2MKVA

Structure of the na,k-atpase regulatory protein fxyd2b in micelles
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
LDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRSGGNKKRRQINEDEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Sodium/potassium-transporting ATPase subunit gamma
publication title Structure of the Na,K-ATPase regulatory protein FXYD2b in micelles: Implications for membrane-water interfacial arginines.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02038 ATP1G1_PLM_MAT8 ATP1G1/PLM/MAT8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.780 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2mkvA00
2JP3A 2MKVA 1Y9BA 2JO1A
chains in the Genus database with same CATH superfamily
2YIUB 1VL2A 1NTKE 1NU1J 3B4SA 4B86A 1G2CA 1NTMJ 2QM7A 4IL6H 1L4AB 2AXTH 1URQB 1X79B 1IJDB 2QA4P 3CX5E 2CPBA 1P84D 2BCCD 1KILA 2C0XA 3NFQA 1Y47A 1M8OB 1KB9H 1PGOA 1NKNA 1A02F 1J2JB 2I1KA 1SQQE 4MN4C 2ZXEB 3AEBC 1ZLLA 5CCHA 4QMAA 1EXJA 1DEBA 1LTJB 1OMIA 4HH2A 3IR9A 3VMZA 5H2FH 3EFGA 4D6TE 2R32A 4YXDC 1IFDA 2K9JA 1PPJD 2BEQD 2OYHB 1VQ6P 1DEEG 2GUSA 3KXDA 2QE7H 1JMMA 1L0LE 2Q3IA 3CCVP 1HJBA 3HE4A 5KAIH 1BGYE 2XDJA 4YTPC 3C1LA 1VQLP 1GW4A 2PGDA 1LT9A 3Q1MA 1N7SA 5APQA 4R4LA 3RK2B 2KNCB 3A3YB 2WTYA 1N73A 2A06G 3S1KA 3PLNA 1JY3P 3CXHD 1NTZJ 4DT0A 2NPSD 2QJYC 1L0NJ 1PGJA 2J5UA 1NTMG 1LGHB 1DX7A 4I6MC 1S1CX 3AEGC 1SQVD 4NPFX 2A06E 1LTAC 2FY8A 2H8PD 2IBZD 1FOSF 3R4YA 3H1KJ 4GIFA 2KOGA 3BRVB 2ZAEB 4I7ZC 4PV1B 1BDCA 2K1AA 3T97A 3TK1A 1JTHA 4L74A 4KT0J 2YXQB 2FYUG 3M9BA 1KMIZ 2WSCH 2OYIB 2QVAA 1MKMA 1GL2B 1HUCA 3VN0A 3OJAB 2W6BA 2NZ2A 4LGDE 3K5BA 3D6ZA 1L2PA 1N86A 3MTUE 1UIIA 1RE3A 1FU1A 3L4FA 2FYUE 1SVFA 5CCGD 2FXPA 1MV8A 1FZFA 1SQXD 4BRYA 2W8ZA 2JP3A 1P84E 1BCCJ 1OW7A 2BCCE 5E79H 3JCUE 4ZNCA 4H44C 1YI2P 3IF4A 1QVGO 3H1IJ 3W67A 2DW3A 2HPCA 1CW5A 1NTZG 1L0NG 1RY3A 1KZUB 4W80A 2XU6A 2XZRA 1MUUA 1IFJA 3CCSP 5DJUB 2QJPC 2AEMA 4I2LC 1HGVA 1PPJE 1BE3D 3L71J 3SSUA 1USEA 2P2UA 3FWNA 2M3BA 2E74C 1A02J 1YQ3C 3IAOA 2PP6A 3MD0A 3VOPA 1VQPP 3H1LE 1RF1B 2IZ0A 1JCDA 1JM0A 3GHGB 1Z56A 3M91A 2JJLA 2Q7CA 2M5AA 2V4HA 5EFWB 1NAFA 4JYBA 2Q1KA 2AEJA 3II6A 2M0BA 1M1JB 3L72J 2B89A 2NPSA 3BCCD 1GMJA 1LTSC 3OA7A 1MFZA 3CXHE 3VTPC 4Z1MH 2OTLP 1EZVI 4LC1A 1K8AQ 1GU5A 4UB6E 2D2CB 1M1KQ 1R5SA 1LP1B 3H1JJ 3C8VA 5BVZA 1OWAA 3WUVA 1BCCG 1AQTA 5B5EE 1IZNB 3CWBD 1W2BO 3H1HD 3HTKA 1VF5D 3HD7D 3H1IG 5KLVJ 1M56D 1FZCB 4WY4D 2YNYA 2E75C 5APUA 4H0LC 4IOIH 4O9BA 2HODA 1SLQA 3L73D 1K73Q 3BATA 3L70J 4PD4I 2R5DA 1SQBD 5CCHC 3L74D 2WITA 4RESB 3AE6C 3M0DC 5BU8B 4U3FE 4ZKPA 1H89A 2C9LY 2A45H 1SFCC 1EQ7A 3RK3B 5CCGA 1BSHA 2WT7B 1USDA 3SFEC 3PTZA 2E76B 3I56P 2WPRA 1NTKD 2A45I 3WMM0 4Y99C 2IZ1A 4H13B 5CJ0A 4A7PA 2JO1A 1DIPA 3MHVA 2WSEH 2WPSA 1QEXA 2FKWB 2YXRB 2KZJA 3AE8C 3L72G 2R3SA 3SWYA 4UB8E 5B66H 1Q2NA 1EZVG 5DJTB 3RK3E 2OYHC 2QJKB 1K9MQ 3AE3C 4GODA 1N7LA 3VMXA 1L4AD 1URQD 3CX5H 5KLVG 4AYCA 1YTZI 1SQPK 1NYHA 2Z4EA 2GUVA 1NKZB 4C7NA 1K05A 4ZKUA 3Q2YA 3H32A 1PIXA 1NU1K 1PP9G 2O01N 4WY4B 4LLHA 3MGNA 2E5TA 2N1TB 4HYTB 3ZDMA 3L35A 5GTIE 3BCCE 1XTCC 2KIKA 3U1CA 4RJTA 1FS0E 1PP9E 1Q86Q 1AJYA 2W6JH 1RE3C 2KYVA 3FX0A 2KS1A 3AE9C 3FWLA 2GA1A 3G3ZA 1CI6B 4AUWA 1YHQP 2LR2A 1QVFO 2WVRA 1S9KD 3LIDA 2P1JA 2A06D 2IYPA 1VQ7P 3GF3A 4TLFA 1WRGA 1RH5B 3TGUG 1NTMD 3L75J 4BWNA 3HUSB 3L73E 2YMYA 2ITAA 2O01J 4GKGA 5APYA 1TU3F 2QIWA 1SQBE 1IO4A 5BU5A 3RK2D 1NOHA 1X9VA 2JWDA 3AEDC 1T8ZA 2ZYAA 5KLIC 1IK7A 1IFIA 1SQPJ 3H25A 3L36A 1PFIA 5AVVB 2AXCA 2O3JA 3BVHA 3O6QB 2FYUD 2KP8A 3E1RA 1CSBA 3CCQP 1IFMA 1NTZK 3AEEC 1L0NK 3MP7B 4PV1D 4JF7A 3VMAA 2IFMA 4OGQB 1S2EA 1IK9A 3MUDC 3MIWA 2NPSC 3IFMA 1GL2D 3CLQA 5KKZB 1KB9I 3R2PA 4L75A 2LXBA 1LT1A 3M0DA 2VRSA 5KTBA 1J1EC 1OVUA 1RHZB 3LW5H 1SFCA 2YKOA 3HE4B 5AVWB 3TSIA 1RF1C 1NTZD 4GOEA 3LIEA 3GHGC 1P84H 3KZIE 3L75G 1LTBC 1HTLC 1U57A 2ZVOB 3JCUH 1N73B 1FE6A 1T3UA 3H1LD 5AW0B 3M06A 1AFOA 2Z5HA 1FZAA 2M3EA 1FJKA 4W7YA 4NPDA 3Q5RA 4HJGH 1JY2P 4WWIA 3TDKA 5C39A 1SQPG 1LTJA 5M1BA 1RF0C 2E42A 4N6JA 5CCGC 1K04A 1KQSO 1QGKB 1NU1G 1PZQA 2OYHA 2OGUA 5APTA 4I1LA 2OTKE 2YO3A 1S9KE 2C0WA 5APSA 3T97B 1JTHB 5KJ7D 3RL0B 3EWKA 5AW8B 1NU1E 3VMYA 1OVVA 1NTME 3CCRP 2K3RA 1OFCX 3IN6A 1T6AA 3A0HE 3WUTA 1ZRTE 2R5BA 4GDOA 1HVVA 2FYNB 4YXWH 2Y0EA 2KB7P 3PJSK 3CXHH 2AXTE 3B5ND 3FXEA 4U3FD 5AW1B 4DJGA 4UB6H 1J1DB 3CCJP 3CXHI 2D2CD 2WSCJ 2HYNA 1KYOD 4DZOA 2AEFA 5AVYB 1M7LA 1EDLA 1FZBA 2HPCB 1YJWP 1SQVJ 2KLVA 2IFNA 1YITP 1QL2A 3HE5A 2IBZI 2O1JA 2QRXA 3BRTB 3M9QA 1HBWA 4OWFA 2QJKC 1JEKA 1GL2A 3N7NA 2Y9ZA 1LTGC 4BXLA 5TISE 3O8ZA 1YQ4C 5KLVK 3CCUP 5AVQB 3RK3D 1H8AA 1DD3A 1ZR4A 3L72D 2E76D 2W90A 3SWKA 1VF5C 2R3CA 1NTZE 3HD7C 1NGMB 1GW3A 2M5AB 1FDMA 2B87B 1L0NE 4WY4C 4H13D 3USSA 1EC5A 3H1KG 4K3AA 2WQYC 5AVUB 1R5LA 1SQXJ 4K35A 5AVSB 1JMBA 3FXDA 4OH8B 4L76A 4U7JA 1LWUB 4UB8H 3H1KE 1S72P 5KLVD 1OIPA 2FXOA 3MUDA 2H88C 4GOFA 1KV4A 3SFDC 3B5NB 1OW8A 1KQFB 1PP9D 4EYYQ 1CZQA 3C9IA 2RMZA 5AW3B 4R4MA 3PH0A 3WU2E 1KTMA 5KJ7A 2HODB 1VQ5P 2QG4A 2W83C 2KLUA 1RF1A 1BE3J 4TT3H 3GHGA 1EDKA 1YIJP 2YKQA 2ZYGA 5AVTB 1BCCE 2N1TD 4XFJA 5GTIH 2QJYB 2OARA 1W2EA 2YIUC 1ZN5A 1Q82Q 3H1IE 1T2KD 3TGUD 1VQMP 1YTZT 1L4AC 1RF0A 3GW6A 1URQC 1OXZA 3D6YA 1KYOE 3TNUB 2KXPB 3L71G 2YO2A 4NPEA 1NJIQ 1QL1A 4I7ZB 3V5BA 2KSEA 1FZCA 3WUUA 1MFTA 1S5LE 3KDPB 5AW7B 1VPCA 3CWBJ 3H1HJ 1W5CE 1OX3A 3AE4C 4AQRD 1FDIA 1LTJC 1Y8AA 3CC2P 2KSJA 5AW4B 3E7KA 1G1IA 2CK3H 2XNDH 2WSEJ 3L73J 3UIAA 1JY3O 4EDFA 3N4XA 3RBZA 1KN7A 1LNQA 2WT7A 5CHXA 3L74J 3H1JG 1DD4A 1KILD 3KPEA 1YBKA 3L72E 3V2RA 2JWAA 1L0LK 3H32B 5KAFE 3GLMA 4H44B 1EZVE 1NTKJ 1KFMA 3H1JE 3GF7A 1SS1A 5AVRB 2C9NY 1AVOA 3RK2C 3L70G 1X0TA 4OGQD 2QSIA 3CX5I 2K9YA 1ZMEC 2KS1B 3EFFK 1VQ9P 5KLVE 2K88A 1JY3N 5APWA 3U59A 1AQ5A 3L75D 1EDJA 1SQQJ 2N9YB 3V2PA 2WMMA 1NHLA 3L70E 3V6IA 1ZW0A 2YMKA 2XNXA 4PD4E 2G3AA 3CMAP 2E74B 3A0BE 2ZT9B 2A45G 3Q5PA 1SQPD 3KZIH 3NTNA 2P67A 4PV1C 4HB1A 3HD7A 2W27A 4D6TJ 1WMKA 3P8CD 4WY4A 3AECC 1FOSE 1NU1D 5K5GB 2MJZA 1PGPA 3PHLA 2FFDB 2OYIC 3V4WA 5GTHE 1GL2C 2V7QH 1NAYA 2JDIH 1ZRTD 1J1DC 1U7MA 2Y0DA 1L0LJ 5TJHA 3CD6P 3QWOC 5CBOA 2Q5UA 3OW2O 1BGYJ 1G2CB 3TGUE 1N8RQ 5APXA 2K37A 4WVZA 3AEFC 1WT6A 2H7HA 3AE7C 1H0TA 1PL5A 3VP8A 2LXCB 1KILB 2W6AA 4JYCA 2E75B 4H0LB 3RL0D 5B66E 2FBWC 1N2DC 2OQQA 4C7RA 1BDDA 3Q5SA 2IPPA 3A0HH 2XV5A 3JSVC 1HF9A 2JEEA 4RO0A 4PJ0E 2WPVB 2P58A 4JQ0D 4JBZA 4ZMDA 1FBMA 1SQQG 2FXMA 2ZXXA 1SFCB 1Q7YQ 4YPCA 4KJMA 2K9JB 2KUBA 1LTTC 1KQLA 3CCMP 1YJNP 4DOJA 1RQVA 4Y99B 1KILE 1VDFA 5KJ7C 3O6QA 1LJ2A 1L4AA 1UIXA 1PGQA 1URQA 3VP9A 1U7JA 4L73A 4D6TG 2BASA 2OYOA 3CMEP 2FYZA 3A2AA 1GTWA 3NMDA 3L37A 1L0ND 1LWUC 1JNMA 1LT9B 2FYUJ 3A7OA 4N78E 1N7SB 3E1IA 3LW5J 3GMAA 2JR8A 1M1JC 1VQKP 4WB4A 1DH3A 1L0LG 2PRRA 1P84I 2BCCJ 1E5WA 1BGYG 3B5NC 5TISH 1Q90D 4KHXA 3L75E 3H1KD 1SQVK 2D2CC 1KC8Q 3CCEP 3AE1C 5AVZB 1IFNA 4IFFA 3CL3D 1Q81Q 2Q3EA 1SQPE 3S9OA 1FZCC 1RQUA 4XE5B 2KI7B 1M90Q 3CC4P 3P8CE 3AE5C 1T3JA 2POHA 5AW6B 3G71P 1VQOP 4JPZB 3MZWB 2KNCA 1BCCD 3H1LJ 3RK3C 4IL6E 2ZYDA 4RKUJ 1SQXK 2E76C 1Y9BA 3PP5A 4BRYB 3RGUA 3H1ID 3WU2H 4H13C 3HE5B 1KB9E 2IDBA 5B5EH 2P10A 4EI2A 1H88A 3QH9A 1RE4C 2HR3A 2BCCG 1ZOYC 3L71D 4EIJA 2J59M 1KQGB 5H2FE 1SP4A 5KLIB 1FZGA 2OYIA 1NVOA 5APVA 2HFED 2QM8A 1KYOH 3P32A 1HH0A 3M0AA 2N9BA 4U3FJ 1IFPA 2P7JA 2LKMA 5KAIE 3D71A 1KYOI 1PPJG 3TF5A 1E79H 2E43A 3KYQA 1S4XA 2GM4A 1EZVD 1S5LH 4OVNF 2NRGA 3V2QA 2N1TC 3H1JD 2NPSB 2ZFCA 3HRNA 3H1LG 1VQ4P 1JUNA 2IYOA 4CPGA 2WZ7A 1JCCA 1T2KC 1JOCA 1S3JA 3H6PA 1J1EB 3I55P 1X22A 3FGAD 2ZT9C 3CI9A 3CCLP 4ASVA 1ZXGA 1ZV8A 4WBAA 1ZP0C 1AV1A 3AE2C 3ABVC 3HTKB 3L70D 4PD4D 5KAFH 1JB0J 2B87A 3CC7P 1HJ0A 2G8YA 3NXSA 1AA0A 2FFDC 2UWJE 1SQVG 3KHUA 4H44D 3PRJA 2Y0CA 3HUSC 1SQBK 1M57D 4IL6X 2WSFH 5AW2B 2IBZG 2QEXP 1LWUA 3U1AA 3F5HA 2H89C 3SWFA 1M1JA 1SQVE 2WSFJ 4HKZH 4C46A 3Q3DA 1NTKK 1FZEA 1D7MA 1KILC 1EDIA 3B5NA 2IBZE 2PFXA 3I5CA 4PD4H 2RH0A 1KORA 4U3FG 1FJPA 3P7KA 1GK6A 3W68A 4DCKA 1LP1A 3A0BH 5E79E 3BCCJ 2WSSH 2E74D 3KQGA 2Q6QA 2ZT9D 4IFMA 2ZVNB 2RKLA 3JC22 2WWWA 5CBNA 1PP9J 1HWTC 2L5GB 1FC2C 4OGQC 1SQQK 1SQXG 3V4QA 1JO5A 2XKMA 1IC2A 5GTHH 3L71E 3S4RA 1JY2O 3AEAC 5KKZC 1GU4A 3RBXA 2I1JA 1FAVA 3B8EB 1SQXE 4W7ZA 3B71A 3RL0g 1QX8A 1XTGB 3ITKA 2ZJSE 3CX5D 5CJ4A 3TNUA 1OW6A 2KZIA 1SQBJ 1AVYA 4C7NB 3P8MC 2L91A 1LT9C 1VQNP 5AVXB 1N7SC 3TGUJ 1GK4A 1SQQD 3D70A 1N73C 1NWQA 1EXIA 4EOTA 3G6EP 2E75D 1BE3G 2M8RA 4H0LD 1OZHA 2PAJA 3VYIA 2YKPA 4N78D 4PJ0H 5CCHD 2Z5IA 1JY2N 1VQ8P 3EQ2A 1RE4A 1BE3E 3G9RA 4D6TD 1KD1Q 1SFCD 1BSNA 1LTIC 1YYCA 3CPWO 5AW5B 2KK7A 1NO4A 3A5TA 2RN0A 1YJ9P 4XA4A 4N3YB 3BCCG 1X8YA 1GD2E 1VF5B 2QJPB 2J58A 3OAKA 3HD7B 1L0LD 1ZR2A 5L8RJ 3RL0C 1MZ9A 1NTMK 1BGYD 1G1JA 5CMZA 2Y9YA 2E5YA 3M9HA 2IX7C 2HG5D 2SPZA 1FDOA 2WPQA 3BASA 3CWBG 2OTJP 3H1HG 1N7SD 4ASWA 2FYNC 1OVRA 3GG2A 1HGZA 4GT1A 1GZLA 2I8DA 2BEZF 2N1TA 1R8EA 3L73G 2HLOA 1H0TB 2CPSA 4IFDK 2JKVA 3V2NA 2Q9IA 3CWBE 3H1HE 1SQBG 2FYUK 3L74G 2O01H 1PV3A 2H43A 1GDTA 2V7QJ 3G4SP 2B9BA 3TYYA 1QLED 1CI6A 1KFNA 1S5LX 2B88A 4Y28J 5AW9B 3F89A 1NH4A 2MKVA 3L74E 1KB9D 1NTKG 2R44A 4M3LA 2FFDA 2O1KA 3HUSA
chains in the Genus database with same CATH topology
4PV1C 2O01J 1RQVA 1TU3F 1U57A 1VL2A 1KILE 2H88C 2QIWA 3AE4C 4H44C 1VF5B 3AE3C 3O6QA 1FDIA 1WMKA 3SFDC 4RKUJ 1VF5D 3AECC 4OGQC 1OW8A 1UIXA 2E76C 1KQFB 5L8RJ 1Y9BA 2QJYC 3AEDC 2WSEJ 2J5UA 5KLIC 1IK7A 2E75C 4R4MA 3Q5RA 1KTMA 3H25A 4H0LC 4H13C 3FGAD 2ZT9C 1NYHA 1S1CX 3AEGC 3LW5J 1FDOA 3AEAC 5M1BA 5KKZC 1K05A 1DD4A 3GMAA 2IDBA 2P10A 1ZP0C 3AE2C 1K04A 2FYNC 2QJKC 3ABVC 3Q2YA 4TT3H 3AE6C 1PIXA 2QJPC 3B71A 3RL0g 3R4YA 1JB0J 3GLMA 3AEEC 1HJ0A 1Q90D 2BEZF 4I7ZC 2G8YA 4PV1B 3AEFC 4H44B 1R8EA 3AEBC 3AE7C 1YQ4C 1PL5A 1OW6A 1ZOYC 2E74C 4PV1D 1EXJA 3GF7A 4H44D 1YQ3C 1OMIA 2D2CC 3IAOA 3T97B 4XFJA 3SFEC 4OGQB 2E76B 4KT0J 1KQGB 3EWKA 1DD3A 1KMIZ 4IL6X 3AE1C 1PV3A 2E75B 2YIUC 1MKMA 2E76D 4OGQD 3RK3E 1AJYA 2QSIA 3D70A 4H0LB 1VF5C 2V7QJ 2K9YA 1EXIA 4YXDC 1ZMEC 2FBWC 3AE9C 4H13B 2E75D 2JO1A 1NGMB 2OQQA 1DIPA 2NZ2A 4H0LD 3Q5SA 2H89C 3IN6A 2BEQD 3D6ZA 4H13D 1ZRTE 1S5LX 2WQYC 4Y28J 3S9OA 3D6YA 2WSFJ 1HF9A 1RQUA 4GDOA 2WPVB 2MKVA 1GMJA 3AE8C 3Q3DA 4Z1MH 3AE5C 2YMKA 2FXPA 3GF3A 4I7ZB 1KORA 2G3AA 3G9RA 4U7JA 3D71A 2E74B 2JP3A 2ZT9B 2D2CB 4YTPC 1OW7A 3C8VA 2E74D 3Q1MA 3Q5PA 2ZT9D 2D2CD 2WSCJ 4R4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JP3 A;  2MKV A;  1Y9B A;  2JO1 A; 
#chains in the Genus database with same CATH topology
 2YIU B;  1VL2 A;  1NTK E;  1NU1 J;  3B4S A;  4B86 A;  1G2C A;  1NTM J;  2QM7 A;  4IL6 H;  1L4A B;  2AXT H;  1URQ B;  1X79 B;  1IJD B;  2QA4 P;  3CX5 E;  2CPB A;  1P84 D;  2BCC D;  1KIL A;  2C0X A;  3NFQ A;  1Y47 A;  1M8O B;  1KB9 H;  1PGO A;  1NKN A;  1A02 F;  1J2J B;  2I1K A;  1SQQ E;  4MN4 C;  2ZXE B;  3AEB C;  1ZLL A;  5CCH A;  4QMA A;  1EXJ A;  1DEB A;  1LTJ B;  1OMI A;  4HH2 A;  3IR9 A;  3VMZ A;  5H2F H;  3EFG A;  4D6T E;  2R32 A;  4YXD C;  1IFD A;  2K9J A;  1PPJ D;  2BEQ D;  2OYH B;  1VQ6 P;  1DEE G;  2GUS A;  3KXD A;  2QE7 H;  1JMM A;  1L0L E;  2Q3I A;  3CCV P;  1HJB A;  3HE4 A;  5KAI H;  1BGY E;  2XDJ A;  4YTP C;  3C1L A;  1VQL P;  1GW4 A;  2PGD A;  1LT9 A;  3Q1M A;  1N7S A;  5APQ A;  4R4L A;  3RK2 B;  2KNC B;  3A3Y B;  2WTY A;  1N73 A;  2A06 G;  3S1K A;  3PLN A;  1JY3 P;  3CXH D;  1NTZ J;  4DT0 A;  2NPS D;  2QJY C;  1L0N J;  1PGJ A;  2J5U A;  1NTM G;  1LGH B;  1DX7 A;  4I6M C;  1S1C X;  3AEG C;  1SQV D;  4NPF X;  2A06 E;  1LTA C;  2FY8 A;  2H8P D;  2IBZ D;  1FOS F;  3R4Y A;  3H1K J;  4GIF A;  2KOG A;  3BRV B;  2ZAE B;  4I7Z C;  4PV1 B;  1BDC A;  2K1A A;  3T97 A;  3TK1 A;  1JTH A;  4L74 A;  4KT0 J;  2YXQ B;  2FYU G;  3M9B A;  1KMI Z;  2WSC H;  2OYI B;  2QVA A;  1MKM A;  1GL2 B;  1HUC A;  3VN0 A;  3OJA B;  2W6B A;  2NZ2 A;  4LGD E;  3K5B A;  3D6Z A;  1L2P A;  1N86 A;  3MTU E;  1UII A;  1RE3 A;  1FU1 A;  3L4F A;  2FYU E;  1SVF A;  5CCG D;  2FXP A;  1MV8 A;  1FZF A;  1SQX D;  4BRY A;  2W8Z A;  2JP3 A;  1P84 E;  1BCC J;  1OW7 A;  2BCC E;  5E79 H;  3JCU E;  4ZNC A;  4H44 C;  1YI2 P;  3IF4 A;  1QVG O;  3H1I J;  3W67 A;  2DW3 A;  2HPC A;  1CW5 A;  1NTZ G;  1L0N G;  1RY3 A;  1KZU B;  4W80 A;  2XU6 A;  2XZR A;  1MUU A;  1IFJ A;  3CCS P;  5DJU B;  2QJP C;  2AEM A;  4I2L C;  1HGV A;  1PPJ E;  1BE3 D;  3L71 J;  3SSU A;  1USE A;  2P2U A;  3FWN A;  2M3B A;  2E74 C;  1A02 J;  1YQ3 C;  3IAO A;  2PP6 A;  3MD0 A;  3VOP A;  1VQP P;  3H1L E;  1RF1 B;  2IZ0 A;  1JCD A;  1JM0 A;  3GHG B;  1Z56 A;  3M91 A;  2JJL A;  2Q7C A;  2M5A A;  2V4H A;  5EFW B;  1NAF A;  4JYB A;  2Q1K A;  2AEJ A;  3II6 A;  2M0B A;  1M1J B;  3L72 J;  2B89 A;  2NPS A;  3BCC D;  1GMJ A;  1LTS C;  3OA7 A;  1MFZ A;  3CXH E;  3VTP C;  4Z1M H;  2OTL P;  1EZV I;  4LC1 A;  1K8A Q;  1GU5 A;  4UB6 E;  2D2C B;  1M1K Q;  1R5S A;  1LP1 B;  3H1J J;  3C8V A;  5BVZ A;  1OWA A;  3WUV A;  1BCC G;  1AQT A;  5B5E E;  1IZN B;  3CWB D;  1W2B O;  3H1H D;  3HTK A;  1VF5 D;  3HD7 D;  3H1I G;  5KLV J;  1M56 D;  1FZC B;  4WY4 D;  2YNY A;  2E75 C;  5APU A;  4H0L C;  4IOI H;  4O9B A;  2HOD A;  1SLQ A;  3L73 D;  1K73 Q;  3BAT A;  3L70 J;  4PD4 I;  2R5D A;  1SQB D;  5CCH C;  3L74 D;  2WIT A;  4RES B;  3AE6 C;  3M0D C;  5BU8 B;  4U3F E;  4ZKP A;  1H89 A;  2C9L Y;  2A45 H;  1SFC C;  1EQ7 A;  3RK3 B;  5CCG A;  1BSH A;  2WT7 B;  1USD A;  3SFE C;  3PTZ A;  2E76 B;  3I56 P;  2WPR A;  1NTK D;  2A45 I;  3WMM 0;  4Y99 C;  2IZ1 A;  4H13 B;  5CJ0 A;  4A7P A;  2JO1 A;  1DIP A;  3MHV A;  2WSE H;  2WPS A;  1QEX A;  2FKW B;  2YXR B;  2KZJ A;  3AE8 C;  3L72 G;  2R3S A;  3SWY A;  4UB8 E;  5B66 H;  1Q2N A;  1EZV G;  5DJT B;  3RK3 E;  2OYH C;  2QJK B;  1K9M Q;  3AE3 C;  4GOD A;  1N7L A;  3VMX A;  1L4A D;  1URQ D;  3CX5 H;  5KLV G;  4AYC A;  1YTZ I;  1SQP K;  1NYH A;  2Z4E A;  2GUV A;  1NKZ B;  4C7N A;  1K05 A;  4ZKU A;  3Q2Y A;  3H32 A;  1PIX A;  1NU1 K;  1PP9 G;  2O01 N;  4WY4 B;  4LLH A;  3MGN A;  2E5T A;  2N1T B;  4HYT B;  3ZDM A;  3L35 A;  5GTI E;  3BCC E;  1XTC C;  2KIK A;  3U1C A;  4RJT A;  1FS0 E;  1PP9 E;  1Q86 Q;  1AJY A;  2W6J H;  1RE3 C;  2KYV A;  3FX0 A;  2KS1 A;  3AE9 C;  3FWL A;  2GA1 A;  3G3Z A;  1CI6 B;  4AUW A;  1YHQ P;  2LR2 A;  1QVF O;  2WVR A;  1S9K D;  3LID A;  2P1J A;  2A06 D;  2IYP A;  1VQ7 P;  3GF3 A;  4TLF A;  1WRG A;  1RH5 B;  3TGU G;  1NTM D;  3L75 J;  4BWN A;  3HUS B;  3L73 E;  2YMY A;  2ITA A;  2O01 J;  4GKG A;  5APY A;  1TU3 F;  2QIW A;  1SQB E;  1IO4 A;  5BU5 A;  3RK2 D;  1NOH A;  1X9V A;  2JWD A;  3AED C;  1T8Z A;  2ZYA A;  5KLI C;  1IK7 A;  1IFI A;  1SQP J;  3H25 A;  3L36 A;  1PFI A;  5AVV B;  2AXC A;  2O3J A;  3BVH A;  3O6Q B;  2FYU D;  2KP8 A;  3E1R A;  1CSB A;  3CCQ P;  1IFM A;  1NTZ K;  3AEE C;  1L0N K;  3MP7 B;  4PV1 D;  4JF7 A;  3VMA A;  2IFM A;  4OGQ B;  1S2E A;  1IK9 A;  3MUD C;  3MIW A;  2NPS C;  3IFM A;  1GL2 D;  3CLQ A;  5KKZ B;  1KB9 I;  3R2P A;  4L75 A;  2LXB A;  1LT1 A;  3M0D A;  2VRS A;  5KTB A;  1J1E C;  1OVU A;  1RHZ B;  3LW5 H;  1SFC A;  2YKO A;  3HE4 B;  5AVW B;  3TSI A;  1RF1 C;  1NTZ D;  4GOE A;  3LIE A;  3GHG C;  1P84 H;  3KZI E;  3L75 G;  1LTB C;  1HTL C;  1U57 A;  2ZVO B;  3JCU H;  1N73 B;  1FE6 A;  1T3U A;  3H1L D;  5AW0 B;  3M06 A;  1AFO A;  2Z5H A;  1FZA A;  2M3E A;  1FJK A;  4W7Y A;  4NPD A;  3Q5R A;  4HJG H;  1JY2 P;  4WWI A;  3TDK A;  5C39 A;  1SQP G;  1LTJ A;  5M1B A;  1RF0 C;  2E42 A;  4N6J A;  5CCG C;  1K04 A;  1KQS O;  1QGK B;  1NU1 G;  1PZQ A;  2OYH A;  2OGU A;  5APT A;  4I1L A;  2OTK E;  2YO3 A;  1S9K E;  2C0W A;  5APS A;  3T97 B;  1JTH B;  5KJ7 D;  3RL0 B;  3EWK A;  5AW8 B;  1NU1 E;  3VMY A;  1OVV A;  1NTM E;  3CCR P;  2K3R A;  1OFC X;  3IN6 A;  1T6A A;  3A0H E;  3WUT A;  1ZRT E;  2R5B A;  4GDO A;  1HVV A;  2FYN B;  4YXW H;  2Y0E A;  2KB7 P;  3PJS K;  3CXH H;  2AXT E;  3B5N D;  3FXE A;  4U3F D;  5AW1 B;  4DJG A;  4UB6 H;  1J1D B;  3CCJ P;  3CXH I;  2D2C D;  2WSC J;  2HYN A;  1KYO D;  4DZO A;  2AEF A;  5AVY B;  1M7L A;  1EDL A;  1FZB A;  2HPC B;  1YJW P;  1SQV J;  2KLV A;  2IFN A;  1YIT P;  1QL2 A;  3HE5 A;  2IBZ I;  2O1J A;  2QRX A;  3BRT B;  3M9Q A;  1HBW A;  4OWF A;  2QJK C;  1JEK A;  1GL2 A;  3N7N A;  2Y9Z A;  1LTG C;  4BXL A;  5TIS E;  3O8Z A;  1YQ4 C;  5KLV K;  3CCU P;  5AVQ B;  3RK3 D;  1H8A A;  1DD3 A;  1ZR4 A;  3L72 D;  2E76 D;  2W90 A;  3SWK A;  1VF5 C;  2R3C A;  1NTZ E;  3HD7 C;  1NGM B;  1GW3 A;  2M5A B;  1FDM A;  2B87 B;  1L0N E;  4WY4 C;  4H13 D;  3USS A;  1EC5 A;  3H1K G;  4K3A A;  2WQY C;  5AVU B;  1R5L A;  1SQX J;  4K35 A;  5AVS B;  1JMB A;  3FXD A;  4OH8 B;  4L76 A;  4U7J A;  1LWU B;  4UB8 H;  3H1K E;  1S72 P;  5KLV D;  1OIP A;  2FXO A;  3MUD A;  2H88 C;  4GOF A;  1KV4 A;  3SFD C;  3B5N B;  1OW8 A;  1KQF B;  1PP9 D;  4EYY Q;  1CZQ A;  3C9I A;  2RMZ A;  5AW3 B;  4R4M A;  3PH0 A;  3WU2 E;  1KTM A;  5KJ7 A;  2HOD B;  1VQ5 P;  2QG4 A;  2W83 C;  2KLU A;  1RF1 A;  1BE3 J;  4TT3 H;  3GHG A;  1EDK A;  1YIJ P;  2YKQ A;  2ZYG A;  5AVT B;  1BCC E;  2N1T D;  4XFJ A;  5GTI H;  2QJY B;  2OAR A;  1W2E A;  2YIU C;  1ZN5 A;  1Q82 Q;  3H1I E;  1T2K D;  3TGU D;  1VQM P;  1YTZ T;  1L4A C;  1RF0 A;  3GW6 A;  1URQ C;  1OXZ A;  3D6Y A;  1KYO E;  3TNU B;  2KXP B;  3L71 G;  2YO2 A;  4NPE A;  1NJI Q;  1QL1 A;  4I7Z B;  3V5B A;  2KSE A;  1FZC A;  3WUU A;  1MFT A;  1S5L E;  3KDP B;  5AW7 B;  1VPC A;  3CWB J;  3H1H J;  1W5C E;  1OX3 A;  3AE4 C;  4AQR D;  1FDI A;  1LTJ C;  1Y8A A;  3CC2 P;  2KSJ A;  5AW4 B;  3E7K A;  1G1I A;  2CK3 H;  2XND H;  2WSE J;  3L73 J;  3UIA A;  1JY3 O;  4EDF A;  3N4X A;  3RBZ A;  1KN7 A;  1LNQ A;  2WT7 A;  5CHX A;  3L74 J;  3H1J G;  1DD4 A;  1KIL D;  3KPE A;  1YBK A;  3L72 E;  3V2R A;  2JWA A;  1L0L K;  3H32 B;  5KAF E;  3GLM A;  4H44 B;  1EZV E;  1NTK J;  1KFM A;  3H1J E;  3GF7 A;  1SS1 A;  5AVR B;  2C9N Y;  1AVO A;  3RK2 C;  3L70 G;  1X0T A;  4OGQ D;  2QSI A;  3CX5 I;  2K9Y A;  1ZME C;  2KS1 B;  3EFF K;  1VQ9 P;  5KLV E;  2K88 A;  1JY3 N;  5APW A;  3U59 A;  1AQ5 A;  3L75 D;  1EDJ A;  1SQQ J;  2N9Y B;  3V2P A;  2WMM A;  1NHL A;  3L70 E;  3V6I A;  1ZW0 A;  2YMK A;  2XNX A;  4PD4 E;  2G3A A;  3CMA P;  2E74 B;  3A0B E;  2ZT9 B;  2A45 G;  3Q5P A;  1SQP D;  3KZI H;  3NTN A;  2P67 A;  4PV1 C;  4HB1 A;  3HD7 A;  2W27 A;  4D6T J;  1WMK A;  3P8C D;  4WY4 A;  3AEC C;  1FOS E;  1NU1 D;  5K5G B;  2MJZ A;  1PGP A;  3PHL A;  2FFD B;  2OYI C;  3V4W A;  5GTH E;  1GL2 C;  2V7Q H;  1NAY A;  2JDI H;  1ZRT D;  1J1D C;  1U7M A;  2Y0D A;  1L0L J;  5TJH A;  3CD6 P;  3QWO C;  5CBO A;  2Q5U A;  3OW2 O;  1BGY J;  1G2C B;  3TGU E;  1N8R Q;  5APX A;  2K37 A;  4WVZ A;  3AEF C;  1WT6 A;  2H7H A;  3AE7 C;  1H0T A;  1PL5 A;  3VP8 A;  2LXC B;  1KIL B;  2W6A A;  4JYC A;  2E75 B;  4H0L B;  3RL0 D;  5B66 E;  2FBW C;  1N2D C;  2OQQ A;  4C7R A;  1BDD A;  3Q5S A;  2IPP A;  3A0H H;  2XV5 A;  3JSV C;  1HF9 A;  2JEE A;  4RO0 A;  4PJ0 E;  2WPV B;  2P58 A;  4JQ0 D;  4JBZ A;  4ZMD A;  1FBM A;  1SQQ G;  2FXM A;  2ZXX A;  1SFC B;  1Q7Y Q;  4YPC A;  4KJM A;  2K9J B;  2KUB A;  1LTT C;  1KQL A;  3CCM P;  1YJN P;  4DOJ A;  1RQV A;  4Y99 B;  1KIL E;  1VDF A;  5KJ7 C;  3O6Q A;  1LJ2 A;  1L4A A;  1UIX A;  1PGQ A;  1URQ A;  3VP9 A;  1U7J A;  4L73 A;  4D6T G;  2BAS A;  2OYO A;  3CME P;  2FYZ A;  3A2A A;  1GTW A;  3NMD A;  3L37 A;  1L0N D;  1LWU C;  1JNM A;  1LT9 B;  2FYU J;  3A7O A;  4N78 E;  1N7S B;  3E1I A;  3LW5 J;  3GMA A;  2JR8 A;  1M1J C;  1VQK P;  4WB4 A;  1DH3 A;  1L0L G;  2PRR A;  1P84 I;  2BCC J;  1E5W A;  1BGY G;  3B5N C;  5TIS H;  1Q90 D;  4KHX A;  3L75 E;  3H1K D;  1SQV K;  2D2C C;  1KC8 Q;  3CCE P;  3AE1 C;  5AVZ B;  1IFN A;  4IFF A;  3CL3 D;  1Q81 Q;  2Q3E A;  1SQP E;  3S9O A;  1FZC C;  1RQU A;  4XE5 B;  2KI7 B;  1M90 Q;  3CC4 P;  3P8C E;  3AE5 C;  1T3J A;  2POH A;  5AW6 B;  3G71 P;  1VQO P;  4JPZ B;  3MZW B;  2KNC A;  1BCC D;  3H1L J;  3RK3 C;  4IL6 E;  2ZYD A;  4RKU J;  1SQX K;  2E76 C;  1Y9B A;  3PP5 A;  4BRY B;  3RGU A;  3H1I D;  3WU2 H;  4H13 C;  3HE5 B;  1KB9 E;  2IDB A;  5B5E H;  2P10 A;  4EI2 A;  1H88 A;  3QH9 A;  1RE4 C;  2HR3 A;  2BCC G;  1ZOY C;  3L71 D;  4EIJ A;  2J59 M;  1KQG B;  5H2F E;  1SP4 A;  5KLI B;  1FZG A;  2OYI A;  1NVO A;  5APV A;  2HFE D;  2QM8 A;  1KYO H;  3P32 A;  1HH0 A;  3M0A A;  2N9B A;  4U3F J;  1IFP A;  2P7J A;  2LKM A;  5KAI E;  3D71 A;  1KYO I;  1PPJ G;  3TF5 A;  1E79 H;  2E43 A;  3KYQ A;  1S4X A;  2GM4 A;  1EZV D;  1S5L H;  4OVN F;  2NRG A;  3V2Q A;  2N1T C;  3H1J D;  2NPS B;  2ZFC A;  3HRN A;  3H1L G;  1VQ4 P;  1JUN A;  2IYO A;  4CPG A;  2WZ7 A;  1JCC A;  1T2K C;  1JOC A;  1S3J A;  3H6P A;  1J1E B;  3I55 P;  1X22 A;  3FGA D;  2ZT9 C;  3CI9 A;  3CCL P;  4ASV A;  1ZXG A;  1ZV8 A;  4WBA A;  1ZP0 C;  1AV1 A;  3AE2 C;  3ABV C;  3HTK B;  3L70 D;  4PD4 D;  5KAF H;  1JB0 J;  2B87 A;  3CC7 P;  1HJ0 A;  2G8Y A;  3NXS A;  1AA0 A;  2FFD C;  2UWJ E;  1SQV G;  3KHU A;  4H44 D;  3PRJ A;  2Y0C A;  3HUS C;  1SQB K;  1M57 D;  4IL6 X;  2WSF H;  5AW2 B;  2IBZ G;  2QEX P;  1LWU A;  3U1A A;  3F5H A;  2H89 C;  3SWF A;  1M1J A;  1SQV E;  2WSF J;  4HKZ H;  4C46 A;  3Q3D A;  1NTK K;  1FZE A;  1D7M A;  1KIL C;  1EDI A;  3B5N A;  2IBZ E;  2PFX A;  3I5C A;  4PD4 H;  2RH0 A;  1KOR A;  4U3F G;  1FJP A;  3P7K A;  1GK6 A;  3W68 A;  4DCK A;  1LP1 A;  3A0B H;  5E79 E;  3BCC J;  2WSS H;  2E74 D;  3KQG A;  2Q6Q A;  2ZT9 D;  4IFM A;  2ZVN B;  2RKL A;  3JC2 2;  2WWW A;  5CBN A;  1PP9 J;  1HWT C;  2L5G B;  1FC2 C;  4OGQ C;  1SQQ K;  1SQX G;  3V4Q A;  1JO5 A;  2XKM A;  1IC2 A;  5GTH H;  3L71 E;  3S4R A;  1JY2 O;  3AEA C;  5KKZ C;  1GU4 A;  3RBX A;  2I1J A;  1FAV A;  3B8E B;  1SQX E;  4W7Z A;  3B71 A;  3RL0 g;  1QX8 A;  1XTG B;  3ITK A;  2ZJS E;  3CX5 D;  5CJ4 A;  3TNU A;  1OW6 A;  2KZI A;  1SQB J;  1AVY A;  4C7N B;  3P8M C;  2L91 A;  1LT9 C;  1VQN P;  5AVX B;  1N7S C;  3TGU J;  1GK4 A;  1SQQ D;  3D70 A;  1N73 C;  1NWQ A;  1EXI A;  4EOT A;  3G6E P;  2E75 D;  1BE3 G;  2M8R A;  4H0L D;  1OZH A;  2PAJ A;  3VYI A;  2YKP A;  4N78 D;  4PJ0 H;  5CCH D;  2Z5I A;  1JY2 N;  1VQ8 P;  3EQ2 A;  1RE4 A;  1BE3 E;  3G9R A;  4D6T D;  1KD1 Q;  1SFC D;  1BSN A;  1LTI C;  1YYC A;  3CPW O;  5AW5 B;  2KK7 A;  1NO4 A;  3A5T A;  2RN0 A;  1YJ9 P;  4XA4 A;  4N3Y B;  3BCC G;  1X8Y A;  1GD2 E;  1VF5 B;  2QJP B;  2J58 A;  3OAK A;  3HD7 B;  1L0L D;  1ZR2 A;  5L8R J;  3RL0 C;  1MZ9 A;  1NTM K;  1BGY D;  1G1J A;  5CMZ A;  2Y9Y A;  2E5Y A;  3M9H A;  2IX7 C;  2HG5 D;  2SPZ A;  1FDO A;  2WPQ A;  3BAS A;  3CWB G;  2OTJ P;  3H1H G;  1N7S D;  4ASW A;  2FYN C;  1OVR A;  3GG2 A;  1HGZ A;  4GT1 A;  1GZL A;  2I8D A;  2BEZ F;  2N1T A;  1R8E A;  3L73 G;  2HLO A;  1H0T B;  2CPS A;  4IFD K;  2JKV A;  3V2N A;  2Q9I A;  3CWB E;  3H1H E;  1SQB G;  2FYU K;  3L74 G;  2O01 H;  1PV3 A;  2H43 A;  1GDT A;  2V7Q J;  3G4S P;  2B9B A;  3TYY A;  1QLE D;  1CI6 A;  1KFN A;  1S5L X;  2B88 A;  4Y28 J;  5AW9 B;  3F89 A;  1NH4 A;  2MKV A;  3L74 E;  1KB9 D;  1NTK G;  2R44 A;  4M3L A;  2FFD A;  2O1K A;  3HUS A; 
#chains in the Genus database with same CATH homology
 4PV1 C;  2O01 J;  1RQV A;  1TU3 F;  1U57 A;  1VL2 A;  1KIL E;  2H88 C;  2QIW A;  3AE4 C;  4H44 C;  1VF5 B;  3AE3 C;  3O6Q A;  1FDI A;  1WMK A;  3SFD C;  4RKU J;  1VF5 D;  3AEC C;  4OGQ C;  1OW8 A;  1UIX A;  2E76 C;  1KQF B;  5L8R J;  1Y9B A;  2QJY C;  3AED C;  2WSE J;  2J5U A;  5KLI C;  1IK7 A;  2E75 C;  4R4M A;  3Q5R A;  1KTM A;  3H25 A;  4H0L C;  4H13 C;  3FGA D;  2ZT9 C;  1NYH A;  1S1C X;  3AEG C;  3LW5 J;  1FDO A;  3AEA C;  5M1B A;  5KKZ C;  1K05 A;  1DD4 A;  3GMA A;  2IDB A;  2P10 A;  1ZP0 C;  3AE2 C;  1K04 A;  2FYN C;  2QJK C;  3ABV C;  3Q2Y A;  4TT3 H;  3AE6 C;  1PIX A;  2QJP C;  3B71 A;  3RL0 g;  3R4Y A;  1JB0 J;  3GLM A;  3AEE C;  1HJ0 A;  1Q90 D;  2BEZ F;  4I7Z C;  2G8Y A;  4PV1 B;  3AEF C;  4H44 B;  1R8E A;  3AEB C;  3AE7 C;  1YQ4 C;  1PL5 A;  1OW6 A;  1ZOY C;  2E74 C;  4PV1 D;  1EXJ A;  3GF7 A;  4H44 D;  1YQ3 C;  1OMI A;  2D2C C;  3IAO A;  3T97 B;  4XFJ A;  3SFE C;  4OGQ B;  2E76 B;  4KT0 J;  1KQG B;  3EWK A;  1DD3 A;  1KMI Z;  4IL6 X;  3AE1 C;  1PV3 A;  2E75 B;  2YIU C;  1MKM A;  2E76 D;  4OGQ D;  3RK3 E;  1AJY A;  2QSI A;  3D70 A;  4H0L B;  1VF5 C;  2V7Q J;  2K9Y A;  1EXI A;  4YXD C;  1ZME C;  2FBW C;  3AE9 C;  4H13 B;  2E75 D;  2JO1 A;  1NGM B;  2OQQ A;  1DIP A;  2NZ2 A;  4H0L D;  3Q5S A;  2H89 C;  3IN6 A;  2BEQ D;  3D6Z A;  4H13 D;  1ZRT E;  1S5L X;  2WQY C;  4Y28 J;  3S9O A;  3D6Y A;  2WSF J;  1HF9 A;  1RQU A;  4GDO A;  2WPV B;  2MKV A;  1GMJ A;  3AE8 C;  3Q3D A;  4Z1M H;  3AE5 C;  2YMK A;  2FXP A;  3GF3 A;  4I7Z B;  1KOR A;  2G3A A;  3G9R A;  4U7J A;  3D71 A;  2E74 B;  2JP3 A;  2ZT9 B;  2D2C B;  4YTP C;  1OW7 A;  3C8V A;  2E74 D;  3Q1M A;  3Q5P A;  2ZT9 D;  2D2C D;  2WSC J;  4R4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...