4AUWA

Crystal structure of the bzip homodimeric mafb in complex with the c- mare binding site
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
87
structure length
87
Chain Sequence
SDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTION FACTOR MAFB
publication title Expression, purification, crystallization and preliminary crystallographic analysis of the mouse transcription factor MafB in complex with its DNA-recognition motif Cmare
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 37
structure length 87
sequence length 87
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03131 bZIP_Maf bZIP Maf transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4auwA00
3KDPB 1CZQA 5APTA 5AVSB 3A7OA 3V4QA 1CI6A 3P32A 1S9KD 4C46A 4C7NA 2Z5HA 1GZLA 5AW2B 1OXZA 1GD2E 2YO3A 3LIDA 5AVWB 5AVYB 2WPRA 5APYA 2E43A 1FAVA 4AUWA 2IPPA 1JUNA 5AW5B 4EOTA 2C9LY 3P8MC 2W6AA 1HUCA 1SP4A 2WWWA 1GTWA 4AYCA 1HWTC 3LIEA 1NWQA 3MGNA 3V5BA 3I5CA 3NTNA 1H8AA 1IO4A 4JYCA 2R32A 5AVZB 3NFQA 2H7HA 3A3YB 3P7KA 3VMZA 3SWFA 5AW9B 3M06A 1GU4A 3TNUB 1CSBA 3OAKA 2P67A 1HJBA 2KP8A 3UIAA 3VMXA 4HYTB 2WTYA 1T2KC 2Q3IA 3M91A 2Z5IA 2JJLA 3L37A 2P7JA 3A2AA 3B8EB 5APQA 2WT7B 4M3LA 1GK6A 2QM8A 2Q5UA 2ZXEB 3L36A 1X8YA 4I6MC 5AW1B 3M9HA 1FOSE 2VRSA 3HE4B 1G2CB 2R3CA 5AVRB 3TK1A 2WPQA 3TNUA 2C9NY 5APVA 2QM7A 4B86A 2YNYA 4XE5B 5AW8B 2R5BA 2ZFCA 2W27A 5AW3B 1GK4A 3VYIA 1H89A 1HBWA 1DH3A 4LC1A 4GKGA 1MFZA 1CI6B 5APWA 5AW7B 5APUA 3HE4A 5APSA 3IR9A 2WPSA 3VMYA 3L35A 3MD0A 5APXA 4AQRD 4GT1A 1OWAA 5AVQB 5AVVB 3HE5B 1A02J 1H88A 1SLQA 3M9BA 2XZRA 3A5TA 1J2JB 2YO2A 1JNMA 1A02F 2R5DA 4KHXA 5AVUB 3NMDA 3KQGA 2Q7CA 5AW4B 1NAFA 3HTKA 5AW0B 2XV5A 1YYCA 1MV8A 3O8ZA 1GU5A 3NXSA 3TYYA 4C7NB 2WT7A 1KQLA 2P2UA 3HE5A 4I2LC 3T97A 1FOSF 2E42A 2BASA 1MUUA 1S9KE 5AW6B 3VTPC 5CMZA 5AVTB 2N9BA 2XU6A 4RESB 1T2KD 5AVXB 4DZOA 4JYBA 3M0AA 3M0DA 3V4WA 3VN0A
chains in the Genus database with same CATH superfamily
2K9JB 3KDPB 3V4QA 4H13B 3B4SA 2E75C 2FKWB 3K5BA 2HPCA 1DEBA 4PD4I 3AE8C 2Z4EA 4Y28J 2W8ZA 1LTJC 1OFCX 3H1IJ 2O1KA 4IFFA 2H8PD 5GTIE 3CXHI 4OGQD 3CCVP 3BCCG 1RF0C 1S5LX 1IFPA 1X22A 1N8RQ 4H13C 2Y9ZA 3L36A 5AW1B 3AE4C 3AEBC 3AEGC 3L74E 2JWAA 3AE6C 4HB1A 2KLVA 2KZIA 2RH0A 2ZFCA 2P58A 1L0LE 1UIIA 3AEEC 1L4AD 1PFIA 2Q6QA 1CI6B 4GOEA 3G4SP 2CK3H 4H0LD 3GLMA 2QE7H 1EDIA 1K9MQ 1SQPJ 3VP8A 2FXMA 1M8OB 3H1IG 5KJ7A 2V7QH 3FWLA 1BDCA 2E76B 1PPJD 1JOCA 1VQ9P 1BDDA 4ASVA 3HTKA 2XNXA 5DJTB 4D6TE 2QIWA 3A0HH 2CPBA 1P84E 3FGAD 2BASA 3O6QA 1FZAA 1S9KE 1NTZD 1ZN5A 4JYBA 1KZUB 2HPCB 1CZQA 1YTZT 5APTA 2Z5HA 3HRNA 1DD4A 1OX3A 1P84I 1SQPG 3PP5A 1NTKD 2W6AA 2E76C 1GTWA 1Y9BA 3BCCE 3H1LD 2OTKE 2KUBA 1U57A 2HR3A 1X0TA 4W7YA 1JO5A 1ZP0C 2NPSD 1IFMA 1PIXA 3L75D 2WPVB 4I6MC 1QL1A 2YXQB 2M0BA 3JC22 1KFMA 4XE5B 2FFDA 2QRXA 2KOGA 4PV1B 3SWKA 4GKGA 1KFNA 3L71D 2K1AA 1BCCJ 3H1IE 1T3UA 1KQFB 3CI9A 3HTKB 2ZVOB 2JWDA 1DD3A 4WY4A 3RBZA 1H88A 4GDOA 1HTLC 2M3BA 3P8CE 2E5TA 5KLIB 1EDJA 3VMAA 1Q2NA 1QVGO 2XV5A 1VF5B 2E42A 4PV1C 4WBAA 1BGYD 4EIJA 2XU6A 3RL0g 5KJ7C 4DZOA 3AEDC 3MHVA 1SQPE 4C7NA 2JR8A 3E7KA 4CPGA 5E79E 3GG2A 1Q86Q 2YO3A 2Y0EA 5AVYB 1BCCG 1Y8AA 5AW5B 3WU2H 4RJTA 4AYCA 1G1JA 1T3JA 1SFCA 1Q7YQ 1KB9D 4BRYA 3A3YB 2LKMA 2RKLA 1CSBA 5CCHD 2FFDB 3Q2YA 3V6IA 3CWBJ 1HH0A 1JM0A 3PHLA 1SQXD 2KSJA 1S3JA 2QM8A 2L5GB 4PJ0E 2YKQA 2WZ7A 2POHA 2YNYA 4WY4B 1SS1A 4JQ0D 4BXLA 1L0LK 5APWA 5TJHA 5KTBA 3CX5D 1AJYA 4H44B 2IYOA 3IR9A 4HKZH 4Z1MH 4WWIA 1KV4A 2I1KA 2WSFJ 1VQOP 3CCLP 2FFDC 2C0WA 1M90Q 2D2CD 3MTUE 3CWBG 4C7NB 2GA1A 1IK9A 1K8AQ 1MUUA 2JP3A 3Q5PA 2N9BA 1M1KQ 1BCCE 1RQUA 5CCGD 3M0AA 3M0DA 3D71A 1J1EB 4H44C 3S9OA 1VQ4P 2FYUJ 1SFCB 3B5ND 3U1AA 4BRYB 4ASWA 2IPPA 3D6ZA 1GW3A 1NWQA 2IZ0A 3IFMA 2R32A 2PP6A 4IL6X 3JCUE 3A0BH 1LWUA 4TT3H 1HJBA 1NO4A 3KPEA 2JJLA 2ITAA 3L37A 1KB9H 1S5LH 1SFCC 5AVRB 2C9NY 1YQ4C 1FC2C 3FX0A 1EC5A 2FYUG 2RMZA 1S72P 3EQ2A 1JY2P 1SQBJ 3L35A 1RQVA 4AQRD 1IFIA 1A02J 3KYQA 4N6JA 1L0ND 3CWBE 1BE3J 3PRJA 2BEQD 2HYNA 2HG5D 1PGPA 3L4FA 3AE5C 1LTIC 1MKMA 2I8DA 4UB8H 1GL2C 2ZAEB 1T6AA 4N78E 2V4HA 3VTPC 4DOJA 2FYNB 1EQ7A 2E74C 3FWNA 3LW5H 2AEMA 1S2EA 5AW2B 1ZR4A 2Y0DA 5KLVJ 3AE2C 3BATA 1LWUB 2QJPC 1FBMA 2K88A 2WMMA 1SQBG 1NTZK 4I7ZB 1K73Q 1KYOH 2WWWA 4K35A 4WB4A 1YITP 3HD7C 2AXTH 2HLOA 1BE3G 1NVOA 3EWKA 1LTJA 1U7MA 3M06A 3RGUA 2FYNC 2H88C 3OAKA 1NTKK 4XA4A 1T2KC 3M91A 2KYVA 2FYUE 1M56D 4ZKPA 1T8ZA 2W90A 1LWUC 4L75A 3KZIH 1E79H 4I7ZC 3L74D 2OYIA 5KLVG 1HGZA 1L0LD 3CMEP 3RL0D 1SLQA 1QEXA 1VQKP 1L4AA 2R5DA 2K9YA 1VQMP 5AW4B 3PLNA 2LXBA 2YKOA 1IJDB 2V7QJ 3RK3B 4EDFA 4D6TD 3WUVA 2KS1A 2H89C 1P84D 1SQBE 1CI6A 1S9KD 2ZXXA 3RK2D 5KKZB 2K3RA 1OXZA 1N73C 1Z56A 4NPDA 2BCCJ 1OVVA 1BE3E 1SQQJ 1ZR2A 4EOTA 1OZHA 2QG4A 3PTZA 4PD4H 3C8VA 1AQ5A 1YHQP 3G6EP 2OARA 3MUDC 3CXHH 4JF7A 3SWFA 3RK3C 3BCCD 4OGQB 1YI2P 2J58A 2Q3IA 1FZCA 3M9QA 1BSNA 2E75D 2OYIB 2WSCH 2N1TD 1GK6A 1RHZB 5KKZC 1BSHA 1URQD 3D6YA 2AEFA 3M9HA 1SQVJ 2OYOA 5KLVE 2QM7A 4IOIH 4TLFA 1JY2O 3VYIA 4YXWH 2NPSA 1DH3A 4YTPC 5CJ4A 1SQXK 1E5WA 1L4AB 2BCCG 4H0LB 1SQQG 3CPWO 5AVQB 3H1ID 1QLED 4OGQC 4U3FJ 2XZRA 1VQ7P 2KS1B 5AVUB 2OYIC 1HF9A 1MV8A 2SPZA 3TF5A 4K3AA 3P8CD 3HE5A 2QA4P 1IK7A 1SQVG 5CJ0A 1L4AC 4H0LC 1GMJA 2J59M 3L72J 3CC7P 1JY2N 3N4XA 1RE3A 1W5CE 3R2PA 1SP4A 3L70J 3ZDMA 1RF1A 1FZCB 4U3FG 3V5BA 3W67A 2RN0A 5CBNA 4O9BA 1PGOA 2DW3A 4IL6H 3VMXA 3A0HE 2NPSB 4ZNCA 2Z5IA 2H43A 4M3LA 1TU3F 2FYZA 2Q5UA 1KILA 2BCCE 2FYUK 3V2NA 2O01H 2R3CA 3TK1A 1SQQE 1W2EA 2PAJA 5CCHA 1H89A 3L72G 2NZ2A 3Q1MA 2B87A 1FZCC 2OYHA 5B66H 2KK7A 1VQ6P 3L70G 3L75J 2Q9IA 1OWAA 3PH0A 3HE5B 1AA0A 3CMAP 1NHLA 1EXIA 2YO2A 1NU1J 2NPSC 3WUTA 1VQLP 1SQVE 1KQLA 1YJNP 3T97A 2ZYAA 1L2PA 1L0NK 1LTSC 4ZKUA 2BEZF 1ZLLA 2OQQA 1U7JA 1RF1B 2PRRA 1BCCD 3CC2P 4U3FE 5BU8B 1ZXGA 3CCMP 3AE3C 4AUWA 1JUNA 3IN6A 1ZRTE 1HUCA 3L75G 3F89A 4U7JA 1BGYJ 1N86A 3NTNA 1H8AA 1NU1G 1KILB 3U59A 5GTHH 3NFQA 3B5NA 3USSA 2A45G 3KXDA 1KQGB 1RE3C 1NYHA 4DT0A 2P7JA 1RF1C 2N9YB 3L72E 2B87B 3AEFC 2OYHB 1X8YA 1OVUA 2VRSA 3CLQA 3IF4A 5APVA 1PL5A 3L70E 3KHUA 1HJ0A 1VF5D 3HE4A 1EZVG 3VP9A 1KILC 3GW6A 3WU2E 3TSIA 2IDBA 3TGUJ 3T97B 1BGYG 1WT6A 5CCHC 5H2FH 1DIPA 3KQGA 5L8RJ 3IAOA 3SFEC 3O8ZA 2OYHC 1XTCC 4I2LC 4RO0A 3V2RA 1Y47A 2QJKB 4IFMA 1GL2A 5AW6B 3RBXA 1N7SA 4RESB 5B5EH 1J1DC 1NJIQ 2JO1A 3V4WA 1YTZI 5AVSB 4N78D 3L75E 1LT9A 2GM4A 3L73J 3AE1C 2IFNA 3H1HD 3B5NB 1M7LA 3GMAA 1NU1E 1FDOA 1G1IA 2M5AA 3LW5J 2FXOA 2M8RA 1HWTC 3TGUG 1RY3A 5KAFH 4WY4D 3CCEP 1IO4A 3HD7A 1FS0E 4C7RA 2QJKC 3VMZA 2HODA 1ZMEC 2P67A 1FE6A 3F5HA 2XNDH 3I55P 5CCGC 2A45I 3WUUA 2ZXEB 3HE4B 3B5NC 2W83C 5AW8B 1EZVE 1SQQK 2KLUA 2FYUD 1LP1A 1S4XA 4L73A 3L73G 1BGYE 3GHGB 2YKPA 1JY3P 5APUA 3QH9A 3VMYA 1KORA 2IYPA 1GL2B 1J2JB 1EZVI 1N7SB 1VDFA 3A0BE 1AFOA 2Q7CA 5AW0B 1RH5B 3H1JJ 3NXSA 1IFNA 1LT9B 1KILE 1FOSF 2E74B 2L91A 1EXJA 3E1IA 1S5LE 5AVXB 2WQYC 2M5AB 3GHGC 3JSVC 3SWYA 2QJPB 3CX5H 2JDIH 1H0TA 4Y99C 3CCUP 5KAIH 1N2DC 3TGUE 1LJ2A 3HD7B 1SQBD 1RE4A 1N73A 1FAVA 2HODB 5CHXA 3P8MC 1N7SC 5C39A 2CPSA 3LIEA 1BE3D 1PP9J 5BU5A 1W2BO 1LT9C 1JMMA 1M1JA 1SQPK 3MUDA 3H1JG 1NTMJ 2KP8A 4UB8E 3UIAA 1LP1B 4IFDK 2C0XA 3L73E 3S1KA 1FOSE 5AW3B 2W27A 1HBWA 1USEA 2WSCJ 1LTAC 5KLVD 2IZ1A 1PZQA 5AW7B 3V2QA 2N1TA 3FXDA 2FBWC 2B88A 1KYOE 1PP9G 2AXTE 4A7PA 1A02F 1NAFA 1NTMG 3II6A 1H0TB 5TISH 2P2UA 1Q82Q 2ZYDA 2QJYB 4BWNA 4NPEA 1KYOI 5M1BA 1N73B 4UB6H 4I1LA 4L74A 2O01N 3KZIE 4C46A 1PGQA 3RK2B 3RL0C 4HH2A 3LIDA 1DX7A 2E43A 1M1JB 3H1KJ 2QVAA 3MP7B 3H1JE 1FU1A 3I5CA 2KNCA 2YMYA 2QJYC 2ZT9D 1RE4C 2IBZG 2WT7B 1OW6A 3CC4P 2N1TB 2R3SA 1NKZB 3RK2C 3TNUA 2IFMA 2P1JA 1M1JC 4NPFX 1SVFA 4EYYQ 1LTGC 2BCCD 1MFZA 1NH4A 1PP9E 1SQQD 2O01J 3H1KG 1G2CA 4W7ZA 4JPZB 4PD4E 1NTME 2WSEH 3C1LA 3A5TA 1EDLA 3AEAC 2NRGA 5GTIH 4YXDC 2XKMA 2QSIA 3CXHE 3CCSP 2N1TC 1URQC 1FDIA 4QMAA 1Q81Q 1JTHA 1JB0J 2A06G 1SQVD 3H25A 1VQ5P 1IZNB 4H13D 3W68A 2KNCB 4R4LA 1GD2E 1FJKA 1JY3N 2WPRA 3S4RA 3AECC 2C9LY 3BVHA 4U3FD 2O1JA 1LGHB 3MGNA 2IBZE 4RKUJ 1NKNA 1D7MA 1ZRTD 2O3JA 4JYCA 3GF3A 1YIJP 1HGVA 5AW9B 1KMIZ 3TNUB 1QGKB 2WTYA 1P84H 1SQPD 1K04A 5APQA 2IBZI 1G2CB 1NTZJ 3H1KE 2M3EA 1VQNP 3L72D 3MZWB 4OH8B 1NOHA 1OMIA 2W6BA 2PGDA 5APSA 1ZV8A 3L70D 4JBZA 4N3YB 1NTKJ 1FDMA 1JTHB 2KB7P 1JNMA 1ZW0A 3QWOC 3H1LJ 2E76D 3Q5SA 2Y9YA 4KHXA 2A06E 2ZYGA 3RK3E 2B9BA 2P10A 1PPJG 4LLHA 3VOPA 3D70A 4IL6E 2PFXA 3HUSA 3CD6P 5DJUB 1NTZG 2KI7B 3VN0A 1WRGA 4KT0J 3P32A 1PV3A 1LTTC 4KJMA 2Q1KA 3AE7C 1MFTA 5B66E 3L71J 5EFWB 1QX8A 4GOFA 3ABVC 1NTKG 1NU1D 3H6PA 3U1CA 3H1LG 1NAYA 2G3AA 1K05A 1SQBK 1X79B 1OIPA 1R5SA 1NGMB 1YJWP 3A2AA 2AXCA 4EI2A 5CCGA 2Y0CA 3Q5RA 4ZMDA 3O6QB 2KIKA 1S1CX 4PV1D 5KJ7D 5E79H 1GDTA 1N7LA 3OA7A 1EZVD 3L71G 2WPSA 1PPJE 1VQPP 2GUVA 1IFJA 2LXCB 1KN7A 1NTMK 2OTLP 1XTGB 3HUSB 5GTHE 5KLVK 2FXPA 2Q3EA 4DJGA 2ZJSE 4GODA 4W80A 1GU5A 3TYYA 1J1DB 1NTZE 3BRVB 3AE9C 5KLIC 1DEEG 2QEXP 2UWJE 1SQXJ 2B89A 5CMZA 3E1RA 1USDA 4PJ0H 1KILD 1VF5C 1IC2A 3A7OA 3GHGA 2E5YA 1KQSO 1FZFA 1NTKE 3CWBD 1AV1A 5AVWB 2D2CB 1WMKA 3H1LE 2KXPB 3HUSC 3TGUD 3CCRP 3Q3DA 5H2FE 4YPCA 1AVOA 2H7HA 2KZJA 2WSSH 4HYTB 3H1HJ 1SQXG 1FZBA 2A45H 5B5EE 3L71E 2D2CC 1OVRA 2WPQA 1VPCA 3I56P 1FZGA 1IFDA 3L73D 4LC1A 2YMKA 4H44D 4WY4C 1QL2A 3MD0A 1YQ3C 4OVNF 2KSEA 3CCJP 3H32A 1JCCA 3M9BA 5KAFE 1KYOD 3JCUH 3C9IA 1YYCA 3BRTB 3H1HG 3TDKA 4Y99B 3EFFK 4L76A 2WITA 1M57D 3G9RA 3G71P 1SFCD 1OW7A 1GW4A 1SQVK 2HFED 1J1EC 1Q90D 1PGJA 1KB9E 5K5GB 1KTMA 1L0NJ 1SQXE 3H1JD 2JEEA 1FZEA 2K37A 1KB9I 2OTJP 4MN4C 1GL2D 1N7SD 1JMBA 4B86A 3CX5E 2IX7C 3H32B 3OJAB 5KAIE 2WSFH 2XDJA 2GUSA 3PJSK 2E74D 3MIWA 3B71A 4OWFA 3WMM0 1PP9D 5AVVB 1FJPA 1VQ8P 3H1HE 3CX5I 1L0NG 3FXEA 4XFJA 4PD4D 1NTMD 3NMDA 1R5LA 1ZOYC 3HD7D 2WVRA 2WSEJ 2OGUA 2WT7A 3CXHD 1URQA 1QVFO 3M0DC 3RL0B 1T2KD 4DCKA 2MJZA 4HJGH 3R4YA 1LT1A 1GZLA 3L74J 5APYA 1YJ9P 3SFDC 2J5UA 1RF0A 1L0LJ 2K9JA 2FY8A 3N7NA 4R4MA 3CCQP 1JEKA 5AVZB 3P7KA 2IBZD 3SSUA 2ZT9B 1GU4A 1MZ9A 5TISE 1KD1Q 3B8EB 1NU1K 1CW5A 5CBOA 2G8YA 4UB6E 3V2PA 1LNQA 4D6TJ 4WVZA 1UIXA 1R8EA 2YXRB 2R5BA 1GK4A 3CL3D 5BVZA 3BASA 1AVYA 2YIUB 3H1KD 3L74G 2JKVA 2I1JA 1KC8Q 1L0NE 4LGDE 1LTBC 1L0LG 5APXA 2W6JH 4GT1A 3GF7A 2LR2A 1YBKA 2E75B 2MKVA 2ZT9C 3EFGA 2AEJA 1URQB 1OW8A 1JY3O 1AQTA 1EDKA 3ITKA 3G3ZA 1LTJB 3BCCJ 4GIFA 2R44A 3OW2O 2ZVNB 2A06D 3RK3D 1JCDA 1VL2A 1X9VA 5AVTB 2YIUC 4D6TG 1HVVA
chains in the Genus database with same CATH topology
1YTZI 3KDPB 5AVSB 3V4QA 3P32A 4N78D 3LW5H 1LT9A 5AW2B 1ZR4A 1LTTC 2GM4A 2IFNA 2FKWB 3B5NB 1M7LA 3BATA 1LWUB 1FBMA 1G1IA 1NTZK 2HPCA 2WWWA 2M8RA 1DEBA 1HWTC 4WB4A 2Z4EA 1RY3A 3HD7C 3H6PA 4WY4D 1LTJC 2HLOA 2O1KA 4IFFA 3U1CA 2H8PD 1IO4A 3HD7A 4C7RA 1LTJA 3VMZA 1SQBK 3M06A 1X79B 2HODA 3OAKA 2P67A 1NTKK 4XA4A 1RF0C 1T2KC 3M91A 5CCGC 3A2AA 2KYVA 2A45I 2ZXEB 5CCGA 3L36A 5AW1B 3HE4B 4ZKPA 1T8ZA 3B5NC 2KLVA 5AW8B 1SQQK 1LWUC 2ZFCA 5KJ7D 1GDTA 1L4AD 1PFIA 1CI6B 3GHGB 1N7LA 2OYIA 3OA7A 2YKPA 1JY3P 5APUA 1HGZA 2WPSA 3VMYA 3VP8A 2FXMA 3RL0D 2GUVA 1IFJA 1SLQA 1NTMK 1GL2B 1J2JB 5KJ7A 1XTGB 1L4AA 3HUSB 2R5DA 5KLVK 1N7SB 1JOCA 1VDFA 1AFOA 2Q7CA 5AW4B 3HTKA 5AW0B 2XNXA 4W80A 1GU5A 3NXSA 1IFNA 2YKOA 3TYYA 1IJDB 1J1DB 1LT9B 3BRVB 2CPBA 1FOSF 2BASA 3E1IA 1FZAA 3RK3B 1S9KE 5CMZA 1ZN5A 5AVXB 4JYBA 1KZUB 1KILD 3GHGC 2HPCB 3SWYA 1CZQA 1IC2A 1YTZT 3A7OA 5APTA 1CI6A 1S9KD 3GHGA 4Y99C 3RK2D 2Z5HA 1FZFA 1N2DC 3HRNA 1OXZA 1N73C 1Z56A 3HD7B 5AVWB 1RE4A 1N73A 1FAVA 1ZR2A 4EOTA 3HUSC 2HODB 3PP5A 3P8MC 2W6AA 5CHXA 1N7SC 2CPSA 1GTWA 1AQ5A 3LIEA 5BU5A 2OARA 1LT9C 1JMMA 2H7HA 4JF7A 1M1JA 1SQPK 3MUDA 3SWFA 3RK3C 4W7YA 1JO5A 2KP8A 2NPSD 3UIAA 2J58A 4HYTB 2Q3IA 1IFMA 1FZCA 3M9QA 4IFDK 2C0XA 2OYIB 2WSCH 1FZBA 2N1TD 1GK6A 2A45H 4I6MC 1URQD 3M9HA 1FOSE 1QL1A 2WPQA 1KFMA 1VPCA 2QM7A 1FZGA 4XE5B 2FFDA 1JY2O 2KOGA 5AW3B 2W27A 3VYIA 1IFDA 1HBWA 2NPSA 1DH3A 4LC1A 1LTAC 4GKGA 5CJ4A 1SQXK 1KFNA 1E5WA 1L4AB 5AW7B 3V2QA 1T3UA 2N1TA 3CI9A 3HTKB 4WY4C 1QL2A 3MD0A 4WY4A 5AVQB 3H32A 1H88A 1JCCA 3M9BA 1HTLC 2XZRA 2M3BA 3P8CE 1A02F 3C9IA 5AVUB 1NAFA 2OYIC 2XV5A 1YYCA 3BRTB 1MV8A 3II6A 3P8CD 2P2UA 3HE5A 2E42A 4Y99B 4WBAA 1N73B 4EIJA 2XU6A 5CJ0A 2WITA 5KJ7C 4DZOA 1L4AC 4I1LA 4C46A 4C7NA 2J59M 1SFCD 3RK2B 3RL0C 4HH2A 2YO3A 3LIDA 1JY2N 5AVYB 1GW4A 3N4XA 1SQVK 1DX7A 2E43A 2HFED 1M1JB 5AW5B 1RE3A 1J1EC 3R2PA 1SP4A 1RF1A 4AYCA 1G1JA 1FZCB 1FU1A 3V5BA 3I5CA 1T3JA 1SFCA 2YMYA 3A3YB 2LKMA 2JEEA 4O9BA 1CSBA 1RE4C 5CCHD 1FZEA 2FFDB 1HH0A 3VMXA 2NPSB 2Z5IA 2H43A 2WT7B 2KSJA 4M3LA 2FYZA 2QM8A 2L5GB 2Q5UA 1KILA 2N1TB 1GL2D 1NKZB 3RK2C 2FYUK 3V2NA 2YKQA 2O01H 2R3CA 3TK1A 1N7SD 2WZ7A 3TNUA 2IFMA 2POHA 4B86A 1W2EA 2P1JA 2PAJA 2YNYA 4WY4B 2IX7C 1M1JC 1SVFA 3H32B 3OJAB 5CCHA 1H89A 2WSFH 1LTGC 1L0LK 2XDJA 1MFZA 2GUSA 1NH4A 5APWA 5KTBA 1FZCC 3MIWA 2OYHA 1G2CA 3IR9A 3WMM0 4W7ZA 2Q9IA 2I1KA 1OWAA 2WSEH 3HE5B 5AVVB 1FJPA 1NHLA 3A5TA 2FFDC 2C0WA 2YO2A 2NPSC 2XKMA 3NMDA 3HD7D 3MTUE 2N1TC 1URQC 4C7NB 2WT7A 1KQLA 1IK9A 3T97A 1MUUA 1URQA 1L0NK 1JTHA 1LTSC 4ZKUA 1ZLLA 3M0DC 2N9BA 3RL0B 1T2KD 5CCGD 3M0AA 2MJZA 3M0DA 1RF1B 1J1EB 1GZLA 1GD2E 1SFCB 1FJKA 3B5ND 5BU8B 1JY3N 3U1AA 2WPRA 5APYA 4AUWA 2IPPA 1JUNA 1RF0A 2C9LY 3BVHA 1HUCA 1GW3A 2O1JA 1LGHB 1NWQA 3N7NA 3MGNA 1N86A 1NKNA 3NTNA 1H8AA 1KILB 3IFMA 3U59A 4JYCA 2R32A 5AVZB 2PP6A 3NFQA 3B5NA 3P7KA 1HGVA 1LWUA 5AW9B 2A45G 1GU4A 3TNUB 1MZ9A 1HJBA 3VN0A 1RE3C 2WTYA 1NO4A 3KPEA 2JJLA 3L37A 2P7JA 1RF1C 3B8EB 5APQA 1NU1K 1CW5A 1HVVA 2OYHB 1X8YA 3V2PA 2VRSA 1G2CB 1SFCC 3CLQA 5AVRB 2C9NY 5APVA 2R5BA 4OH8B 1GK4A 3CL3D 5BVZA 1NOHA 3BASA 2W6BA 3EQ2A 2I1JA 1JY2P 3HE4A 5APSA 1ZV8A 3VP9A 1KILC 3L35A 4LGDE 1LTBC 4N3YB 5APXA 4AQRD 1IFIA 4GT1A 3TSIA 1A02J 3KYQA 3EFGA 4N6JA 1WT6A 1URQB 1FDMA 1JTHB 2KB7P 1JNMA 5CCHC 2HYNA 4KHXA 2HG5D 3L4FA 1JY3O 3KQGA 4LLHA 1LTIC 3O8ZA 3VOPA 2OYHC 3G3ZA 1LTJB 1GL2C 4GIFA 1XTCC 4I2LC 3V2RA 4IFMA 3RK3D 1GL2A 4N78E 1JCDA 5AW6B 3VTPC 1X9VA 5AVTB 3HUSA 4DOJA 1N7SA 4RESB 1EQ7A 1J1DC 3V4WA 1WRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KDP B;  1CZQ A;  5APT A;  5AVS B;  3A7O A;  3V4Q A;  1CI6 A;  3P32 A;  1S9K D;  4C46 A;  4C7N A;  2Z5H A;  1GZL A;  5AW2 B;  1OXZ A;  1GD2 E;  2YO3 A;  3LID A;  5AVW B;  5AVY B;  2WPR A;  5APY A;  2E43 A;  1FAV A;  4AUW A;  2IPP A;  1JUN A;  5AW5 B;  4EOT A;  2C9L Y;  3P8M C;  2W6A A;  1HUC A;  1SP4 A;  2WWW A;  1GTW A;  4AYC A;  1HWT C;  3LIE A;  1NWQ A;  3MGN A;  3V5B A;  3I5C A;  3NTN A;  1H8A A;  1IO4 A;  4JYC A;  2R32 A;  5AVZ B;  3NFQ A;  2H7H A;  3A3Y B;  3P7K A;  3VMZ A;  3SWF A;  5AW9 B;  3M06 A;  1GU4 A;  3TNU B;  1CSB A;  3OAK A;  2P67 A;  1HJB A;  2KP8 A;  3UIA A;  3VMX A;  4HYT B;  2WTY A;  1T2K C;  2Q3I A;  3M91 A;  2Z5I A;  2JJL A;  3L37 A;  2P7J A;  3A2A A;  3B8E B;  5APQ A;  2WT7 B;  4M3L A;  1GK6 A;  2QM8 A;  2Q5U A;  2ZXE B;  3L36 A;  1X8Y A;  4I6M C;  5AW1 B;  3M9H A;  1FOS E;  2VRS A;  3HE4 B;  1G2C B;  2R3C A;  5AVR B;  3TK1 A;  2WPQ A;  3TNU A;  2C9N Y;  5APV A;  2QM7 A;  4B86 A;  2YNY A;  4XE5 B;  5AW8 B;  2R5B A;  2ZFC A;  2W27 A;  5AW3 B;  1GK4 A;  3VYI A;  1H89 A;  1HBW A;  1DH3 A;  4LC1 A;  4GKG A;  1MFZ A;  1CI6 B;  5APW A;  5AW7 B;  5APU A;  3HE4 A;  5APS A;  3IR9 A;  2WPS A;  3VMY A;  3L35 A;  3MD0 A;  5APX A;  4AQR D;  4GT1 A;  1OWA A;  5AVQ B;  5AVV B;  3HE5 B;  1A02 J;  1H88 A;  1SLQ A;  3M9B A;  2XZR A;  3A5T A;  1J2J B;  2YO2 A;  1JNM A;  1A02 F;  2R5D A;  4KHX A;  5AVU B;  3NMD A;  3KQG A;  2Q7C A;  5AW4 B;  1NAF A;  3HTK A;  5AW0 B;  2XV5 A;  1YYC A;  1MV8 A;  3O8Z A;  1GU5 A;  3NXS A;  3TYY A;  4C7N B;  2WT7 A;  1KQL A;  2P2U A;  3HE5 A;  4I2L C;  3T97 A;  1FOS F;  2E42 A;  2BAS A;  1MUU A;  1S9K E;  5AW6 B;  3VTP C;  5CMZ A;  5AVT B;  2N9B A;  2XU6 A;  4RES B;  1T2K D;  5AVX B;  4DZO A;  4JYB A;  3M0A A;  3M0D A;  3V4W A;  3VN0 A; 
#chains in the Genus database with same CATH topology
 2K9J B;  3KDP B;  3V4Q A;  4H13 B;  3B4S A;  2E75 C;  2FKW B;  3K5B A;  2HPC A;  1DEB A;  4PD4 I;  3AE8 C;  2Z4E A;  4Y28 J;  2W8Z A;  1LTJ C;  1OFC X;  3H1I J;  2O1K A;  4IFF A;  2H8P D;  5GTI E;  3CXH I;  4OGQ D;  3CCV P;  3BCC G;  1RF0 C;  1S5L X;  1IFP A;  1X22 A;  1N8R Q;  4H13 C;  2Y9Z A;  3L36 A;  5AW1 B;  3AE4 C;  3AEB C;  3AEG C;  3L74 E;  2JWA A;  3AE6 C;  4HB1 A;  2KLV A;  2KZI A;  2RH0 A;  2ZFC A;  2P58 A;  1L0L E;  1UII A;  3AEE C;  1L4A D;  1PFI A;  2Q6Q A;  1CI6 B;  4GOE A;  3G4S P;  2CK3 H;  4H0L D;  3GLM A;  2QE7 H;  1EDI A;  1K9M Q;  1SQP J;  3VP8 A;  2FXM A;  1M8O B;  3H1I G;  5KJ7 A;  2V7Q H;  3FWL A;  1BDC A;  2E76 B;  1PPJ D;  1JOC A;  1VQ9 P;  1BDD A;  4ASV A;  3HTK A;  2XNX A;  5DJT B;  4D6T E;  2QIW A;  3A0H H;  2CPB A;  1P84 E;  3FGA D;  2BAS A;  3O6Q A;  1FZA A;  1S9K E;  1NTZ D;  1ZN5 A;  4JYB A;  1KZU B;  2HPC B;  1CZQ A;  1YTZ T;  5APT A;  2Z5H A;  3HRN A;  1DD4 A;  1OX3 A;  1P84 I;  1SQP G;  3PP5 A;  1NTK D;  2W6A A;  2E76 C;  1GTW A;  1Y9B A;  3BCC E;  3H1L D;  2OTK E;  2KUB A;  1U57 A;  2HR3 A;  1X0T A;  4W7Y A;  1JO5 A;  1ZP0 C;  2NPS D;  1IFM A;  1PIX A;  3L75 D;  2WPV B;  4I6M C;  1QL1 A;  2YXQ B;  2M0B A;  3JC2 2;  1KFM A;  4XE5 B;  2FFD A;  2QRX A;  2KOG A;  4PV1 B;  3SWK A;  4GKG A;  1KFN A;  3L71 D;  2K1A A;  1BCC J;  3H1I E;  1T3U A;  1KQF B;  3CI9 A;  3HTK B;  2ZVO B;  2JWD A;  1DD3 A;  4WY4 A;  3RBZ A;  1H88 A;  4GDO A;  1HTL C;  2M3B A;  3P8C E;  2E5T A;  5KLI B;  1EDJ A;  3VMA A;  1Q2N A;  1QVG O;  2XV5 A;  1VF5 B;  2E42 A;  4PV1 C;  4WBA A;  1BGY D;  4EIJ A;  2XU6 A;  3RL0 g;  5KJ7 C;  4DZO A;  3AED C;  3MHV A;  1SQP E;  4C7N A;  2JR8 A;  3E7K A;  4CPG A;  5E79 E;  3GG2 A;  1Q86 Q;  2YO3 A;  2Y0E A;  5AVY B;  1BCC G;  1Y8A A;  5AW5 B;  3WU2 H;  4RJT A;  4AYC A;  1G1J A;  1T3J A;  1SFC A;  1Q7Y Q;  1KB9 D;  4BRY A;  3A3Y B;  2LKM A;  2RKL A;  1CSB A;  5CCH D;  2FFD B;  3Q2Y A;  3V6I A;  3CWB J;  1HH0 A;  1JM0 A;  3PHL A;  1SQX D;  2KSJ A;  1S3J A;  2QM8 A;  2L5G B;  4PJ0 E;  2YKQ A;  2WZ7 A;  2POH A;  2YNY A;  4WY4 B;  1SS1 A;  4JQ0 D;  4BXL A;  1L0L K;  5APW A;  5TJH A;  5KTB A;  3CX5 D;  1AJY A;  4H44 B;  2IYO A;  3IR9 A;  4HKZ H;  4Z1M H;  4WWI A;  1KV4 A;  2I1K A;  2WSF J;  1VQO P;  3CCL P;  2FFD C;  2C0W A;  1M90 Q;  2D2C D;  3MTU E;  3CWB G;  4C7N B;  2GA1 A;  1IK9 A;  1K8A Q;  1MUU A;  2JP3 A;  3Q5P A;  2N9B A;  1M1K Q;  1BCC E;  1RQU A;  5CCG D;  3M0A A;  3M0D A;  3D71 A;  1J1E B;  4H44 C;  3S9O A;  1VQ4 P;  2FYU J;  1SFC B;  3B5N D;  3U1A A;  4BRY B;  4ASW A;  2IPP A;  3D6Z A;  1GW3 A;  1NWQ A;  2IZ0 A;  3IFM A;  2R32 A;  2PP6 A;  4IL6 X;  3JCU E;  3A0B H;  1LWU A;  4TT3 H;  1HJB A;  1NO4 A;  3KPE A;  2JJL A;  2ITA A;  3L37 A;  1KB9 H;  1S5L H;  1SFC C;  5AVR B;  2C9N Y;  1YQ4 C;  1FC2 C;  3FX0 A;  1EC5 A;  2FYU G;  2RMZ A;  1S72 P;  3EQ2 A;  1JY2 P;  1SQB J;  3L35 A;  1RQV A;  4AQR D;  1IFI A;  1A02 J;  3KYQ A;  4N6J A;  1L0N D;  3CWB E;  1BE3 J;  3PRJ A;  2BEQ D;  2HYN A;  2HG5 D;  1PGP A;  3L4F A;  3AE5 C;  1LTI C;  1MKM A;  2I8D A;  4UB8 H;  1GL2 C;  2ZAE B;  1T6A A;  4N78 E;  2V4H A;  3VTP C;  4DOJ A;  2FYN B;  1EQ7 A;  2E74 C;  3FWN A;  3LW5 H;  2AEM A;  1S2E A;  5AW2 B;  1ZR4 A;  2Y0D A;  5KLV J;  3AE2 C;  3BAT A;  1LWU B;  2QJP C;  1FBM A;  2K88 A;  2WMM A;  1SQB G;  1NTZ K;  4I7Z B;  1K73 Q;  1KYO H;  2WWW A;  4K35 A;  4WB4 A;  1YIT P;  3HD7 C;  2AXT H;  2HLO A;  1BE3 G;  1NVO A;  3EWK A;  1LTJ A;  1U7M A;  3M06 A;  3RGU A;  2FYN C;  2H88 C;  3OAK A;  1NTK K;  4XA4 A;  1T2K C;  3M91 A;  2KYV A;  2FYU E;  1M56 D;  4ZKP A;  1T8Z A;  2W90 A;  1LWU C;  4L75 A;  3KZI H;  1E79 H;  4I7Z C;  3L74 D;  2OYI A;  5KLV G;  1HGZ A;  1L0L D;  3CME P;  3RL0 D;  1SLQ A;  1QEX A;  1VQK P;  1L4A A;  2R5D A;  2K9Y A;  1VQM P;  5AW4 B;  3PLN A;  2LXB A;  2YKO A;  1IJD B;  2V7Q J;  3RK3 B;  4EDF A;  4D6T D;  3WUV A;  2KS1 A;  2H89 C;  1P84 D;  1SQB E;  1CI6 A;  1S9K D;  2ZXX A;  3RK2 D;  5KKZ B;  2K3R A;  1OXZ A;  1N73 C;  1Z56 A;  4NPD A;  2BCC J;  1OVV A;  1BE3 E;  1SQQ J;  1ZR2 A;  4EOT A;  1OZH A;  2QG4 A;  3PTZ A;  4PD4 H;  3C8V A;  1AQ5 A;  1YHQ P;  3G6E P;  2OAR A;  3MUD C;  3CXH H;  4JF7 A;  3SWF A;  3RK3 C;  3BCC D;  4OGQ B;  1YI2 P;  2J58 A;  2Q3I A;  1FZC A;  3M9Q A;  1BSN A;  2E75 D;  2OYI B;  2WSC H;  2N1T D;  1GK6 A;  1RHZ B;  5KKZ C;  1BSH A;  1URQ D;  3D6Y A;  2AEF A;  3M9H A;  1SQV J;  2OYO A;  5KLV E;  2QM7 A;  4IOI H;  4TLF A;  1JY2 O;  3VYI A;  4YXW H;  2NPS A;  1DH3 A;  4YTP C;  5CJ4 A;  1SQX K;  1E5W A;  1L4A B;  2BCC G;  4H0L B;  1SQQ G;  3CPW O;  5AVQ B;  3H1I D;  1QLE D;  4OGQ C;  4U3F J;  2XZR A;  1VQ7 P;  2KS1 B;  5AVU B;  2OYI C;  1HF9 A;  1MV8 A;  2SPZ A;  3TF5 A;  4K3A A;  3P8C D;  3HE5 A;  2QA4 P;  1IK7 A;  1SQV G;  5CJ0 A;  1L4A C;  4H0L C;  1GMJ A;  2J59 M;  3L72 J;  3CC7 P;  1JY2 N;  3N4X A;  1RE3 A;  1W5C E;  3R2P A;  1SP4 A;  3L70 J;  3ZDM A;  1RF1 A;  1FZC B;  4U3F G;  3V5B A;  3W67 A;  2RN0 A;  5CBN A;  4O9B A;  1PGO A;  2DW3 A;  4IL6 H;  3VMX A;  3A0H E;  2NPS B;  4ZNC A;  2Z5I A;  2H43 A;  4M3L A;  1TU3 F;  2FYZ A;  2Q5U A;  1KIL A;  2BCC E;  2FYU K;  3V2N A;  2O01 H;  2R3C A;  3TK1 A;  1SQQ E;  1W2E A;  2PAJ A;  5CCH A;  1H89 A;  3L72 G;  2NZ2 A;  3Q1M A;  2B87 A;  1FZC C;  2OYH A;  5B66 H;  2KK7 A;  1VQ6 P;  3L70 G;  3L75 J;  2Q9I A;  1OWA A;  3PH0 A;  3HE5 B;  1AA0 A;  3CMA P;  1NHL A;  1EXI A;  2YO2 A;  1NU1 J;  2NPS C;  3WUT A;  1VQL P;  1SQV E;  1KQL A;  1YJN P;  3T97 A;  2ZYA A;  1L2P A;  1L0N K;  1LTS C;  4ZKU A;  2BEZ F;  1ZLL A;  2OQQ A;  1U7J A;  1RF1 B;  2PRR A;  1BCC D;  3CC2 P;  4U3F E;  5BU8 B;  1ZXG A;  3CCM P;  3AE3 C;  4AUW A;  1JUN A;  3IN6 A;  1ZRT E;  1HUC A;  3L75 G;  3F89 A;  4U7J A;  1BGY J;  1N86 A;  3NTN A;  1H8A A;  1NU1 G;  1KIL B;  3U59 A;  5GTH H;  3NFQ A;  3B5N A;  3USS A;  2A45 G;  3KXD A;  1KQG B;  1RE3 C;  1NYH A;  4DT0 A;  2P7J A;  1RF1 C;  2N9Y B;  3L72 E;  2B87 B;  3AEF C;  2OYH B;  1X8Y A;  1OVU A;  2VRS A;  3CLQ A;  3IF4 A;  5APV A;  1PL5 A;  3L70 E;  3KHU A;  1HJ0 A;  1VF5 D;  3HE4 A;  1EZV G;  3VP9 A;  1KIL C;  3GW6 A;  3WU2 E;  3TSI A;  2IDB A;  3TGU J;  3T97 B;  1BGY G;  1WT6 A;  5CCH C;  5H2F H;  1DIP A;  3KQG A;  5L8R J;  3IAO A;  3SFE C;  3O8Z A;  2OYH C;  1XTC C;  4I2L C;  4RO0 A;  3V2R A;  1Y47 A;  2QJK B;  4IFM A;  1GL2 A;  5AW6 B;  3RBX A;  1N7S A;  4RES B;  5B5E H;  1J1D C;  1NJI Q;  2JO1 A;  3V4W A;  1YTZ I;  5AVS B;  4N78 D;  3L75 E;  1LT9 A;  2GM4 A;  3L73 J;  3AE1 C;  2IFN A;  3H1H D;  3B5N B;  1M7L A;  3GMA A;  1NU1 E;  1FDO A;  1G1I A;  2M5A A;  3LW5 J;  2FXO A;  2M8R A;  1HWT C;  3TGU G;  1RY3 A;  5KAF H;  4WY4 D;  3CCE P;  1IO4 A;  3HD7 A;  1FS0 E;  4C7R A;  2QJK C;  3VMZ A;  2HOD A;  1ZME C;  2P67 A;  1FE6 A;  3F5H A;  2XND H;  3I55 P;  5CCG C;  2A45 I;  3WUU A;  2ZXE B;  3HE4 B;  3B5N C;  2W83 C;  5AW8 B;  1EZV E;  1SQQ K;  2KLU A;  2FYU D;  1LP1 A;  1S4X A;  4L73 A;  3L73 G;  1BGY E;  3GHG B;  2YKP A;  1JY3 P;  5APU A;  3QH9 A;  3VMY A;  1KOR A;  2IYP A;  1GL2 B;  1J2J B;  1EZV I;  1N7S B;  1VDF A;  3A0B E;  1AFO A;  2Q7C A;  5AW0 B;  1RH5 B;  3H1J J;  3NXS A;  1IFN A;  1LT9 B;  1KIL E;  1FOS F;  2E74 B;  2L91 A;  1EXJ A;  3E1I A;  1S5L E;  5AVX B;  2WQY C;  2M5A B;  3GHG C;  3JSV C;  3SWY A;  2QJP B;  3CX5 H;  2JDI H;  1H0T A;  4Y99 C;  3CCU P;  5KAI H;  1N2D C;  3TGU E;  1LJ2 A;  3HD7 B;  1SQB D;  1RE4 A;  1N73 A;  1FAV A;  2HOD B;  5CHX A;  3P8M C;  1N7S C;  5C39 A;  2CPS A;  3LIE A;  1BE3 D;  1PP9 J;  5BU5 A;  1W2B O;  1LT9 C;  1JMM A;  1M1J A;  1SQP K;  3MUD A;  3H1J G;  1NTM J;  2KP8 A;  4UB8 E;  3UIA A;  1LP1 B;  4IFD K;  2C0X A;  3L73 E;  3S1K A;  1FOS E;  5AW3 B;  2W27 A;  1HBW A;  1USE A;  2WSC J;  1LTA C;  5KLV D;  2IZ1 A;  1PZQ A;  5AW7 B;  3V2Q A;  2N1T A;  3FXD A;  2FBW C;  2B88 A;  1KYO E;  1PP9 G;  2AXT E;  4A7P A;  1A02 F;  1NAF A;  1NTM G;  3II6 A;  1H0T B;  5TIS H;  2P2U A;  1Q82 Q;  2ZYD A;  2QJY B;  4BWN A;  4NPE A;  1KYO I;  5M1B A;  1N73 B;  4UB6 H;  4I1L A;  4L74 A;  2O01 N;  3KZI E;  4C46 A;  1PGQ A;  3RK2 B;  3RL0 C;  4HH2 A;  3LID A;  1DX7 A;  2E43 A;  1M1J B;  3H1K J;  2QVA A;  3MP7 B;  3H1J E;  1FU1 A;  3I5C A;  2KNC A;  2YMY A;  2QJY C;  2ZT9 D;  1RE4 C;  2IBZ G;  2WT7 B;  1OW6 A;  3CC4 P;  2N1T B;  2R3S A;  1NKZ B;  3RK2 C;  3TNU A;  2IFM A;  2P1J A;  1M1J C;  4NPF X;  1SVF A;  4EYY Q;  1LTG C;  2BCC D;  1MFZ A;  1NH4 A;  1PP9 E;  1SQQ D;  2O01 J;  3H1K G;  1G2C A;  4W7Z A;  4JPZ B;  4PD4 E;  1NTM E;  2WSE H;  3C1L A;  3A5T A;  1EDL A;  3AEA C;  2NRG A;  5GTI H;  4YXD C;  2XKM A;  2QSI A;  3CXH E;  3CCS P;  2N1T C;  1URQ C;  1FDI A;  4QMA A;  1Q81 Q;  1JTH A;  1JB0 J;  2A06 G;  1SQV D;  3H25 A;  1VQ5 P;  1IZN B;  4H13 D;  3W68 A;  2KNC B;  4R4L A;  1GD2 E;  1FJK A;  1JY3 N;  2WPR A;  3S4R A;  3AEC C;  2C9L Y;  3BVH A;  4U3F D;  2O1J A;  1LGH B;  3MGN A;  2IBZ E;  4RKU J;  1NKN A;  1D7M A;  1ZRT D;  2O3J A;  4JYC A;  3GF3 A;  1YIJ P;  1HGV A;  5AW9 B;  1KMI Z;  3TNU B;  1QGK B;  2WTY A;  1P84 H;  1SQP D;  1K04 A;  5APQ A;  2IBZ I;  1G2C B;  1NTZ J;  3H1K E;  2M3E A;  1VQN P;  3L72 D;  3MZW B;  4OH8 B;  1NOH A;  1OMI A;  2W6B A;  2PGD A;  5APS A;  1ZV8 A;  3L70 D;  4JBZ A;  4N3Y B;  1NTK J;  1FDM A;  1JTH B;  2KB7 P;  1JNM A;  1ZW0 A;  3QWO C;  3H1L J;  2E76 D;  3Q5S A;  2Y9Y A;  4KHX A;  2A06 E;  2ZYG A;  3RK3 E;  2B9B A;  2P10 A;  1PPJ G;  4LLH A;  3VOP A;  3D70 A;  4IL6 E;  2PFX A;  3HUS A;  3CD6 P;  5DJU B;  1NTZ G;  2KI7 B;  3VN0 A;  1WRG A;  4KT0 J;  3P32 A;  1PV3 A;  1LTT C;  4KJM A;  2Q1K A;  3AE7 C;  1MFT A;  5B66 E;  3L71 J;  5EFW B;  1QX8 A;  4GOF A;  3ABV C;  1NTK G;  1NU1 D;  3H6P A;  3U1C A;  3H1L G;  1NAY A;  2G3A A;  1K05 A;  1SQB K;  1X79 B;  1OIP A;  1R5S A;  1NGM B;  1YJW P;  3A2A A;  2AXC A;  4EI2 A;  5CCG A;  2Y0C A;  3Q5R A;  4ZMD A;  3O6Q B;  2KIK A;  1S1C X;  4PV1 D;  5KJ7 D;  5E79 H;  1GDT A;  1N7L A;  3OA7 A;  1EZV D;  3L71 G;  2WPS A;  1PPJ E;  1VQP P;  2GUV A;  1IFJ A;  2LXC B;  1KN7 A;  1NTM K;  2OTL P;  1XTG B;  3HUS B;  5GTH E;  5KLV K;  2FXP A;  2Q3E A;  4DJG A;  2ZJS E;  4GOD A;  4W80 A;  1GU5 A;  3TYY A;  1J1D B;  1NTZ E;  3BRV B;  3AE9 C;  5KLI C;  1DEE G;  2QEX P;  2UWJ E;  1SQX J;  2B89 A;  5CMZ A;  3E1R A;  1USD A;  4PJ0 H;  1KIL D;  1VF5 C;  1IC2 A;  3A7O A;  3GHG A;  2E5Y A;  1KQS O;  1FZF A;  1NTK E;  3CWB D;  1AV1 A;  5AVW B;  2D2C B;  1WMK A;  3H1L E;  2KXP B;  3HUS C;  3TGU D;  3CCR P;  3Q3D A;  5H2F E;  4YPC A;  1AVO A;  2H7H A;  2KZJ A;  2WSS H;  4HYT B;  3H1H J;  1SQX G;  1FZB A;  2A45 H;  5B5E E;  3L71 E;  2D2C C;  1OVR A;  2WPQ A;  1VPC A;  3I56 P;  1FZG A;  1IFD A;  3L73 D;  4LC1 A;  2YMK A;  4H44 D;  4WY4 C;  1QL2 A;  3MD0 A;  1YQ3 C;  4OVN F;  2KSE A;  3CCJ P;  3H32 A;  1JCC A;  3M9B A;  5KAF E;  1KYO D;  3JCU H;  3C9I A;  1YYC A;  3BRT B;  3H1H G;  3TDK A;  4Y99 B;  3EFF K;  4L76 A;  2WIT A;  1M57 D;  3G9R A;  3G71 P;  1SFC D;  1OW7 A;  1GW4 A;  1SQV K;  2HFE D;  1J1E C;  1Q90 D;  1PGJ A;  1KB9 E;  5K5G B;  1KTM A;  1L0N J;  1SQX E;  3H1J D;  2JEE A;  1FZE A;  2K37 A;  1KB9 I;  2OTJ P;  4MN4 C;  1GL2 D;  1N7S D;  1JMB A;  4B86 A;  3CX5 E;  2IX7 C;  3H32 B;  3OJA B;  5KAI E;  2WSF H;  2XDJ A;  2GUS A;  3PJS K;  2E74 D;  3MIW A;  3B71 A;  4OWF A;  3WMM 0;  1PP9 D;  5AVV B;  1FJP A;  1VQ8 P;  3H1H E;  3CX5 I;  1L0N G;  3FXE A;  4XFJ A;  4PD4 D;  1NTM D;  3NMD A;  1R5L A;  1ZOY C;  3HD7 D;  2WVR A;  2WSE J;  2OGU A;  2WT7 A;  3CXH D;  1URQ A;  1QVF O;  3M0D C;  3RL0 B;  1T2K D;  4DCK A;  2MJZ A;  4HJG H;  3R4Y A;  1LT1 A;  1GZL A;  3L74 J;  5APY A;  1YJ9 P;  3SFD C;  2J5U A;  1RF0 A;  1L0L J;  2K9J A;  2FY8 A;  3N7N A;  4R4M A;  3CCQ P;  1JEK A;  5AVZ B;  3P7K A;  2IBZ D;  3SSU A;  2ZT9 B;  1GU4 A;  1MZ9 A;  5TIS E;  1KD1 Q;  3B8E B;  1NU1 K;  1CW5 A;  5CBO A;  2G8Y A;  4UB6 E;  3V2P A;  1LNQ A;  4D6T J;  4WVZ A;  1UIX A;  1R8E A;  2YXR B;  2R5B A;  1GK4 A;  3CL3 D;  5BVZ A;  3BAS A;  1AVY A;  2YIU B;  3H1K D;  3L74 G;  2JKV A;  2I1J A;  1KC8 Q;  1L0N E;  4LGD E;  1LTB C;  1L0L G;  5APX A;  2W6J H;  4GT1 A;  3GF7 A;  2LR2 A;  1YBK A;  2E75 B;  2MKV A;  2ZT9 C;  3EFG A;  2AEJ A;  1URQ B;  1OW8 A;  1JY3 O;  1AQT A;  1EDK A;  3ITK A;  3G3Z A;  1LTJ B;  3BCC J;  4GIF A;  2R44 A;  3OW2 O;  2ZVN B;  2A06 D;  3RK3 D;  1JCD A;  1VL2 A;  1X9V A;  5AVT B;  2YIU C;  4D6T G;  1HVV A; 
#chains in the Genus database with same CATH homology
 1YTZ I;  3KDP B;  5AVS B;  3V4Q A;  3P32 A;  4N78 D;  3LW5 H;  1LT9 A;  5AW2 B;  1ZR4 A;  1LTT C;  2GM4 A;  2IFN A;  2FKW B;  3B5N B;  1M7L A;  3BAT A;  1LWU B;  1FBM A;  1G1I A;  1NTZ K;  2HPC A;  2WWW A;  2M8R A;  1DEB A;  1HWT C;  4WB4 A;  2Z4E A;  1RY3 A;  3HD7 C;  3H6P A;  4WY4 D;  1LTJ C;  2HLO A;  2O1K A;  4IFF A;  3U1C A;  2H8P D;  1IO4 A;  3HD7 A;  4C7R A;  1LTJ A;  3VMZ A;  1SQB K;  3M06 A;  1X79 B;  2HOD A;  3OAK A;  2P67 A;  1NTK K;  4XA4 A;  1RF0 C;  1T2K C;  3M91 A;  5CCG C;  3A2A A;  2KYV A;  2A45 I;  2ZXE B;  5CCG A;  3L36 A;  5AW1 B;  3HE4 B;  4ZKP A;  1T8Z A;  3B5N C;  2KLV A;  5AW8 B;  1SQQ K;  1LWU C;  2ZFC A;  5KJ7 D;  1GDT A;  1L4A D;  1PFI A;  1CI6 B;  3GHG B;  1N7L A;  2OYI A;  3OA7 A;  2YKP A;  1JY3 P;  5APU A;  1HGZ A;  2WPS A;  3VMY A;  3VP8 A;  2FXM A;  3RL0 D;  2GUV A;  1IFJ A;  1SLQ A;  1NTM K;  1GL2 B;  1J2J B;  5KJ7 A;  1XTG B;  1L4A A;  3HUS B;  2R5D A;  5KLV K;  1N7S B;  1JOC A;  1VDF A;  1AFO A;  2Q7C A;  5AW4 B;  3HTK A;  5AW0 B;  2XNX A;  4W80 A;  1GU5 A;  3NXS A;  1IFN A;  2YKO A;  3TYY A;  1IJD B;  1J1D B;  1LT9 B;  3BRV B;  2CPB A;  1FOS F;  2BAS A;  3E1I A;  1FZA A;  3RK3 B;  1S9K E;  5CMZ A;  1ZN5 A;  5AVX B;  4JYB A;  1KZU B;  1KIL D;  3GHG C;  2HPC B;  3SWY A;  1CZQ A;  1IC2 A;  1YTZ T;  3A7O A;  5APT A;  1CI6 A;  1S9K D;  3GHG A;  4Y99 C;  3RK2 D;  2Z5H A;  1FZF A;  1N2D C;  3HRN A;  1OXZ A;  1N73 C;  1Z56 A;  3HD7 B;  5AVW B;  1RE4 A;  1N73 A;  1FAV A;  1ZR2 A;  4EOT A;  3HUS C;  2HOD B;  3PP5 A;  3P8M C;  2W6A A;  5CHX A;  1N7S C;  2CPS A;  1GTW A;  1AQ5 A;  3LIE A;  5BU5 A;  2OAR A;  1LT9 C;  1JMM A;  2H7H A;  4JF7 A;  1M1J A;  1SQP K;  3MUD A;  3SWF A;  3RK3 C;  4W7Y A;  1JO5 A;  2KP8 A;  2NPS D;  3UIA A;  2J58 A;  4HYT B;  2Q3I A;  1IFM A;  1FZC A;  3M9Q A;  4IFD K;  2C0X A;  2OYI B;  2WSC H;  1FZB A;  2N1T D;  1GK6 A;  2A45 H;  4I6M C;  1URQ D;  3M9H A;  1FOS E;  1QL1 A;  2WPQ A;  1KFM A;  1VPC A;  2QM7 A;  1FZG A;  4XE5 B;  2FFD A;  1JY2 O;  2KOG A;  5AW3 B;  2W27 A;  3VYI A;  1IFD A;  1HBW A;  2NPS A;  1DH3 A;  4LC1 A;  1LTA C;  4GKG A;  5CJ4 A;  1SQX K;  1KFN A;  1E5W A;  1L4A B;  5AW7 B;  3V2Q A;  1T3U A;  2N1T A;  3CI9 A;  3HTK B;  4WY4 C;  1QL2 A;  3MD0 A;  4WY4 A;  5AVQ B;  3H32 A;  1H88 A;  1JCC A;  3M9B A;  1HTL C;  2XZR A;  2M3B A;  3P8C E;  1A02 F;  3C9I A;  5AVU B;  1NAF A;  2OYI C;  2XV5 A;  1YYC A;  3BRT B;  1MV8 A;  3II6 A;  3P8C D;  2P2U A;  3HE5 A;  2E42 A;  4Y99 B;  4WBA A;  1N73 B;  4EIJ A;  2XU6 A;  5CJ0 A;  2WIT A;  5KJ7 C;  4DZO A;  1L4A C;  4I1L A;  4C46 A;  4C7N A;  2J59 M;  1SFC D;  3RK2 B;  3RL0 C;  4HH2 A;  2YO3 A;  3LID A;  1JY2 N;  5AVY B;  1GW4 A;  3N4X A;  1SQV K;  1DX7 A;  2E43 A;  2HFE D;  1M1J B;  5AW5 B;  1RE3 A;  1J1E C;  3R2P A;  1SP4 A;  1RF1 A;  4AYC A;  1G1J A;  1FZC B;  1FU1 A;  3V5B A;  3I5C A;  1T3J A;  1SFC A;  2YMY A;  3A3Y B;  2LKM A;  2JEE A;  4O9B A;  1CSB A;  1RE4 C;  5CCH D;  1FZE A;  2FFD B;  1HH0 A;  3VMX A;  2NPS B;  2Z5I A;  2H43 A;  2WT7 B;  2KSJ A;  4M3L A;  2FYZ A;  2QM8 A;  2L5G B;  2Q5U A;  1KIL A;  2N1T B;  1GL2 D;  1NKZ B;  3RK2 C;  2FYU K;  3V2N A;  2YKQ A;  2O01 H;  2R3C A;  3TK1 A;  1N7S D;  2WZ7 A;  3TNU A;  2IFM A;  2POH A;  4B86 A;  1W2E A;  2P1J A;  2PAJ A;  2YNY A;  4WY4 B;  2IX7 C;  1M1J C;  1SVF A;  3H32 B;  3OJA B;  5CCH A;  1H89 A;  2WSF H;  1LTG C;  1L0L K;  2XDJ A;  1MFZ A;  2GUS A;  1NH4 A;  5APW A;  5KTB A;  1FZC C;  3MIW A;  2OYH A;  1G2C A;  3IR9 A;  3WMM 0;  4W7Z A;  2Q9I A;  2I1K A;  1OWA A;  2WSE H;  3HE5 B;  5AVV B;  1FJP A;  1NHL A;  3A5T A;  2FFD C;  2C0W A;  2YO2 A;  2NPS C;  2XKM A;  3NMD A;  3HD7 D;  3MTU E;  2N1T C;  1URQ C;  4C7N B;  2WT7 A;  1KQL A;  1IK9 A;  3T97 A;  1MUU A;  1URQ A;  1L0N K;  1JTH A;  1LTS C;  4ZKU A;  1ZLL A;  3M0D C;  2N9B A;  3RL0 B;  1T2K D;  5CCG D;  3M0A A;  2MJZ A;  3M0D A;  1RF1 B;  1J1E B;  1GZL A;  1GD2 E;  1SFC B;  1FJK A;  3B5N D;  5BU8 B;  1JY3 N;  3U1A A;  2WPR A;  5APY A;  4AUW A;  2IPP A;  1JUN A;  1RF0 A;  2C9L Y;  3BVH A;  1HUC A;  1GW3 A;  2O1J A;  1LGH B;  1NWQ A;  3N7N A;  3MGN A;  1N86 A;  1NKN A;  3NTN A;  1H8A A;  1KIL B;  3IFM A;  3U59 A;  4JYC A;  2R32 A;  5AVZ B;  2PP6 A;  3NFQ A;  3B5N A;  3P7K A;  1HGV A;  1LWU A;  5AW9 B;  2A45 G;  1GU4 A;  3TNU B;  1MZ9 A;  1HJB A;  3VN0 A;  1RE3 C;  2WTY A;  1NO4 A;  3KPE A;  2JJL A;  3L37 A;  2P7J A;  1RF1 C;  3B8E B;  5APQ A;  1NU1 K;  1CW5 A;  1HVV A;  2OYH B;  1X8Y A;  3V2P A;  2VRS A;  1G2C B;  1SFC C;  3CLQ A;  5AVR B;  2C9N Y;  5APV A;  2R5B A;  4OH8 B;  1GK4 A;  3CL3 D;  5BVZ A;  1NOH A;  3BAS A;  2W6B A;  3EQ2 A;  2I1J A;  1JY2 P;  3HE4 A;  5APS A;  1ZV8 A;  3VP9 A;  1KIL C;  3L35 A;  4LGD E;  1LTB C;  4N3Y B;  5APX A;  4AQR D;  1IFI A;  4GT1 A;  3TSI A;  1A02 J;  3KYQ A;  3EFG A;  4N6J A;  1WT6 A;  1URQ B;  1FDM A;  1JTH B;  2KB7 P;  1JNM A;  5CCH C;  2HYN A;  4KHX A;  2HG5 D;  3L4F A;  1JY3 O;  3KQG A;  4LLH A;  1LTI C;  3O8Z A;  3VOP A;  2OYH C;  3G3Z A;  1LTJ B;  1GL2 C;  4GIF A;  1XTC C;  4I2L C;  3V2R A;  4IFM A;  3RK3 D;  1GL2 A;  4N78 E;  1JCD A;  5AW6 B;  3VTP C;  1X9V A;  5AVT B;  3HUS A;  4DOJ A;  1N7S A;  4RES B;  1EQ7 A;  1J1D C;  3V4W A;  1WRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...