4AUWA

Crystal structure of the bzip homodimeric mafb in complex with the c- mare binding site
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
87
structure length
87
Chain Sequence
SDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords TRANSCRIPTION FACTOR MAFB
publication title Expression, purification, crystallization and preliminary crystallographic analysis of the mouse transcription factor MafB in complex with its DNA-recognition motif Cmare
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 87
sequence length 87
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03131 bZIP_Maf bZIP Maf transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4auwA00
2R32A 2WPRA 5AVQB 5AW0B 5AVTB 2Q5UA 3IR9A 1FOSE 4AQRD 3V4WA 1S9KE 1CI6B 2BASA 5CMZA 1MV8A 2R5DA 4GT1A 4JYBA 2E43A 1CSBA 2ZFCA 1S9KD 3V5BA 3TNUA 3OAKA 2Z5HA 4LC1A 5AVZB 1H89A 3V4QA 3VMYA 2P2UA 4KHXA 1HWTC 2WT7B 3VYIA 3L36A 2XU6A 2YO2A 4C46A 5AW5B 3A7OA 5APVA 1GZLA 3NXSA 3B8EB 5APQA 1CI6A 1G2CB 1FAVA 1GTWA 1JUNA 5AVXB 3VN0A 3M9BA 4EOTA 5AW2B 5APTA 3VTPC 1SLQA 2P7JA 3VMZA 1SP4A 1GK4A 2N9BA 3NTNA 3HE5B 1OWAA 1IO4A 5AW8B 1GK6A 5AVVB 1HJBA 2P67A 3P7KA 5AVWB 4XE5B 3L35A 3LIDA 4M3LA 2WPSA 3KQGA 3I5CA 2C9LY 2Q3IA 2YO3A 2QM7A 2W6AA 4DZOA 1GU5A 2WTYA 2R5BA 4GKGA 1A02J 3T97A 3HE4B 3L37A 1JNMA 3TYYA 1GD2E 2JJLA 3SWFA 3HE5A 3M0AA 1T2KC 4AUWA 2C9NY 2E42A 1MUUA 1HUCA 2W27A 1OXZA 1X8YA 2YNYA 2ZXEB 4JYCA 5AW4B 1HBWA 5AW7B 3O8ZA 5AVUB 5AW1B 1NAFA 4I2LC 1H88A 2WT7A 3M0DA 5APYA 5AW6B 2H7HA 2QM8A 2KP8A 3HE4A 3TNUB 1T2KD 2WWWA 4HYTB 5APWA 3VMXA 1YYCA 1H8AA 5APUA 4C7NB 5AW9B 5APSA 2VRSA 1MFZA 5AVRB 2IPPA 3M9HA 3MD0A 2Q7CA 1KQLA 1CZQA 3LIEA 3A2AA 3TK1A 1FOSF 1DH3A 4B86A 1NWQA 2Z5IA 4RESB 2R3CA 4I6MC 5AVYB 4AYCA 1A02F 3A5TA 1GU4A 3P8MC 5AW3B 3M06A 3M91A 3NMDA 2XZRA 3NFQA 2WPQA 4C7NA 3MGNA 5AVSB 2XV5A 3HTKA 1J2JB 3A3YB 3P32A 5APXA 3KDPB 3UIAA
chains in the Genus database with same CATH superfamily
1JY2N 1FE6A 4HJGH 1SQXK 1L0NK 1KILD 1AQTA 2XNXA 1OX3A 1RE3C 1FC2C 2CK3H 3TNUA 3WUTA 3OAKA 5BU5A 3CXHI 2M0BA 1RE3A 4H0LD 2YO2A 2H88C 1PP9J 5AW2B 1IFMA 1SP4A 2FXPA 3G3ZA 1GK6A 1HJBA 1OFCX 1GW4A 3S9OA 2R5BA 3CD6P 1GMJA 1E79H 1LTJC 2DW3A 2IDBA 4I7ZB 3M0AA 1OMIA 1LTJA 3CC7P 3Q2YA 5KJ7A 1AQ5A 2ZJSE 1AFOA 1LTAC 2LXCB 3PJSK 1PPJG 1T2KD 4UB8E 3H1KE 4IFFA 1K73Q 4EYYQ 1BGYE 1LJ2A 1W2BO 5H2FH 1RF1B 2YMKA 2WSCH 4AYCA 3CX5I 3WUVA 3B5NA 3MGNA 1JY3P 3FWLA 2OYOA 3A0BE 1XTCC 1DX7A 1H0TB 3H1JJ 1YITP 2JO1A 4JQ0D 2NPSC 2O3JA 1YHQP 3CXHE 3L72E 1NTKE 2FFDC 1PGQA 3M9QA 2ZT9B 2ZYDA 1YBKA 2WT7B 3L70G 2WSEJ 1S5LE 3D71A 5APQA 4D6TE 1USDA 1FAVA 1SQBE 2BCCJ 1KN7A 1EDIA 3VMZA 3F5HA 3HE5B 3MUDC 3H1ID 1PL5A 3MUDA 1J1EB 5CCHC 2OYIC 4IOIH 1LP1A 5DJUB 2WTYA 5CCHA 2OYIA 2YKOA 1SFCB 2QIWA 3L71D 1RF0C 2B87B 2CPSA 5AW4B 3H1KG 2KI7B 3HUSB 4A7PA 1BGYG 2YKPA 3CWBJ 1LTGC 3L75J 2ZT9D 1SQXE 1NHLA 2HR3A 2YXQB 1YYCA 2KB7P 1M7LA 1K8AQ 3TGUE 1GL2C 1FZEA 1K04A 1Q7YQ 2FYUJ 3CX5E 4C7RA 2AEFA 1EXJA 1GL2A 4OGQB 4U7JA 2KNCB 2XZRA 2Q1KA 1Y8AA 3L74D 4U3FD 1ZLLA 2QRXA 3MIWA 3H1HD 3L72G 1NTKG 3LW5H 3UIAA 3QH9A 1BCCE 3W68A 5AVQB 1FU1A 1KFMA 3D70A 5CMZA 2OARA 1SFCD 2KYVA 4JYBA 1S5LX 4D6TG 2PGDA 3V5BA 1SQPE 1QVFO 3VMYA 3CC2P 4PD4H 1R5LA 2FXOA 1BDCA 1BE3D 2SPZA 1NTMD 3T97B 3PH0A 4LGDE 2HLOA 3BCCJ 5AW8B 2Y0CA 3WMM0 4TLFA 4OGQD 1U57A 4PJ0H 4N6JA 1SQQD 4IFMA 2Q3IA 1JB0J 3JSVC 2Y0EA 3U1CA 2A45H 4IL6H 3G71P 3PP5A 2ZXXA 1T6AA 4PV1B 4GOFA 1JEKA 3FX0A 3TGUG 3SWKA 3TNUB 3HE4A 5KLVK 1L0LK 3JCUE 2C0WA 1SVFA 4ASVA 4EDFA 2LR2A 1NTZE 1P84H 3H1LD 3TK1A 3GMAA 1ZW0A 1LWUA 3AE9C 1OVVA 4I6MC 1ZN5A 3BASA 1BCCG 4UB6H 1SQBJ 2WPQA 1FZCC 5K5GB 1VQPP 4WY4C 2K9YA 5KAIH 2ZVOB 4WY4A 3KXDA 3AE2C 1CI6B 1OVRA 1PGPA 1LTJB 2R44A 4ASWA 3C9IA 1D7MA 4PV1D 1JY2O 4RO0A 2QJYB 1IC2A 4BXLA 5B66E 3USSA 5H2FE 4HKZH 1IFDA 2OYHC 1NU1E 2OYHA 3VTPC 1KORA 5KKZC 1SQXJ 1L0NJ 4DCKA 4M3LA 3I5CA 2OQQA 2KLUA 5B5EE 1EDJA 4OVNF 4RJTA 1J1DC 2Y9ZA 1VF5C 2O01H 4JBZA 2E42A 1PPJD 2NPSB 5TJHA 2JKVA 1N2DC 1NTZG 2QM8A 3KYQA 4K35A 2KZIA 1L4AB 1MZ9A 2R3SA 5APUA 2FFDB 2OTJP 2VRSA 3M9HA 2E74C 1UIIA 2HYNA 1S3JA 1SQPJ 3A2AA 3TF5A 3CLQA 2HODA 4YXWH 1IK7A 3M91A 3GF3A 1YTZI 4C7NA 5AVSB 1N8RQ 1LP1B 3FGAD 3EQ2A 4H13C 2D2CC 2OYIB 2R5DA 3I55P 4N78E 3L70D 2NPSD 5AVZB 3GHGC 3BRTB 3VMAA 1M1JC 1L4AD 3GHGA 1KQFB 3B8EB 1NKZB 5GTHH 1GTWA 2QA4P 1FDMA 1M8OB 1M1JA 1KMIZ 2WQYC 1OWAA 2YXRB 3F89A 1FZGA 1GL2B 2K88A 1R5SA 1G2CA 1SQVE 1VPCA 3I56P 3RBZA 3H1JE 1BGYD 1RQVA 1OXZA 3RK3B 2IX7C 2H43A 3A0HH 2HPCA 5E79H 1KB9I 2I8DA 5APWA 3L4FA 5TISE 1PP9G 5AVRB 2PRRA 2N1TB 3CMEP 5CBNA 3D6ZA 2W90A 2O01N 2R3CA 3RL0g 2BCCE 3L72D 1NTKD 1NU1J 2M5AB 1GL2D 2WSCJ 2XV5A 3WU2H 1S1CX 3IR9A 4D6TD 1ZOYC 3AECC 1PGOA 1VL2A 2UWJE 2Z5HA 3EFFK 1NJIQ 2K9JB 5CBOA 3GG2A 1VQMP 1EQ7A 1YJWP 4U3FJ 1GW3A 3CWBE 5APTA 3L75E 2E76C 1GK4A 2N9BA 2N1TD 4GDOA 2A06E 5CHXA 2KSEA 3L73J 2FYUE 1N86A 5KAIE 3H1JG 4NPFX 2J59M 1A02J 3RL0B 3Q1MA 3ABVC 1N73C 1LTBC 1FZCB 3W67A 3KPEA 2QEXP 3TGUD 1KFNA 1N73A 4WY4B 2ZXEB 1KB9E 3CX5D 2AXTE 1NAFA 1VQLP 4I2LC 2H7HA 1G1IA 4O9BA 3CCRP 2BCCG 1KC8Q 1IFJA 2J5UA 3AEFC 1CZQA 2IZ1A 5KJ7C 1BCCD 1BSNA 3CCJP 2OYHB 4RESB 1U7JA 1M56D 1EXIA 5KKZB 3BCCE 5KLVJ 1L0LJ 3A3YB 1HH0A 3SWYA 2KS1B 3RL0D 1DD3A 1S9KE 3LW5J 4ZKPA 1KYOH 1SQVJ 2WZ7A 1J1DB 4WY4D 3B5NC 1VF5B 3H1LJ 4XFJA 1KD1Q 3CWBG 3L75G 1HWTC 5KAFH 3CL3D 2M8RA 3OJAB 2A06G 4MN4C 4LLHA 1IK9A 2FYUG 3VN0A 2E75C 3HRNA 3CCSP 1JTHA 3NTNA 1IO4A 3P8CE 2HODB 4WVZA 3LIDA 1ZRTE 3KQGA 1M57D 2JJLA 1T3JA 3MTUE 3RK2C 1FZFA 4DJGA 1X8YA 3FXEA 1NTZD 4NPEA 5AW7B 5AW6B 4H13B 1VF5D 2D2CB 3AEEC 2M3BA 3Q3DA 2Q6QA 4GODA 4ZKUA 3BCCG 1KYOD 2H89C 5AVYB 1ZMEC 3C8VA 2E74D 2K1AA 4GIFA 1X0TA 1L0NE 3AE3C 3GLMA 5AW0B 1KILE 3KZIH 4AQRD 2BASA 4WBAA 2PP6A 1URQC 1URQA 2P2UA 4H13D 1FZAA 2D2CD 3C1LA 1LTTC 2P58A 5GTIE 1VQKP 3HD7A 4W7YA 1SQBG 3O6QA 1LTSC 1W5CE 3TSIA 1OIPA 4YXDC 1NGMB 5KLIB 3CCQP 1PGJA 2WMMA 2B9BA 1N7SC 3H32B 4IFDK 1S2EA 4L73A 2GUSA 1WT6A 1YI2P 1NTMK 1N7SA 2O01J 1PP9D 4HYTB 2IYOA 3B71A 5C39A 1KILA 2K37A 3HTKB 1SQQK 2BEQD 3BRVB 1OW7A 1SQXG 1L0NG 2QVAA 3P8MC 3NFQA 1U7MA 1JOCA 3CI9A 2NZ2A 3BATA 1EDKA 1LWUC 1Y9BA 2QJKC 1N73B 4K3AA 1T3UA 1KTMA 3AEAC 3VYIA 1NH4A 2QJPC 3A7OA 3U59A 1QEXA 1YIJP 1VQ4P 2KSJA 1SQPG 1Q2NA 3U1AA 1ZXGA 3H1JD 5CJ0A 1VQNP 2KIKA 1VQ8P 2E76D 2IFMA 1FZBA 1S72P 3IF4A 3L71E 1LT9C 4ZNCA 1W2EA 1LT9A 1VQ7P 1TU3F 3O8ZA 5CCGC 1USEA 3II6A 3CMAP 1OVUA 2BCCD 2KP8A 2RN0A 5CCGA 2V7QH 3B5NB 1AVYA 3MHVA 1PFIA 4B86A 1NVOA 3L74E 1A02F 3VP8A 4U3FE 2FKWB 2E75B 5KJ7D 4QMAA 1J2JB 3CC4P 3EFGA 3L73E 1RF1A 4PD4I 4Z1MH 4UB8H 2YIUC 3V4WA 3AE4C 1S4XA 3CWBD 1EZVI 3L75D 2A06D 1H0TA 4LC1A 3RK2B 1LTIC 4KHXA 2FYUD 4C46A 2FYZA 2GM4A 3D6YA 4L74A 1NYHA 3A0BH 3B5ND 3ZDMA 3M9BA 3AE5C 2A45I 4BRYA 1SQQE 3CXHH 1NU1G 1KB9D 2LKMA 3L35A 4JPZB 2XNDH 1L2PA 3G6EP 2E75D 4W7ZA 1ZV8A 4GKGA 2HG5D 4WWIA 3L37A 1WRGA 3HE5A 1J1EC 4AUWA 3E7KA 1P84I 5KLVE 1L0LE 1LT1A 2B89A 2W83C 5AVUB 3Q5RA 2JWAA 1H88A 3RK2D 3VMXA 1URQB 1H8AA 4L75A 3H1LE 3HUSC 4U3FG 1FJKA 2B87A 4W80A 3H1KD 1R8EA 2IBZI 3HUSA 2BEZF 1RY3A 1FOSF 2JEEA 1NWQA 1JMMA 2Z5IA 5CCHD 3L73G 1MKMA 1QL1A 3CPWO 1IZNB 4PD4E 1YQ3C 3O6QB 3H1IJ 3IAOA 3P32A 4OWFA 4OGQC 3RBXA 2IYPA 2WSFH 4RKUJ 1EZVE 5AVTB 1FOSE 2JWDA 2Y0DA 1BDDA 3CX5H 3FXDA 4PJ0E 1LNQA 3CXHD 1Q82Q 3L71J 1N7SB 1XTGB 2YKQA 4OH8B 4IL6E 1NTKK 1WMKA 1URQD 1RE4A 4R4LA 1SQBD 3Q5SA 1SQBK 3AE6C 4JF7A 5KLVG 1L0LG 1P84E 1K9MQ 3T97A 1G1JA 3HE4B 4N3YB 1JNMA 3L74J 1PPJE 1MUUA 1QX8A 2G8YA 3H1HJ 4UB6E 1SQVG 3R4YA 1YJNP 1LWUB 1Y47A 2WWWA 1CW5A 1N7SD 2NRGA 2IBZE 2QJKB 2E5TA 3B4SA 2IPPA 1SQXD 1L0ND 3PHLA 3AE8C 2QJPB 3CCLP 1FDOA 4XA4A 1BE3J 2I1JA 2P1JA 1NKNA 1NTMJ 3KHUA 1EZVG 3G9RA 2ZYGA 2KXPB 2FBWC 1Z56A 3KDPB 4H44C 1ZR4A 2R32A 3RGUA 4YPCA 3JCUH 1SQQJ 3AE1C 3L70E 4GT1A 1T8ZA 2ZAEB 4IL6X 2A45G 1LT9B 1QVGO 3MP7B 4R4MA 1SQPD 2POHA 4NPDA 5APVA 1GZLA 3NXSA 3OA7A 1CI6A 1IJDB 1BSHA 1SQPK 2QJYC 5CJ4A 3JC22 2IFNA 1QGKB 2WPSA 4EI2A 1NAYA 4EIJA 4HH2A 5B66H 1RQUA 2M3EA 3H25A 2OTLP 2FYNC 4Y28J 3TYYA 1SS1A 3IFMA 2RKLA 1KV4A 4I1LA 2IBZG 3TDKA 1PIXA 1IFNA 2E74B 1KZUB 1OZHA 1VQ6P 2YIUB 2K3RA 4DOJA 1E5WA 2JP3A 1MFTA 4C7NB 5AW9B 1AVOA 1MFZA 5B5EH 3MD0A 2Q7CA 3V2PA 5CCGD 2O1JA 3LIEA 2NPSA 2W6JH 1ZP0C 1L4AC 2O1KA 2PFXA 2FXMA 1L4AA 2KZJA 4BRYB 3PLNA 1NTZK 2FFDA 5GTHE 2WPRA 1JY3N 3GHGB 3RK3E 1M1JB 4GOEA 1AV1A 4KT0J 2CPBA 3L36A 1N7LA 2WITA 5M1BA 2KK7A 2WPVB 1G2CB 5AVXB 3V6IA 1DD4A 4BWNA 1NU1D 3A0HE 4L76A 2ITAA 1VQ5P 3CCMP 3CCEP 5E79E 1RF0A 5AVVB 1NU1K 3WUUA 1JM0A 1QL2A 2HPCB 2YMYA 5DJTB 1HVVA 1GD2E 4Y99C 3HD7C 2JR8A 2PAJA 1Q90D 5APYA 1AJYA 3WU2E 3RK3C 3L70J 1UIXA 1DEBA 1YQ4C 3EWKA 2GUVA 2W8ZA 3PRJA 3L73D 2P10A 2V7QJ 3AEGC 1KYOI 3A5TA 1IFPA 3NMDA 3N7NA 5BVZA 2N1TC 3AEBC 1RHZB 5EFWB 1KILC 2MJZA 3ITKA 5APXA 2N1TA 1OW8A 2H8PD 3S4RA 2WSSH 1K05A 5TISH 4H0LC 2XKMA 1MV8A 2E43A 2M5AA 3G4SP 3MZWB 3GW6A 3H1KJ 2C0XA 2WSEH 3BVHA 3V4QA 1BGYJ 1DEEG 1AA0A 2E76B 4N78D 1NO4A 2AEMA 2B88A 2GA1A 2IZ0A 2WVRA 3E1IA 3H6PA 1YTZT 1SLQA 2P7JA 1QLED 1HJ0A 5KLVD 1L0LD 4HB1A 2P67A 2K9JA 4XE5B 1M90Q 2QM7A 2JDIH 2W6AA 4DZOA 3L72J 1NTKJ 1SQVD 1JMBA 1T2KC 3VP9A 3S1KA 2AXCA 3H1IE 3E1RA 1HUCA 1SQVK 3M0DC 2KUBA 4H44B 3RL0C 3R2PA 2L5GB 3M0DA 4D6TJ 1Q81Q 2L91A 2RMZA 3SFDC 2Z4EA 1FZCA 4PD4D 3OW2O 5APSA 1JCDA 3IN6A 4ZMDA 1KYOE 3AEDC 1JCCA 1EZVD 1HTLC 4DT0A 5KAFE 1KB9H 4I7ZC 3N4XA 2AXTH 3K5BA 2LXBA 3V2NA 3Q5PA 2ZYAA 2WSFJ 3QWOC 3CCUP 1CSBA 1EC5A 2ZFCA 2FYNB 1FS0E 4H44D 1JTHB 5L8RJ 4YTPC 1H89A 3TGUJ 2FY8A 1GDTA 3H1HE 1VQOP 1RF1C 2XU6A 2KS1A 2E5YA 1FJPA 1HGVA 3CCVP 1JUNA 1RH5B 1P84D 3VOPA 3PTZA 2MKVA 3P7KA 5AVWB 1KQSO 1X9VA 1BCCJ 3AE7C 2C9LY 3H1IG 4CPGA 3V2RA 2YO3A 1BE3E 1NTME 2KOGA 3SSUA 1JO5A 3SFEC 2IBZD 2FYUK 2G3AA 1VQ9P 2J58A 1KQGB 2ZT9C 2C9NY 2W27A 2YNYA 1HBWA 1PP9E 5AW1B 2WT7A 3L71G 4KJMA 3KZIE 1Q86Q 1KQLA 1S5LH 2OTKE 2RH0A 1PV3A 1GU4A 5AW3B 3M06A 2XDJA 2Q9IA 2QSIA 1SFCC 4TT3H 1LGHB 1SFCA 3L74G 3BCCD 2Q5UA 1HF9A 3H1HG 2W6BA 4WB4A 1PZQA 1S9KD 1JY3O 1OW6A 4Y99B 1NTZJ 1FDIA 3HD7B 2N9YB 5AW5B 2ZVNB 1HGZA 1NOHA 4EOTA 5KTBA 2KNCA 1BE3G 1NTMG 3V2QA 2HFED 2Q3EA 3P8CD 2V4HA 1RE4C 2AEJA 1GU5A 1ZRTD 1SQQG 3SWFA 1IFIA 2QE7H 1VDFA 2KLVA 1KILB 2OGUA 4JYCA 2I1KA 3FWNA 5GTIH 5KLIC 2QG4A 1JY2P 3GF7A 4H0LB 1YJ9P 5BU8B 1FBMA 3HD7D 3H32A 1DH3A 2Y9YA 1ZR2A 3RK3D 3H1LG 1X79B 1EDLA 1X22A 3HTKA 1DIPA 1M1KQ 4PV1C
chains in the Genus database with same CATH topology
2WPRA 1JY2N 1JY3N 1LWUC 3GHGB 3EQ2A 2OYIB 2R5DA 1SQXK 1L0NK 1KILD 1M1JB 2XNXA 4N78E 1RE3C 1N73B 3TNUA 2NPSD 3OAKA 5BU5A 5AVZB 3GHGC 1RE3A 1T3UA 3BRTB 2CPBA 3VYIA 1NH4A 3L36A 1N7LA 2WITA 2YO2A 3A7OA 3U59A 1M1JC 1L4AD 3GHGA 3B8EB 1NKZB 1G2CB 1GTWA 5AVXB 2KSJA 1FDMA 5AW2B 1M1JA 1IFMA 1SP4A 3U1AA 1OWAA 3G3ZA 1GK6A 1FZGA 1RF0A 5AVVB 1NU1K 1HJBA 1GL2B 5CJ0A 1QL2A 1GW4A 1G2CA 2HPCB 2IFMA 1FZBA 2YMYA 2R5BA 1VPCA 1LTJC 1HVVA 1GD2E 1LT9C 3M0AA 1LTJA 4Y99C 1OXZA 1W2EA 3RK3B 1LT9A 3HD7C 2IX7C 5KJ7A 3O8ZA 2H43A 1AQ5A 2PAJA 3II6A 5CCGC 1AFOA 1LTAC 5APYA 2HPCA 2KP8A 1T2KD 5CCGA 5APWA 3RK3C 3B5NB 3L4FA 4IFFA 1DEBA 5AVRB 2GUVA 1RF1B 2N1TB 1PFIA 4B86A 2R3CA 2WSCH 4AYCA 1A02F 3VP8A 3A5TA 2FKWB 3NMDA 3N7NA 1GL2D 3B5NA 5BVZA 2N1TC 3MGNA 1JY3P 5KJ7D 1KILC 1XTCC 2MJZA 2XV5A 1DX7A 1J2JB 5APXA 3EFGA 1RF1A 2N1TA 2H8PD 2NPSC 3IR9A 3V4WA 2XKMA 1MV8A 2E43A 2FFDC 2C0XA 2WSEH 3M9QA 3BVHA 2Z5HA 4LC1A 3RK2B 3V4QA 1LTIC 4N78D 4KHXA 2WT7B 1NO4A 4C46A 2FYZA 2GM4A 1EQ7A 5APQA 1FAVA 3B5ND 3E1IA 1GW3A 3M9BA 3H6PA 5APTA 1YTZT 1SLQA 2P7JA 2A45I 3VMZA 1GK4A 2N9BA 2N1TD 3HE5B 5CHXA 2P67A 2LKMA 4XE5B 3MUDA 3L35A 1J1EB 1N86A 5CCHC 2J59M 4W7ZA 2OYIC 1ZV8A 2QM7A 2W6AA 4DZOA 2WTYA 4GKGA 1A02J 2HG5D 3RL0B 3L37A 5CCHA 1WRGA 1N73C 1LTBC 2OYIA 2YKOA 3HE5A 1FZCB 1J1EC 1SFCB 1T2KC 4AUWA 3VP9A 3KPEA 1HUCA 1KFNA 1RF0C 1SQVK 1N73A 2CPSA 3M0DC 2ZXEB 4WY4B 5AW4B 3HUSB 3R2PA 5AVUB 3RL0C 1NAFA 4I2LC 1H88A 2L5GB 3M0DA 2H7HA 3RK2D 2YKPA 1LTGC 1G1IA 1NHLA 3VMXA 1YYCA 4O9BA 1URQB 2Z4EA 1H8AA 1FZCA 5APSA 3HUSC 2KB7P 1JCDA 1FJKA 1M7LA 4W80A 1IFJA 1GL2C 1FZEA 1CZQA 5KJ7C 1JCCA 3HUSA 4C7RA 1RY3A 1FOSF 2JEEA 1GL2A 2OYHB 1NWQA 1JMMA 2Z5IA 5CCHD 4RESB 1HTLC 2XZRA 1QL1A 3N4XA 1ZLLA 3MIWA 3A3YB 3P32A 3LW5H 3UIAA 2WSFH 1HH0A 5AVQB 3SWYA 5AVTB 3RL0D 1FU1A 1KFMA 1FOSE 1S9KE 5CMZA 2OARA 3V2NA 1SFCD 4ZKPA 2KYVA 4JYBA 1CSBA 2ZFCA 2WZ7A 1J1DB 4WY4D 3B5NC 3V5BA 1JTHB 1H89A 1N7SB 1GDTA 3VMYA 1XTGB 1HWTC 1RF1C 3CL3D 2XU6A 2YKQA 2M8RA 3OJAB 4OH8B 1NTKK 1FJPA 1HGVA 1URQD 4LLHA 1IK9A 1JUNA 1RE4A 3VN0A 3VOPA 4LGDE 2HLOA 3HRNA 1JTHA 3NTNA 1IO4A 5AW8B 3WMM0 3P8CE 1SQBK 2HODB 3P7KA 5AVWB 1X9VA 3LIDA 3KQGA 2C9LY 4JF7A 4N6JA 4IFMA 3V2RA 2Q3IA 2YO3A 3T97A 2KOGA 1G1JA 3HE4B 4N3YB 3U1CA 1JNMA 1JO5A 2FYUK 2JJLA 1T3JA 2A45H 3MTUE 2J58A 3RK2C 1FZFA 2C9NY 1MUUA 3PP5A 2W27A 1X8YA 2YNYA 1HBWA 5AW7B 5AW1B 2WT7A 1LWUB 5AW6B 3TNUB 3HE4A 2WWWA 5KLVK 1L0LK 1CW5A 1N7SD 2C0WA 1SVFA 2IPPA 1KQLA 2M3BA 3TK1A 4ZKUA 1LWUA 4XA4A 4I6MC 5AVYB 2I1JA 2P1JA 1GU4A 1ZN5A 3BASA 5AW3B 3M06A 1NKNA 2XDJA 2Q9IA 4GIFA 1FZCC 2WPQA 1SFCC 4WY4C 1LGHB 1Z56A 3KDPB 1SFCA 1ZR4A 2R32A 5AW0B 4WY4A 2Q5UA 4AQRD 1CI6B 2BASA 2W6BA 4WB4A 4WBAA 4GT1A 2PP6A 1T8ZA 1LTJB 1URQC 2A45G 1S9KD 1LT9B 3C9IA 1JY2O 1JY3O 1IC2A 1URQA 2P2UA 4Y99B 1FZAA 3HD7B 2POHA 5AW5B 5APVA 1GZLA 1IFDA 2OYHC 3NXSA 3OA7A 1CI6A 1IJDB 1HGZA 1LTTC 1NOHA 1SQPK 4EOTA 5KTBA 2OYHA 3VTPC 5CJ4A 3V2QA 3HD7A 4W7YA 4M3LA 2IFNA 2HFED 2WPSA 3P8CD 3I5CA 4EIJA 1LTSC 4HH2A 3TSIA 1RE4C 1GU5A 1J1DC 3TYYA 3IFMA 3SWFA 1IFIA 2O01H 1VDFA 2KLVA 2E42A 1N7SC 1KILB 4I1LA 3H32B 4IFDK 4JYCA 2I1KA 2GUSA 1WT6A 2NPSB 1NTMK 1N7SA 1IFNA 1KZUB 1JY2P 1N2DC 2QM8A 3KYQA 4DOJA 1L4AB 1MZ9A 4HYTB 5BU8B 5APUA 2FFDB 1E5WA 1FBMA 4C7NB 3HD7D 5AW9B 2VRSA 1MFZA 1KILA 3M9HA 3MD0A 3H32A 3HTKB 1SQQK 2HYNA 2Q7CA 3V2PA 5CCGD 2O1JA 3LIEA 2NPSA 3A2AA 1L4AC 3CLQA 1DH3A 3BRVB 2HODA 2O1KA 2FXMA 1ZR2A 3RK3D 3P8MC 1L4AA 3M91A 1X79B 3NFQA 1YTZI 1NTZK 2FFDA 4C7NA 5AVSB 1JOCA 3HTKA 3CI9A 3BATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R32 A;  2WPR A;  5AVQ B;  5AW0 B;  5AVT B;  2Q5U A;  3IR9 A;  1FOS E;  4AQR D;  3V4W A;  1S9K E;  1CI6 B;  2BAS A;  5CMZ A;  1MV8 A;  2R5D A;  4GT1 A;  4JYB A;  2E43 A;  1CSB A;  2ZFC A;  1S9K D;  3V5B A;  3TNU A;  3OAK A;  2Z5H A;  4LC1 A;  5AVZ B;  1H89 A;  3V4Q A;  3VMY A;  2P2U A;  4KHX A;  1HWT C;  2WT7 B;  3VYI A;  3L36 A;  2XU6 A;  2YO2 A;  4C46 A;  5AW5 B;  3A7O A;  5APV A;  1GZL A;  3NXS A;  3B8E B;  5APQ A;  1CI6 A;  1G2C B;  1FAV A;  1GTW A;  1JUN A;  5AVX B;  3VN0 A;  3M9B A;  4EOT A;  5AW2 B;  5APT A;  3VTP C;  1SLQ A;  2P7J A;  3VMZ A;  1SP4 A;  1GK4 A;  2N9B A;  3NTN A;  3HE5 B;  1OWA A;  1IO4 A;  5AW8 B;  1GK6 A;  5AVV B;  1HJB A;  2P67 A;  3P7K A;  5AVW B;  4XE5 B;  3L35 A;  3LID A;  4M3L A;  2WPS A;  3KQG A;  3I5C A;  2C9L Y;  2Q3I A;  2YO3 A;  2QM7 A;  2W6A A;  4DZO A;  1GU5 A;  2WTY A;  2R5B A;  4GKG A;  1A02 J;  3T97 A;  3HE4 B;  3L37 A;  1JNM A;  3TYY A;  1GD2 E;  2JJL A;  3SWF A;  3HE5 A;  3M0A A;  1T2K C;  4AUW A;  2C9N Y;  2E42 A;  1MUU A;  1HUC A;  2W27 A;  1OXZ A;  1X8Y A;  2YNY A;  2ZXE B;  4JYC A;  5AW4 B;  1HBW A;  5AW7 B;  3O8Z A;  5AVU B;  5AW1 B;  1NAF A;  4I2L C;  1H88 A;  2WT7 A;  3M0D A;  5APY A;  5AW6 B;  2H7H A;  2QM8 A;  2KP8 A;  3HE4 A;  3TNU B;  1T2K D;  2WWW A;  4HYT B;  5APW A;  3VMX A;  1YYC A;  1H8A A;  5APU A;  4C7N B;  5AW9 B;  5APS A;  2VRS A;  1MFZ A;  5AVR B;  2IPP A;  3M9H A;  3MD0 A;  2Q7C A;  1KQL A;  1CZQ A;  3LIE A;  3A2A A;  3TK1 A;  1FOS F;  1DH3 A;  4B86 A;  1NWQ A;  2Z5I A;  4RES B;  2R3C A;  4I6M C;  5AVY B;  4AYC A;  1A02 F;  3A5T A;  1GU4 A;  3P8M C;  5AW3 B;  3M06 A;  3M91 A;  3NMD A;  2XZR A;  3NFQ A;  2WPQ A;  4C7N A;  3MGN A;  5AVS B;  2XV5 A;  3HTK A;  1J2J B;  3A3Y B;  3P32 A;  5APX A;  3KDP B;  3UIA A; 
#chains in the Genus database with same CATH topology
 1JY2 N;  1FE6 A;  4HJG H;  1SQX K;  1L0N K;  1KIL D;  1AQT A;  2XNX A;  1OX3 A;  1RE3 C;  1FC2 C;  2CK3 H;  3TNU A;  3WUT A;  3OAK A;  5BU5 A;  3CXH I;  2M0B A;  1RE3 A;  4H0L D;  2YO2 A;  2H88 C;  1PP9 J;  5AW2 B;  1IFM A;  1SP4 A;  2FXP A;  3G3Z A;  1GK6 A;  1HJB A;  1OFC X;  1GW4 A;  3S9O A;  2R5B A;  3CD6 P;  1GMJ A;  1E79 H;  1LTJ C;  2DW3 A;  2IDB A;  4I7Z B;  3M0A A;  1OMI A;  1LTJ A;  3CC7 P;  3Q2Y A;  5KJ7 A;  1AQ5 A;  2ZJS E;  1AFO A;  1LTA C;  2LXC B;  3PJS K;  1PPJ G;  1T2K D;  4UB8 E;  3H1K E;  4IFF A;  1K73 Q;  4EYY Q;  1BGY E;  1LJ2 A;  1W2B O;  5H2F H;  1RF1 B;  2YMK A;  2WSC H;  4AYC A;  3CX5 I;  3WUV A;  3B5N A;  3MGN A;  1JY3 P;  3FWL A;  2OYO A;  3A0B E;  1XTC C;  1DX7 A;  1H0T B;  3H1J J;  1YIT P;  2JO1 A;  4JQ0 D;  2NPS C;  2O3J A;  1YHQ P;  3CXH E;  3L72 E;  1NTK E;  2FFD C;  1PGQ A;  3M9Q A;  2ZT9 B;  2ZYD A;  1YBK A;  2WT7 B;  3L70 G;  2WSE J;  1S5L E;  3D71 A;  5APQ A;  4D6T E;  1USD A;  1FAV A;  1SQB E;  2BCC J;  1KN7 A;  1EDI A;  3VMZ A;  3F5H A;  3HE5 B;  3MUD C;  3H1I D;  1PL5 A;  3MUD A;  1J1E B;  5CCH C;  2OYI C;  4IOI H;  1LP1 A;  5DJU B;  2WTY A;  5CCH A;  2OYI A;  2YKO A;  1SFC B;  2QIW A;  3L71 D;  1RF0 C;  2B87 B;  2CPS A;  5AW4 B;  3H1K G;  2KI7 B;  3HUS B;  4A7P A;  1BGY G;  2YKP A;  3CWB J;  1LTG C;  3L75 J;  2ZT9 D;  1SQX E;  1NHL A;  2HR3 A;  2YXQ B;  1YYC A;  2KB7 P;  1M7L A;  1K8A Q;  3TGU E;  1GL2 C;  1FZE A;  1K04 A;  1Q7Y Q;  2FYU J;  3CX5 E;  4C7R A;  2AEF A;  1EXJ A;  1GL2 A;  4OGQ B;  4U7J A;  2KNC B;  2XZR A;  2Q1K A;  1Y8A A;  3L74 D;  4U3F D;  1ZLL A;  2QRX A;  3MIW A;  3H1H D;  3L72 G;  1NTK G;  3LW5 H;  3UIA A;  3QH9 A;  1BCC E;  3W68 A;  5AVQ B;  1FU1 A;  1KFM A;  3D70 A;  5CMZ A;  2OAR A;  1SFC D;  2KYV A;  4JYB A;  1S5L X;  4D6T G;  2PGD A;  3V5B A;  1SQP E;  1QVF O;  3VMY A;  3CC2 P;  4PD4 H;  1R5L A;  2FXO A;  1BDC A;  1BE3 D;  2SPZ A;  1NTM D;  3T97 B;  3PH0 A;  4LGD E;  2HLO A;  3BCC J;  5AW8 B;  2Y0C A;  3WMM 0;  4TLF A;  4OGQ D;  1U57 A;  4PJ0 H;  4N6J A;  1SQQ D;  4IFM A;  2Q3I A;  1JB0 J;  3JSV C;  2Y0E A;  3U1C A;  2A45 H;  4IL6 H;  3G71 P;  3PP5 A;  2ZXX A;  1T6A A;  4PV1 B;  4GOF A;  1JEK A;  3FX0 A;  3TGU G;  3SWK A;  3TNU B;  3HE4 A;  5KLV K;  1L0L K;  3JCU E;  2C0W A;  1SVF A;  4ASV A;  4EDF A;  2LR2 A;  1NTZ E;  1P84 H;  3H1L D;  3TK1 A;  3GMA A;  1ZW0 A;  1LWU A;  3AE9 C;  1OVV A;  4I6M C;  1ZN5 A;  3BAS A;  1BCC G;  4UB6 H;  1SQB J;  2WPQ A;  1FZC C;  5K5G B;  1VQP P;  4WY4 C;  2K9Y A;  5KAI H;  2ZVO B;  4WY4 A;  3KXD A;  3AE2 C;  1CI6 B;  1OVR A;  1PGP A;  1LTJ B;  2R44 A;  4ASW A;  3C9I A;  1D7M A;  4PV1 D;  1JY2 O;  4RO0 A;  2QJY B;  1IC2 A;  4BXL A;  5B66 E;  3USS A;  5H2F E;  4HKZ H;  1IFD A;  2OYH C;  1NU1 E;  2OYH A;  3VTP C;  1KOR A;  5KKZ C;  1SQX J;  1L0N J;  4DCK A;  4M3L A;  3I5C A;  2OQQ A;  2KLU A;  5B5E E;  1EDJ A;  4OVN F;  4RJT A;  1J1D C;  2Y9Z A;  1VF5 C;  2O01 H;  4JBZ A;  2E42 A;  1PPJ D;  2NPS B;  5TJH A;  2JKV A;  1N2D C;  1NTZ G;  2QM8 A;  3KYQ A;  4K35 A;  2KZI A;  1L4A B;  1MZ9 A;  2R3S A;  5APU A;  2FFD B;  2OTJ P;  2VRS A;  3M9H A;  2E74 C;  1UII A;  2HYN A;  1S3J A;  1SQP J;  3A2A A;  3TF5 A;  3CLQ A;  2HOD A;  4YXW H;  1IK7 A;  3M91 A;  3GF3 A;  1YTZ I;  4C7N A;  5AVS B;  1N8R Q;  1LP1 B;  3FGA D;  3EQ2 A;  4H13 C;  2D2C C;  2OYI B;  2R5D A;  3I55 P;  4N78 E;  3L70 D;  2NPS D;  5AVZ B;  3GHG C;  3BRT B;  3VMA A;  1M1J C;  1L4A D;  3GHG A;  1KQF B;  3B8E B;  1NKZ B;  5GTH H;  1GTW A;  2QA4 P;  1FDM A;  1M8O B;  1M1J A;  1KMI Z;  2WQY C;  1OWA A;  2YXR B;  3F89 A;  1FZG A;  1GL2 B;  2K88 A;  1R5S A;  1G2C A;  1SQV E;  1VPC A;  3I56 P;  3RBZ A;  3H1J E;  1BGY D;  1RQV A;  1OXZ A;  3RK3 B;  2IX7 C;  2H43 A;  3A0H H;  2HPC A;  5E79 H;  1KB9 I;  2I8D A;  5APW A;  3L4F A;  5TIS E;  1PP9 G;  5AVR B;  2PRR A;  2N1T B;  3CME P;  5CBN A;  3D6Z A;  2W90 A;  2O01 N;  2R3C A;  3RL0 g;  2BCC E;  3L72 D;  1NTK D;  1NU1 J;  2M5A B;  1GL2 D;  2WSC J;  2XV5 A;  3WU2 H;  1S1C X;  3IR9 A;  4D6T D;  1ZOY C;  3AEC C;  1PGO A;  1VL2 A;  2UWJ E;  2Z5H A;  3EFF K;  1NJI Q;  2K9J B;  5CBO A;  3GG2 A;  1VQM P;  1EQ7 A;  1YJW P;  4U3F J;  1GW3 A;  3CWB E;  5APT A;  3L75 E;  2E76 C;  1GK4 A;  2N9B A;  2N1T D;  4GDO A;  2A06 E;  5CHX A;  2KSE A;  3L73 J;  2FYU E;  1N86 A;  5KAI E;  3H1J G;  4NPF X;  2J59 M;  1A02 J;  3RL0 B;  3Q1M A;  3ABV C;  1N73 C;  1LTB C;  1FZC B;  3W67 A;  3KPE A;  2QEX P;  3TGU D;  1KFN A;  1N73 A;  4WY4 B;  2ZXE B;  1KB9 E;  3CX5 D;  2AXT E;  1NAF A;  1VQL P;  4I2L C;  2H7H A;  1G1I A;  4O9B A;  3CCR P;  2BCC G;  1KC8 Q;  1IFJ A;  2J5U A;  3AEF C;  1CZQ A;  2IZ1 A;  5KJ7 C;  1BCC D;  1BSN A;  3CCJ P;  2OYH B;  4RES B;  1U7J A;  1M56 D;  1EXI A;  5KKZ B;  3BCC E;  5KLV J;  1L0L J;  3A3Y B;  1HH0 A;  3SWY A;  2KS1 B;  3RL0 D;  1DD3 A;  1S9K E;  3LW5 J;  4ZKP A;  1KYO H;  1SQV J;  2WZ7 A;  1J1D B;  4WY4 D;  3B5N C;  1VF5 B;  3H1L J;  4XFJ A;  1KD1 Q;  3CWB G;  3L75 G;  1HWT C;  5KAF H;  3CL3 D;  2M8R A;  3OJA B;  2A06 G;  4MN4 C;  4LLH A;  1IK9 A;  2FYU G;  3VN0 A;  2E75 C;  3HRN A;  3CCS P;  1JTH A;  3NTN A;  1IO4 A;  3P8C E;  2HOD B;  4WVZ A;  3LID A;  1ZRT E;  3KQG A;  1M57 D;  2JJL A;  1T3J A;  3MTU E;  3RK2 C;  1FZF A;  4DJG A;  1X8Y A;  3FXE A;  1NTZ D;  4NPE A;  5AW7 B;  5AW6 B;  4H13 B;  1VF5 D;  2D2C B;  3AEE C;  2M3B A;  3Q3D A;  2Q6Q A;  4GOD A;  4ZKU A;  3BCC G;  1KYO D;  2H89 C;  5AVY B;  1ZME C;  3C8V A;  2E74 D;  2K1A A;  4GIF A;  1X0T A;  1L0N E;  3AE3 C;  3GLM A;  5AW0 B;  1KIL E;  3KZI H;  4AQR D;  2BAS A;  4WBA A;  2PP6 A;  1URQ C;  1URQ A;  2P2U A;  4H13 D;  1FZA A;  2D2C D;  3C1L A;  1LTT C;  2P58 A;  5GTI E;  1VQK P;  3HD7 A;  4W7Y A;  1SQB G;  3O6Q A;  1LTS C;  1W5C E;  3TSI A;  1OIP A;  4YXD C;  1NGM B;  5KLI B;  3CCQ P;  1PGJ A;  2WMM A;  2B9B A;  1N7S C;  3H32 B;  4IFD K;  1S2E A;  4L73 A;  2GUS A;  1WT6 A;  1YI2 P;  1NTM K;  1N7S A;  2O01 J;  1PP9 D;  4HYT B;  2IYO A;  3B71 A;  5C39 A;  1KIL A;  2K37 A;  3HTK B;  1SQQ K;  2BEQ D;  3BRV B;  1OW7 A;  1SQX G;  1L0N G;  2QVA A;  3P8M C;  3NFQ A;  1U7M A;  1JOC A;  3CI9 A;  2NZ2 A;  3BAT A;  1EDK A;  1LWU C;  1Y9B A;  2QJK C;  1N73 B;  4K3A A;  1T3U A;  1KTM A;  3AEA C;  3VYI A;  1NH4 A;  2QJP C;  3A7O A;  3U59 A;  1QEX A;  1YIJ P;  1VQ4 P;  2KSJ A;  1SQP G;  1Q2N A;  3U1A A;  1ZXG A;  3H1J D;  5CJ0 A;  1VQN P;  2KIK A;  1VQ8 P;  2E76 D;  2IFM A;  1FZB A;  1S72 P;  3IF4 A;  3L71 E;  1LT9 C;  4ZNC A;  1W2E A;  1LT9 A;  1VQ7 P;  1TU3 F;  3O8Z A;  5CCG C;  1USE A;  3II6 A;  3CMA P;  1OVU A;  2BCC D;  2KP8 A;  2RN0 A;  5CCG A;  2V7Q H;  3B5N B;  1AVY A;  3MHV A;  1PFI A;  4B86 A;  1NVO A;  3L74 E;  1A02 F;  3VP8 A;  4U3F E;  2FKW B;  2E75 B;  5KJ7 D;  4QMA A;  1J2J B;  3CC4 P;  3EFG A;  3L73 E;  1RF1 A;  4PD4 I;  4Z1M H;  4UB8 H;  2YIU C;  3V4W A;  3AE4 C;  1S4X A;  3CWB D;  1EZV I;  3L75 D;  2A06 D;  1H0T A;  4LC1 A;  3RK2 B;  1LTI C;  4KHX A;  2FYU D;  4C46 A;  2FYZ A;  2GM4 A;  3D6Y A;  4L74 A;  1NYH A;  3A0B H;  3B5N D;  3ZDM A;  3M9B A;  3AE5 C;  2A45 I;  4BRY A;  1SQQ E;  3CXH H;  1NU1 G;  1KB9 D;  2LKM A;  3L35 A;  4JPZ B;  2XND H;  1L2P A;  3G6E P;  2E75 D;  4W7Z A;  1ZV8 A;  4GKG A;  2HG5 D;  4WWI A;  3L37 A;  1WRG A;  3HE5 A;  1J1E C;  4AUW A;  3E7K A;  1P84 I;  5KLV E;  1L0L E;  1LT1 A;  2B89 A;  2W83 C;  5AVU B;  3Q5R A;  2JWA A;  1H88 A;  3RK2 D;  3VMX A;  1URQ B;  1H8A A;  4L75 A;  3H1L E;  3HUS C;  4U3F G;  1FJK A;  2B87 A;  4W80 A;  3H1K D;  1R8E A;  2IBZ I;  3HUS A;  2BEZ F;  1RY3 A;  1FOS F;  2JEE A;  1NWQ A;  1JMM A;  2Z5I A;  5CCH D;  3L73 G;  1MKM A;  1QL1 A;  3CPW O;  1IZN B;  4PD4 E;  1YQ3 C;  3O6Q B;  3H1I J;  3IAO A;  3P32 A;  4OWF A;  4OGQ C;  3RBX A;  2IYP A;  2WSF H;  4RKU J;  1EZV E;  5AVT B;  1FOS E;  2JWD A;  2Y0D A;  1BDD A;  3CX5 H;  3FXD A;  4PJ0 E;  1LNQ A;  3CXH D;  1Q82 Q;  3L71 J;  1N7S B;  1XTG B;  2YKQ A;  4OH8 B;  4IL6 E;  1NTK K;  1WMK A;  1URQ D;  1RE4 A;  4R4L A;  1SQB D;  3Q5S A;  1SQB K;  3AE6 C;  4JF7 A;  5KLV G;  1L0L G;  1P84 E;  1K9M Q;  3T97 A;  1G1J A;  3HE4 B;  4N3Y B;  1JNM A;  3L74 J;  1PPJ E;  1MUU A;  1QX8 A;  2G8Y A;  3H1H J;  4UB6 E;  1SQV G;  3R4Y A;  1YJN P;  1LWU B;  1Y47 A;  2WWW A;  1CW5 A;  1N7S D;  2NRG A;  2IBZ E;  2QJK B;  2E5T A;  3B4S A;  2IPP A;  1SQX D;  1L0N D;  3PHL A;  3AE8 C;  2QJP B;  3CCL P;  1FDO A;  4XA4 A;  1BE3 J;  2I1J A;  2P1J A;  1NKN A;  1NTM J;  3KHU A;  1EZV G;  3G9R A;  2ZYG A;  2KXP B;  2FBW C;  1Z56 A;  3KDP B;  4H44 C;  1ZR4 A;  2R32 A;  3RGU A;  4YPC A;  3JCU H;  1SQQ J;  3AE1 C;  3L70 E;  4GT1 A;  1T8Z A;  2ZAE B;  4IL6 X;  2A45 G;  1LT9 B;  1QVG O;  3MP7 B;  4R4M A;  1SQP D;  2POH A;  4NPD A;  5APV A;  1GZL A;  3NXS A;  3OA7 A;  1CI6 A;  1IJD B;  1BSH A;  1SQP K;  2QJY C;  5CJ4 A;  3JC2 2;  2IFN A;  1QGK B;  2WPS A;  4EI2 A;  1NAY A;  4EIJ A;  4HH2 A;  5B66 H;  1RQU A;  2M3E A;  3H25 A;  2OTL P;  2FYN C;  4Y28 J;  3TYY A;  1SS1 A;  3IFM A;  2RKL A;  1KV4 A;  4I1L A;  2IBZ G;  3TDK A;  1PIX A;  1IFN A;  2E74 B;  1KZU B;  1OZH A;  1VQ6 P;  2YIU B;  2K3R A;  4DOJ A;  1E5W A;  2JP3 A;  1MFT A;  4C7N B;  5AW9 B;  1AVO A;  1MFZ A;  5B5E H;  3MD0 A;  2Q7C A;  3V2P A;  5CCG D;  2O1J A;  3LIE A;  2NPS A;  2W6J H;  1ZP0 C;  1L4A C;  2O1K A;  2PFX A;  2FXM A;  1L4A A;  2KZJ A;  4BRY B;  3PLN A;  1NTZ K;  2FFD A;  5GTH E;  2WPR A;  1JY3 N;  3GHG B;  3RK3 E;  1M1J B;  4GOE A;  1AV1 A;  4KT0 J;  2CPB A;  3L36 A;  1N7L A;  2WIT A;  5M1B A;  2KK7 A;  2WPV B;  1G2C B;  5AVX B;  3V6I A;  1DD4 A;  4BWN A;  1NU1 D;  3A0H E;  4L76 A;  2ITA A;  1VQ5 P;  3CCM P;  3CCE P;  5E79 E;  1RF0 A;  5AVV B;  1NU1 K;  3WUU A;  1JM0 A;  1QL2 A;  2HPC B;  2YMY A;  5DJT B;  1HVV A;  1GD2 E;  4Y99 C;  3HD7 C;  2JR8 A;  2PAJ A;  1Q90 D;  5APY A;  1AJY A;  3WU2 E;  3RK3 C;  3L70 J;  1UIX A;  1DEB A;  1YQ4 C;  3EWK A;  2GUV A;  2W8Z A;  3PRJ A;  3L73 D;  2P10 A;  2V7Q J;  3AEG C;  1KYO I;  3A5T A;  1IFP A;  3NMD A;  3N7N A;  5BVZ A;  2N1T C;  3AEB C;  1RHZ B;  5EFW B;  1KIL C;  2MJZ A;  3ITK A;  5APX A;  2N1T A;  1OW8 A;  2H8P D;  3S4R A;  2WSS H;  1K05 A;  5TIS H;  4H0L C;  2XKM A;  1MV8 A;  2E43 A;  2M5A A;  3G4S P;  3MZW B;  3GW6 A;  3H1K J;  2C0X A;  2WSE H;  3BVH A;  3V4Q A;  1BGY J;  1DEE G;  1AA0 A;  2E76 B;  4N78 D;  1NO4 A;  2AEM A;  2B88 A;  2GA1 A;  2IZ0 A;  2WVR A;  3E1I A;  3H6P A;  1YTZ T;  1SLQ A;  2P7J A;  1QLE D;  1HJ0 A;  5KLV D;  1L0L D;  4HB1 A;  2P67 A;  2K9J A;  4XE5 B;  1M90 Q;  2QM7 A;  2JDI H;  2W6A A;  4DZO A;  3L72 J;  1NTK J;  1SQV D;  1JMB A;  1T2K C;  3VP9 A;  3S1K A;  2AXC A;  3H1I E;  3E1R A;  1HUC A;  1SQV K;  3M0D C;  2KUB A;  4H44 B;  3RL0 C;  3R2P A;  2L5G B;  3M0D A;  4D6T J;  1Q81 Q;  2L91 A;  2RMZ A;  3SFD C;  2Z4E A;  1FZC A;  4PD4 D;  3OW2 O;  5APS A;  1JCD A;  3IN6 A;  4ZMD A;  1KYO E;  3AED C;  1JCC A;  1EZV D;  1HTL C;  4DT0 A;  5KAF E;  1KB9 H;  4I7Z C;  3N4X A;  2AXT H;  3K5B A;  2LXB A;  3V2N A;  3Q5P A;  2ZYA A;  2WSF J;  3QWO C;  3CCU P;  1CSB A;  1EC5 A;  2ZFC A;  2FYN B;  1FS0 E;  4H44 D;  1JTH B;  5L8R J;  4YTP C;  1H89 A;  3TGU J;  2FY8 A;  1GDT A;  3H1H E;  1VQO P;  1RF1 C;  2XU6 A;  2KS1 A;  2E5Y A;  1FJP A;  1HGV A;  3CCV P;  1JUN A;  1RH5 B;  1P84 D;  3VOP A;  3PTZ A;  2MKV A;  3P7K A;  5AVW B;  1KQS O;  1X9V A;  1BCC J;  3AE7 C;  2C9L Y;  3H1I G;  4CPG A;  3V2R A;  2YO3 A;  1BE3 E;  1NTM E;  2KOG A;  3SSU A;  1JO5 A;  3SFE C;  2IBZ D;  2FYU K;  2G3A A;  1VQ9 P;  2J58 A;  1KQG B;  2ZT9 C;  2C9N Y;  2W27 A;  2YNY A;  1HBW A;  1PP9 E;  5AW1 B;  2WT7 A;  3L71 G;  4KJM A;  3KZI E;  1Q86 Q;  1KQL A;  1S5L H;  2OTK E;  2RH0 A;  1PV3 A;  1GU4 A;  5AW3 B;  3M06 A;  2XDJ A;  2Q9I A;  2QSI A;  1SFC C;  4TT3 H;  1LGH B;  1SFC A;  3L74 G;  3BCC D;  2Q5U A;  1HF9 A;  3H1H G;  2W6B A;  4WB4 A;  1PZQ A;  1S9K D;  1JY3 O;  1OW6 A;  4Y99 B;  1NTZ J;  1FDI A;  3HD7 B;  2N9Y B;  5AW5 B;  2ZVN B;  1HGZ A;  1NOH A;  4EOT A;  5KTB A;  2KNC A;  1BE3 G;  1NTM G;  3V2Q A;  2HFE D;  2Q3E A;  3P8C D;  2V4H A;  1RE4 C;  2AEJ A;  1GU5 A;  1ZRT D;  1SQQ G;  3SWF A;  1IFI A;  2QE7 H;  1VDF A;  2KLV A;  1KIL B;  2OGU A;  4JYC A;  2I1K A;  3FWN A;  5GTI H;  5KLI C;  2QG4 A;  1JY2 P;  3GF7 A;  4H0L B;  1YJ9 P;  5BU8 B;  1FBM A;  3HD7 D;  3H32 A;  1DH3 A;  2Y9Y A;  1ZR2 A;  3RK3 D;  3H1L G;  1X79 B;  1EDL A;  1X22 A;  3HTK A;  1DIP A;  1M1K Q;  4PV1 C; 
#chains in the Genus database with same CATH homology
 2WPR A;  1JY2 N;  1JY3 N;  1LWU C;  3GHG B;  3EQ2 A;  2OYI B;  2R5D A;  1SQX K;  1L0N K;  1KIL D;  1M1J B;  2XNX A;  4N78 E;  1RE3 C;  1N73 B;  3TNU A;  2NPS D;  3OAK A;  5BU5 A;  5AVZ B;  3GHG C;  1RE3 A;  1T3U A;  3BRT B;  2CPB A;  3VYI A;  1NH4 A;  3L36 A;  1N7L A;  2WIT A;  2YO2 A;  3A7O A;  3U59 A;  1M1J C;  1L4A D;  3GHG A;  3B8E B;  1NKZ B;  1G2C B;  1GTW A;  5AVX B;  2KSJ A;  1FDM A;  5AW2 B;  1M1J A;  1IFM A;  1SP4 A;  3U1A A;  1OWA A;  3G3Z A;  1GK6 A;  1FZG A;  1RF0 A;  5AVV B;  1NU1 K;  1HJB A;  1GL2 B;  5CJ0 A;  1QL2 A;  1GW4 A;  1G2C A;  2HPC B;  2IFM A;  1FZB A;  2YMY A;  2R5B A;  1VPC A;  1LTJ C;  1HVV A;  1GD2 E;  1LT9 C;  3M0A A;  1LTJ A;  4Y99 C;  1OXZ A;  1W2E A;  3RK3 B;  1LT9 A;  3HD7 C;  2IX7 C;  5KJ7 A;  3O8Z A;  2H43 A;  1AQ5 A;  2PAJ A;  3II6 A;  5CCG C;  1AFO A;  1LTA C;  5APY A;  2HPC A;  2KP8 A;  1T2K D;  5CCG A;  5APW A;  3RK3 C;  3B5N B;  3L4F A;  4IFF A;  1DEB A;  5AVR B;  2GUV A;  1RF1 B;  2N1T B;  1PFI A;  4B86 A;  2R3C A;  2WSC H;  4AYC A;  1A02 F;  3VP8 A;  3A5T A;  2FKW B;  3NMD A;  3N7N A;  1GL2 D;  3B5N A;  5BVZ A;  2N1T C;  3MGN A;  1JY3 P;  5KJ7 D;  1KIL C;  1XTC C;  2MJZ A;  2XV5 A;  1DX7 A;  1J2J B;  5APX A;  3EFG A;  1RF1 A;  2N1T A;  2H8P D;  2NPS C;  3IR9 A;  3V4W A;  2XKM A;  1MV8 A;  2E43 A;  2FFD C;  2C0X A;  2WSE H;  3M9Q A;  3BVH A;  2Z5H A;  4LC1 A;  3RK2 B;  3V4Q A;  1LTI C;  4N78 D;  4KHX A;  2WT7 B;  1NO4 A;  4C46 A;  2FYZ A;  2GM4 A;  1EQ7 A;  5APQ A;  1FAV A;  3B5N D;  3E1I A;  1GW3 A;  3M9B A;  3H6P A;  5APT A;  1YTZ T;  1SLQ A;  2P7J A;  2A45 I;  3VMZ A;  1GK4 A;  2N9B A;  2N1T D;  3HE5 B;  5CHX A;  2P67 A;  2LKM A;  4XE5 B;  3MUD A;  3L35 A;  1J1E B;  1N86 A;  5CCH C;  2J59 M;  4W7Z A;  2OYI C;  1ZV8 A;  2QM7 A;  2W6A A;  4DZO A;  2WTY A;  4GKG A;  1A02 J;  2HG5 D;  3RL0 B;  3L37 A;  5CCH A;  1WRG A;  1N73 C;  1LTB C;  2OYI A;  2YKO A;  3HE5 A;  1FZC B;  1J1E C;  1SFC B;  1T2K C;  4AUW A;  3VP9 A;  3KPE A;  1HUC A;  1KFN A;  1RF0 C;  1SQV K;  1N73 A;  2CPS A;  3M0D C;  2ZXE B;  4WY4 B;  5AW4 B;  3HUS B;  3R2P A;  5AVU B;  3RL0 C;  1NAF A;  4I2L C;  1H88 A;  2L5G B;  3M0D A;  2H7H A;  3RK2 D;  2YKP A;  1LTG C;  1G1I A;  1NHL A;  3VMX A;  1YYC A;  4O9B A;  1URQ B;  2Z4E A;  1H8A A;  1FZC A;  5APS A;  3HUS C;  2KB7 P;  1JCD A;  1FJK A;  1M7L A;  4W80 A;  1IFJ A;  1GL2 C;  1FZE A;  1CZQ A;  5KJ7 C;  1JCC A;  3HUS A;  4C7R A;  1RY3 A;  1FOS F;  2JEE A;  1GL2 A;  2OYH B;  1NWQ A;  1JMM A;  2Z5I A;  5CCH D;  4RES B;  1HTL C;  2XZR A;  1QL1 A;  3N4X A;  1ZLL A;  3MIW A;  3A3Y B;  3P32 A;  3LW5 H;  3UIA A;  2WSF H;  1HH0 A;  5AVQ B;  3SWY A;  5AVT B;  3RL0 D;  1FU1 A;  1KFM A;  1FOS E;  1S9K E;  5CMZ A;  2OAR A;  3V2N A;  1SFC D;  4ZKP A;  2KYV A;  4JYB A;  1CSB A;  2ZFC A;  2WZ7 A;  1J1D B;  4WY4 D;  3B5N C;  3V5B A;  1JTH B;  1H89 A;  1N7S B;  1GDT A;  3VMY A;  1XTG B;  1HWT C;  1RF1 C;  3CL3 D;  2XU6 A;  2YKQ A;  2M8R A;  3OJA B;  4OH8 B;  1NTK K;  1FJP A;  1HGV A;  1URQ D;  4LLH A;  1IK9 A;  1JUN A;  1RE4 A;  3VN0 A;  3VOP A;  4LGD E;  2HLO A;  3HRN A;  1JTH A;  3NTN A;  1IO4 A;  5AW8 B;  3WMM 0;  3P8C E;  1SQB K;  2HOD B;  3P7K A;  5AVW B;  1X9V A;  3LID A;  3KQG A;  2C9L Y;  4JF7 A;  4N6J A;  4IFM A;  3V2R A;  2Q3I A;  2YO3 A;  3T97 A;  2KOG A;  1G1J A;  3HE4 B;  4N3Y B;  3U1C A;  1JNM A;  1JO5 A;  2FYU K;  2JJL A;  1T3J A;  2A45 H;  3MTU E;  2J58 A;  3RK2 C;  1FZF A;  2C9N Y;  1MUU A;  3PP5 A;  2W27 A;  1X8Y A;  2YNY A;  1HBW A;  5AW7 B;  5AW1 B;  2WT7 A;  1LWU B;  5AW6 B;  3TNU B;  3HE4 A;  2WWW A;  5KLV K;  1L0L K;  1CW5 A;  1N7S D;  2C0W A;  1SVF A;  2IPP A;  1KQL A;  2M3B A;  3TK1 A;  4ZKU A;  1LWU A;  4XA4 A;  4I6M C;  5AVY B;  2I1J A;  2P1J A;  1GU4 A;  1ZN5 A;  3BAS A;  5AW3 B;  3M06 A;  1NKN A;  2XDJ A;  2Q9I A;  4GIF A;  1FZC C;  2WPQ A;  1SFC C;  4WY4 C;  1LGH B;  1Z56 A;  3KDP B;  1SFC A;  1ZR4 A;  2R32 A;  5AW0 B;  4WY4 A;  2Q5U A;  4AQR D;  1CI6 B;  2BAS A;  2W6B A;  4WB4 A;  4WBA A;  4GT1 A;  2PP6 A;  1T8Z A;  1LTJ B;  1URQ C;  2A45 G;  1S9K D;  1LT9 B;  3C9I A;  1JY2 O;  1JY3 O;  1IC2 A;  1URQ A;  2P2U A;  4Y99 B;  1FZA A;  3HD7 B;  2POH A;  5AW5 B;  5APV A;  1GZL A;  1IFD A;  2OYH C;  3NXS A;  3OA7 A;  1CI6 A;  1IJD B;  1HGZ A;  1LTT C;  1NOH A;  1SQP K;  4EOT A;  5KTB A;  2OYH A;  3VTP C;  5CJ4 A;  3V2Q A;  3HD7 A;  4W7Y A;  4M3L A;  2IFN A;  2HFE D;  2WPS A;  3P8C D;  3I5C A;  4EIJ A;  1LTS C;  4HH2 A;  3TSI A;  1RE4 C;  1GU5 A;  1J1D C;  3TYY A;  3IFM A;  3SWF A;  1IFI A;  2O01 H;  1VDF A;  2KLV A;  2E42 A;  1N7S C;  1KIL B;  4I1L A;  3H32 B;  4IFD K;  4JYC A;  2I1K A;  2GUS A;  1WT6 A;  2NPS B;  1NTM K;  1N7S A;  1IFN A;  1KZU B;  1JY2 P;  1N2D C;  2QM8 A;  3KYQ A;  4DOJ A;  1L4A B;  1MZ9 A;  4HYT B;  5BU8 B;  5APU A;  2FFD B;  1E5W A;  1FBM A;  4C7N B;  3HD7 D;  5AW9 B;  2VRS A;  1MFZ A;  1KIL A;  3M9H A;  3MD0 A;  3H32 A;  3HTK B;  1SQQ K;  2HYN A;  2Q7C A;  3V2P A;  5CCG D;  2O1J A;  3LIE A;  2NPS A;  3A2A A;  1L4A C;  3CLQ A;  1DH3 A;  3BRV B;  2HOD A;  2O1K A;  2FXM A;  1ZR2 A;  3RK3 D;  3P8M C;  1L4A A;  3M91 A;  1X79 B;  3NFQ A;  1YTZ I;  1NTZ K;  2FFD A;  4C7N A;  5AVS B;  1JOC A;  3HTK A;  3CI9 A;  3BAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...