2MKVA

Structure of the na,k-atpase regulatory protein fxyd2b in micelles
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
LDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRSGGNKKRRQINEDEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium/potassium-transporting ATPase subunit gamma
publication title Structure of the Na,K-ATPase regulatory protein FXYD2b in micelles: Implications for membrane-water interfacial arginines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2014-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02038 ATP1G1_PLM_MAT8 ATP1G1/PLM/MAT8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.780 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2mkvA00
2MKVA 2JP3A 2JO1A 1Y9BA
chains in the Genus database with same CATH superfamily
2JWDA 3VYIA 1OXZA 2ZJSE 3HD7C 3GF7A 2OTKE 2MKVA 3HE5A 2WSCJ 3L71G 3RBZA 2YIUB 3O6QA 3A7OA 1R5SA 1FZAA 2KNCB 2NZ2A 5APSA 4UB8H 2I8DA 3H1KJ 2FY8A 2FYUJ 2V7QH 4RESB 1DH3A 3L70J 1ZP0C 1M57D 1Q2NA 3IF4A 3VMAA 3FGAD 1L0NE 1HVVA 3B5NA 4OWFA 2OYOA 3L72G 3GG2A 2FFDC 4GOEA 2C9LY 1D7MA 3HE4A 5APVA 2QIWA 3L75E 4HKZH 2Y9YA 1KILD 2W83C 3G6EP 1FU1A 1KC8Q 3EQ2A 3HE5B 2FBWC 2QJKC 1Q90D 3E1IA 4ZKPA 1GL2B 4I7ZB 2Z5IA 2IFNA 2M3EA 2C0XA 5DJUB 2XU6A 2B9BA 2IYPA 3B8EB 3ZDMA 1YTZI 3CC7P 1VF5B 1AV1A 2QJPC 1KYOI 1FE6A 4W7ZA 2M8RA 3CPWO 1NAFA 2BEQD 1JCCA 5BU5A 1EC5A 1FDMA 3RK2C 5KAIH 1LWUA 2E76D 2OYIA 4K35A 1URQC 1SFCB 2WWWA 3WU2E 5CHXA 1L0NJ 3VMZA 1M1JA 2KLUA 3M0AA 3AEFC 1BCCD 5AW5B 3EFFK 1IFMA 4UB8E 3UIAA 2AXTH 3KZIE 1JMBA 4ZMDA 3L75J 1GK4A 1ZR2A 3VMYA 1A02F 1GU4A 5APQA 3AEAC 3PH0A 1KV4A 3C9IA 1SQBD 1BGYG 2E5TA 3U59A 3G4SP 5AVRB 3SWYA 1EZVD 1PP9E 3M0DA 2IBZI 1PPJD 2FYUK 1N73A 2ZYGA 3MIWA 1KILA 4KJMA 3U1AA 4U7JA 1OW8A 1MFTA 2HR3A 3S1KA 1HH0A 4IL6H 4IFDK 2HPCB 1M1JB 4BXLA 3H32A 1EDIA 2JO1A 1LTJA 2BEZF 1NTZD 5CMZA 3MD0A 1KTMA 1JOCA 3NXSA 4NPEA 1M1KQ 2R5DA 2IBZE 2GM4A 3P8CD 1SQQG 1DEBA 3G9RA 2YIUC 3CXHI 3FWLA 3H25A 1G1JA 2V7QJ 1PPJE 5KAIE 1YIJP 3H1LG 1SQVE 2JWAA 1MZ9A 1IK7A 2ZXXA 1ZOYC 4WWIA 4GOFA 3FX0A 1M8OB 1PGPA 2AXTE 3L36A 3WUTA 4Z1MH 2IFMA 1U57A 3I5CA 2IDBA 3HUSB 1H0TB 1N7SD 1RH5B 4HYTB 5EFWB 3CXHE 1ZN5A 1S3JA 2KS1A 4MN4C 1BCCJ 3ABVC 4GT1A 1L0NK 3AE8C 1HWTC 1P84H 1NTKD 1SQXD 1DEEG 1GL2C 1YJNP 4I7ZC 2KZIA 3GF3A 3II6A 1N7LA 1EXJA 2E76B 1FZFA 3ITKA 4IL6E 3JCUH 1S4XA 1URQD 1L0LE 1VQ4P 2HYNA 3RK3E 2HODB 1LP1A 5KAFE 2YKQA 1S9KD 3CMAP 2PRRA 4LLHA 2Z4EA 3M9BA 1SQVJ 1IK9A 1BDDA 1RQVA 1SFCC 1KMIZ 1SQPD 3VN0A 1GDTA 1USEA 1VQ8P 3BASA 1NU1E 3L73E 1NTZJ 2L91A 1VQ7P 3WUVA 2FFDA 4EOTA 2SPZA 3P7KA 3W68A 5KLIB 3TYYA 2K9JA 1ZV8A 1P84I 1VQPP 1QLED 1BCCG 3AE2C 3FXDA 3FXEA 2H89C 1NVOA 2M0BA 3CCSP 1QL2A 5AW8B 2XKMA 2NRGA 3A0HE 2KIKA 1R5LA 5AW7B 1N7SA 2PFXA 2Q6QA 3V2QA 1L0LJ 2Q9IA 1NOHA 1SQBG 3PLNA 1G2CA 4PD4I 1EZVG 1P84E 2H88C 3L71E 4WBAA 1M1JC 1LT9A 4ZNCA 2IYOA 2M5AB 3MP7B 2K9JB 3U1CA 1K04A 4I2LC 1URQA 3CX5H 3O8ZA 2BCCD 1DIPA 1IFJA 2KB7P 3QWOC 1NTKJ 1NU1J 1SQXJ 3L73J 2N9YB 1LTIC 3E1RA 3CCQP 2WQYC 1NTZG 4PV1B 4PD4E 2IX7C 2WPVB 3L72E 1S5LH 1N7SB 1LTTC 1X22A 3CI9A 1T2KD 1N73C 1KILC 1XTCC 2CPSA 3AE5C 4WY4D 3SWFA 1OVVA 4H44B 3CCVP 1LTGC 2KXPB 5AW1B 1AQ5A 1JY2P 1LT9B 1SQPJ 1GL2D 1YHQP 2G8YA 1CI6A 1S1CX 1SQVK 3HUSC 2RMZA 3CD6P 3AEBC 3CX5D 1NTMD 4C7NA 4YXDC 2QEXP 2W6BA 3HRNA 3CMEP 3L71J 1A02J 1BE3D 5H2FH 1FS0E 1NTZK 2N1TD 5KLVD 1ZR4A 1VF5D 2P58A 4A7PA 3RL0B 1EDKA 2WT7B 2R44A 4D6TG 2XNXA 2IPPA 2E76C 1PFIA 3N4XA 4NPFX 1SFCD 1NTKG 1SQXG 2IZ1A 2QSIA 2VRSA 1HJ0A 4OVNF 1VL2A 3L72J 3OAKA 5L8RJ 3CX5E 3TDKA 2OYHB 1H89A 2Q3IA 3PJSK 1L0LK 5K5GB 1SVFA 2Y0DA 1SP4A 3K5BA 2NPSB 5AW9B 2I1KA 1VQMP 1S5LE 1BGYE 1SQQD 1SQPG 3GW6A 2R3SA 3AE7C 2O1JA 4ASWA 1N86A 1NTKK 1KB9H 4U3FG 1NU1K 1SQXK 1ZRTD 3H1LD 1HUCA 1GL2A 1BSNA 4GKGA 5AVVB 3V2RA 3PHLA 3V4WA 5H2FE 3T97B 2N1TA 1RF1B 3GLMA 1AFOA 1HGZA 1SQQE 1E5WA 4JYCA 1JO5A 2LXBA 1Q81Q 1SQPK 1NTMJ 5AVQB 1SFCA 3H1LE 1J2JB 1KB9D 2Q5UA 3CCJP 4H13B 1YJ9P 4WY4B 5APUA 2V4HA 2QM7A 4W80A 1ZMEC 1BGYJ 2BCCG 4PV1C 5BU8B 1JY3O 3L35A 1PGQA 1N7SC 1VQ6P 2E74B 1VPCA 3Q1MA 2A06D 1K9MQ 1IFIA 3IN6A 2IZ0A 1T6AA 4XFJA 2N1TB 2WSFH 4H44C 3TGUD 1KORA 5DJTB 3MUDC 1LT9C 2ZVOB 3GMAA 2WITA 3VTPC 3BRVB 1KB9E 2AEMA 1KILE 3W67A 1KYOD 3BCCD 2HPCA 1SQQJ 3G3ZA 1NAYA 5TISH 1HF9A 2Q3EA 2WMMA 4DT0A 1NTMG 4YPCA 4EDFA 1KQLA 4C46A 3H1LJ 2WPSA 1BE3G 3BRTB 5TJHA 4BRYB 2L5GB 2YNYA 5KLVG 1QX8A 3SWKA 1OW6A 2OTJP 2B88A 4NPDA 1Q7YQ 1ZW0A 3AECC 1NGMB 2OYHC 2FKWB 2KSJA 3MHVA 4Y28J 3TSIA 4BWNA 1YQ3C 1BCCE 2NPSC 3H1ID 4B86A 1J1EB 3H1HD 1NTMK 3HUSA 2MJZA 1H0TA 1VDFA 2P2UA 1UIIA 4DZOA 3NFQA 4ZKUA 1OW7A 5GTHH 2C0WA 1SQBE 4L76A 3PRJA 3AEDC 1EZVE 2JR8A 2O01H 2GUVA 2H43A 2R32A 2HODA 2YXQB 3SSUA 5TISE 1RF1C 4DOJA 4YTPC 1VQ5P 3LIEA 2CK3H 2XZRA 1FBMA 3A0BH 5E79H 1NTZE 4UB6H 3BCCJ 4PV1D 4HB1A 2KK7A 3VMXA 2B89A 4AUWA 1W2BO 1BSHA 1Y47A 2WPRA 1T2KC 2KSEA 3P8CE 1SQQK 4WY4C 4D6TD 2ZAEB 2KLVA 1X8YA 4C7RA 4L73A 2PGDA 4H44D 3D6ZA 3Q5SA 5AW2B 1T3UA 2RN0A 3F5HA 2H7HA 3L4FA 2E74C 3QH9A 1SQBJ 2WSFJ 1X9VA 5KTBA 5CCHC 2OQQA 2N1TC 2K37A 1VF5C 2P7JA 2Y9ZA 1E79H 4AYCA 2A06G 3RL0D 1PGOA 1OMIA 1KQGB 2QM8A 3AE1C 1R8EA 1USDA 2WTYA 1GW4A 5GTHE 4H0LB 4D6TE 1OVRA 4IOIH 3TGUG 3H1HJ 3JSVC 1FJPA 3AE3C 2GA1A 3HTKB 1N2DC 1NTKE 1SQXE 5BVZA 4U3FD 2M5AA 1FJKA 3WUUA 3BCCG 1CZQA 4N78D 3CCLP 2JEEA 4RJTA 3R2PA 3M91A 2D2CB 1QGKB 4HH2A 1AJYA 3L74D 3P32A 1W2EA 2NPSD 1S9KE 4OGQB 1RY3A 3R4YA 1Y8AA 2FYNB 3EWKA 5KJ7C 3BVHA 3OA7A 1PIXA 5AVXB 1EXIA 1SQPE 5APXA 2WSSH 3HD7B 3SFDC 1JM0A 1GW3A 2Y0EA 3H1JD 2C9NY 4U3FE 2WSCH 3MUDA 1VQ9P 1XTGB 3H6PA 4WVZA 2K3RA 1Z56A 2K88A 3JCUE 4D6TJ 1LGHB 1OFCX 1FOSF 1ZLLA 3H1IG 3H1HG 5AVWB 3CCEP 3L37A 2R3CA 4YXWH 2W8ZA 4OH8B 5APTA 3NTNA 4AQRD 2WT7A 4CPGA 1FZCA 1RF0C 5AVUB 4R4MA 1IFNA 1IFPA 1SQBK 1JUNA 3WMM0 1KD1Q 1G1IA 1NHLA 1GZLA 2PAJA 3RK3B 4H13D 1AVYA 1FC2C 1QL1A 1NJIQ 3MTUE 5M1BA 1HJBA 2M3BA 3KPEA 3NMDA 2OYHA 3AE4C 1LT1A 2BCCE 3KYQA 3RL0g 2E74D 4I6MC 4U3FJ 3H1KD 2FYUD 2DW3A 2NPSA 1OZHA 3L70D 1Q82Q 3CX5I 5CCHD 2ITAA 4EI2A 3M06A 3RK2B 1OVUA 1FZCB 2O1KA 1WT6A 1YYCA 3CC4P 5AW6B 3OW2O 2ZVNB 1HGVA 2A45G 1DX7A 1OWAA 3V2NA 2AXCA 2W6JH 1LTBC 3D71A 2G3AA 1NTME 5CBNA 3A3YB 1CSBA 3GHGB 1QVFO 2QE7H 4H0LC 2XDJA 1BE3E 3T97A 1RF1A 1AVOA 2GUSA 3RGUA 5KLVE 2B87B 1JY2N 3G71P 2I1JA 2E5YA 1YITP 2BCCJ 3EFGA 3TF5A 1Q86Q 3AE6C 5KJ7D 5KLIC 1IC2A 1EDJA 1JTHB 4LC1A 3CCUP 2J5UA 5B5EH 4WY4A 3PP5A 2YMYA 2ZT9B 4OGQC 1FDIA 2FYNC 4JPZB 1GU5A 1GTWA 2JKVA 3N7NA 3L74G 3PTZA 1FZBA 5AVZB 1L4AB 3I55P 5AVYB 3L75D 3WU2H 5CCHA 3TNUB 3V6IA 3IAOA 4O9BA 2HG5D 4PJ0H 1FAVA 4QMAA 1K73Q 5AW0B 3E7KA 1RE3A 1LTAC 2POHA 2RH0A 3KZIH 3MZWB 3H1JG 1BE3J 3CL3D 1ZRTE 2OGUA 1KYOH 5KLVJ 3C8VA 2E75B 1KB9I 3CWBG 1RQUA 4Y99B 3SFEC 5APYA 2O3JA 1YJWP 3CCRP 4BRYA 3TK1A 1MV8A 1JB0J 1DD3A 3MGNA 3RK3C 5AVSB 1FOSE 2W6AA 3O6QB 4LGDE 3M9HA 4JF7A 5KJ7A 4IL6X 2RKLA 1U7MA 3JC22 3Q2YA 1YI2P 1VQOP 5B5EE 1IJDB 3KQGA 3B4SA 4JBZA 2QJYB 3B5NB 5B66H 1PL5A 2WSEH 3S9OA 1NYHA 1NH4A 2FXOA 3RL0C 1PP9D 2YO2A 3H1KG 2FYUG 4W7YA 3M9QA 1FZCC 2A06E 3L70G 2Z5HA 3HE4B 3CCMP 4TLFA 4R4LA 4H0LD 4PJ0E 3TGUE 1LTSC 1RF0A 2WVRA 1PV3A 3KHUA 1KYOE 3GHGC 3BCCE 5CJ4A 3CXHH 1EZVI 2D2CD 1RHZB 1X79B 1KZUB 1LJ2A 3Q5RA 2HFED 2IBZD 1J1DB 1T8ZA 3F89A 4OGQD 4XA4A 1MFZA 1X0TA 2QA4P 1LWUB 1PGJA 2OYIB 3HD7D 5KLVK 1N8RQ 1SQVD 2YKOA 1RE4C 1KQFB 1T3JA 2JDIH 1FZGA 3LW5H 2ZT9C 5KAFH 4KHXA 1NKNA 1M90Q 4IFFA 4M3LA 2A45H 1L4AC 2KP8A 3CXHD 1DD4A 2KOGA 1SLQA 3TGUJ 1L0NG 3H1IE 5B66E 2P67A 1KN7A 1AQTA 3H1HE 2KZJA 2ZXEB 4GIFA 2XV5A 4JQ0D 3L75G 1QEXA 1N73B 4GDOA 1KILB 2W90A 1JMMA 1L0LD 3HTKA 4H13C 3VP8A 3RK3D 1PP9J 1PZQA 4GODA 2E75C 2YXRB 5CCGC 3A0HH 3H32B 1JY2O 4EIJA 4Y99C 2AEFA 1JY3P 1LTJB 3CC2P 4KT0J 2A45I 2UWJE 3S4RA 5CJ0A 4WB4A 5AVTB 4N3YB 1H8AA 1NU1D 3L73D 1LNQA 2JJLA 1M56D 1IFDA 3FWNA 1AA0A 1WRGA 3RK2D 4I1LA 3KDPB 1RE3C 3HD7A 3Q5PA 2OTLP 3H1IJ 1H88A 3P8MC 2WSEJ 3AE9C 1M7LA 3IFMA 3USSA 5CBOA 1YTZT 2QJYC 3B5NC 2P10A 2N9BA 4N6JA 3VP9A 2WPQA 2H8PD 4PD4H 2OARA 1ZXGA 2KS1B 5KKZB 1NKZB 1S5LX 1NWQA 2LKMA 1P84D 1PP9G 3A0BE 1JY3N 3L71D 5E79E 1KQSO 4UB6E 2J58A 2ZYDA 1YQ4C 2BASA 3AEEC 2QVAA 2W27A 4K3AA 2CPBA 1OIPA 5AW3B 4ASVA 4JYBA 3V2PA 2AEJA 5APWA 1YBKA 1LP1B 1J1DC 2YO3A 2ZFCA 1IZNB 2ZT9D 4RO0A 1S72P 1J1EC 4N78E 3CLQA 3BATA 1CW5A 1FZEA 3CWBD 4PD4D 3L72D 3L74E 1LWUC 2IBZG 1TU3F 2R5BA 2OYIC 1L4AD 3LW5J 1MUUA 2O01J 3V5BA 1PPJG 2Q1KA 1VQLP 3OJAB 4RKUJ 2FFDB 1JCDA 3D6YA 1JNMA 1SS1A 1SQVG 4DCKA 2WZ7A 1EQ7A 3KXDA 5GTIH 3Q3DA 2LR2A 2YMKA 1BDCA 1HBWA 5AW4B 2FYZA 3H1JE 3B71A 4IFMA 2QJKB 3D70A 4HJGH 2E75D 5C39A 2P1JA 5CCGD 4L75A 3CWBE 4XE5B 2XNDH 2YKPA 3M0DC 1IO4A 3GHGA 3V4QA 2E43A 1S2EA 1K8AQ 1NO4A 1KFMA 2O01N 1G2CB 2B87A 4DJGA 1GMJA 2QJPB 2J59M 1GD2E 4TT3H 2Y0CA 2FXMA 1U7JA 1LTJC 2KI7B 2ZYAA 2E42A 3L74J 1JTHA 1L0LG 1MKMA 1URQB 2Q7CA 1UIXA 1HTLC 1W5CE 1RE4A 4L74A 2KUBA 3C1LA 2KYVA 1JEKA 3B5ND 3RBXA 1BGYD 1VQKP 1L2PA 1L4AA 3H1JJ 1EDLA 3H1KE 1GK6A 2FYUE 2HLOA 1NU1G 3L70E 3L73G 3TNUA 1KFNA 3VOPA 3AEGC 3A2AA 2KNCA 3I56P 1K05A 2FXPA 1Y9BA 3CWBJ 2PP6A 5GTIE 1CI6B 1QVGO 2JP3A 2D2CC 4C7NB 1VQNP 1WMKA 5KKZC 2K1AA 4EYYQ 2K9YA 1FDOA 3LIDA 3IR9A 1OX3A 5CCGA 3A5TA 1L0ND 2QG4A 2QRXA 2LXCB
chains in the Genus database with same CATH topology
1VF5B 1YQ3C 2QJPC 4GDOA 2E74C 4PV1C 2WQYC 1YQ4C 2BEQD 1GMJA 3G9RA 3AEEC 4TT3H 2YIUC 2WSFJ 1RQVA 3GF7A 2MKVA 4H13C 1KMIZ 1ZRTE 2E74B 2WSCJ 4PV1B 3Q1MA 2WPVB 3H25A 2V7QJ 2E76D 2E75C 3O6QA 2OQQA 1PV3A 3C8VA 3IN6A 1VF5C 3D71A 2E75B 2D2CD 2NZ2A 1MKMA 2G3AA 4XFJA 1UIXA 4H44C 1KORA 1RQUA 3AEFC 2ZT9D 3AE5C 1OMIA 1OW7A 3Q5RA 1IK7A 1KQGB 3AE7C 4H0LC 4KT0J 3SFEC 3AE1C 1ZOYC 4H44B 1R8EA 3AEDC 1ZP0C 3GMAA 4OGQD 4H0LB 3AE2C 1KILE 4R4MA 1JB0J 1DD3A 1TU3F 2G8YA 2H89C 3AE3C 4Z1MH 1S1CX 3LW5J 1U57A 3FGAD 3AEBC 3AE6C 5KLIC 2IDBA 4YXDC 2O01J 4H13D 3AEAC 1HF9A 2J5UA 4RKUJ 3ABVC 4IL6X 1KQFB 3AEGC 3D6YA 2ZT9C 5M1BA 3AE8C 3Q5PA 4YTPC 1VF5D 2D2CB 2QIWA 3Q2YA 1K05A 2FXPA 1AJYA 1Y9BA 3T97B 3Q3DA 2WSEJ 2ZT9B 3AE4C 3GLMA 2YMKA 3AE9C 4OGQC 1FDIA 2FYNC 3RL0g 2E74D 4PV1D 4U7JA 4I7ZC 2QJYC 2FBWC 2H88C 2QJKC 1OW8A 3GF3A 1OW6A 2E76C 3B71A 4OGQB 2P10A 1Q90D 3R4YA 1DD4A 3EWKA 1EXJA 4I7ZB 3D70A 2E76B 2JP3A 2D2CC 1PL5A 2E75D 1WMKA 3S9OA 5KKZC 1NYHA 1PIXA 1EXIA 2K9YA 1FDOA 3RK3E 2QSIA 3AECC 1K04A 2JO1A 1NGMB 4H13B 3SFDC 1HJ0A 1VL2A 4H44D 3D6ZA 3Q5SA 1DIPA 2BEZF 1KTMA 3IAOA 1S5LX 4R4LA 5L8RJ 4H0LD 4Y28J 1ZMEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MKV A;  2JP3 A;  2JO1 A;  1Y9B A; 
#chains in the Genus database with same CATH topology
 2JWD A;  3VYI A;  1OXZ A;  2ZJS E;  3HD7 C;  3GF7 A;  2OTK E;  2MKV A;  3HE5 A;  2WSC J;  3L71 G;  3RBZ A;  2YIU B;  3O6Q A;  3A7O A;  1R5S A;  1FZA A;  2KNC B;  2NZ2 A;  5APS A;  4UB8 H;  2I8D A;  3H1K J;  2FY8 A;  2FYU J;  2V7Q H;  4RES B;  1DH3 A;  3L70 J;  1ZP0 C;  1M57 D;  1Q2N A;  3IF4 A;  3VMA A;  3FGA D;  1L0N E;  1HVV A;  3B5N A;  4OWF A;  2OYO A;  3L72 G;  3GG2 A;  2FFD C;  4GOE A;  2C9L Y;  1D7M A;  3HE4 A;  5APV A;  2QIW A;  3L75 E;  4HKZ H;  2Y9Y A;  1KIL D;  2W83 C;  3G6E P;  1FU1 A;  1KC8 Q;  3EQ2 A;  3HE5 B;  2FBW C;  2QJK C;  1Q90 D;  3E1I A;  4ZKP A;  1GL2 B;  4I7Z B;  2Z5I A;  2IFN A;  2M3E A;  2C0X A;  5DJU B;  2XU6 A;  2B9B A;  2IYP A;  3B8E B;  3ZDM A;  1YTZ I;  3CC7 P;  1VF5 B;  1AV1 A;  2QJP C;  1KYO I;  1FE6 A;  4W7Z A;  2M8R A;  3CPW O;  1NAF A;  2BEQ D;  1JCC A;  5BU5 A;  1EC5 A;  1FDM A;  3RK2 C;  5KAI H;  1LWU A;  2E76 D;  2OYI A;  4K35 A;  1URQ C;  1SFC B;  2WWW A;  3WU2 E;  5CHX A;  1L0N J;  3VMZ A;  1M1J A;  2KLU A;  3M0A A;  3AEF C;  1BCC D;  5AW5 B;  3EFF K;  1IFM A;  4UB8 E;  3UIA A;  2AXT H;  3KZI E;  1JMB A;  4ZMD A;  3L75 J;  1GK4 A;  1ZR2 A;  3VMY A;  1A02 F;  1GU4 A;  5APQ A;  3AEA C;  3PH0 A;  1KV4 A;  3C9I A;  1SQB D;  1BGY G;  2E5T A;  3U59 A;  3G4S P;  5AVR B;  3SWY A;  1EZV D;  1PP9 E;  3M0D A;  2IBZ I;  1PPJ D;  2FYU K;  1N73 A;  2ZYG A;  3MIW A;  1KIL A;  4KJM A;  3U1A A;  4U7J A;  1OW8 A;  1MFT A;  2HR3 A;  3S1K A;  1HH0 A;  4IL6 H;  4IFD K;  2HPC B;  1M1J B;  4BXL A;  3H32 A;  1EDI A;  2JO1 A;  1LTJ A;  2BEZ F;  1NTZ D;  5CMZ A;  3MD0 A;  1KTM A;  1JOC A;  3NXS A;  4NPE A;  1M1K Q;  2R5D A;  2IBZ E;  2GM4 A;  3P8C D;  1SQQ G;  1DEB A;  3G9R A;  2YIU C;  3CXH I;  3FWL A;  3H25 A;  1G1J A;  2V7Q J;  1PPJ E;  5KAI E;  1YIJ P;  3H1L G;  1SQV E;  2JWA A;  1MZ9 A;  1IK7 A;  2ZXX A;  1ZOY C;  4WWI A;  4GOF A;  3FX0 A;  1M8O B;  1PGP A;  2AXT E;  3L36 A;  3WUT A;  4Z1M H;  2IFM A;  1U57 A;  3I5C A;  2IDB A;  3HUS B;  1H0T B;  1N7S D;  1RH5 B;  4HYT B;  5EFW B;  3CXH E;  1ZN5 A;  1S3J A;  2KS1 A;  4MN4 C;  1BCC J;  3ABV C;  4GT1 A;  1L0N K;  3AE8 C;  1HWT C;  1P84 H;  1NTK D;  1SQX D;  1DEE G;  1GL2 C;  1YJN P;  4I7Z C;  2KZI A;  3GF3 A;  3II6 A;  1N7L A;  1EXJ A;  2E76 B;  1FZF A;  3ITK A;  4IL6 E;  3JCU H;  1S4X A;  1URQ D;  1L0L E;  1VQ4 P;  2HYN A;  3RK3 E;  2HOD B;  1LP1 A;  5KAF E;  2YKQ A;  1S9K D;  3CMA P;  2PRR A;  4LLH A;  2Z4E A;  3M9B A;  1SQV J;  1IK9 A;  1BDD A;  1RQV A;  1SFC C;  1KMI Z;  1SQP D;  3VN0 A;  1GDT A;  1USE A;  1VQ8 P;  3BAS A;  1NU1 E;  3L73 E;  1NTZ J;  2L91 A;  1VQ7 P;  3WUV A;  2FFD A;  4EOT A;  2SPZ A;  3P7K A;  3W68 A;  5KLI B;  3TYY A;  2K9J A;  1ZV8 A;  1P84 I;  1VQP P;  1QLE D;  1BCC G;  3AE2 C;  3FXD A;  3FXE A;  2H89 C;  1NVO A;  2M0B A;  3CCS P;  1QL2 A;  5AW8 B;  2XKM A;  2NRG A;  3A0H E;  2KIK A;  1R5L A;  5AW7 B;  1N7S A;  2PFX A;  2Q6Q A;  3V2Q A;  1L0L J;  2Q9I A;  1NOH A;  1SQB G;  3PLN A;  1G2C A;  4PD4 I;  1EZV G;  1P84 E;  2H88 C;  3L71 E;  4WBA A;  1M1J C;  1LT9 A;  4ZNC A;  2IYO A;  2M5A B;  3MP7 B;  2K9J B;  3U1C A;  1K04 A;  4I2L C;  1URQ A;  3CX5 H;  3O8Z A;  2BCC D;  1DIP A;  1IFJ A;  2KB7 P;  3QWO C;  1NTK J;  1NU1 J;  1SQX J;  3L73 J;  2N9Y B;  1LTI C;  3E1R A;  3CCQ P;  2WQY C;  1NTZ G;  4PV1 B;  4PD4 E;  2IX7 C;  2WPV B;  3L72 E;  1S5L H;  1N7S B;  1LTT C;  1X22 A;  3CI9 A;  1T2K D;  1N73 C;  1KIL C;  1XTC C;  2CPS A;  3AE5 C;  4WY4 D;  3SWF A;  1OVV A;  4H44 B;  3CCV P;  1LTG C;  2KXP B;  5AW1 B;  1AQ5 A;  1JY2 P;  1LT9 B;  1SQP J;  1GL2 D;  1YHQ P;  2G8Y A;  1CI6 A;  1S1C X;  1SQV K;  3HUS C;  2RMZ A;  3CD6 P;  3AEB C;  3CX5 D;  1NTM D;  4C7N A;  4YXD C;  2QEX P;  2W6B A;  3HRN A;  3CME P;  3L71 J;  1A02 J;  1BE3 D;  5H2F H;  1FS0 E;  1NTZ K;  2N1T D;  5KLV D;  1ZR4 A;  1VF5 D;  2P58 A;  4A7P A;  3RL0 B;  1EDK A;  2WT7 B;  2R44 A;  4D6T G;  2XNX A;  2IPP A;  2E76 C;  1PFI A;  3N4X A;  4NPF X;  1SFC D;  1NTK G;  1SQX G;  2IZ1 A;  2QSI A;  2VRS A;  1HJ0 A;  4OVN F;  1VL2 A;  3L72 J;  3OAK A;  5L8R J;  3CX5 E;  3TDK A;  2OYH B;  1H89 A;  2Q3I A;  3PJS K;  1L0L K;  5K5G B;  1SVF A;  2Y0D A;  1SP4 A;  3K5B A;  2NPS B;  5AW9 B;  2I1K A;  1VQM P;  1S5L E;  1BGY E;  1SQQ D;  1SQP G;  3GW6 A;  2R3S A;  3AE7 C;  2O1J A;  4ASW A;  1N86 A;  1NTK K;  1KB9 H;  4U3F G;  1NU1 K;  1SQX K;  1ZRT D;  3H1L D;  1HUC A;  1GL2 A;  1BSN A;  4GKG A;  5AVV B;  3V2R A;  3PHL A;  3V4W A;  5H2F E;  3T97 B;  2N1T A;  1RF1 B;  3GLM A;  1AFO A;  1HGZ A;  1SQQ E;  1E5W A;  4JYC A;  1JO5 A;  2LXB A;  1Q81 Q;  1SQP K;  1NTM J;  5AVQ B;  1SFC A;  3H1L E;  1J2J B;  1KB9 D;  2Q5U A;  3CCJ P;  4H13 B;  1YJ9 P;  4WY4 B;  5APU A;  2V4H A;  2QM7 A;  4W80 A;  1ZME C;  1BGY J;  2BCC G;  4PV1 C;  5BU8 B;  1JY3 O;  3L35 A;  1PGQ A;  1N7S C;  1VQ6 P;  2E74 B;  1VPC A;  3Q1M A;  2A06 D;  1K9M Q;  1IFI A;  3IN6 A;  2IZ0 A;  1T6A A;  4XFJ A;  2N1T B;  2WSF H;  4H44 C;  3TGU D;  1KOR A;  5DJT B;  3MUD C;  1LT9 C;  2ZVO B;  3GMA A;  2WIT A;  3VTP C;  3BRV B;  1KB9 E;  2AEM A;  1KIL E;  3W67 A;  1KYO D;  3BCC D;  2HPC A;  1SQQ J;  3G3Z A;  1NAY A;  5TIS H;  1HF9 A;  2Q3E A;  2WMM A;  4DT0 A;  1NTM G;  4YPC A;  4EDF A;  1KQL A;  4C46 A;  3H1L J;  2WPS A;  1BE3 G;  3BRT B;  5TJH A;  4BRY B;  2L5G B;  2YNY A;  5KLV G;  1QX8 A;  3SWK A;  1OW6 A;  2OTJ P;  2B88 A;  4NPD A;  1Q7Y Q;  1ZW0 A;  3AEC C;  1NGM B;  2OYH C;  2FKW B;  2KSJ A;  3MHV A;  4Y28 J;  3TSI A;  4BWN A;  1YQ3 C;  1BCC E;  2NPS C;  3H1I D;  4B86 A;  1J1E B;  3H1H D;  1NTM K;  3HUS A;  2MJZ A;  1H0T A;  1VDF A;  2P2U A;  1UII A;  4DZO A;  3NFQ A;  4ZKU A;  1OW7 A;  5GTH H;  2C0W A;  1SQB E;  4L76 A;  3PRJ A;  3AED C;  1EZV E;  2JR8 A;  2O01 H;  2GUV A;  2H43 A;  2R32 A;  2HOD A;  2YXQ B;  3SSU A;  5TIS E;  1RF1 C;  4DOJ A;  4YTP C;  1VQ5 P;  3LIE A;  2CK3 H;  2XZR A;  1FBM A;  3A0B H;  5E79 H;  1NTZ E;  4UB6 H;  3BCC J;  4PV1 D;  4HB1 A;  2KK7 A;  3VMX A;  2B89 A;  4AUW A;  1W2B O;  1BSH A;  1Y47 A;  2WPR A;  1T2K C;  2KSE A;  3P8C E;  1SQQ K;  4WY4 C;  4D6T D;  2ZAE B;  2KLV A;  1X8Y A;  4C7R A;  4L73 A;  2PGD A;  4H44 D;  3D6Z A;  3Q5S A;  5AW2 B;  1T3U A;  2RN0 A;  3F5H A;  2H7H A;  3L4F A;  2E74 C;  3QH9 A;  1SQB J;  2WSF J;  1X9V A;  5KTB A;  5CCH C;  2OQQ A;  2N1T C;  2K37 A;  1VF5 C;  2P7J A;  2Y9Z A;  1E79 H;  4AYC A;  2A06 G;  3RL0 D;  1PGO A;  1OMI A;  1KQG B;  2QM8 A;  3AE1 C;  1R8E A;  1USD A;  2WTY A;  1GW4 A;  5GTH E;  4H0L B;  4D6T E;  1OVR A;  4IOI H;  3TGU G;  3H1H J;  3JSV C;  1FJP A;  3AE3 C;  2GA1 A;  3HTK B;  1N2D C;  1NTK E;  1SQX E;  5BVZ A;  4U3F D;  2M5A A;  1FJK A;  3WUU A;  3BCC G;  1CZQ A;  4N78 D;  3CCL P;  2JEE A;  4RJT A;  3R2P A;  3M91 A;  2D2C B;  1QGK B;  4HH2 A;  1AJY A;  3L74 D;  3P32 A;  1W2E A;  2NPS D;  1S9K E;  4OGQ B;  1RY3 A;  3R4Y A;  1Y8A A;  2FYN B;  3EWK A;  5KJ7 C;  3BVH A;  3OA7 A;  1PIX A;  5AVX B;  1EXI A;  1SQP E;  5APX A;  2WSS H;  3HD7 B;  3SFD C;  1JM0 A;  1GW3 A;  2Y0E A;  3H1J D;  2C9N Y;  4U3F E;  2WSC H;  3MUD A;  1VQ9 P;  1XTG B;  3H6P A;  4WVZ A;  2K3R A;  1Z56 A;  2K88 A;  3JCU E;  4D6T J;  1LGH B;  1OFC X;  1FOS F;  1ZLL A;  3H1I G;  3H1H G;  5AVW B;  3CCE P;  3L37 A;  2R3C A;  4YXW H;  2W8Z A;  4OH8 B;  5APT A;  3NTN A;  4AQR D;  2WT7 A;  4CPG A;  1FZC A;  1RF0 C;  5AVU B;  4R4M A;  1IFN A;  1IFP A;  1SQB K;  1JUN A;  3WMM 0;  1KD1 Q;  1G1I A;  1NHL A;  1GZL A;  2PAJ A;  3RK3 B;  4H13 D;  1AVY A;  1FC2 C;  1QL1 A;  1NJI Q;  3MTU E;  5M1B A;  1HJB A;  2M3B A;  3KPE A;  3NMD A;  2OYH A;  3AE4 C;  1LT1 A;  2BCC E;  3KYQ A;  3RL0 g;  2E74 D;  4I6M C;  4U3F J;  3H1K D;  2FYU D;  2DW3 A;  2NPS A;  1OZH A;  3L70 D;  1Q82 Q;  3CX5 I;  5CCH D;  2ITA A;  4EI2 A;  3M06 A;  3RK2 B;  1OVU A;  1FZC B;  2O1K A;  1WT6 A;  1YYC A;  3CC4 P;  5AW6 B;  3OW2 O;  2ZVN B;  1HGV A;  2A45 G;  1DX7 A;  1OWA A;  3V2N A;  2AXC A;  2W6J H;  1LTB C;  3D71 A;  2G3A A;  1NTM E;  5CBN A;  3A3Y B;  1CSB A;  3GHG B;  1QVF O;  2QE7 H;  4H0L C;  2XDJ A;  1BE3 E;  3T97 A;  1RF1 A;  1AVO A;  2GUS A;  3RGU A;  5KLV E;  2B87 B;  1JY2 N;  3G71 P;  2I1J A;  2E5Y A;  1YIT P;  2BCC J;  3EFG A;  3TF5 A;  1Q86 Q;  3AE6 C;  5KJ7 D;  5KLI C;  1IC2 A;  1EDJ A;  1JTH B;  4LC1 A;  3CCU P;  2J5U A;  5B5E H;  4WY4 A;  3PP5 A;  2YMY A;  2ZT9 B;  4OGQ C;  1FDI A;  2FYN C;  4JPZ B;  1GU5 A;  1GTW A;  2JKV A;  3N7N A;  3L74 G;  3PTZ A;  1FZB A;  5AVZ B;  1L4A B;  3I55 P;  5AVY B;  3L75 D;  3WU2 H;  5CCH A;  3TNU B;  3V6I A;  3IAO A;  4O9B A;  2HG5 D;  4PJ0 H;  1FAV A;  4QMA A;  1K73 Q;  5AW0 B;  3E7K A;  1RE3 A;  1LTA C;  2POH A;  2RH0 A;  3KZI H;  3MZW B;  3H1J G;  1BE3 J;  3CL3 D;  1ZRT E;  2OGU A;  1KYO H;  5KLV J;  3C8V A;  2E75 B;  1KB9 I;  3CWB G;  1RQU A;  4Y99 B;  3SFE C;  5APY A;  2O3J A;  1YJW P;  3CCR P;  4BRY A;  3TK1 A;  1MV8 A;  1JB0 J;  1DD3 A;  3MGN A;  3RK3 C;  5AVS B;  1FOS E;  2W6A A;  3O6Q B;  4LGD E;  3M9H A;  4JF7 A;  5KJ7 A;  4IL6 X;  2RKL A;  1U7M A;  3JC2 2;  3Q2Y A;  1YI2 P;  1VQO P;  5B5E E;  1IJD B;  3KQG A;  3B4S A;  4JBZ A;  2QJY B;  3B5N B;  5B66 H;  1PL5 A;  2WSE H;  3S9O A;  1NYH A;  1NH4 A;  2FXO A;  3RL0 C;  1PP9 D;  2YO2 A;  3H1K G;  2FYU G;  4W7Y A;  3M9Q A;  1FZC C;  2A06 E;  3L70 G;  2Z5H A;  3HE4 B;  3CCM P;  4TLF A;  4R4L A;  4H0L D;  4PJ0 E;  3TGU E;  1LTS C;  1RF0 A;  2WVR A;  1PV3 A;  3KHU A;  1KYO E;  3GHG C;  3BCC E;  5CJ4 A;  3CXH H;  1EZV I;  2D2C D;  1RHZ B;  1X79 B;  1KZU B;  1LJ2 A;  3Q5R A;  2HFE D;  2IBZ D;  1J1D B;  1T8Z A;  3F89 A;  4OGQ D;  4XA4 A;  1MFZ A;  1X0T A;  2QA4 P;  1LWU B;  1PGJ A;  2OYI B;  3HD7 D;  5KLV K;  1N8R Q;  1SQV D;  2YKO A;  1RE4 C;  1KQF B;  1T3J A;  2JDI H;  1FZG A;  3LW5 H;  2ZT9 C;  5KAF H;  4KHX A;  1NKN A;  1M90 Q;  4IFF A;  4M3L A;  2A45 H;  1L4A C;  2KP8 A;  3CXH D;  1DD4 A;  2KOG A;  1SLQ A;  3TGU J;  1L0N G;  3H1I E;  5B66 E;  2P67 A;  1KN7 A;  1AQT A;  3H1H E;  2KZJ A;  2ZXE B;  4GIF A;  2XV5 A;  4JQ0 D;  3L75 G;  1QEX A;  1N73 B;  4GDO A;  1KIL B;  2W90 A;  1JMM A;  1L0L D;  3HTK A;  4H13 C;  3VP8 A;  3RK3 D;  1PP9 J;  1PZQ A;  4GOD A;  2E75 C;  2YXR B;  5CCG C;  3A0H H;  3H32 B;  1JY2 O;  4EIJ A;  4Y99 C;  2AEF A;  1JY3 P;  1LTJ B;  3CC2 P;  4KT0 J;  2A45 I;  2UWJ E;  3S4R A;  5CJ0 A;  4WB4 A;  5AVT B;  4N3Y B;  1H8A A;  1NU1 D;  3L73 D;  1LNQ A;  2JJL A;  1M56 D;  1IFD A;  3FWN A;  1AA0 A;  1WRG A;  3RK2 D;  4I1L A;  3KDP B;  1RE3 C;  3HD7 A;  3Q5P A;  2OTL P;  3H1I J;  1H88 A;  3P8M C;  2WSE J;  3AE9 C;  1M7L A;  3IFM A;  3USS A;  5CBO A;  1YTZ T;  2QJY C;  3B5N C;  2P10 A;  2N9B A;  4N6J A;  3VP9 A;  2WPQ A;  2H8P D;  4PD4 H;  2OAR A;  1ZXG A;  2KS1 B;  5KKZ B;  1NKZ B;  1S5L X;  1NWQ A;  2LKM A;  1P84 D;  1PP9 G;  3A0B E;  1JY3 N;  3L71 D;  5E79 E;  1KQS O;  4UB6 E;  2J58 A;  2ZYD A;  1YQ4 C;  2BAS A;  3AEE C;  2QVA A;  2W27 A;  4K3A A;  2CPB A;  1OIP A;  5AW3 B;  4ASV A;  4JYB A;  3V2P A;  2AEJ A;  5APW A;  1YBK A;  1LP1 B;  1J1D C;  2YO3 A;  2ZFC A;  1IZN B;  2ZT9 D;  4RO0 A;  1S72 P;  1J1E C;  4N78 E;  3CLQ A;  3BAT A;  1CW5 A;  1FZE A;  3CWB D;  4PD4 D;  3L72 D;  3L74 E;  1LWU C;  2IBZ G;  1TU3 F;  2R5B A;  2OYI C;  1L4A D;  3LW5 J;  1MUU A;  2O01 J;  3V5B A;  1PPJ G;  2Q1K A;  1VQL P;  3OJA B;  4RKU J;  2FFD B;  1JCD A;  3D6Y A;  1JNM A;  1SS1 A;  1SQV G;  4DCK A;  2WZ7 A;  1EQ7 A;  3KXD A;  5GTI H;  3Q3D A;  2LR2 A;  2YMK A;  1BDC A;  1HBW A;  5AW4 B;  2FYZ A;  3H1J E;  3B71 A;  4IFM A;  2QJK B;  3D70 A;  4HJG H;  2E75 D;  5C39 A;  2P1J A;  5CCG D;  4L75 A;  3CWB E;  4XE5 B;  2XND H;  2YKP A;  3M0D C;  1IO4 A;  3GHG A;  3V4Q A;  2E43 A;  1S2E A;  1K8A Q;  1NO4 A;  1KFM A;  2O01 N;  1G2C B;  2B87 A;  4DJG A;  1GMJ A;  2QJP B;  2J59 M;  1GD2 E;  4TT3 H;  2Y0C A;  2FXM A;  1U7J A;  1LTJ C;  2KI7 B;  2ZYA A;  2E42 A;  3L74 J;  1JTH A;  1L0L G;  1MKM A;  1URQ B;  2Q7C A;  1UIX A;  1HTL C;  1W5C E;  1RE4 A;  4L74 A;  2KUB A;  3C1L A;  2KYV A;  1JEK A;  3B5N D;  3RBX A;  1BGY D;  1VQK P;  1L2P A;  1L4A A;  3H1J J;  1EDL A;  3H1K E;  1GK6 A;  2FYU E;  2HLO A;  1NU1 G;  3L70 E;  3L73 G;  3TNU A;  1KFN A;  3VOP A;  3AEG C;  3A2A A;  2KNC A;  3I56 P;  1K05 A;  2FXP A;  1Y9B A;  3CWB J;  2PP6 A;  5GTI E;  1CI6 B;  1QVG O;  2JP3 A;  2D2C C;  4C7N B;  1VQN P;  1WMK A;  5KKZ C;  2K1A A;  4EYY Q;  2K9Y A;  1FDO A;  3LID A;  3IR9 A;  1OX3 A;  5CCG A;  3A5T A;  1L0N D;  2QG4 A;  2QRX A;  2LXC B; 
#chains in the Genus database with same CATH homology
 1VF5 B;  1YQ3 C;  2QJP C;  4GDO A;  2E74 C;  4PV1 C;  2WQY C;  1YQ4 C;  2BEQ D;  1GMJ A;  3G9R A;  3AEE C;  4TT3 H;  2YIU C;  2WSF J;  1RQV A;  3GF7 A;  2MKV A;  4H13 C;  1KMI Z;  1ZRT E;  2E74 B;  2WSC J;  4PV1 B;  3Q1M A;  2WPV B;  3H25 A;  2V7Q J;  2E76 D;  2E75 C;  3O6Q A;  2OQQ A;  1PV3 A;  3C8V A;  3IN6 A;  1VF5 C;  3D71 A;  2E75 B;  2D2C D;  2NZ2 A;  1MKM A;  2G3A A;  4XFJ A;  1UIX A;  4H44 C;  1KOR A;  1RQU A;  3AEF C;  2ZT9 D;  3AE5 C;  1OMI A;  1OW7 A;  3Q5R A;  1IK7 A;  1KQG B;  3AE7 C;  4H0L C;  4KT0 J;  3SFE C;  3AE1 C;  1ZOY C;  4H44 B;  1R8E A;  3AED C;  1ZP0 C;  3GMA A;  4OGQ D;  4H0L B;  3AE2 C;  1KIL E;  4R4M A;  1JB0 J;  1DD3 A;  1TU3 F;  2G8Y A;  2H89 C;  3AE3 C;  4Z1M H;  1S1C X;  3LW5 J;  1U57 A;  3FGA D;  3AEB C;  3AE6 C;  5KLI C;  2IDB A;  4YXD C;  2O01 J;  4H13 D;  3AEA C;  1HF9 A;  2J5U A;  4RKU J;  3ABV C;  4IL6 X;  1KQF B;  3AEG C;  3D6Y A;  2ZT9 C;  5M1B A;  3AE8 C;  3Q5P A;  4YTP C;  1VF5 D;  2D2C B;  2QIW A;  3Q2Y A;  1K05 A;  2FXP A;  1AJY A;  1Y9B A;  3T97 B;  3Q3D A;  2WSE J;  2ZT9 B;  3AE4 C;  3GLM A;  2YMK A;  3AE9 C;  4OGQ C;  1FDI A;  2FYN C;  3RL0 g;  2E74 D;  4PV1 D;  4U7J A;  4I7Z C;  2QJY C;  2FBW C;  2H88 C;  2QJK C;  1OW8 A;  3GF3 A;  1OW6 A;  2E76 C;  3B71 A;  4OGQ B;  2P10 A;  1Q90 D;  3R4Y A;  1DD4 A;  3EWK A;  1EXJ A;  4I7Z B;  3D70 A;  2E76 B;  2JP3 A;  2D2C C;  1PL5 A;  2E75 D;  1WMK A;  3S9O A;  5KKZ C;  1NYH A;  1PIX A;  1EXI A;  2K9Y A;  1FDO A;  3RK3 E;  2QSI A;  3AEC C;  1K04 A;  2JO1 A;  1NGM B;  4H13 B;  3SFD C;  1HJ0 A;  1VL2 A;  4H44 D;  3D6Z A;  3Q5S A;  1DIP A;  2BEZ F;  1KTM A;  3IAO A;  1S5L X;  4R4L A;  5L8R J;  4H0L D;  4Y28 J;  1ZME C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...