2LXCB 1S5LE 1KQLA 2N1TA 1H8AA 1KYOH 2H8PD 2L91A 2V7QH 2XKMA 3V6IA 1X9VA 1PGJA 1NTME 4KHXA 3AEDC 2BEZF 3Q5SA 3JSVC 1T2KC 2A45H 5AVUB 3AECC 3GHGB 3C8VA 4IFFA 2Y0CA 3U1AA 1H88A 2FYNB 2QJPB 5C39A 3H32A 5APSA 4I7ZC 1PV3A 1TU3F 1N73B 1M57D 2QG4A 2IBZD 1SFCA 1LP1B 2FYUE 5AVVB 1EZVD 2OYHB 1QGKB 4WB4A 1QVFO 2W6BA 4TT3H 3FXDA 1LTGC 1OIPA 2RKLA 1J1DB 2QM8A 1U57A 5KAFE 4C7NB 1JTHB 1ZP0C 1EC5A 1EXIA 1SQQG 1HH0A 4GODA 1RH5B 1BDCA 1VQ6P 1KZUB 4JYBA 1BSHA 5GTHE 3MIWA 1SQPJ 1NTKK 3RBZA 1NYHA 2N1TD 1JOCA 1SQBE 1OFCX 4Y28J 1S9KE 1GK4A 3KZIE 4IFMA 3VP8A 5BU8B 1AA0A 2R3CA 4XA4A 2KSJA 3M0AA 2BCCJ 2G3AA 1M90Q 1FZCB 2HFED 3L36A 3C1LA 3V4QA 2HPCA 1VQLP 3HRNA 1NO4A 3CWBD 1SQPD 2OTKE 1SFCB 2QVAA 3I56P 2SPZA 3H1LG 1KILA 1JEKA 2OQQA 1IZNB 2FY8A 2FFDC 1AJYA 3TGUG 1YTZI 2N1TC 1NTZE 5KLVK 3W68A 2I1KA 1JMBA 2QA4P 1YYCA 4D6TE 3FWLA 2E5TA 3HE4A 4MN4C 3TSIA 3BCCE 1GU5A 3V5BA 3CCSP 3PH0A 1BCCG 1J1EB 2ZFCA 2GM4A 1RE4C 2QJYB 2QRXA 1IFDA 1N86A 3RK3D 5CCGA 2WPVB 2KI7B 1SLQA 1VL2A 2WSEH 1A02F 3LIEA 1G2CA 3AE4C 3I5CA 1NTMJ 1KQGB 1EDKA 2AXTE 4XFJA 1SQVK 3OW2O 4HB1A 5AW3B 3NFQA 1EXJA 2L5GB 1LGHB 2WVRA 1KFNA 4UB8E 5B66H 2AXCA 3USSA 3A0BH 2HPCB 1ZN5A 1GMJA 2Q3IA 2FBWC 2Y0DA 2Y9ZA 1KILB 1FZFA 2K37A 1NTMD 1RY3A 2FYUJ 3AE9C 4ASVA 4RKUJ 2R3SA 4UB6H 3RK3C 1PGQA 3L75E 5CBOA 1AQ5A 1FBMA 1AVOA 1URQA 3L73G 1LT9A 3VTPC 4GT1A 3OJAB 1PP9G 5TISE 3CCUP 4U3FE 3LW5J 3HE4B 3TYYA 4B86A 1AFOA 2MKVA 3H1IG 1L0NK 1NTKG 3CC4P 4IFDK 2WSCJ 1BGYG 1RF0A 2Q1KA 1P84D 4Y99B 3WU2H 3G9RA 4BWNA 3H1HE 2JKVA 2MJZA 1PPJE 2E74B 1LTIC 1USEA 1IC2A 3A0HE 4C46A 1KQSO 5GTIE 1JY2O 1SQBJ 3RL0D 5BVZA 1FC2C 1HJ0A 3K5BA 1PIXA 4IOIH 5AVRB 3SSUA 3A5TA 1CW5A 4PJ0H 5AVQB 4IL6X 4YPCA 1GTWA 1PGPA 4GIFA 2AEJA 2C9LY 5APXA 1LTJA 1GZLA 1CZQA 3H1KD 2A06G 1T8ZA 2OTJP 3ITKA 5KLVG 2I1JA 2HYNA 2XZRA 4YXWH 1SQBD 1IFNA 3B71A 1S9KD 1EZVE 3AE8C 3TDKA 3EFFK 4H0LB 1PZQA 1JY3O 1GW4A 2KS1A 1LT9B 1NTZJ 4I2LC 4I6MC 3L71G 3RL0C 4D6TJ 5E79E 3RK2D 3HUSC 1URQD 3E1IA 5CMZA 3P8CE 3CCEP 3O6QB 2ZVOB 3M9QA 3BCCJ 3MGNA 1H89A 1KMIZ 3LW5H 5KKZB 2QJKB 1WMKA 1NVOA 4DCKA 1RF1C 1SQVG 1BE3G 1RHZB 3L70G 1YIJP 1SQXD 2QIWA 3V2RA 2ZYGA 1HTLC 3PP5A 3CXHD 5AW0B 2W6JH 4D6TD 3CX5H 1OXZA 4H44D 1EDIA 4OH8B 2JP3A 1W2BO 4EYYQ 1NGMB 3L74G 1WRGA 3S4RA 5KJ7D 3BCCD 1GW3A 4ZKUA 2KLUA 1KB9I 2WT7A 3RK2C 2DW3A 1URQC 4L74A 2D2CB 1S4XA 5AVTB 1QVGO 1SVFA 1LTSC 2Q6QA 4GDOA 1YBKA 2ZAEB 1NU1K 1VQ8P 1L0NG 2LXBA 4ZMDA 2OGUA 3SFDC 2KNCA 1LTTC 3IN6A 3L75J 3CCVP 3H1LE 2A45G 4H44C 3JCUE 3CCRP 4U3FJ 1Y47A 5KJ7C 1JM0A 3TGUE 4KT0J 2ZVNB 4CPGA 3WUTA 3H1HJ 3D70A 1R5SA 4I7ZB 2H88C 2P7JA 1QLED 1LTJC 3UIAA 3L75D 1NOHA 3WUVA 2YO2A 1E79H 1HJBA 1IFPA 3CCMP 4AUWA 1X79B 3HE5A 3G4SP 3G71P 1NJIQ 2O01J 3P32A 3H1HD 4JBZA 2FXMA 1X0TA 1PPJD 4PD4E 1N7SA 5CHXA 2R5DA 2C0WA 1VQ4P 3TNUA 3L72G 1GDTA 4UB8H 1VQ9P 1ZXGA 2KUBA 2E42A 1KFMA 3O8ZA 1NAFA 2Q3EA 1U7JA 1FOSF 1RE4A 2CPSA 1ZV8A 4O9BA 4RO0A 3Q3DA 3AEFC 2IBZG 1YI2P 5AW4B 3NXSA 3WUUA 1DEBA 2KXPB 1P84E 2K9JA 2PRRA 3MUDC 1GD2E 1M8OB 5TISH 3KYQA 2R32A 5AVXB 1PP9E 3BASA 3VMYA 1JY2N 5DJTB 1KTMA 1H0TA 1KYOI 1FZEA 1QEXA 3H1IE 1KB9E 3G3ZA 3JC22 1MZ9A 4WY4A 1BGYE 3FWNA 2E76D 5AW7B 4IL6E 2M5AA 1HVVA 5CJ4A 1OVUA 2WPRA 3ZDMA 3A0HH 3P8CD 2A45I 2XV5A 2FFDB 2ITAA 2YKPA 5GTIH 2B87A 1NU1G 5L8RJ 2N1TB 2Q5UA 3CI9A 3H1KE 1YQ3C 3CWBJ 2YXQB 1SQQD 3TNUB 3BATA 2OYOA 1N7SD 4ASWA 2W6AA 2FYUK 3BVHA 3LIDA 2OYIA 3GHGC 2R44A 4GOFA 3V4WA 4JYCA 3GF3A 1M56D 2A06E 5H2FH 1YJWP 1VDFA 3F5HA 5KLVE 5KAIH 3ABVC 3H32B 2FXOA 2H7HA 3PHLA 1FE6A 2E76C 3R2PA 2JDIH 1G1JA 3H1LJ 1Q81Q 2OTLP 3MHVA 1FDIA 1OMIA 2KZIA 4H13D 3AE3C 3HTKA 2KIKA 3M91A 1SQXE 1NAYA 3GW6A 3L71E 2BCCG 3N4XA 1D7MA 4N6JA 2YO3A 1H0TB 4AQRD 2N9YB 2PGDA 3AE2C 3CXHE 1N7SC 5AVYB 2YIUC 2AEMA 2M5AB 3CMAP
chains in the Genus database with same CATH topology
1T3JA 4C46A 2YNYA 4WY4D 1LT9C 1L0LK 1JY2O 1SQQK 1FZCA 1FU1A 1EQ7A 4W80A 3RL0D 5BVZA 3HD7C 2CPBA 3M0DA 2NPSC 3RK3B 5AVRB 3A5TA 1CW5A 2R5BA 1FZAA 5AVQB 3MTUE 2HODB 1DX7A 1GK6A 1RF0C 1GTWA 1ZLLA 1HGVA 1ZR4A 4W7ZA 1NTMK 4GIFA 2KLVA 2BASA 3CLQA 3M9BA 2C9LY 2M8RA 5APXA 1LTJA 1GZLA 4LC1A 1CZQA 3VYIA 2C9NY 3EFGA 3HUSA 1HUCA 2J59M 2JEEA 1T8ZA 2OARA 1JY3P 3HE5B 4W7YA 2I1JA 2FYZA 2HYNA 2XZRA 4N78E 1QL2A 1N73A 4JF7A 1FZCC 2Q7CA 3A3YB 1IFNA 1JO5A 1NTZK 1RF1A 1N7SB 1M1JA 3M0DC 1S9KD 1GU4A 1IK9A 3U59A 5APTA 4GKGA 5APUA 1JY3O 1GW4A 3OA7A 1LT9B 1NKZB 2O01H 4WY4C 1T2KD 4I2LC 4I6MC 2HG5D 1JY3N 3HD7B 3RL0C 3RK2D 2NPSB 5AVZB 3HUSC 1URQD 2P67A 3E1IA 5CMZA 3P8CE 2C0XA 2N9BA 3HTKB 3M9QA 1VPCA 3MGNA 4C7NA 1QL1A 5AW5B 1H89A 1N73C 4XE5B 3LW5H 5APVA 2GUVA 3MD0A 2O1KA 2E43A 1RF1C 1PFIA 1M1JC 1NWQA 1CSBA 3OAKA 2FFDA 1GL2D 2WPQA 3V2RA 3V2QA 1KQLA 2N1TA 1H8AA 1HTLC 3PP5A 2H8PD 3IFMA 2P2UA 4RESB 5AW0B 5AW6B 4I1LA 2OYIC 2XKMA 2OYHC 1OXZA 1X9VA 4OH8B 1GL2A 1WRGA 1A02J 1J1DC 4KHXA 5KJ7D 5APYA 1GW3A 4ZKUA 4WY4B 1SQBK 1T2KC 2IFMA 2A45H 5AVUB 3GHGB 4IFFA 3RL0B 2YKQA 2Z5HA 3A2AA 2WT7A 3A7OA 1SFCD 3RK2C 1G2CB 3HUSB 3U1AA 1H88A 3VOPA 3SWFA 1URQC 1XTGB 5AVTB 3H32A 3CL3D 5APSA 2WSFH 5KJ7A 1G1IA 1SVFA 1J2JB 1MV8A 4ZKPA 1N73B 5APWA 1L4AA 3VMZA 1LTSC 4C7RA 1SFCA 1RF1B 1NU1K 1M1JB 1GL2C 2XU6A 1NKNA 1YTZT 1LTTC 2KYVA 5AVVB 2OYIB 2OYHB 2XNXA 1SQXK 2A45G 1JMMA 4WB4A 2W6BA 2WPSA 2H43A 3L35A 1LTGC 1J1DB 3B5ND 5KJ7C 2QM8A 4C7NB 1JTHB 4DZOA 1HH0A 3NTNA 1E5WA 3RK2B 1SFCC 1LWUA 1URQB 1IFJA 4LGDE 3B5NA 2P7JA 2WZ7A 1LTJC 3UIAA 2POHA 1KZUB 5CCHD 2HODA 4JYBA 2O1JA 1NOHA 3MIWA 1WT6A 2Z5IA 2YO2A 1NTKK 2VRSA 2N1TD 1HJBA 1GL2B 4AUWA 2KOGA 1JOCA 1HBWA 1X79B 2YMYA 3HE5A 1S9KE 5CCHA 5AW8B 3H6PA 1GK4A 2WSCH 4IFMA 3VP8A 3VMXA 5BU8B 3WMM0 2R3CA 3P32A 1FAVA 4M3LA 4XA4A 2KSJA 1LWUC 3M0AA 2FXMA 1N7SA 1FZCB 1KILD 5CHXA 3B5NC 2R5DA 1HGZA 2HFED 3L36A 1J1EC 3KQGA 3V4QA 2C0WA 1JNMA 3C9IA 1Z56A 2HPCA 1CI6A 3TNUA 3U1CA 3MUDA 3HRNA 1NO4A 1FJKA 1GDTA 1SFCB 3M06A 3VP9A 5CJ0A 1L4AD 2NPSA 3BRVB 1KILA 1IFIA 2E42A 1KFMA 3O8ZA 1LTJB 1NAFA 5AW9B 5CCHC 1FOSF 1RE4A 1M7LA 1X8YA 2FFDC 2CPSA 3L37A 3P7KA 1ZV8A 4O9BA 4EIJA 2IFNA 1FJPA 1YTZI 1RE3A 2N1TC 5KLVK 2I1KA 1FOSE 3B8EB 2Q9IA 3II6A 1YYCA 2FKWB 5AW4B 3TK1A 3NXSA 1OWAA 1DEBA 2LKMA 3KDPB 3HE4A 4LLHA 1FDMA 3TSIA 4DOJA 1NHLA 4N78D 1GD2E 1LWUB 5CCGD 3VN0A 3KYQA 2Z4EA 1GU5A 2R32A 5AVXB 3BASA 3VMYA 3V5BA 4N3YB 2P1JA 1KILC 1JY2N 2PP6A 3B5NB 1FZGA 1FZEA 2ZFCA 1J1EB 1NH4A 1LTAC 2KB7P 5AVWB 3V2PA 2GM4A 3G3ZA 1RE4C 1MZ9A 4WY4A 1IFDA 1N86A 5AW7B 3RK3D 3P8MC 3BRTB 5CCGA 3GHGA 1MUUA 1HVVA 1SLQA 1RE3C 2WSEH 3KPEA 1A02F 2PAJA 3L4FA 3LIEA 1G2CA 1L4AC 5CJ4A 2WPRA 1JUNA 3P8CD 3I5CA 2A45I 2WWWA 2XV5A 1SQPK 2FFDB 2YKPA 1SQVK 1T3UA 5AW3B 2N1TB 2Q5UA 2KP8A 3CI9A 3NFQA 1N2DC 3M9HA 2WTYA 2L5GB 2HLOA 4HYTB 1LGHB 4Y99C 1KFNA 1IFMA 2HPCB 1ZN5A 1HWTC 1CI6B 3TNUB 5AW1B 3BATA 1N7SD 2W6AA 2FYUK 2IPPA 3BVHA 2Q3IA 3LIDA 2OYIA 1MFZA 5CCGC 3GHGC 3V2NA 2OYHA 1KILB 3V4WA 4JYCA 1FZFA 1IO4A 1SP4A 2WT7B 1LTBC 1RY3A 3HD7D 1VDFA 1JCCA 4HH2A 1JTHA 3H32B 2NPSD 2WITA 2H7HA 1IJDB 1W2EA 2JJLA 3RK3C 3R2PA 1FZBA 3NMDA 1G1JA 5AVSB 1AQ5A 1FBMA 1L4AB 1N7LA 1URQA 3IR9A 4EOTA 1LT9A 3VTPC 4GT1A 3OJAB 1ZR2A 3HE4B 2ZXEB 5AW2B 3T97A 3HD7A 3TYYA 4B86A 1AFOA 5KTBA 2M3BA 5APQA 1L0NK 1JCDA 4IFDK 3HTKA 3M91A 1RF0A 1JY2P 3N4XA 4Y99B 2XDJA 5BU5A 2J58A 4N6JA 2YO3A 1XTCC 2GUSA 2QM7A 4AQRD 4AYCA 2MJZA 3EQ2A 1LTIC 1IC2A 1N7SC 3SWYA 4WBAA 5AVYB 2IX7C 3N7NA 2YKOA 1DH3A 2W27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P8M C;  4C46 A;  1MUU A;  1SLQ A;  2YNY A;  2P2U A;  4RES B;  2Z5I A;  5AW0 B;  5AW6 B;  1A02 F;  2YO2 A;  3LIE A;  2VRS A;  2WPR A;  1HJB A;  1OXZ A;  4AUW A;  1HBW A;  1JUN A;  3I5C A;  2WWW A;  3M0D A;  2XV5 A;  3HE5 A;  5AVR B;  3A5T A;  1S9K E;  1A02 J;  4KHX A;  5AW8 B;  5APY A;  1GK4 A;  2R5B A;  5AVQ B;  1GK6 A;  1T2K C;  3VMX A;  5AW3 B;  1GTW A;  2Q5U A;  2KP8 A;  5AVU B;  2R3C A;  3P32 A;  1FAV A;  3NFQ A;  4M3L A;  3M9H A;  2WTY A;  2BAS A;  2Z5H A;  3A2A A;  3M0A A;  3A7O A;  4HYT B;  2WT7 A;  3M9B A;  1G2C B;  1H88 A;  2C9L Y;  5APX A;  3SWF A;  1GZL A;  4LC1 A;  1CZQ A;  3VYI A;  2C9N Y;  1HUC A;  2R5D A;  1CI6 B;  5AVT B;  3TNU B;  5AW1 B;  3L36 A;  5APS A;  1HWT C;  3KQG A;  3V4Q A;  1JNM A;  3HE5 B;  2W6A A;  1CI6 A;  1J2J B;  2IPP A;  1MV8 A;  3TNU A;  2Q3I A;  5APW A;  3LID A;  1MFZ A;  2XZR A;  3VMZ A;  3M06 A;  3V4W A;  4JYC A;  1IO4 A;  1SP4 A;  2Q7C A;  3A3Y B;  2WT7 B;  2E42 A;  3O8Z A;  1S9K D;  2XU6 A;  1NAF A;  1GU4 A;  5AW9 B;  1FOS F;  2H7H A;  2JJL A;  1X8Y A;  5APT A;  4GKG A;  5APU A;  3L37 A;  3P7K A;  3NMD A;  5AVS B;  5AVV B;  1T2K D;  4I2L C;  4I6M C;  3IR9 A;  4EOT A;  1FOS E;  3B8E B;  3VTP C;  4GT1 A;  2WPS A;  3TK1 A;  1YYC A;  5AW4 B;  3NXS A;  3HE4 B;  5AVZ B;  3L35 A;  2ZXE B;  5AW2 B;  1OWA A;  2P67 A;  3T97 A;  3TYY A;  4B86 A;  3KDP B;  5CMZ A;  3HE4 A;  2N9B A;  2QM8 A;  4C7N B;  5APQ A;  4DZO A;  3MGN A;  1GD2 E;  3HTK A;  4C7N A;  3M91 A;  3NTN A;  5AW5 B;  4XE5 B;  3VN0 A;  1H89 A;  5APV A;  1GU5 A;  2R32 A;  5AVX B;  2YO3 A;  3MD0 A;  3VMY A;  3V5B A;  4AQR D;  2QM7 A;  2E43 A;  4AYC A;  1NWQ A;  1CSB A;  3OAK A;  2ZFC A;  5AVW B;  2P7J A;  2WPQ A;  3UIA A;  5AVY B;  4JYB A;  1KQL A;  1DH3 A;  5AW7 B;  1H8A A;  2W27 A; 
#chains in the Genus database with same CATH topology
 2ZXX A;  3H1L D;  4WY4 D;  5EFW B;  1L0L K;  3L70 E;  1EQ7 A;  4W80 A;  2IBZ I;  2B87 B;  3RK3 B;  3TGU D;  1DX7 A;  2UWJ E;  1ZLL A;  1YQ4 C;  4EI2 A;  2KLV A;  2BAS A;  3M9B A;  1Q2N A;  3L74 E;  2C9N Y;  3HUS A;  4H13 C;  1HUC A;  2JEE A;  2OAR A;  1M1K Q;  2IDB A;  4R4M A;  4N78 E;  1DEE G;  1BCC D;  1FZC C;  1OVV A;  1NTZ K;  1RF1 A;  1DD4 A;  2PFX A;  3U59 A;  2K1A A;  3GLM A;  2AEF A;  4WY4 C;  1KYO E;  1ZW0 A;  1KQF B;  5B5E H;  4PD4 D;  2HG5 D;  1L0N E;  3CCL P;  2NZ2 A;  2C0X A;  2N9B A;  3HTK B;  4XE5 B;  1PP9 J;  3D6Y A;  3TF5 A;  1M1J C;  3H1I J;  1GL2 D;  3V2Q A;  1BGY J;  4DT0 A;  2OYI C;  1MFT A;  1S3J A;  3IAO A;  2FYU G;  2Y0E A;  3KHU A;  3SWK A;  3I55 P;  1A02 J;  1YJ9 P;  2I8D A;  3L73 D;  2IFM A;  3SFE C;  1PP9 D;  3H1K J;  3RL0 B;  1IK7 A;  2Z5H A;  3A2A A;  3A7O A;  1G2C B;  3HUS B;  3H1I D;  1KB9 D;  1NTK D;  3CL3 D;  1BGY D;  1S5L H;  5KJ7 A;  1J2J B;  1MV8 A;  4ZKP A;  1L4A A;  3VMZ A;  1Q82 Q;  4C7R A;  1RF1 B;  1R8E A;  1GL2 C;  2XU6 A;  1OVR A;  3AE7 C;  1NKN A;  5KLV J;  3S1K A;  1QX8 A;  2KYV A;  1SQB G;  3AEB C;  1JMM A;  2WPS A;  1R5L A;  1KD1 Q;  3L35 A;  1K9M Q;  3B5N D;  4DZO A;  1L0L G;  1SQX J;  3NTN A;  2E75 D;  3L71 J;  1E5W A;  2RH0 A;  3RK2 B;  1P84 H;  1URQ B;  2A06 D;  2RN0 A;  5KLV D;  2POH A;  5CCH D;  3CPW O;  2HOD A;  2YMK A;  3Q2Y A;  1OZH A;  3L70 J;  2QEX P;  2YMY A;  4HJG H;  2WMM A;  5KAF H;  3AEG C;  1S72 P;  5AW8 B;  4PV1 D;  2B88 A;  2WSC H;  3L71 D;  3VMX A;  1VQO P;  1NTZ G;  1RQV A;  2QSI A;  1SQQ E;  3WMM 0;  2K88 A;  4H44 B;  4M3L A;  1Q7Y Q;  2LR2 A;  1LWU C;  4D6T G;  4YXD C;  2ZT9 D;  5KLI C;  3L74 J;  3B5N C;  1OX3 A;  3C9I A;  1NU1 E;  1Z56 A;  1CI6 A;  3U1C A;  3MUD A;  5GTH H;  1VF5 D;  2E75 C;  1KV4 A;  3VP9 A;  5CJ0 A;  1SQV D;  1BE3 D;  3L70 D;  1L4A D;  2NPS A;  1IFI A;  2W8Z A;  1LTJ B;  1L2P A;  3GMA A;  5CCH C;  2W90 A;  3CME P;  3KZI H;  2CK3 H;  1YHQ P;  1DIP A;  1VQ5 P;  1FJP A;  2V7Q J;  1L0N J;  1FOS E;  2Q9I A;  3L74 D;  3II6 A;  4JQ0 D;  2JR8 A;  3H1J G;  4LLH A;  4PV1 C;  2M3E A;  4N78 D;  1BSN A;  2KS1 B;  4WWI A;  2P58 A;  2ZT9 C;  1FZG A;  4GOE A;  5B66 E;  3V2P A;  3CX5 I;  1VF5 C;  3CCJ P;  1KYO D;  3P8M C;  2BCC E;  1PL5 A;  3GHG A;  1RE3 C;  1L0N D;  3CXH H;  2PAJ A;  1L4A C;  3RGU A;  1JUN A;  1K04 A;  1SQP K;  2O01 N;  3W67 A;  1T3U A;  4UB6 E;  2J5U A;  2KP8 A;  1N2D C;  3M9H A;  1LNQ A;  4ZNC A;  4U3F G;  1YJN P;  1HWT C;  2G8Y A;  1CI6 B;  5AW1 B;  3E7K A;  1BCC E;  1K05 A;  2IPP A;  1ZRT E;  2IZ1 A;  1MFZ A;  1Q90 D;  2OYH A;  3KXD A;  1IO4 A;  1YIT P;  3WU2 E;  2WT7 B;  1LTB C;  3HD7 D;  2AXT H;  4HH2 A;  1JTH A;  2NPS D;  2WIT A;  1K73 Q;  1FZB A;  1USD A;  1KOR A;  3RBX A;  3IR9 A;  2WSS H;  4BRY A;  1ZR2 A;  2H89 C;  5AW2 B;  3T97 A;  2M3B A;  3D71 A;  4PJ0 E;  2KNC B;  2KSE A;  1N8R Q;  3FX0 A;  2XDJ A;  5BU5 A;  1XTC C;  2GUS A;  2QM7 A;  4AYC A;  4OGQ C;  3L72 D;  1KIL E;  3SWY A;  4WBA A;  4L76 A;  3MP7 B;  2YKO A;  1DH3 A;  3PTZ A;  1T3J A;  4RJT A;  3IF4 A;  1FZC A;  1FU1 A;  3L73 E;  1EZV G;  3HD7 C;  2E76 B;  2NPS C;  2R5B A;  1FZA A;  2JWD A;  1GK6 A;  4JPZ B;  1S2E A;  1SQQ J;  1NTK E;  2WSF J;  1NTM K;  3CLQ A;  4HKZ H;  1KC8 Q;  3VYI A;  3EFG A;  2J59 M;  1NU1 J;  3HE5 B;  4W7Y A;  1QL2 A;  3EWK A;  4JF7 A;  3CCQ P;  1DD3 A;  3A3Y B;  1JO5 A;  1N7S B;  1M1J A;  3M0D C;  2YXR B;  1GU4 A;  2YIU B;  5APT A;  1K8A Q;  2O01 H;  2WSE J;  4BRY B;  2IZ0 A;  1JY3 N;  3CX5 E;  3T97 B;  5AVZ B;  2FYN C;  1NU1 D;  3GG2 A;  2QJP C;  1VPC A;  1N73 C;  1VQM P;  4A7P A;  2GUV A;  3MD0 A;  3CWB G;  1SQP G;  4H13 B;  1PFI A;  1NWQ A;  3OAK A;  2WPQ A;  1L0L E;  2K9J B;  3IFM A;  2P2U A;  4RES B;  5AW6 B;  4I1L A;  3TGU J;  4OVN F;  5E79 H;  2OYH C;  2B89 A;  1GL2 A;  1J1D C;  5APY A;  4WY4 B;  3AE5 C;  1BDD A;  1SQB K;  2QE7 H;  2ZYD A;  2YKQ A;  1SFC D;  3VOP A;  3SWF A;  1XTG B;  3H25 A;  1SQV E;  1BE3 E;  1BCC J;  2WSF H;  1JB0 J;  1G1I A;  2BCC D;  2O3J A;  5APW A;  5M1B A;  4NPD A;  1VQN P;  3PRJ A;  1M1J B;  1MKM A;  1EZV I;  1YTZ T;  2OYI B;  3G6E P;  1HF9 A;  2XNX A;  1SQX K;  3FXE A;  2H43 A;  2XND H;  1ZRT D;  2Y9Y A;  1SFC C;  3AEE C;  2E5Y A;  1LWU A;  3PLN A;  1IFJ A;  4LGD E;  3H1J E;  3B5N A;  2WZ7 A;  2JO1 A;  4Z1M H;  1NTM G;  2O1J A;  2ZJS E;  3E1R A;  1VQK P;  1WT6 A;  2Z5I A;  3JCU H;  2VRS A;  3L73 J;  2KK7 A;  1GL2 B;  2KOG A;  1HBW A;  1S5L X;  5CCH A;  1Q86 Q;  3H6P A;  1NTK J;  5TJH A;  1FAV A;  1S1C X;  1OW6 A;  3FGA D;  2NRG A;  1KIL D;  4K3A A;  4U7J A;  1HGZ A;  3Q5R A;  1J1E C;  3KQG A;  1JNM A;  2QJY C;  1FJK A;  5CBN A;  1OW8 A;  3M06 A;  3RL0 g;  1ZOY C;  3BRV B;  3O6Q A;  5AW9 B;  3AE1 C;  4BXL A;  1M7L A;  4L75 A;  1X8Y A;  3L37 A;  3P7K A;  4EIJ A;  1RQU A;  2BEQ D;  1VQ7 P;  2IFN A;  2FYU D;  1RE3 A;  1SS1 A;  2HR3 A;  4PD4 H;  3B8E B;  5DJU B;  3TK1 A;  2FKW B;  1OWA A;  2LKM A;  3KDP B;  1Y9B A;  2E74 D;  1FDM A;  4DOJ A;  3CC7 P;  1NHL A;  3H1K G;  2IYP A;  1LWU B;  3L72 E;  3VN0 A;  5CCG D;  1KN7 A;  2Z4E A;  3CD6 P;  5KLI B;  4N3Y B;  2P1J A;  1KIL C;  2PP6 A;  3B5N B;  2KZJ A;  5AVW B;  1NH4 A;  1LTA C;  2KB7 P;  3VMA A;  1L0L J;  1LT1 A;  2E75 B;  2V4H A;  3BRT B;  4OWF A;  1MUU A;  3KPE A;  3CX5 D;  3L4F A;  2IBZ E;  1UIX A;  2WWW A;  5H2F E;  3CC2 P;  5KAI E;  2WTY A;  2HLO A;  4HYT B;  4DJG A;  4Y99 C;  5K5G B;  3AE6 C;  4PD4 I;  1IFM A;  1BE3 J;  1KB9 H;  1L0L D;  1SQV J;  3QH9 A;  4PV1 B;  2E74 C;  1LJ2 A;  2W83 C;  4IL6 H;  1SQX G;  2P10 A;  5CCG C;  3V2N A;  4EDF A;  4H0L D;  2ZT9 B;  3S9O A;  1SP4 A;  1PGO A;  1OW7 A;  1JCC A;  4KJM A;  1VF5 B;  1IJD B;  1W2E A;  2JJL A;  3NMD A;  4NPE A;  5AVS B;  1FS0 E;  1L4A B;  1N7L A;  3BCC G;  3GF7 A;  1Y8A A;  4EOT A;  2RMZ A;  2ZXE B;  3HD7 A;  2B9B A;  5KTB A;  1NTZ D;  1P84 I;  5APQ A;  1JCD A;  1T6A A;  1JY2 P;  2M0B A;  2J58 A;  4K35 A;  2K3R A;  3B4S A;  4R4L A;  3H1J J;  3EQ2 A;  3QWO C;  3D6Z A;  2JWA A;  2IX7 C;  3N7N A;  2W27 A;  4H0L C;  2YNY A;  3CWB E;  1SQP E;  1LT9 C;  4NPF X;  1SQQ K;  3AEA C;  2FXP A;  1EDJ A;  4WVZ A;  1W5C E;  2WQY C;  2CPB A;  3M0D A;  1U7M A;  1VQP P;  2D2C D;  3MTU E;  2HOD B;  1AVY A;  3A0B E;  1RF0 C;  1HGV A;  1ZR4 A;  4W7Z A;  4QMA A;  5B5E E;  1AV1 A;  5KKZ C;  3H1J D;  2QJK C;  2M8R A;  4LC1 A;  1AQT A;  2IYO A;  1JY3 P;  2FYZ A;  3MZW B;  3L75 G;  1N73 A;  3PJS K;  2Q7C A;  1UII A;  4OGQ B;  3R4Y A;  1LP1 A;  2ZYA A;  2K9Y A;  1IK9 A;  4GKG A;  5APU A;  2GA1 A;  4OGQ D;  3OA7 A;  1NKZ B;  1T2K D;  1EDL A;  3RK3 E;  4TLF A;  3HD7 B;  2NPS B;  3H1H G;  1ZME C;  2P67 A;  1PPJ G;  3Q5P A;  2D2C C;  3Q1M A;  1X22 A;  4U3F D;  4C7N A;  1QL1 A;  1FDO A;  3L72 J;  5AW5 B;  5APV A;  2O1K A;  2E43 A;  1CSB A;  2FFD A;  3F89 A;  4YTP C;  4L73 A;  3CXH I;  2LXC B;  1S5L E;  1KQL A;  2N1T A;  1H8A A;  1KYO H;  2H8P D;  2L91 A;  2V7Q H;  2XKM A;  3V6I A;  1X9V A;  1PGJ A;  1NTM E;  4KHX A;  3AED C;  2BEZ F;  3Q5S A;  3JSV C;  1T2K C;  2A45 H;  5AVU B;  3AEC C;  3GHG B;  3C8V A;  4IFF A;  2Y0C A;  3U1A A;  1H88 A;  2FYN B;  2QJP B;  5C39 A;  3H32 A;  5APS A;  4I7Z C;  1PV3 A;  1TU3 F;  1N73 B;  1M57 D;  2QG4 A;  2IBZ D;  1SFC A;  1LP1 B;  2FYU E;  5AVV B;  1EZV D;  2OYH B;  1QGK B;  4WB4 A;  1QVF O;  2W6B A;  4TT3 H;  3FXD A;  1LTG C;  1OIP A;  2RKL A;  1J1D B;  2QM8 A;  1U57 A;  5KAF E;  4C7N B;  1JTH B;  1ZP0 C;  1EC5 A;  1EXI A;  1SQQ G;  1HH0 A;  4GOD A;  1RH5 B;  1BDC A;  1VQ6 P;  1KZU B;  4JYB A;  1BSH A;  5GTH E;  3MIW A;  1SQP J;  1NTK K;  3RBZ A;  1NYH A;  2N1T D;  1JOC A;  1SQB E;  1OFC X;  4Y28 J;  1S9K E;  1GK4 A;  3KZI E;  4IFM A;  3VP8 A;  5BU8 B;  1AA0 A;  2R3C A;  4XA4 A;  2KSJ A;  3M0A A;  2BCC J;  2G3A A;  1M90 Q;  1FZC B;  2HFE D;  3L36 A;  3C1L A;  3V4Q A;  2HPC A;  1VQL P;  3HRN A;  1NO4 A;  3CWB D;  1SQP D;  2OTK E;  1SFC B;  2QVA A;  3I56 P;  2SPZ A;  3H1L G;  1KIL A;  1JEK A;  2OQQ A;  1IZN B;  2FY8 A;  2FFD C;  1AJY A;  3TGU G;  1YTZ I;  2N1T C;  1NTZ E;  5KLV K;  3W68 A;  2I1K A;  1JMB A;  2QA4 P;  1YYC A;  4D6T E;  3FWL A;  2E5T A;  3HE4 A;  4MN4 C;  3TSI A;  3BCC E;  1GU5 A;  3V5B A;  3CCS P;  3PH0 A;  1BCC G;  1J1E B;  2ZFC A;  2GM4 A;  1RE4 C;  2QJY B;  2QRX A;  1IFD A;  1N86 A;  3RK3 D;  5CCG A;  2WPV B;  2KI7 B;  1SLQ A;  1VL2 A;  2WSE H;  1A02 F;  3LIE A;  1G2C A;  3AE4 C;  3I5C A;  1NTM J;  1KQG B;  1EDK A;  2AXT E;  4XFJ A;  1SQV K;  3OW2 O;  4HB1 A;  5AW3 B;  3NFQ A;  1EXJ A;  2L5G B;  1LGH B;  2WVR A;  1KFN A;  4UB8 E;  5B66 H;  2AXC A;  3USS A;  3A0B H;  2HPC B;  1ZN5 A;  1GMJ A;  2Q3I A;  2FBW C;  2Y0D A;  2Y9Z A;  1KIL B;  1FZF A;  2K37 A;  1NTM D;  1RY3 A;  2FYU J;  3AE9 C;  4ASV A;  4RKU J;  2R3S A;  4UB6 H;  3RK3 C;  1PGQ A;  3L75 E;  5CBO A;  1AQ5 A;  1FBM A;  1AVO A;  1URQ A;  3L73 G;  1LT9 A;  3VTP C;  4GT1 A;  3OJA B;  1PP9 G;  5TIS E;  3CCU P;  4U3F E;  3LW5 J;  3HE4 B;  3TYY A;  4B86 A;  1AFO A;  2MKV A;  3H1I G;  1L0N K;  1NTK G;  3CC4 P;  4IFD K;  2WSC J;  1BGY G;  1RF0 A;  2Q1K A;  1P84 D;  4Y99 B;  3WU2 H;  3G9R A;  4BWN A;  3H1H E;  2JKV A;  2MJZ A;  1PPJ E;  2E74 B;  1LTI C;  1USE A;  1IC2 A;  3A0H E;  4C46 A;  1KQS O;  5GTI E;  1JY2 O;  1SQB J;  3RL0 D;  5BVZ A;  1FC2 C;  1HJ0 A;  3K5B A;  1PIX A;  4IOI H;  5AVR B;  3SSU A;  3A5T A;  1CW5 A;  4PJ0 H;  5AVQ B;  4IL6 X;  4YPC A;  1GTW A;  1PGP A;  4GIF A;  2AEJ A;  2C9L Y;  5APX A;  1LTJ A;  1GZL A;  1CZQ A;  3H1K D;  2A06 G;  1T8Z A;  2OTJ P;  3ITK A;  5KLV G;  2I1J A;  2HYN A;  2XZR A;  4YXW H;  1SQB D;  1IFN A;  3B71 A;  1S9K D;  1EZV E;  3AE8 C;  3TDK A;  3EFF K;  4H0L B;  1PZQ A;  1JY3 O;  1GW4 A;  2KS1 A;  1LT9 B;  1NTZ J;  4I2L C;  4I6M C;  3L71 G;  3RL0 C;  4D6T J;  5E79 E;  3RK2 D;  3HUS C;  1URQ D;  3E1I A;  5CMZ A;  3P8C E;  3CCE P;  3O6Q B;  2ZVO B;  3M9Q A;  3BCC J;  3MGN A;  1H89 A;  1KMI Z;  3LW5 H;  5KKZ B;  2QJK B;  1WMK A;  1NVO A;  4DCK A;  1RF1 C;  1SQV G;  1BE3 G;  1RHZ B;  3L70 G;  1YIJ P;  1SQX D;  2QIW A;  3V2R A;  2ZYG A;  1HTL C;  3PP5 A;  3CXH D;  5AW0 B;  2W6J H;  4D6T D;  3CX5 H;  1OXZ A;  4H44 D;  1EDI A;  4OH8 B;  2JP3 A;  1W2B O;  4EYY Q;  1NGM B;  3L74 G;  1WRG A;  3S4R A;  5KJ7 D;  3BCC D;  1GW3 A;  4ZKU A;  2KLU A;  1KB9 I;  2WT7 A;  3RK2 C;  2DW3 A;  1URQ C;  4L74 A;  2D2C B;  1S4X A;  5AVT B;  1QVG O;  1SVF A;  1LTS C;  2Q6Q A;  4GDO A;  1YBK A;  2ZAE B;  1NU1 K;  1VQ8 P;  1L0N G;  2LXB A;  4ZMD A;  2OGU A;  3SFD C;  2KNC A;  1LTT C;  3IN6 A;  3L75 J;  3CCV P;  3H1L E;  2A45 G;  4H44 C;  3JCU E;  3CCR P;  4U3F J;  1Y47 A;  5KJ7 C;  1JM0 A;  3TGU E;  4KT0 J;  2ZVN B;  4CPG A;  3WUT A;  3H1H J;  3D70 A;  1R5S A;  4I7Z B;  2H88 C;  2P7J A;  1QLE D;  1LTJ C;  3UIA A;  3L75 D;  1NOH A;  3WUV A;  2YO2 A;  1E79 H;  1HJB A;  1IFP A;  3CCM P;  4AUW A;  1X79 B;  3HE5 A;  3G4S P;  3G71 P;  1NJI Q;  2O01 J;  3P32 A;  3H1H D;  4JBZ A;  2FXM A;  1X0T A;  1PPJ D;  4PD4 E;  1N7S A;  5CHX A;  2R5D A;  2C0W A;  1VQ4 P;  3TNU A;  3L72 G;  1GDT A;  4UB8 H;  1VQ9 P;  1ZXG A;  2KUB A;  2E42 A;  1KFM A;  3O8Z A;  1NAF A;  2Q3E A;  1U7J A;  1FOS F;  1RE4 A;  2CPS A;  1ZV8 A;  4O9B A;  4RO0 A;  3Q3D A;  3AEF C;  2IBZ G;  1YI2 P;  5AW4 B;  3NXS A;  3WUU A;  1DEB A;  2KXP B;  1P84 E;  2K9J A;  2PRR A;  3MUD C;  1GD2 E;  1M8O B;  5TIS H;  3KYQ A;  2R32 A;  5AVX B;  1PP9 E;  3BAS A;  3VMY A;  1JY2 N;  5DJT B;  1KTM A;  1H0T A;  1KYO I;  1FZE A;  1QEX A;  3H1I E;  1KB9 E;  3G3Z A;  3JC2 2;  1MZ9 A;  4WY4 A;  1BGY E;  3FWN A;  2E76 D;  5AW7 B;  4IL6 E;  2M5A A;  1HVV A;  5CJ4 A;  1OVU A;  2WPR A;  3ZDM A;  3A0H H;  3P8C D;  2A45 I;  2XV5 A;  2FFD B;  2ITA A;  2YKP A;  5GTI H;  2B87 A;  1NU1 G;  5L8R J;  2N1T B;  2Q5U A;  3CI9 A;  3H1K E;  1YQ3 C;  3CWB J;  2YXQ B;  1SQQ D;  3TNU B;  3BAT A;  2OYO A;  1N7S D;  4ASW A;  2W6A A;  2FYU K;  3BVH A;  3LID A;  2OYI A;  3GHG C;  2R44 A;  4GOF A;  3V4W A;  4JYC A;  3GF3 A;  1M56 D;  2A06 E;  5H2F H;  1YJW P;  1VDF A;  3F5H A;  5KLV E;  5KAI H;  3ABV C;  3H32 B;  2FXO A;  2H7H A;  3PHL A;  1FE6 A;  2E76 C;  3R2P A;  2JDI H;  1G1J A;  3H1L J;  1Q81 Q;  2OTL P;  3MHV A;  1FDI A;  1OMI A;  2KZI A;  4H13 D;  3AE3 C;  3HTK A;  2KIK A;  3M91 A;  1SQX E;  1NAY A;  3GW6 A;  3L71 E;  2BCC G;  3N4X A;  1D7M A;  4N6J A;  2YO3 A;  1H0T B;  4AQR D;  2N9Y B;  2PGD A;  3AE2 C;  3CXH E;  1N7S C;  5AVY B;  2YIU C;  2AEM A;  2M5A B;  3CMA P; 
#chains in the Genus database with same CATH homology
 1T3J A;  4C46 A;  2YNY A;  4WY4 D;  1LT9 C;  1L0L K;  1JY2 O;  1SQQ K;  1FZC A;  1FU1 A;  1EQ7 A;  4W80 A;  3RL0 D;  5BVZ A;  3HD7 C;  2CPB A;  3M0D A;  2NPS C;  3RK3 B;  5AVR B;  3A5T A;  1CW5 A;  2R5B A;  1FZA A;  5AVQ B;  3MTU E;  2HOD B;  1DX7 A;  1GK6 A;  1RF0 C;  1GTW A;  1ZLL A;  1HGV A;  1ZR4 A;  4W7Z A;  1NTM K;  4GIF A;  2KLV A;  2BAS A;  3CLQ A;  3M9B A;  2C9L Y;  2M8R A;  5APX A;  1LTJ A;  1GZL A;  4LC1 A;  1CZQ A;  3VYI A;  2C9N Y;  3EFG A;  3HUS A;  1HUC A;  2J59 M;  2JEE A;  1T8Z A;  2OAR A;  1JY3 P;  3HE5 B;  4W7Y A;  2I1J A;  2FYZ A;  2HYN A;  2XZR A;  4N78 E;  1QL2 A;  1N73 A;  4JF7 A;  1FZC C;  2Q7C A;  3A3Y B;  1IFN A;  1JO5 A;  1NTZ K;  1RF1 A;  1N7S B;  1M1J A;  3M0D C;  1S9K D;  1GU4 A;  1IK9 A;  3U59 A;  5APT A;  4GKG A;  5APU A;  1JY3 O;  1GW4 A;  3OA7 A;  1LT9 B;  1NKZ B;  2O01 H;  4WY4 C;  1T2K D;  4I2L C;  4I6M C;  2HG5 D;  1JY3 N;  3HD7 B;  3RL0 C;  3RK2 D;  2NPS B;  5AVZ B;  3HUS C;  1URQ D;  2P67 A;  3E1I A;  5CMZ A;  3P8C E;  2C0X A;  2N9B A;  3HTK B;  3M9Q A;  1VPC A;  3MGN A;  4C7N A;  1QL1 A;  5AW5 B;  1H89 A;  1N73 C;  4XE5 B;  3LW5 H;  5APV A;  2GUV A;  3MD0 A;  2O1K A;  2E43 A;  1RF1 C;  1PFI A;  1M1J C;  1NWQ A;  1CSB A;  3OAK A;  2FFD A;  1GL2 D;  2WPQ A;  3V2R A;  3V2Q A;  1KQL A;  2N1T A;  1H8A A;  1HTL C;  3PP5 A;  2H8P D;  3IFM A;  2P2U A;  4RES B;  5AW0 B;  5AW6 B;  4I1L A;  2OYI C;  2XKM A;  2OYH C;  1OXZ A;  1X9V A;  4OH8 B;  1GL2 A;  1WRG A;  1A02 J;  1J1D C;  4KHX A;  5KJ7 D;  5APY A;  1GW3 A;  4ZKU A;  4WY4 B;  1SQB K;  1T2K C;  2IFM A;  2A45 H;  5AVU B;  3GHG B;  4IFF A;  3RL0 B;  2YKQ A;  2Z5H A;  3A2A A;  2WT7 A;  3A7O A;  1SFC D;  3RK2 C;  1G2C B;  3HUS B;  3U1A A;  1H88 A;  3VOP A;  3SWF A;  1URQ C;  1XTG B;  5AVT B;  3H32 A;  3CL3 D;  5APS A;  2WSF H;  5KJ7 A;  1G1I A;  1SVF A;  1J2J B;  1MV8 A;  4ZKP A;  1N73 B;  5APW A;  1L4A A;  3VMZ A;  1LTS C;  4C7R A;  1SFC A;  1RF1 B;  1NU1 K;  1M1J B;  1GL2 C;  2XU6 A;  1NKN A;  1YTZ T;  1LTT C;  2KYV A;  5AVV B;  2OYI B;  2OYH B;  2XNX A;  1SQX K;  2A45 G;  1JMM A;  4WB4 A;  2W6B A;  2WPS A;  2H43 A;  3L35 A;  1LTG C;  1J1D B;  3B5N D;  5KJ7 C;  2QM8 A;  4C7N B;  1JTH B;  4DZO A;  1HH0 A;  3NTN A;  1E5W A;  3RK2 B;  1SFC C;  1LWU A;  1URQ B;  1IFJ A;  4LGD E;  3B5N A;  2P7J A;  2WZ7 A;  1LTJ C;  3UIA A;  2POH A;  1KZU B;  5CCH D;  2HOD A;  4JYB A;  2O1J A;  1NOH A;  3MIW A;  1WT6 A;  2Z5I A;  2YO2 A;  1NTK K;  2VRS A;  2N1T D;  1HJB A;  1GL2 B;  4AUW A;  2KOG A;  1JOC A;  1HBW A;  1X79 B;  2YMY A;  3HE5 A;  1S9K E;  5CCH A;  5AW8 B;  3H6P A;  1GK4 A;  2WSC H;  4IFM A;  3VP8 A;  3VMX A;  5BU8 B;  3WMM 0;  2R3C A;  3P32 A;  1FAV A;  4M3L A;  4XA4 A;  2KSJ A;  1LWU C;  3M0A A;  2FXM A;  1N7S A;  1FZC B;  1KIL D;  5CHX A;  3B5N C;  2R5D A;  1HGZ A;  2HFE D;  3L36 A;  1J1E C;  3KQG A;  3V4Q A;  2C0W A;  1JNM A;  3C9I A;  1Z56 A;  2HPC A;  1CI6 A;  3TNU A;  3U1C A;  3MUD A;  3HRN A;  1NO4 A;  1FJK A;  1GDT A;  1SFC B;  3M06 A;  3VP9 A;  5CJ0 A;  1L4A D;  2NPS A;  3BRV B;  1KIL A;  1IFI A;  2E42 A;  1KFM A;  3O8Z A;  1LTJ B;  1NAF A;  5AW9 B;  5CCH C;  1FOS F;  1RE4 A;  1M7L A;  1X8Y A;  2FFD C;  2CPS A;  3L37 A;  3P7K A;  1ZV8 A;  4O9B A;  4EIJ A;  2IFN A;  1FJP A;  1YTZ I;  1RE3 A;  2N1T C;  5KLV K;  2I1K A;  1FOS E;  3B8E B;  2Q9I A;  3II6 A;  1YYC A;  2FKW B;  5AW4 B;  3TK1 A;  3NXS A;  1OWA A;  1DEB A;  2LKM A;  3KDP B;  3HE4 A;  4LLH A;  1FDM A;  3TSI A;  4DOJ A;  1NHL A;  4N78 D;  1GD2 E;  1LWU B;  5CCG D;  3VN0 A;  3KYQ A;  2Z4E A;  1GU5 A;  2R32 A;  5AVX B;  3BAS A;  3VMY A;  3V5B A;  4N3Y B;  2P1J A;  1KIL C;  1JY2 N;  2PP6 A;  3B5N B;  1FZG A;  1FZE A;  2ZFC A;  1J1E B;  1NH4 A;  1LTA C;  2KB7 P;  5AVW B;  3V2P A;  2GM4 A;  3G3Z A;  1RE4 C;  1MZ9 A;  4WY4 A;  1IFD A;  1N86 A;  5AW7 B;  3RK3 D;  3P8M C;  3BRT B;  5CCG A;  3GHG A;  1MUU A;  1HVV A;  1SLQ A;  1RE3 C;  2WSE H;  3KPE A;  1A02 F;  2PAJ A;  3L4F A;  3LIE A;  1G2C A;  1L4A C;  5CJ4 A;  2WPR A;  1JUN A;  3P8C D;  3I5C A;  2A45 I;  2WWW A;  2XV5 A;  1SQP K;  2FFD B;  2YKP A;  1SQV K;  1T3U A;  5AW3 B;  2N1T B;  2Q5U A;  2KP8 A;  3CI9 A;  3NFQ A;  1N2D C;  3M9H A;  2WTY A;  2L5G B;  2HLO A;  4HYT B;  1LGH B;  4Y99 C;  1KFN A;  1IFM A;  2HPC B;  1ZN5 A;  1HWT C;  1CI6 B;  3TNU B;  5AW1 B;  3BAT A;  1N7S D;  2W6A A;  2FYU K;  2IPP A;  3BVH A;  2Q3I A;  3LID A;  2OYI A;  1MFZ A;  5CCG C;  3GHG C;  3V2N A;  2OYH A;  1KIL B;  3V4W A;  4JYC A;  1FZF A;  1IO4 A;  1SP4 A;  2WT7 B;  1LTB C;  1RY3 A;  3HD7 D;  1VDF A;  1JCC A;  4HH2 A;  1JTH A;  3H32 B;  2NPS D;  2WIT A;  2H7H A;  1IJD B;  1W2E A;  2JJL A;  3RK3 C;  3R2P A;  1FZB A;  3NMD A;  1G1J A;  5AVS B;  1AQ5 A;  1FBM A;  1L4A B;  1N7L A;  1URQ A;  3IR9 A;  4EOT A;  1LT9 A;  3VTP C;  4GT1 A;  3OJA B;  1ZR2 A;  3HE4 B;  2ZXE B;  5AW2 B;  3T97 A;  3HD7 A;  3TYY A;  4B86 A;  1AFO A;  5KTB A;  2M3B A;  5APQ A;  1L0N K;  1JCD A;  4IFD K;  3HTK A;  3M91 A;  1RF0 A;  1JY2 P;  3N4X A;  4Y99 B;  2XDJ A;  5BU5 A;  2J58 A;  4N6J A;  2YO3 A;  1XTC C;  2GUS A;  2QM7 A;  4AQR D;  4AYC A;  2MJZ A;  3EQ2 A;  1LTI C;  1IC2 A;  1N7S C;  3SWY A;  4WBA A;  5AVY B;  2IX7 C;  3N7N A;  2YKO A;  1DH3 A;  2W27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...