2MKVA

Structure of the na,k-atpase regulatory protein fxyd2b in micelles
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
LDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRSGGNKKRRQINEDEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Na,K-ATPase regulatory protein FXYD2b in micelles: Implications for membrane-water interfacial arginines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Sodium/potassium-transporting ATPase subunit gamma
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02038 ATP1G1_PLM_MAT8 ATP1G1/PLM/MAT8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.780 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2mkvA00
2JP3A 2MKVA 1Y9BA 2JO1A
chains in the Genus database with same CATH superfamily
1IK9A 2NPSA 4Y99C 3RL0g 1N8RQ 1GL2B 3P7KA 4BRYB 3WUTA 2XNXA 2KNCB 1BDDA 1AFOA 4BRYA 2A06G 3HE4A 1JCDA 5GTIH 2O01J 2IBZI 1YJNP 1J2JB 1KORA 1AVOA 1PP9D 2M3EA 3H32B 4A7PA 3PHLA 5TISH 1LT9A 1N7SD 3BCCD 2D2CC 5KLVD 3TGUE 1FZEA 4I6MC 1RY3A 1NU1K 3H1HJ 3CCVP 1L0ND 2K3RA 1VQMP 1FZGA 5APVA 2WVRA 3I56P 1PPJE 1GMJA 1JEKA 2BCCD 1SQVE 3IAOA 4MN4C 1KC8Q 3WMM0 1RF1B 2B88A 3E1RA 1KB9I 2P2UA 4Y28J 3CD6P 3L73G 2Z5IA 5AW2B 1NTME 3H1KG 2I1KA 1CI6A 1PZQA 1LWUC 3BRVB 3L75D 4EYYQ 1LTSC 2A45I 2WWWA 1OVVA 2FYUJ 2CPSA 2YMKA 5APQA 4DZOA 1RF0C 4LGDE 1VPCA 1SQQD 3TGUD 3JCUH 1SQPJ 2KYVA 3AE1C 1YJ9P 1NTKD 1ZRTE 1SQQG 2P58A 3WUUA 3BVHA 2R3CA 2C0XA 4W7ZA 1JMMA 2M5AB 1ZR4A 1KD1Q 1S4XA 3H1KJ 1L0LK 1EDKA 5AVQB 3D71A 1LTIC 3CL3D 1T2KC 5E79H 3HE5B 2FXOA 2IBZG 3RK3B 3H1JG 5CBNA 3V2QA 2O1KA 2E75C 1HJBA 4TT3H 3C8VA 3H1HD 2QIWA 1JY3O 1LTJC 1LTJB 3G6EP 4IFDK 1HBWA 1CW5A 3EFGA 3L75J 3CCLP 1OFCX 2WSEH 1GW4A 3L72D 1SQXJ 1OXZA 1LNQA 1NTKK 3E7KA 1LP1A 1LTBC 3L72G 4YXWH 1P84H 1SQQK 1PGOA 3RBZA 1AVYA 4DT0A 1YHQP 2ZT9B 3VTPC 1JY2P 3LW5J 3NXSA 1SFCD 4PD4E 3CCSP 1JY2O 2ZAEB 2OQQA 1NTMJ 2H88C 5L8RJ 5CCHD 3CCEP 2KS1B 1N2DC 1N73C 2C9NY 1G1JA 2IBZE 2JWAA 2QEXP 3G71P 2OYIA 1LWUB 5AVTB 1QGKB 4GODA 4QMAA 2KS1A 1MUUA 4KJMA 3P8MC 2W6AA 1KILE 2QJPC 1PIXA 1UIXA 5AVWB 3Q5RA 2KI7B 1R5LA 2P7JA 3OA7A 1NU1G 2JWDA 1NTZK 3FXEA 1L0LE 2YKPA 1RE3C 1AQTA 1KFNA 1JM0A 4N78E 4YXDC 3Q2YA 3L73E 5AVSB 2D2CB 2WZ7A 5AVRB 3SFEC 1BGYE 1S9KE 4WY4C 2L5GB 1DEBA 5AW4B 1H88A 1M7LA 1KB9H 2AXTH 1Q86Q 3L74D 2KLVA 2R5BA 2YMYA 1OW6A 4PJ0E 2FFDA 5H2FE 3FWLA 2Y9YA 4D6TD 1PGJA 1S2EA 1YITP 1JY2N 2IYPA 1X79B 2UWJE 4OVNF 4WWIA 3L70J 1IC2A 2OARA 1ZR2A 3CLQA 1NTMK 1H8AA 1U7MA 3V2PA 2KOGA 1JO5A 2NRGA 2YIUB 4CPGA 2Q3IA 1JTHA 4HYTB 4U3FG 2LXCB 1DD3A 2N9YB 1SQVK 5AW8B 3T97A 4I7ZB 1DD4A 2V7QJ 2E74B 2WQYC 1H0TB 2P67A 2A06E 3LIDA 2WSCJ 1NU1E 1YJWP 1FAVA 3L70G 3IR9A 2LKMA 2ZYGA 3P8CD 1QL1A 4L74A 1VF5D 2E42A 4PV1D 4PD4D 3CXHD 2N1TB 4NPFX 4WB4A 4AYCA 5CCGD 2Y0CA 3PH0A 2WTYA 4H44C 1SVFA 5E79E 1BCCD 1KTMA 1NKZB 1KB9E 4TLFA 1VF5B 5CCGA 3GF7A 4LC1A 1URQA 1A02J 3CI9A 3PJSK 2W6JH 1L4AA 3CWBJ 1FU1A 2QJKB 3T97B 2K1AA 1M8OB 2YKOA 1M56D 3BCCJ 5KLVJ 1PGPA 1L0LG 2YNYA 1SQBK 5BVZA 3H25A 2J59M 3B5NA 4ASVA 1RF1A 2WSFJ 1OMIA 1L0LD 2C9LY 3I5CA 4N78D 1FJKA 1BSHA 1LTJA 3JSVC 4N6JA 1KILA 3RK2D 2OYHA 1M1JC 1L0NE 2FYNB 3A0HE 3L71D 4H13C 5AW7B 3TDKA 4B86A 3B5NB 3L75E 3L4FA 5CMZA 3RL0C 1NAYA 1M90Q 4PD4H 4RESB 5DJTB 1EDLA 3M9HA 3VMYA 3MUDA 1GL2A 3H1JE 3MTUE 1NTMD 5B66H 3CXHE 3L72J 1X22A 5AW5B 1ZP0C 3AE3C 3TGUG 1VQ8P 3CC4P 1IFJA 2N1TA 1SQPK 1FZAA 1ZOYC 3KXDA 3OW2O 1E79H 3UIAA 4RKUJ 3NTNA 3BASA 2WSSH 2ZVNB 4NPEA 3WUVA 3LIEA 2OTJP 1USDA 3S4RA 1SQXK 2BCCJ 2CPBA 2A45H 2PRRA 2QJYC 3D70A 3B71A 2KUBA 2WPSA 2IDBA 2HLOA 2E75B 5APXA 2WMMA 5KAIH 1FC2C 3C1LA 3KQGA 3V2RA 1FZFA 1EC5A 1KQFB 2W27A 4KT0J 3I55P 2IFMA 2D2CD 2KZJA 2WPRA 5M1BA 1KILC 3PTZA 3A2AA 3VMXA 4HH2A 3VN0A 2BCCG 5TJHA 1SQQJ 1IFIA 1NJIQ 5CCHC 3RK2B 1IFNA 2A45G 3EQ2A 1NTKJ 3B8EB 1U7JA 1LGHB 3F89A 3CC2P 3E1IA 4UB8H 1K73Q 4HB1A 1BCCE 3ABVC 4IFFA 4H44B 4L73A 1ZW0A 3HUSA 3U1CA 2FYUE 2WSFH 5GTHE 2B9BA 2B89A 4ZKPA 2N1TC 1M1KQ 5CCGC 4DJGA 1AA0A 1QLED 2Q1KA 1M57D 2O1JA 1IZNB 2M3BA 3L36A 4H13D 3SSUA 1OW7A 1EZVD 1HGVA 3L75G 1GL2C 1KYOH 3KHUA 2YO3A 5KKZC 2OYIB 4Y99B 1URQD 1E5WA 4I7ZC 4BWNA 1FDIA 1PGQA 1M1JA 1JOCA 3Q1MA 3N7NA 4UB6E 2JP3A 3B5NC 5APWA 1VQ6P 1JTHB 1NTZD 3KZIH 3WU2H 3RK3E 1FZCA 1G2CB 3M06A 1RQVA 2KSJA 3AEFC 4OGQD 3TYYA 2ITAA 1FDMA 1KN7A 3N4XA 2AEMA 3GHGB 4D6TG 2ZXXA 1N7SC 3PRJA 1FZCB 1A02F 3TNUB 3CPWO 2J58A 2WITA 1FE6A 2XU6A 3H1KD 2XDJA 1J1DC 3TGUJ 1BGYD 1S9KD 1X0TA 2OYOA 3H1IG 2BEZF 5DJUB 2FYUD 1VQOP 3R2PA 2QJKC 2QSIA 1N7LA 1BE3J 2YKQA 1H89A 1X9VA 3HRNA 4K35A 4O9BA 1SQVJ 3KZIE 4WY4A 1Y9BA 1RE4C 2KB7P 1MV8A 4R4LA 2P1JA 2QRXA 2YXRB 2QJPB 1RE3A 3A7OA 2E5TA 2FY8A 2KNCA 1KFMA 5AVZB 3GW6A 3SFDC 3W67A 4EOTA 2I8DA 1LTAC 2AXCA 1BSNA 4M3LA 3AECC 3M9QA 3CX5I 5AVVB 1GK4A 1T8ZA 2RH0A 3MZWB 2G3AA 5AW1B 4EIJA 3CCMP 1R5SA 2Q3EA 4W7YA 2B87A 2KLUA 3C9IA 1YQ4C 1T3JA 4OGQC 4WBAA 3P8CE 4YPCA 5KLVK 1NTZJ 1RE4A 2Q5UA 1GTWA 2OTLP 3V4QA 3AE2C 5CBOA 1J1DB 3AE6C 1KQLA 3R4YA 3TNUA 1GK6A 1SQPD 3AEDC 3A0HH 1QVFO 1KB9D 3HD7D 5AW3B 1Q82Q 1YBKA 1N7SA 2Z5HA 2R3SA 4W80A 5KAFE 1NAFA 3V6IA 5GTIE 4IL6X 1FZBA 1L4AB 1OW8A 4Z1MH 1AJYA 1QVGO 3CX5E 2HFED 3V4WA 1EXJA 1FOSE 2BASA 2PAJA 2QVAA 3H32A 3ITKA 2JKVA 2NPSD 1FJPA 3LW5H 2W8ZA 3G3ZA 5AVYB 1EXIA 2OYIC 1SQBD 1EZVI 5KKZB 3TSIA 2QG4A 3H1LJ 1WMKA 1GU4A 4IFMA 4PD4I 2AEFA 2FXPA 1JNMA 1KQSO 1NYHA 4PV1C 1FZCC 5KAIE 1RHZB 2KZIA 2XKMA 2M8RA 1EDIA 1GD2E 4R4MA 2VRSA 2IPPA 4PV1B 3HUSC 3VOPA 2K88A 1T3UA 3H1IE 1S3JA 5KJ7C 1G1IA 2QM8A 3HTKA 3V2NA 1QX8A 2JEEA 5C39A 1VQNP 5APTA 3H6PA 2DW3A 2JO1A 2W6BA 3CWBE 3FXDA 1JB0J 4BXLA 1KILB 5BU5A 2R32A 1HVVA 3BCCE 5TISE 4ZNCA 5CCHA 5KLVE 2FYUG 5KJ7D 4WVZA 5AW0B 1S5LH 2H89C 2JR8A 4HKZH 3U59A 2HG5D 5B66E 2HYNA 5KTBA 3A5TA 3A0BE 3Q5SA 1IFDA 1G2CA 3M0DA 2N9BA 3RL0B 3AE9C 1KILD 1PL5A 5H2FH 3KDPB 2CK3H 3W68A 3TF5A 1FBMA 5CJ0A 3M91A 4N3YB 1EZVG 2ZVOB 3CX5H 3NFQA 4H0LD 3H1HE 1LJ2A 1NH4A 3O6QA 4EI2A 3SWFA 1NVOA 1KYOD 1DEEG 1RF0A 4AQRD 2JDIH 3MD0A 4ZKUA 1K8AQ 3D6YA 2NPSC 3CWBG 3IN6A 1LWUA 1NU1J 1SQXD 2OGUA 4NPDA 1VF5C 2AEJA 3BCCG 1EZVE 1IFMA 3MUDC 5KLVG 1FOSF 3CWBD 3Q3DA 2Q9IA 4H13B 2QA4P 1SS1A 2Q7CA 2Y9ZA 1W5CE 1Q7YQ 2WPVB 3MP7B 2IZ0A 5AVXB 4JYCA 3KPEA 4JQ0D 2OYHC 1FS0E 3GG2A 2R5DA 1RF1C 2GUVA 5BU8B 2Y0EA 4IL6H 1LT9C 2I1JA 3G4SP 3CCQP 1LTTC 2IX7C 3QWOC 2NZ2A 2OTKE 2E76B 1HGZA 4U3FD 4H0LB 2K37A 4D6TE 1HWTC 1ZMEC 1L4AC 2AXTE 3O8ZA 1URQC 2HODB 1SLQA 1Y8AA 1PP9E 2WPQA 1VQPP 2WT7A 1DIPA 4YTPC 2FBWC 1SFCC 1SFCA 3CMEP 2FYUK 1IK7A 1MFTA 2LXBA 1L0NJ 3AEEC 4L76A 5APUA 4IL6E 1GZLA 5APYA 2XZRA 2GA1A 1SFCB 1AV1A 2IBZD 3FGAD 3AE4C 3KYQA 1PP9G 3K5BA 2E74C 1MKMA 1N86A 3H1JJ 1JUNA 3H1HG 3QH9A 4JBZA 4OGQB 4DOJA 1L0NG 4OWFA 3ZDMA 3M0AA 1R8EA 5AVUB 1SP4A 3JCUE 1GU5A 2M0BA 1SQPG 2RN0A 3H1LG 1YIJP 2R44A 4HJGH 2FYZA 3RL0D 4DCKA 4EDFA 1HUCA 3V5BA 3B5ND 2OYHB 1YQ3C 3CCRP 3S1KA 1ZRTD 3H1LD 3SWYA 4GT1A 3D6ZA 2XV5A 1BGYG 1EDJA 1URQB 1BE3D 3GF3A 2YXQB 2FFDC 4GKGA 3S9OA 1AQ5A 3H1IJ 4H0LC 1ZLLA 1SQPE 2E76C 2PP6A 3NMDA 1LT1A 5KAFH 1BE3G 1QL2A 1W2EA 2NPSB 1JCCA 3MGNA 1KZUB 4OH8B 3RK2C 1LT9B 4D6TJ 2GM4A 1NTMG 3H1KE 4AUWA 3L73J 2H8PD 2KXPB 1J1EB 2ZFCA 3HE4B 1BGYJ 1SQBG 1Q90D 2E76D 2IYOA 2RMZA 3CXHH 3AE7C 1WT6A 2K9JA 3HD7A 2MKVA 1PFIA 4UB8E 1KV4A 2ZXEB 1L0NK 1KYOI 2A06D 1NU1D 2ZYAA 3CX5D 3M0DC 1KQGB 2K9JB 4LLHA 2PFXA 1PV3A 3MHVA 3Q5PA 1MZ9A 3AE5C 2QJYB 3B4SA 3L70E 1YTZI 1CI6B 1NOHA 1YYCA 3RBXA 5KLIB 5AW9B 1BDCA 2POHA 4JF7A 3A3YB 1P84D 1H0TA 2PGDA 3AEBC 2ZT9C 5APSA 3VYIA 1NGMB 2E75D 3G9RA 2O01N 1OZHA 4U7JA 1OVUA 3AEAC 1S72P 1FDOA 2QE7H 1VQ9P 5KJ7A 1QEXA 4GOEA 1T6AA 3USSA 3PLNA 1Q81Q 1IJDB 2E5YA 1OX3A 1LP1B 3RGUA 2Y0DA 3VMAA 3FX0A 2O01H 3HE5A 3P32A 4JYBA 5KLIC 4C7RA 1VQ7P 1VQLP 3AE8C 3HTKB 5CHXA 2FYNC 2KIKA 1M1JB 1Q2NA 2FXMA 2V4HA 1KMIZ 3JC22 4GDOA 4IOIH 1UIIA 1TU3F 4XFJA 1DH3A 1L2PA 4U3FJ 2KP8A 3RK3C 2M5AA 4K3AA 2H7HA 1K05A 2YO2A 1J1EC 1VQ5P 1L4AD 1S5LX 3BATA 3WU2E 1BE3E 3BRTB 3O6QB 3CXHI 3L74E 3PP5A 5EFWB 3GMAA 3CCJP 2H43A 2WSEJ 3H1JD 4I1LA 4WY4D 1NWQA 2IFNA 3H1LE 1P84E 3HUSB 3TK1A 2WT7B 5GTHH 1HF9A 1OVRA 1PP9J 1S5LE 1XTGB 1IO4A 2ZJSE 2C0WA 3L37A 3FWNA 4JPZB 4RO0A 3VP8A 2L91A 1MFZA 2V7QH 4PJ0H 2HR3A 1HH0A 3U1AA 4GOFA 2HPCA 1KYOE 1HJ0A 1RQUA 3L74G 5CJ4A 5B5EE 1Z56A 3L73D 3VMZA 1JY3N 2J5UA 2K9YA 1Y47A 2G8YA 1YTZT 2XNDH 4ASWA 2MJZA 2HPCB 1RH5B 1SQBJ 2QM7A 1K9MQ 1U57A 3EFFK 1K04A 1NTZE 2P10A 3OJAB 2ZT9D 1JMBA 3GLMA 4XE5B 1HTLC 1VDFA 2N1TD 1ZXGA 2KSEA 3H1ID 1GW3A 2W90A 3L71J 1PPJG 4GIFA 2YIUC 3CC7P 2FKWB 2B87B 3OAKA 3HD7C 3L70D 1T2KD 1PPJD 2BCCE 2ZYDA 5B5EH 4XA4A 1USEA 3AEGC 1LTGC 2Q6QA 4UB6H 1EQ7A 2BEQD 4H44D 3M9BA 1IFPA 1NTKG 1SQXE 3A0BH 4U3FE 1OIPA 1YI2P 1BCCG 4WY4B 1X8YA 3II6A 4C46A 1S1CX 3RK3D 1N73A 1SQQE 2GUSA 2E43A 3L74J 2HODA 5K5GB 2W83C 4I2LC 2RKLA 2Z4EA 1VQKP 1NTKE 1JY3P 1SQXG 1NTZG 1XTCC 1P84I 3MIWA 1WRGA 1ZN5A 1W2BO 2FFDB 1OWAA 2E74D 1BCCJ 4KHXA 1N7SB 3IF4A 2O3JA 3EWKA 3GHGC 4C7NB 3IFMA 4RJTA 3L71G 4L75A 3CMAP 1SQVD 3CCUP 1DX7A 2WSCH 3GHGA 4C7NA 3F5HA 1NO4A 1ZV8A 3L35A 1NHLA 1SQVG 3HD7B 2JJLA 2SPZA 1NKNA 1GDTA 1SQBE 1GL2D 4ZMDA 1CSBA 1VL2A 1D7MA 3SWKA 1L0LJ 2IZ1A 2KK7A 5AW6B 1N73B 3L72E 3L71E 1VQ4P 2LR2A 1CZQA 3VP9A
chains in the Genus database with same CATH topology
4H44C 3AE6C 1KTMA 3GF3A 3R4YA 3RL0g 3S9OA 3AEDC 1VF5B 4H0LC 2E76C 3GF7A 3T97B 2O01J 1KORA 4PV1D 4IL6X 2E76D 3H25A 1Q90D 2D2CC 1AJYA 1OW8A 3AE7C 2WSFJ 1OMIA 4Z1MH 2MKVA 1EXJA 1GMJA 1KQGB 4H13C 3Q5PA 1PV3A 3IAOA 3AE5C 1EXIA 4Y28J 1WMKA 2FXPA 3AEBC 2ZT9C 1NYHA 4PV1C 1NGMB 2E75D 3G9RA 4U7JA 1ZP0C 2YMKA 3AEAC 3AE3C 4R4MA 1FDOA 1ZOYC 4PV1B 4RKUJ 3AE1C 5KLIC 1ZRTE 2JO1A 3AE8C 2QJYC 3D70A 1JB0J 3B71A 2IDBA 2FYNC 2E75B 4GDOA 3SFEC 1KMIZ 3D71A 4XFJA 2H89C 1TU3F 1KQFB 3Q5SA 4KT0J 1K05A 2E75C 4TT3H 2D2CD 5M1BA 3C8VA 1S5LX 2QIWA 3AE9C 1PL5A 3GMAA 2WSEJ 1HF9A 4H0LD 3ABVC 3O6QA 4H44B 2ZT9B 1HJ0A 1RQUA 3D6YA 3LW5J 4H13D 3IN6A 1OW7A 2J5UA 5KKZC 1VF5C 2K9YA 2OQQA 5L8RJ 2G8YA 2H88C 3Q3DA 4H13B 1U57A 1K04A 2P10A 2ZT9D 3GLMA 4I7ZC 2WPVB 1FDIA 2YIUC 1KILE 2QJPC 3Q1MA 1PIXA 1UIXA 3Q5RA 2JP3A 3RK3E 3AEGC 1RQVA 3AEFC 4OGQD 2BEQD 4H44D 2NZ2A 4YXDC 2E76B 1ZMEC 4H0LB 3Q2YA 2D2CB 1DIPA 1S1CX 2BEZF 4YTPC 2FBWC 1OW6A 2QJKC 2QSIA 1IK7A 3AEEC 1Y9BA 4R4LA 3FGAD 3AE4C 2E74C 2E74D 1MKMA 3SFDC 3EWKA 1DD3A 4I7ZB 1DD4A 2WQYC 2V7QJ 2E74B 3AECC 4OGQB 2WSCJ 1R8EA 2G3AA 1YQ4C 4OGQC 1VF5D 1VL2A 1YQ3C 3D6ZA 3AE2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JP3 A;  2MKV A;  1Y9B A;  2JO1 A; 
#chains in the Genus database with same CATH topology
 1IK9 A;  2NPS A;  4Y99 C;  3RL0 g;  1N8R Q;  1GL2 B;  3P7K A;  4BRY B;  3WUT A;  2XNX A;  2KNC B;  1BDD A;  1AFO A;  4BRY A;  2A06 G;  3HE4 A;  1JCD A;  5GTI H;  2O01 J;  2IBZ I;  1YJN P;  1J2J B;  1KOR A;  1AVO A;  1PP9 D;  2M3E A;  3H32 B;  4A7P A;  3PHL A;  5TIS H;  1LT9 A;  1N7S D;  3BCC D;  2D2C C;  5KLV D;  3TGU E;  1FZE A;  4I6M C;  1RY3 A;  1NU1 K;  3H1H J;  3CCV P;  1L0N D;  2K3R A;  1VQM P;  1FZG A;  5APV A;  2WVR A;  3I56 P;  1PPJ E;  1GMJ A;  1JEK A;  2BCC D;  1SQV E;  3IAO A;  4MN4 C;  1KC8 Q;  3WMM 0;  1RF1 B;  2B88 A;  3E1R A;  1KB9 I;  2P2U A;  4Y28 J;  3CD6 P;  3L73 G;  2Z5I A;  5AW2 B;  1NTM E;  3H1K G;  2I1K A;  1CI6 A;  1PZQ A;  1LWU C;  3BRV B;  3L75 D;  4EYY Q;  1LTS C;  2A45 I;  2WWW A;  1OVV A;  2FYU J;  2CPS A;  2YMK A;  5APQ A;  4DZO A;  1RF0 C;  4LGD E;  1VPC A;  1SQQ D;  3TGU D;  3JCU H;  1SQP J;  2KYV A;  3AE1 C;  1YJ9 P;  1NTK D;  1ZRT E;  1SQQ G;  2P58 A;  3WUU A;  3BVH A;  2R3C A;  2C0X A;  4W7Z A;  1JMM A;  2M5A B;  1ZR4 A;  1KD1 Q;  1S4X A;  3H1K J;  1L0L K;  1EDK A;  5AVQ B;  3D71 A;  1LTI C;  3CL3 D;  1T2K C;  5E79 H;  3HE5 B;  2FXO A;  2IBZ G;  3RK3 B;  3H1J G;  5CBN A;  3V2Q A;  2O1K A;  2E75 C;  1HJB A;  4TT3 H;  3C8V A;  3H1H D;  2QIW A;  1JY3 O;  1LTJ C;  1LTJ B;  3G6E P;  4IFD K;  1HBW A;  1CW5 A;  3EFG A;  3L75 J;  3CCL P;  1OFC X;  2WSE H;  1GW4 A;  3L72 D;  1SQX J;  1OXZ A;  1LNQ A;  1NTK K;  3E7K A;  1LP1 A;  1LTB C;  3L72 G;  4YXW H;  1P84 H;  1SQQ K;  1PGO A;  3RBZ A;  1AVY A;  4DT0 A;  1YHQ P;  2ZT9 B;  3VTP C;  1JY2 P;  3LW5 J;  3NXS A;  1SFC D;  4PD4 E;  3CCS P;  1JY2 O;  2ZAE B;  2OQQ A;  1NTM J;  2H88 C;  5L8R J;  5CCH D;  3CCE P;  2KS1 B;  1N2D C;  1N73 C;  2C9N Y;  1G1J A;  2IBZ E;  2JWA A;  2QEX P;  3G71 P;  2OYI A;  1LWU B;  5AVT B;  1QGK B;  4GOD A;  4QMA A;  2KS1 A;  1MUU A;  4KJM A;  3P8M C;  2W6A A;  1KIL E;  2QJP C;  1PIX A;  1UIX A;  5AVW B;  3Q5R A;  2KI7 B;  1R5L A;  2P7J A;  3OA7 A;  1NU1 G;  2JWD A;  1NTZ K;  3FXE A;  1L0L E;  2YKP A;  1RE3 C;  1AQT A;  1KFN A;  1JM0 A;  4N78 E;  4YXD C;  3Q2Y A;  3L73 E;  5AVS B;  2D2C B;  2WZ7 A;  5AVR B;  3SFE C;  1BGY E;  1S9K E;  4WY4 C;  2L5G B;  1DEB A;  5AW4 B;  1H88 A;  1M7L A;  1KB9 H;  2AXT H;  1Q86 Q;  3L74 D;  2KLV A;  2R5B A;  2YMY A;  1OW6 A;  4PJ0 E;  2FFD A;  5H2F E;  3FWL A;  2Y9Y A;  4D6T D;  1PGJ A;  1S2E A;  1YIT P;  1JY2 N;  2IYP A;  1X79 B;  2UWJ E;  4OVN F;  4WWI A;  3L70 J;  1IC2 A;  2OAR A;  1ZR2 A;  3CLQ A;  1NTM K;  1H8A A;  1U7M A;  3V2P A;  2KOG A;  1JO5 A;  2NRG A;  2YIU B;  4CPG A;  2Q3I A;  1JTH A;  4HYT B;  4U3F G;  2LXC B;  1DD3 A;  2N9Y B;  1SQV K;  5AW8 B;  3T97 A;  4I7Z B;  1DD4 A;  2V7Q J;  2E74 B;  2WQY C;  1H0T B;  2P67 A;  2A06 E;  3LID A;  2WSC J;  1NU1 E;  1YJW P;  1FAV A;  3L70 G;  3IR9 A;  2LKM A;  2ZYG A;  3P8C D;  1QL1 A;  4L74 A;  1VF5 D;  2E42 A;  4PV1 D;  4PD4 D;  3CXH D;  2N1T B;  4NPF X;  4WB4 A;  4AYC A;  5CCG D;  2Y0C A;  3PH0 A;  2WTY A;  4H44 C;  1SVF A;  5E79 E;  1BCC D;  1KTM A;  1NKZ B;  1KB9 E;  4TLF A;  1VF5 B;  5CCG A;  3GF7 A;  4LC1 A;  1URQ A;  1A02 J;  3CI9 A;  3PJS K;  2W6J H;  1L4A A;  3CWB J;  1FU1 A;  2QJK B;  3T97 B;  2K1A A;  1M8O B;  2YKO A;  1M56 D;  3BCC J;  5KLV J;  1PGP A;  1L0L G;  2YNY A;  1SQB K;  5BVZ A;  3H25 A;  2J59 M;  3B5N A;  4ASV A;  1RF1 A;  2WSF J;  1OMI A;  1L0L D;  2C9L Y;  3I5C A;  4N78 D;  1FJK A;  1BSH A;  1LTJ A;  3JSV C;  4N6J A;  1KIL A;  3RK2 D;  2OYH A;  1M1J C;  1L0N E;  2FYN B;  3A0H E;  3L71 D;  4H13 C;  5AW7 B;  3TDK A;  4B86 A;  3B5N B;  3L75 E;  3L4F A;  5CMZ A;  3RL0 C;  1NAY A;  1M90 Q;  4PD4 H;  4RES B;  5DJT B;  1EDL A;  3M9H A;  3VMY A;  3MUD A;  1GL2 A;  3H1J E;  3MTU E;  1NTM D;  5B66 H;  3CXH E;  3L72 J;  1X22 A;  5AW5 B;  1ZP0 C;  3AE3 C;  3TGU G;  1VQ8 P;  3CC4 P;  1IFJ A;  2N1T A;  1SQP K;  1FZA A;  1ZOY C;  3KXD A;  3OW2 O;  1E79 H;  3UIA A;  4RKU J;  3NTN A;  3BAS A;  2WSS H;  2ZVN B;  4NPE A;  3WUV A;  3LIE A;  2OTJ P;  1USD A;  3S4R A;  1SQX K;  2BCC J;  2CPB A;  2A45 H;  2PRR A;  2QJY C;  3D70 A;  3B71 A;  2KUB A;  2WPS A;  2IDB A;  2HLO A;  2E75 B;  5APX A;  2WMM A;  5KAI H;  1FC2 C;  3C1L A;  3KQG A;  3V2R A;  1FZF A;  1EC5 A;  1KQF B;  2W27 A;  4KT0 J;  3I55 P;  2IFM A;  2D2C D;  2KZJ A;  2WPR A;  5M1B A;  1KIL C;  3PTZ A;  3A2A A;  3VMX A;  4HH2 A;  3VN0 A;  2BCC G;  5TJH A;  1SQQ J;  1IFI A;  1NJI Q;  5CCH C;  3RK2 B;  1IFN A;  2A45 G;  3EQ2 A;  1NTK J;  3B8E B;  1U7J A;  1LGH B;  3F89 A;  3CC2 P;  3E1I A;  4UB8 H;  1K73 Q;  4HB1 A;  1BCC E;  3ABV C;  4IFF A;  4H44 B;  4L73 A;  1ZW0 A;  3HUS A;  3U1C A;  2FYU E;  2WSF H;  5GTH E;  2B9B A;  2B89 A;  4ZKP A;  2N1T C;  1M1K Q;  5CCG C;  4DJG A;  1AA0 A;  1QLE D;  2Q1K A;  1M57 D;  2O1J A;  1IZN B;  2M3B A;  3L36 A;  4H13 D;  3SSU A;  1OW7 A;  1EZV D;  1HGV A;  3L75 G;  1GL2 C;  1KYO H;  3KHU A;  2YO3 A;  5KKZ C;  2OYI B;  4Y99 B;  1URQ D;  1E5W A;  4I7Z C;  4BWN A;  1FDI A;  1PGQ A;  1M1J A;  1JOC A;  3Q1M A;  3N7N A;  4UB6 E;  2JP3 A;  3B5N C;  5APW A;  1VQ6 P;  1JTH B;  1NTZ D;  3KZI H;  3WU2 H;  3RK3 E;  1FZC A;  1G2C B;  3M06 A;  1RQV A;  2KSJ A;  3AEF C;  4OGQ D;  3TYY A;  2ITA A;  1FDM A;  1KN7 A;  3N4X A;  2AEM A;  3GHG B;  4D6T G;  2ZXX A;  1N7S C;  3PRJ A;  1FZC B;  1A02 F;  3TNU B;  3CPW O;  2J58 A;  2WIT A;  1FE6 A;  2XU6 A;  3H1K D;  2XDJ A;  1J1D C;  3TGU J;  1BGY D;  1S9K D;  1X0T A;  2OYO A;  3H1I G;  2BEZ F;  5DJU B;  2FYU D;  1VQO P;  3R2P A;  2QJK C;  2QSI A;  1N7L A;  1BE3 J;  2YKQ A;  1H89 A;  1X9V A;  3HRN A;  4K35 A;  4O9B A;  1SQV J;  3KZI E;  4WY4 A;  1Y9B A;  1RE4 C;  2KB7 P;  1MV8 A;  4R4L A;  2P1J A;  2QRX A;  2YXR B;  2QJP B;  1RE3 A;  3A7O A;  2E5T A;  2FY8 A;  2KNC A;  1KFM A;  5AVZ B;  3GW6 A;  3SFD C;  3W67 A;  4EOT A;  2I8D A;  1LTA C;  2AXC A;  1BSN A;  4M3L A;  3AEC C;  3M9Q A;  3CX5 I;  5AVV B;  1GK4 A;  1T8Z A;  2RH0 A;  3MZW B;  2G3A A;  5AW1 B;  4EIJ A;  3CCM P;  1R5S A;  2Q3E A;  4W7Y A;  2B87 A;  2KLU A;  3C9I A;  1YQ4 C;  1T3J A;  4OGQ C;  4WBA A;  3P8C E;  4YPC A;  5KLV K;  1NTZ J;  1RE4 A;  2Q5U A;  1GTW A;  2OTL P;  3V4Q A;  3AE2 C;  5CBO A;  1J1D B;  3AE6 C;  1KQL A;  3R4Y A;  3TNU A;  1GK6 A;  1SQP D;  3AED C;  3A0H H;  1QVF O;  1KB9 D;  3HD7 D;  5AW3 B;  1Q82 Q;  1YBK A;  1N7S A;  2Z5H A;  2R3S A;  4W80 A;  5KAF E;  1NAF A;  3V6I A;  5GTI E;  4IL6 X;  1FZB A;  1L4A B;  1OW8 A;  4Z1M H;  1AJY A;  1QVG O;  3CX5 E;  2HFE D;  3V4W A;  1EXJ A;  1FOS E;  2BAS A;  2PAJ A;  2QVA A;  3H32 A;  3ITK A;  2JKV A;  2NPS D;  1FJP A;  3LW5 H;  2W8Z A;  3G3Z A;  5AVY B;  1EXI A;  2OYI C;  1SQB D;  1EZV I;  5KKZ B;  3TSI A;  2QG4 A;  3H1L J;  1WMK A;  1GU4 A;  4IFM A;  4PD4 I;  2AEF A;  2FXP A;  1JNM A;  1KQS O;  1NYH A;  4PV1 C;  1FZC C;  5KAI E;  1RHZ B;  2KZI A;  2XKM A;  2M8R A;  1EDI A;  1GD2 E;  4R4M A;  2VRS A;  2IPP A;  4PV1 B;  3HUS C;  3VOP A;  2K88 A;  1T3U A;  3H1I E;  1S3J A;  5KJ7 C;  1G1I A;  2QM8 A;  3HTK A;  3V2N A;  1QX8 A;  2JEE A;  5C39 A;  1VQN P;  5APT A;  3H6P A;  2DW3 A;  2JO1 A;  2W6B A;  3CWB E;  3FXD A;  1JB0 J;  4BXL A;  1KIL B;  5BU5 A;  2R32 A;  1HVV A;  3BCC E;  5TIS E;  4ZNC A;  5CCH A;  5KLV E;  2FYU G;  5KJ7 D;  4WVZ A;  5AW0 B;  1S5L H;  2H89 C;  2JR8 A;  4HKZ H;  3U59 A;  2HG5 D;  5B66 E;  2HYN A;  5KTB A;  3A5T A;  3A0B E;  3Q5S A;  1IFD A;  1G2C A;  3M0D A;  2N9B A;  3RL0 B;  3AE9 C;  1KIL D;  1PL5 A;  5H2F H;  3KDP B;  2CK3 H;  3W68 A;  3TF5 A;  1FBM A;  5CJ0 A;  3M91 A;  4N3Y B;  1EZV G;  2ZVO B;  3CX5 H;  3NFQ A;  4H0L D;  3H1H E;  1LJ2 A;  1NH4 A;  3O6Q A;  4EI2 A;  3SWF A;  1NVO A;  1KYO D;  1DEE G;  1RF0 A;  4AQR D;  2JDI H;  3MD0 A;  4ZKU A;  1K8A Q;  3D6Y A;  2NPS C;  3CWB G;  3IN6 A;  1LWU A;  1NU1 J;  1SQX D;  2OGU A;  4NPD A;  1VF5 C;  2AEJ A;  3BCC G;  1EZV E;  1IFM A;  3MUD C;  5KLV G;  1FOS F;  3CWB D;  3Q3D A;  2Q9I A;  4H13 B;  2QA4 P;  1SS1 A;  2Q7C A;  2Y9Z A;  1W5C E;  1Q7Y Q;  2WPV B;  3MP7 B;  2IZ0 A;  5AVX B;  4JYC A;  3KPE A;  4JQ0 D;  2OYH C;  1FS0 E;  3GG2 A;  2R5D A;  1RF1 C;  2GUV A;  5BU8 B;  2Y0E A;  4IL6 H;  1LT9 C;  2I1J A;  3G4S P;  3CCQ P;  1LTT C;  2IX7 C;  3QWO C;  2NZ2 A;  2OTK E;  2E76 B;  1HGZ A;  4U3F D;  4H0L B;  2K37 A;  4D6T E;  1HWT C;  1ZME C;  1L4A C;  2AXT E;  3O8Z A;  1URQ C;  2HOD B;  1SLQ A;  1Y8A A;  1PP9 E;  2WPQ A;  1VQP P;  2WT7 A;  1DIP A;  4YTP C;  2FBW C;  1SFC C;  1SFC A;  3CME P;  2FYU K;  1IK7 A;  1MFT A;  2LXB A;  1L0N J;  3AEE C;  4L76 A;  5APU A;  4IL6 E;  1GZL A;  5APY A;  2XZR A;  2GA1 A;  1SFC B;  1AV1 A;  2IBZ D;  3FGA D;  3AE4 C;  3KYQ A;  1PP9 G;  3K5B A;  2E74 C;  1MKM A;  1N86 A;  3H1J J;  1JUN A;  3H1H G;  3QH9 A;  4JBZ A;  4OGQ B;  4DOJ A;  1L0N G;  4OWF A;  3ZDM A;  3M0A A;  1R8E A;  5AVU B;  1SP4 A;  3JCU E;  1GU5 A;  2M0B A;  1SQP G;  2RN0 A;  3H1L G;  1YIJ P;  2R44 A;  4HJG H;  2FYZ A;  3RL0 D;  4DCK A;  4EDF A;  1HUC A;  3V5B A;  3B5N D;  2OYH B;  1YQ3 C;  3CCR P;  3S1K A;  1ZRT D;  3H1L D;  3SWY A;  4GT1 A;  3D6Z A;  2XV5 A;  1BGY G;  1EDJ A;  1URQ B;  1BE3 D;  3GF3 A;  2YXQ B;  2FFD C;  4GKG A;  3S9O A;  1AQ5 A;  3H1I J;  4H0L C;  1ZLL A;  1SQP E;  2E76 C;  2PP6 A;  3NMD A;  1LT1 A;  5KAF H;  1BE3 G;  1QL2 A;  1W2E A;  2NPS B;  1JCC A;  3MGN A;  1KZU B;  4OH8 B;  3RK2 C;  1LT9 B;  4D6T J;  2GM4 A;  1NTM G;  3H1K E;  4AUW A;  3L73 J;  2H8P D;  2KXP B;  1J1E B;  2ZFC A;  3HE4 B;  1BGY J;  1SQB G;  1Q90 D;  2E76 D;  2IYO A;  2RMZ A;  3CXH H;  3AE7 C;  1WT6 A;  2K9J A;  3HD7 A;  2MKV A;  1PFI A;  4UB8 E;  1KV4 A;  2ZXE B;  1L0N K;  1KYO I;  2A06 D;  1NU1 D;  2ZYA A;  3CX5 D;  3M0D C;  1KQG B;  2K9J B;  4LLH A;  2PFX A;  1PV3 A;  3MHV A;  3Q5P A;  1MZ9 A;  3AE5 C;  2QJY B;  3B4S A;  3L70 E;  1YTZ I;  1CI6 B;  1NOH A;  1YYC A;  3RBX A;  5KLI B;  5AW9 B;  1BDC A;  2POH A;  4JF7 A;  3A3Y B;  1P84 D;  1H0T A;  2PGD A;  3AEB C;  2ZT9 C;  5APS A;  3VYI A;  1NGM B;  2E75 D;  3G9R A;  2O01 N;  1OZH A;  4U7J A;  1OVU A;  3AEA C;  1S72 P;  1FDO A;  2QE7 H;  1VQ9 P;  5KJ7 A;  1QEX A;  4GOE A;  1T6A A;  3USS A;  3PLN A;  1Q81 Q;  1IJD B;  2E5Y A;  1OX3 A;  1LP1 B;  3RGU A;  2Y0D A;  3VMA A;  3FX0 A;  2O01 H;  3HE5 A;  3P32 A;  4JYB A;  5KLI C;  4C7R A;  1VQ7 P;  1VQL P;  3AE8 C;  3HTK B;  5CHX A;  2FYN C;  2KIK A;  1M1J B;  1Q2N A;  2FXM A;  2V4H A;  1KMI Z;  3JC2 2;  4GDO A;  4IOI H;  1UII A;  1TU3 F;  4XFJ A;  1DH3 A;  1L2P A;  4U3F J;  2KP8 A;  3RK3 C;  2M5A A;  4K3A A;  2H7H A;  1K05 A;  2YO2 A;  1J1E C;  1VQ5 P;  1L4A D;  1S5L X;  3BAT A;  3WU2 E;  1BE3 E;  3BRT B;  3O6Q B;  3CXH I;  3L74 E;  3PP5 A;  5EFW B;  3GMA A;  3CCJ P;  2H43 A;  2WSE J;  3H1J D;  4I1L A;  4WY4 D;  1NWQ A;  2IFN A;  3H1L E;  1P84 E;  3HUS B;  3TK1 A;  2WT7 B;  5GTH H;  1HF9 A;  1OVR A;  1PP9 J;  1S5L E;  1XTG B;  1IO4 A;  2ZJS E;  2C0W A;  3L37 A;  3FWN A;  4JPZ B;  4RO0 A;  3VP8 A;  2L91 A;  1MFZ A;  2V7Q H;  4PJ0 H;  2HR3 A;  1HH0 A;  3U1A A;  4GOF A;  2HPC A;  1KYO E;  1HJ0 A;  1RQU A;  3L74 G;  5CJ4 A;  5B5E E;  1Z56 A;  3L73 D;  3VMZ A;  1JY3 N;  2J5U A;  2K9Y A;  1Y47 A;  2G8Y A;  1YTZ T;  2XND H;  4ASW A;  2MJZ A;  2HPC B;  1RH5 B;  1SQB J;  2QM7 A;  1K9M Q;  1U57 A;  3EFF K;  1K04 A;  1NTZ E;  2P10 A;  3OJA B;  2ZT9 D;  1JMB A;  3GLM A;  4XE5 B;  1HTL C;  1VDF A;  2N1T D;  1ZXG A;  2KSE A;  3H1I D;  1GW3 A;  2W90 A;  3L71 J;  1PPJ G;  4GIF A;  2YIU C;  3CC7 P;  2FKW B;  2B87 B;  3OAK A;  3HD7 C;  3L70 D;  1T2K D;  1PPJ D;  2BCC E;  2ZYD A;  5B5E H;  4XA4 A;  1USE A;  3AEG C;  1LTG C;  2Q6Q A;  4UB6 H;  1EQ7 A;  2BEQ D;  4H44 D;  3M9B A;  1IFP A;  1NTK G;  1SQX E;  3A0B H;  4U3F E;  1OIP A;  1YI2 P;  1BCC G;  4WY4 B;  1X8Y A;  3II6 A;  4C46 A;  1S1C X;  3RK3 D;  1N73 A;  1SQQ E;  2GUS A;  2E43 A;  3L74 J;  2HOD A;  5K5G B;  2W83 C;  4I2L C;  2RKL A;  2Z4E A;  1VQK P;  1NTK E;  1JY3 P;  1SQX G;  1NTZ G;  1XTC C;  1P84 I;  3MIW A;  1WRG A;  1ZN5 A;  1W2B O;  2FFD B;  1OWA A;  2E74 D;  1BCC J;  4KHX A;  1N7S B;  3IF4 A;  2O3J A;  3EWK A;  3GHG C;  4C7N B;  3IFM A;  4RJT A;  3L71 G;  4L75 A;  3CMA P;  1SQV D;  3CCU P;  1DX7 A;  2WSC H;  3GHG A;  4C7N A;  3F5H A;  1NO4 A;  1ZV8 A;  3L35 A;  1NHL A;  1SQV G;  3HD7 B;  2JJL A;  2SPZ A;  1NKN A;  1GDT A;  1SQB E;  1GL2 D;  4ZMD A;  1CSB A;  1VL2 A;  1D7M A;  3SWK A;  1L0L J;  2IZ1 A;  2KK7 A;  5AW6 B;  1N73 B;  3L72 E;  3L71 E;  1VQ4 P;  2LR2 A;  1CZQ A;  3VP9 A; 
#chains in the Genus database with same CATH homology
 4H44 C;  3AE6 C;  1KTM A;  3GF3 A;  3R4Y A;  3RL0 g;  3S9O A;  3AED C;  1VF5 B;  4H0L C;  2E76 C;  3GF7 A;  3T97 B;  2O01 J;  1KOR A;  4PV1 D;  4IL6 X;  2E76 D;  3H25 A;  1Q90 D;  2D2C C;  1AJY A;  1OW8 A;  3AE7 C;  2WSF J;  1OMI A;  4Z1M H;  2MKV A;  1EXJ A;  1GMJ A;  1KQG B;  4H13 C;  3Q5P A;  1PV3 A;  3IAO A;  3AE5 C;  1EXI A;  4Y28 J;  1WMK A;  2FXP A;  3AEB C;  2ZT9 C;  1NYH A;  4PV1 C;  1NGM B;  2E75 D;  3G9R A;  4U7J A;  1ZP0 C;  2YMK A;  3AEA C;  3AE3 C;  4R4M A;  1FDO A;  1ZOY C;  4PV1 B;  4RKU J;  3AE1 C;  5KLI C;  1ZRT E;  2JO1 A;  3AE8 C;  2QJY C;  3D70 A;  1JB0 J;  3B71 A;  2IDB A;  2FYN C;  2E75 B;  4GDO A;  3SFE C;  1KMI Z;  3D71 A;  4XFJ A;  2H89 C;  1TU3 F;  1KQF B;  3Q5S A;  4KT0 J;  1K05 A;  2E75 C;  4TT3 H;  2D2C D;  5M1B A;  3C8V A;  1S5L X;  2QIW A;  3AE9 C;  1PL5 A;  3GMA A;  2WSE J;  1HF9 A;  4H0L D;  3ABV C;  3O6Q A;  4H44 B;  2ZT9 B;  1HJ0 A;  1RQU A;  3D6Y A;  3LW5 J;  4H13 D;  3IN6 A;  1OW7 A;  2J5U A;  5KKZ C;  1VF5 C;  2K9Y A;  2OQQ A;  5L8R J;  2G8Y A;  2H88 C;  3Q3D A;  4H13 B;  1U57 A;  1K04 A;  2P10 A;  2ZT9 D;  3GLM A;  4I7Z C;  2WPV B;  1FDI A;  2YIU C;  1KIL E;  2QJP C;  3Q1M A;  1PIX A;  1UIX A;  3Q5R A;  2JP3 A;  3RK3 E;  3AEG C;  1RQV A;  3AEF C;  4OGQ D;  2BEQ D;  4H44 D;  2NZ2 A;  4YXD C;  2E76 B;  1ZME C;  4H0L B;  3Q2Y A;  2D2C B;  1DIP A;  1S1C X;  2BEZ F;  4YTP C;  2FBW C;  1OW6 A;  2QJK C;  2QSI A;  1IK7 A;  3AEE C;  1Y9B A;  4R4L A;  3FGA D;  3AE4 C;  2E74 C;  2E74 D;  1MKM A;  3SFD C;  3EWK A;  1DD3 A;  4I7Z B;  1DD4 A;  2WQY C;  2V7Q J;  2E74 B;  3AEC C;  4OGQ B;  2WSC J;  1R8E A;  2G3A A;  1YQ4 C;  4OGQ C;  1VF5 D;  1VL2 A;  1YQ3 C;  3D6Z A;  3AE2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...