4R4LA

Crystal structure of wt cgmp dependent protein kinase i alpha (pkgi alpha) leucine zipper
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
47
structure length
47
Chain Sequence
SELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of cGMP-Dependent Protein Kinase (PKG) I alpha Leucine Zippers Reveal an Interchain Disulfide Bond Important for Dimer Stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords cGMP-dependent protein kinase 1
total genus 20
structure length 47
sequence length 47
chains with identical sequence B, C
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16808 PKcGMP_CC Coiled-coil N-terminus of cGMP-dependent protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4r4lA00
3G9RA 1R8EA 3Q5PA 1EXJA 3Q3DA 2J5UA 3IAOA 3Q5RA 3D6YA 3D71A 3D70A 3T97B 2OQQA 3Q5SA 4R4MA 3Q2YA 1DIPA 1EXIA 4R4LA 3Q1MA 3D6ZA
chains in the Genus database with same CATH superfamily
2YIUC 1SQXJ 4I7ZC 1SFCC 1LP1A 4RKUJ 1FZAA 1NTZE 1J1DC 2JO1A 1QVGO 3GHGA 5CJ0A 1LNQA 2M5AA 2XNDH 1GTWA 1RQVA 1SLQA 1FC2C 3H25A 2W6AA 5H2FH 1KV4A 4OGQB 2N1TD 2YO2A 1LTJC 3SSUA 2XZRA 2Z5IA 4UB6E 4W7YA 1U7JA 2O1KA 3UIAA 4NPDA 2FYUD 4WBAA 3QWOC 3WUTA 5CJ4A 2ZFCA 3M06A 5KLVJ 1GW3A 3WUVA 2GUVA 1ZN5A 1PP9D 3BCCE 3C1LA 2OTKE 1BE3D 1MZ9A 2FYNB 3R4YA 2QA4P 1WMKA 1JCCA 1HBWA 1PGPA 4L73A 5KAIE 1OWAA 2G8YA 1FDIA 1K04A 5AVUB 3V6IA 1M1JC 1H0TA 4R4MA 3RL0D 1RF0A 1FZFA 1L4AD 3M0DA 4R4LA 5KLIB 3CCSP 4KT0J 1NU1J 1Q86Q 2Q1KA 2FFDA 1AFOA 2R5BA 1NGMB 3RL0B 3Q5PA 3TGUG 2PP6A 2BASA 3VMXA 2HODA 4OVNF 2Q5UA 3A7OA 3L75J 3HUSC 2ZYDA 4PV1B 3HE4B 1RE3A 1ZR4A 2QVAA 3H1IE 3WU2E 1J1EC 4OH8B 4PD4I 1PPJE 2NRGA 2ZJSE 2QG4A 3RK2B 3II6A 1FE6A 2E75C 4HB1A 2XDJA 1IFDA 3HUSB 1RF1A 1JY2N 3EFFK 3A3YB 3C9IA 1BSNA 1NAFA 1PPJD 3L72D 3TYYA 1NU1G 1L4AA 3KQGA 2JEEA 4GDOA 1N73A 1T6AA 3G71P 2R3SA 1G1IA 3KDPB 2OTLP 1KILB 2FFDC 2ZXXA 1JO5A 2IBZD 3P8CD 3JCUH 1SVFA 2IBZI 5GTHH 3H1JJ 2K88A 2O3JA 2ZT9B 1BCCE 1IZNB 1LT9A 1QEXA 2WWWA 3M0AA 1SS1A 3WMM0 3CD6P 3L73G 1NAYA 1S1CX 2JWDA 3L74D 1KYOD 3AE4C 1FZBA 3H1HG 1NTZD 1CZQA 1LTBC 1SFCB 1P84E 2QJYC 1MFZA 2RMZA 3B5ND 3L71G 4HYTB 4IL6H 4AQRD 5KTBA 2IBZG 3HD7A 1M90Q 1DH3A 3CC4P 1LTJB 4YTPC 1PIXA 2QJYB 5E79H 4JBZA 2FYUE 3RK3C 4UB8E 1VQMP 5APTA 1EDLA 1EC5A 3BRTB 1FU1A 5TJHA 1ZR2A 2FXOA 1T2KC 4RO0A 2WSEH 2E5YA 2QJKC 4CPGA 1IK9A 1OVRA 1Q90D 3HD7D 2OYOA 1OIPA 3O6QB 2IPPA 2BCCE 3L73E 1SQPE 5APXA 2Q9IA 3VTPC 3U1CA 4GOFA 5AVSB 3KXDA 5AW1B 1N7LA 1OVUA 1Y9BA 2N1TC 2RH0A 2WZ7A 4K3AA 3G9RA 5AW8B 1KQSO 1HJ0A 1VQ4P 5K5GB 1S2EA 1NTMJ 2WQYC 3K5BA 3TGUD 4A7PA 4IOIH 2D2CB 2BCCJ 3PRJA 1JUNA 3A2AA 4PJ0E 1VQ5P 1YTZT 1NTKD 2WT7A 1NTZK 1CI6B 1P84D 1JY3N 1LTSC 2FYNC 2IYPA 2KB7P 3BCCD 4MN4C 1EZVG 1RE4C 4DOJA 1GD2E 3MTUE 1CSBA 2WSEJ 2P2UA 1EZVE 2D2CC 3M9QA 4O9BA 2J58A 1RQUA 2M8RA 1PV3A 3JCUE 2M3BA 1FS0E 2ZVNB 1L0LG 1L0NE 2KNCB 3H1IG 2E75B 3MGNA 3T97B 1BGYJ 1EZVI 5DJUB 3RGUA 3CWBD 3V2RA 2AXTE 3AEBC 4ZKPA 2E42A 4DZOA 3T97A 1LTJA 1VQKP 2K9JA 1VF5B 3C8VA 1LTAC 1L4AC 2BCCG 3TGUE 2OARA 1L0LD 1OVVA 1FZCA 2NZ2A 2OYIB 3H1HJ 4H0LC 4H13B 3CXHI 3L74G 1JY3O 4IFMA 3TSIA 2K9YA 1H8AA 4EOTA 5EFWB 4H44B 1YI2P 1ZW0A 3CPWO 2OYHC 3EWKA 2LXCB 4JYCA 4H0LB 1GU4A 1RHZB 2WPVB 4N78D 1OXZA 5CBNA 3VN0A 3ABVC 1IFIA 2H8PD 2IZ0A 3L71E 4KJMA 3F5HA 1ZOYC 4XA4A 2YIUB 3CCMP 1HH0A 2A45H 2JP3A 3E1RA 3IF4A 1DD3A 1GU5A 4JQ0D 1JY2P 1N2DC 2M5AB 2XKMA 4IL6X 2HODB 1RF0C 3RL0g 4IL6E 3VMZA 4PD4E 4ZKUA 2H43A 3CC7P 1NU1E 2C0XA 4GODA 2WSFH 4BXLA 2YNYA 2KS1B 2KZJA 3MIWA 3TDKA 4WY4C 3H1KD 3L73D 1JEKA 4Y99B 1NKZB 2N9YB 1AVYA 1S72P 4DT0A 1RF1C 2L91A 1N73C 4HJGH 1NHLA 4GT1A 1PGOA 4UB6H 2Y0CA 1GL2D 1GMJA 2Q7CA 1XTGB 5CCGD 2HLOA 1YQ4C 1NVOA 2CPBA 3A0HH 5AVWB 1N73B 4I2LC 4LC1A 1X0TA 1NOHA 1SQQG 2IX7C 3LIDA 4ASWA 3KPEA 1NKNA 3AE9C 4K35A 5KLVD 3B71A 3L71J 5KLIC 2HFED 3CWBG 1PP9J 1BGYG 4TLFA 3RL0C 1IJDB 2P10A 2N1TB 1K8AQ 3U1AA 1PGQA 1BE3E 3L70E 4RJTA 2P58A 1OFCX 3GW6A 2Y0EA 3CCJP 1NTKK 2B9BA 2E76C 3AEAC 3L36A 5BU8B 1N86A 4QMAA 2KI7B 5B66E 1M1JB 4U7JA 5AVQB 1R8EA 1FZCB 1LT9C 1Z56A 2E76B 2P7JA 5CCGA 1SQQE 3P8MC 4H0LD 3VP9A 3HD7B 3QH9A 3USSA 2WPQA 1URQC 3IAOA 3L75D 4H44D 1S4XA 2ZXEB 4JF7A 2HPCA 4GIFA 2KLVA 4D6TD 2OYIA 2H89C 1W5CE 5B66H 1FBMA 2RN0A 4U3FJ 3B4SA 1N8RQ 5KLVE 3SFDC 4DCKA 4OWFA 3L75E 1CW5A 2K9JB 1URQB 3OAKA 3H1ID 1PP9E 1QLED 1SQBD 2ZYAA 1L0LK 1FJKA 3L75G 4JYBA 5E79E 1DD4A 1W2EA 1QX8A 3P8CE 3W68A 3L72J 3VOPA 3B5NB 3CI9A 2I1KA 1YHQP 1SFCD 1T8ZA 3S4RA 5L8RJ 2FY8A 2YKQA 2PGDA 4I6MC 2IDBA 5AW7B 2FBWC 1SQBG 1H89A 1NTKE 1G2CA 3PH0A 2CK3H 3GLMA 2J59M 1FOSE 1NTZJ 2FKWB 2WSCH 1GL2B 2RKLA 4PV1D 1BCCJ 4D6TE 2FYUG 1BDCA 1M1JA 3N7NA 3V4WA 1R5LA 2YKOA 5KJ7A 4YPCA 1FDMA 2V7QH 4W80A 2WITA 1FZEA 3AE7C 1JMMA 3NMDA 2YO3A 3GF7A 3FX0A 5H2FE 1U7MA 2QJPC 1KD1Q 3GF3A 2V7QJ 2VRSA 3AE2C 3Q5SA 1PFIA 3IN6A 1KQFB 2NPSA 1N7SB 1LWUA 2E76D 3AE6C 1AVOA 3RK3E 2LXBA 5KAFH 3L35A 1MUUA 5AVTB 1QL1A 2B88A 1M7LA 1KILE 3CXHD 2W6BA 3Q3DA 2R44A 1SQVJ 1QGKB 3AEFC 4GKGA 4L74A 3M9HA 2BCCD 1A02J 3HTKA 1LT9B 5KJ7D 2Z5HA 1SQQD 3S9OA 2CPSA 3CCUP 2KZIA 2NPSD 1HJBA 4IFDK 2M0BA 4XFJA 3SWYA 1S9KD 1YITP 3L70J 4BWNA 1PL5A 2N9BA 1BSHA 3RK2C 1PPJG 2IYOA 1VF5C 3MD0A 5AW2B 1EDKA 2SPZA 3RK3B 2WMMA 5KKZC 3H1JG 3I55P 1HF9A 4WB4A 1URQA 2LR2A 4PD4D 1YIJP 1VQNP 3CWBJ 1FJPA 3PTZA 1NJIQ 2E74D 2B89A 1Q7YQ 2HG5D 4NPEA 4L76A 3HD7C 3L70G 3G3ZA 4H44C 2ZT9D 1VQ7P 3CX5I 3RK3D 1VQ9P 4NPFX 1NTME 2W90A 3A0HE 3G4SP 4YXDC 2JDIH 1J1EB 2WSCJ 5CCHA 3H1HD 3CWBE 4DJGA 1JM0A 1AV1A 3IR9A 3TNUA 1SQBK 3CCEP 2IBZE 2BEZF 1VQ6P 1SQXG 1Q81Q 1FZCC 4AYCA 2B87A 1IFNA 2GA1A 2Q3IA 3H1HE 5TISE 3OW2O 1DEEG 3HRNA 5C39A 1YTZI 2O1JA 2IFMA 3JSVC 1X8YA 5AVXB 1KTMA 2FXMA 1WT6A 2POHA 2XU6A 1T3JA 2I8DA 4PD4H 3G6EP 3M9BA 3AEEC 3H32B 1PP9G 1IC2A 1K05A 3VMAA 3CX5H 2E74B 2WT7B 1T3UA 3WUUA 1QVFO 1SP4A 2OQQA 3GG2A 3AE1C 1M8OB 1JNMA 2KLUA 1S5LE 2QJPB 2QJKB 3H1LD 5AW9B 3SWKA 1SQPD 4W7ZA 1MV8A 1SQXK 2KSEA 3H1KJ 2ZVOB 3L73J 1NWQA 1IK7A 1N7SC 1LWUB 1OW8A 3LW5J 2YMYA 1HUCA 2JR8A 1ZRTE 1KQLA 5DJTB 2OYHB 1J1DB 1TU3F 2QSIA 3HE4A 3VP8A 4EYYQ 2O01J 2W27A 1PGJA 1G1JA 2W83C 4PJ0H 2KXPB 1LWUC 1VQLP 1NO4A 2W8ZA 3CX5D 3H1LG 4C7NB 3D6YA 1HTLC 1LTTC 1Y8AA 3V2PA 3CCLP 3L71D 2LKMA 2MKVA 3RK2D 2QM7A 1PZQA 2P67A 3MUDC 3NFQA 3EFGA 4IFFA 4EI2A 2Q3EA 2R32A 1ZXGA 3ZDMA 1FZGA 1L0ND 4OGQD 1GK6A 1YYCA 3L37A 3A0BH 1MKMA 2FXPA 5AVVB 1KZUB 1RE3C 1G2CB 1LGHB 1SQQK 3SWFA 1BGYE 2PRRA 2PAJA 2O01H 1EQ7A 2Q6QA 3H1LE 1LTGC 1Q2NA 1USEA 2YMKA 2ZT9C 3KZIE 4U3FG 3D6ZA 2DW3A 1KYOH 1SQXD 2I1JA 3S1KA 1ZMEC 5CCHC 1XTCC 5APYA 3O8ZA 1AQTA 3RBXA 4ASVA 3H6PA 3AECC 4HKZH 1E5WA 1KB9D 1JCDA 1VL2A 4D6TJ 1UIIA 1DEBA 1MFTA 3U59A 1HVVA 2AEJA 2Y0DA 4U3FD 3FGAD 2NPSC 5AW4B 3I56P 1S3JA 3PP5A 5APWA 1YQ3C 5APUA 3TNUB 3O6QA 2FYUJ 4AUWA 1RH5B 1HGZA 3H1IJ 1EDIA 5AVZB 1SQBJ 1L4AB 1BE3J 2GUSA 4WVZA 3B5NA 2YKPA 1ZP0C 2NPSB 4OGQC 1X9VA 3CLQA 3H1KG 3FXDA 5APVA 2HYNA 2YXRB 1SQPG 1S5LH 3VMYA 1L0NK 3H32A 3ITKA 3SFEC 1K73Q 2E75D 2Z4EA 4M3LA 2QEXP 2E74C 3LIEA 3LW5H 1EXIA 2KYVA 1GL2C 2IFNA 3HTKB 3JC22 3L72E 1NU1D 3P7KA 1VQOP 2E43A 1OZHA 3B8EB 1KILC 1P84I 1JOCA 5CCHD 2FFDB 2G3AA 1NTMG 4WY4B 1SFCA 1SQXE 1VDFA 1N7SD 2WPRA 4Y99C 3V5BA 5BVZA 2GM4A 1FDOA 1YJWP 1BE3G 1CI6A 3PHLA 4C46A 1S9KE 1KORA 2BEQD 2JKVA 3AEGC 3VYIA 1LT1A 1BCCD 1Q82Q 4UB8H 1KN7A 1T2KD 1NTKG 1EZVD 1L2PA 1USDA 3V2QA 1KFNA 3BCCG 1L0NG 1OW6A 1SQPK 2KP8A 1GZLA 4C7RA 3D70A 2W6JH 3IFMA 2K37A 2WSSH 3AE3C 3MUDA 2C0WA 3NXSA 2WVRA 2AEMA 1JB0J 1KB9I 3TF5A 3RBZA 4C7NA 2Y9ZA 1BDDA 3AE5C 4B86A 2C9NY 1L0LE 3Q2YA 5AW3B 1KYOE 3BRVB 1DX7A 1ZRTD 1NTZG 2OYIC 3W67A 2H88C 2QRXA 1IFPA 3F89A 3H1JD 3MZWB 4TT3H 1LJ2A 1UIXA 2WPSA 1IO4A 3FXEA 1AJYA 1U57A 2M3EA 1SQVD 1AQ5A 3L74J 2HR3A 4N78E 5AW5B 5CBOA 3CXHH 4LLHA 1JY2O 1SQQJ 1WRGA 1R5SA 4N6JA 1RY3A 2KOGA 3Q5RA 3E7KA 4YXWH 1YJ9P 3L70D 1VPCA 2A06D 2Y9YA 1AA0A 5AVYB 1FAVA 1M57D 4U3FE 1ZV8A 1EDJA 2QE7H 5AW0B 1SQVG 1M1KQ 1GK4A 1YJNP 3CC2P 1KB9E 2QIWA 5B5EE 1OW7A 2H7HA 1P84H 2A06E 3AE8C 3E1IA 4ZMDA 1HWTC 2C9LY 3CCVP 3CMAP 2D2CD 2AEFA 3GHGB 1DIPA 2K1AA 1HGVA 1LP1B 4I7ZB 1LTIC 1S5LX 2FYUK 5TISH 3FWLA 5GTHE 5B5EH 1D7MA 5APSA 5KJ7C 3Q1MA 3HUSA 2OYHA 1JTHB 1OX3A 1SQVE 1RF1B 1IFMA 3AEDC 4D6TG 1A02F 1OMIA 4HH2A 3GHGC 4JPZB 1NTMD 2J5UA 3MP7B 2FYZA 1JTHA 3TGUJ 3TK1A 2WTYA 1W2BO 3GMAA 3HE5A 3N4XA 3NTNA 4L75A 1KILA 2B87B 1JMBA 2R3CA 1SQBE 1J2JB 1NTKJ 3CX5E 4WY4A 5BU5A 1KYOI 3V4QA 3BCCJ 3HE5B 5GTIE 1KC8Q 2OTJP 1BCCG 1KQGB 3MHVA 3OA7A 3A0BE 4N3YB 3KYQA 5KAFE 2P1JA 4BRYB 2KIKA 1NU1K 1IFJA 5KAIH 1QL2A 4BRYA 3KHUA 3A5TA 3L4FA 1VF5D 2JWAA 2PFXA 2MJZA 4KHXA 5KLVG 1GW4A 1Y47A 1BGYD 1VQPP 5APQA 1K9MQ 1X79B 2E5TA 1X22A 2XNXA 1ZLLA 2L5GB 3M0DC 2K3RA 3H1LJ 1M56D 2JJLA 1KFMA 4WY4D 4H13C 1SQPJ 3CCQP 4WWIA 3KZIH 2XV5A 5KLVK 5AW6B 5AVRB 1L0LJ 2YXQB 2KUBA 1KILD 3CXHE 4GOEA 1EXJA 3PLNA 5CHXA 2UWJE 4PV1C 2ZYGA 2WSFJ 1VQ8P 3CMEP 1NTMK 2V4HA 3BATA 5GTIH 3BVHA 3M91A 4XE5B 2N1TA 1N7SA 1JY3P 2R5DA 3PJSK 2O01N 2A06G 2OGUA 1NYHA 4EIJA 3L74E 2A45I 2QM8A 4RESB 3P32A 3CCRP 3CL3D 1KMIZ 5M1BA 4LGDE 4Z1MH 1URQD 3D71A 2ZAEB 3R2PA 3I5CA 5CCGC 2ITAA 3B5NC 3FWNA 3L72G 1GDTA 4EDFA 1YBKA 1L0NJ 1SQVK 2AXCA 2KSJA 3BASA 4Y28J 5KKZB 1FOSF 2HPCB 2AXTH 2A45G 1H0TB 2KK7A 3H1JE 3WU2H 1E79H 1NH4A 2IZ1A 3EQ2A 1RE4A 2KNCA 1GL2A 3H1KE 3OJAB 4H13D 3V2NA 4ZNCA 1H88A 4I1LA 1KB9H 5CMZA 2KS1A
chains in the Genus database with same CATH topology
1KILE 2YIUC 2G3AA 2NZ2A 4I7ZC 4H0LC 4RKUJ 2JO1A 3Q3DA 4H13B 3AEFC 1FDOA 1RQVA 2K9YA 3H25A 1KORA 2BEQD 3AEGC 4H44B 4OGQB 3S9OA 3EWKA 4H0LB 4XFJA 2WPVB 1PL5A 1OW6A 3ABVC 1VF5C 3R4YA 3D70A 5KKZC 1WMKA 1ZOYC 3AE3C 1HF9A 2G8YA 1JB0J 1FDIA 1K04A 2JP3A 1DD3A 3AE5C 2E74D 4IL6X 3RL0g 4R4MA 3Q2YA 4H44C 4R4LA 2ZT9D 4KT0J 2H88C 1NGMB 4TT3H 2WSCJ 3Q5PA 1UIXA 1AJYA 1U57A 2BEZF 1GMJA 1YQ4C 4PV1B 3Q5RA 1KTMA 3AE9C 2E75C 3B71A 5KLIC 3AEEC 2QIWA 1K05A 1OW7A 3AE8C 2E74B 2P10A 2D2CD 2OQQA 4GDOA 2E76C 3AE1C 3AEAC 1DIPA 4I7ZB 1S5LX 3Q1MA 4U7JA 3AEDC 1IK7A 1R8EA 1OMIA 2ZT9B 1OW8A 2E76B 3LW5J 2J5UA 4H0LD 1ZRTE 1S1CX 3GMAA 3IAOA 1TU3F 2QSIA 3AE4C 4H44D 4PV1D 2O01J 2QJYC 2H89C 1KQGB 3SFDC 3D6YA 4YTPC 1PIXA 2MKVA 4YXDC 1VF5D 1DD4A 4OGQD 1MKMA 2FXPA 2QJKC 1Q90D 5L8RJ 4H13C 2IDBA 2YMKA 2ZT9C 1Y9BA 3D6ZA 3G9RA 1HJ0A 1EXJA 2FBWC 1ZMEC 2WQYC 4PV1C 2WSFJ 3GLMA 2D2CB 3AECC 1VL2A 2FYNC 3FGAD 1NYHA 1YQ3C 2WSEJ 3O6QA 2D2CC 1KMIZ 5M1BA 3D71A 4Z1MH 1RQUA 3AE7C 1PV3A 3GF7A 1ZP0C 4OGQC 2E75B 2QJPC 3T97B 4Y28J 3GF3A 2V7QJ 3SFEC 3AE2C 3AEBC 2E75D 3Q5SA 3IN6A 1KQFB 2E74C 4H13D 2E76D 1VF5B 3AE6C 3C8VA 3RK3E 1EXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G9R A;  1R8E A;  3Q5P A;  1EXJ A;  3Q3D A;  2J5U A;  3IAO A;  3Q5R A;  3D6Y A;  3D71 A;  3D70 A;  3T97 B;  2OQQ A;  3Q5S A;  4R4M A;  3Q2Y A;  1DIP A;  1EXI A;  4R4L A;  3Q1M A;  3D6Z A; 
#chains in the Genus database with same CATH topology
 2YIU C;  1SQX J;  4I7Z C;  1SFC C;  1LP1 A;  4RKU J;  1FZA A;  1NTZ E;  1J1D C;  2JO1 A;  1QVG O;  3GHG A;  5CJ0 A;  1LNQ A;  2M5A A;  2XND H;  1GTW A;  1RQV A;  1SLQ A;  1FC2 C;  3H25 A;  2W6A A;  5H2F H;  1KV4 A;  4OGQ B;  2N1T D;  2YO2 A;  1LTJ C;  3SSU A;  2XZR A;  2Z5I A;  4UB6 E;  4W7Y A;  1U7J A;  2O1K A;  3UIA A;  4NPD A;  2FYU D;  4WBA A;  3QWO C;  3WUT A;  5CJ4 A;  2ZFC A;  3M06 A;  5KLV J;  1GW3 A;  3WUV A;  2GUV A;  1ZN5 A;  1PP9 D;  3BCC E;  3C1L A;  2OTK E;  1BE3 D;  1MZ9 A;  2FYN B;  3R4Y A;  2QA4 P;  1WMK A;  1JCC A;  1HBW A;  1PGP A;  4L73 A;  5KAI E;  1OWA A;  2G8Y A;  1FDI A;  1K04 A;  5AVU B;  3V6I A;  1M1J C;  1H0T A;  4R4M A;  3RL0 D;  1RF0 A;  1FZF A;  1L4A D;  3M0D A;  4R4L A;  5KLI B;  3CCS P;  4KT0 J;  1NU1 J;  1Q86 Q;  2Q1K A;  2FFD A;  1AFO A;  2R5B A;  1NGM B;  3RL0 B;  3Q5P A;  3TGU G;  2PP6 A;  2BAS A;  3VMX A;  2HOD A;  4OVN F;  2Q5U A;  3A7O A;  3L75 J;  3HUS C;  2ZYD A;  4PV1 B;  3HE4 B;  1RE3 A;  1ZR4 A;  2QVA A;  3H1I E;  3WU2 E;  1J1E C;  4OH8 B;  4PD4 I;  1PPJ E;  2NRG A;  2ZJS E;  2QG4 A;  3RK2 B;  3II6 A;  1FE6 A;  2E75 C;  4HB1 A;  2XDJ A;  1IFD A;  3HUS B;  1RF1 A;  1JY2 N;  3EFF K;  3A3Y B;  3C9I A;  1BSN A;  1NAF A;  1PPJ D;  3L72 D;  3TYY A;  1NU1 G;  1L4A A;  3KQG A;  2JEE A;  4GDO A;  1N73 A;  1T6A A;  3G71 P;  2R3S A;  1G1I A;  3KDP B;  2OTL P;  1KIL B;  2FFD C;  2ZXX A;  1JO5 A;  2IBZ D;  3P8C D;  3JCU H;  1SVF A;  2IBZ I;  5GTH H;  3H1J J;  2K88 A;  2O3J A;  2ZT9 B;  1BCC E;  1IZN B;  1LT9 A;  1QEX A;  2WWW A;  3M0A A;  1SS1 A;  3WMM 0;  3CD6 P;  3L73 G;  1NAY A;  1S1C X;  2JWD A;  3L74 D;  1KYO D;  3AE4 C;  1FZB A;  3H1H G;  1NTZ D;  1CZQ A;  1LTB C;  1SFC B;  1P84 E;  2QJY C;  1MFZ A;  2RMZ A;  3B5N D;  3L71 G;  4HYT B;  4IL6 H;  4AQR D;  5KTB A;  2IBZ G;  3HD7 A;  1M90 Q;  1DH3 A;  3CC4 P;  1LTJ B;  4YTP C;  1PIX A;  2QJY B;  5E79 H;  4JBZ A;  2FYU E;  3RK3 C;  4UB8 E;  1VQM P;  5APT A;  1EDL A;  1EC5 A;  3BRT B;  1FU1 A;  5TJH A;  1ZR2 A;  2FXO A;  1T2K C;  4RO0 A;  2WSE H;  2E5Y A;  2QJK C;  4CPG A;  1IK9 A;  1OVR A;  1Q90 D;  3HD7 D;  2OYO A;  1OIP A;  3O6Q B;  2IPP A;  2BCC E;  3L73 E;  1SQP E;  5APX A;  2Q9I A;  3VTP C;  3U1C A;  4GOF A;  5AVS B;  3KXD A;  5AW1 B;  1N7L A;  1OVU A;  1Y9B A;  2N1T C;  2RH0 A;  2WZ7 A;  4K3A A;  3G9R A;  5AW8 B;  1KQS O;  1HJ0 A;  1VQ4 P;  5K5G B;  1S2E A;  1NTM J;  2WQY C;  3K5B A;  3TGU D;  4A7P A;  4IOI H;  2D2C B;  2BCC J;  3PRJ A;  1JUN A;  3A2A A;  4PJ0 E;  1VQ5 P;  1YTZ T;  1NTK D;  2WT7 A;  1NTZ K;  1CI6 B;  1P84 D;  1JY3 N;  1LTS C;  2FYN C;  2IYP A;  2KB7 P;  3BCC D;  4MN4 C;  1EZV G;  1RE4 C;  4DOJ A;  1GD2 E;  3MTU E;  1CSB A;  2WSE J;  2P2U A;  1EZV E;  2D2C C;  3M9Q A;  4O9B A;  2J58 A;  1RQU A;  2M8R A;  1PV3 A;  3JCU E;  2M3B A;  1FS0 E;  2ZVN B;  1L0L G;  1L0N E;  2KNC B;  3H1I G;  2E75 B;  3MGN A;  3T97 B;  1BGY J;  1EZV I;  5DJU B;  3RGU A;  3CWB D;  3V2R A;  2AXT E;  3AEB C;  4ZKP A;  2E42 A;  4DZO A;  3T97 A;  1LTJ A;  1VQK P;  2K9J A;  1VF5 B;  3C8V A;  1LTA C;  1L4A C;  2BCC G;  3TGU E;  2OAR A;  1L0L D;  1OVV A;  1FZC A;  2NZ2 A;  2OYI B;  3H1H J;  4H0L C;  4H13 B;  3CXH I;  3L74 G;  1JY3 O;  4IFM A;  3TSI A;  2K9Y A;  1H8A A;  4EOT A;  5EFW B;  4H44 B;  1YI2 P;  1ZW0 A;  3CPW O;  2OYH C;  3EWK A;  2LXC B;  4JYC A;  4H0L B;  1GU4 A;  1RHZ B;  2WPV B;  4N78 D;  1OXZ A;  5CBN A;  3VN0 A;  3ABV C;  1IFI A;  2H8P D;  2IZ0 A;  3L71 E;  4KJM A;  3F5H A;  1ZOY C;  4XA4 A;  2YIU B;  3CCM P;  1HH0 A;  2A45 H;  2JP3 A;  3E1R A;  3IF4 A;  1DD3 A;  1GU5 A;  4JQ0 D;  1JY2 P;  1N2D C;  2M5A B;  2XKM A;  4IL6 X;  2HOD B;  1RF0 C;  3RL0 g;  4IL6 E;  3VMZ A;  4PD4 E;  4ZKU A;  2H43 A;  3CC7 P;  1NU1 E;  2C0X A;  4GOD A;  2WSF H;  4BXL A;  2YNY A;  2KS1 B;  2KZJ A;  3MIW A;  3TDK A;  4WY4 C;  3H1K D;  3L73 D;  1JEK A;  4Y99 B;  1NKZ B;  2N9Y B;  1AVY A;  1S72 P;  4DT0 A;  1RF1 C;  2L91 A;  1N73 C;  4HJG H;  1NHL A;  4GT1 A;  1PGO A;  4UB6 H;  2Y0C A;  1GL2 D;  1GMJ A;  2Q7C A;  1XTG B;  5CCG D;  2HLO A;  1YQ4 C;  1NVO A;  2CPB A;  3A0H H;  5AVW B;  1N73 B;  4I2L C;  4LC1 A;  1X0T A;  1NOH A;  1SQQ G;  2IX7 C;  3LID A;  4ASW A;  3KPE A;  1NKN A;  3AE9 C;  4K35 A;  5KLV D;  3B71 A;  3L71 J;  5KLI C;  2HFE D;  3CWB G;  1PP9 J;  1BGY G;  4TLF A;  3RL0 C;  1IJD B;  2P10 A;  2N1T B;  1K8A Q;  3U1A A;  1PGQ A;  1BE3 E;  3L70 E;  4RJT A;  2P58 A;  1OFC X;  3GW6 A;  2Y0E A;  3CCJ P;  1NTK K;  2B9B A;  2E76 C;  3AEA C;  3L36 A;  5BU8 B;  1N86 A;  4QMA A;  2KI7 B;  5B66 E;  1M1J B;  4U7J A;  5AVQ B;  1R8E A;  1FZC B;  1LT9 C;  1Z56 A;  2E76 B;  2P7J A;  5CCG A;  1SQQ E;  3P8M C;  4H0L D;  3VP9 A;  3HD7 B;  3QH9 A;  3USS A;  2WPQ A;  1URQ C;  3IAO A;  3L75 D;  4H44 D;  1S4X A;  2ZXE B;  4JF7 A;  2HPC A;  4GIF A;  2KLV A;  4D6T D;  2OYI A;  2H89 C;  1W5C E;  5B66 H;  1FBM A;  2RN0 A;  4U3F J;  3B4S A;  1N8R Q;  5KLV E;  3SFD C;  4DCK A;  4OWF A;  3L75 E;  1CW5 A;  2K9J B;  1URQ B;  3OAK A;  3H1I D;  1PP9 E;  1QLE D;  1SQB D;  2ZYA A;  1L0L K;  1FJK A;  3L75 G;  4JYB A;  5E79 E;  1DD4 A;  1W2E A;  1QX8 A;  3P8C E;  3W68 A;  3L72 J;  3VOP A;  3B5N B;  3CI9 A;  2I1K A;  1YHQ P;  1SFC D;  1T8Z A;  3S4R A;  5L8R J;  2FY8 A;  2YKQ A;  2PGD A;  4I6M C;  2IDB A;  5AW7 B;  2FBW C;  1SQB G;  1H89 A;  1NTK E;  1G2C A;  3PH0 A;  2CK3 H;  3GLM A;  2J59 M;  1FOS E;  1NTZ J;  2FKW B;  2WSC H;  1GL2 B;  2RKL A;  4PV1 D;  1BCC J;  4D6T E;  2FYU G;  1BDC A;  1M1J A;  3N7N A;  3V4W A;  1R5L A;  2YKO A;  5KJ7 A;  4YPC A;  1FDM A;  2V7Q H;  4W80 A;  2WIT A;  1FZE A;  3AE7 C;  1JMM A;  3NMD A;  2YO3 A;  3GF7 A;  3FX0 A;  5H2F E;  1U7M A;  2QJP C;  1KD1 Q;  3GF3 A;  2V7Q J;  2VRS A;  3AE2 C;  3Q5S A;  1PFI A;  3IN6 A;  1KQF B;  2NPS A;  1N7S B;  1LWU A;  2E76 D;  3AE6 C;  1AVO A;  3RK3 E;  2LXB A;  5KAF H;  3L35 A;  1MUU A;  5AVT B;  1QL1 A;  2B88 A;  1M7L A;  1KIL E;  3CXH D;  2W6B A;  3Q3D A;  2R44 A;  1SQV J;  1QGK B;  3AEF C;  4GKG A;  4L74 A;  3M9H A;  2BCC D;  1A02 J;  3HTK A;  1LT9 B;  5KJ7 D;  2Z5H A;  1SQQ D;  3S9O A;  2CPS A;  3CCU P;  2KZI A;  2NPS D;  1HJB A;  4IFD K;  2M0B A;  4XFJ A;  3SWY A;  1S9K D;  1YIT P;  3L70 J;  4BWN A;  1PL5 A;  2N9B A;  1BSH A;  3RK2 C;  1PPJ G;  2IYO A;  1VF5 C;  3MD0 A;  5AW2 B;  1EDK A;  2SPZ A;  3RK3 B;  2WMM A;  5KKZ C;  3H1J G;  3I55 P;  1HF9 A;  4WB4 A;  1URQ A;  2LR2 A;  4PD4 D;  1YIJ P;  1VQN P;  3CWB J;  1FJP A;  3PTZ A;  1NJI Q;  2E74 D;  2B89 A;  1Q7Y Q;  2HG5 D;  4NPE A;  4L76 A;  3HD7 C;  3L70 G;  3G3Z A;  4H44 C;  2ZT9 D;  1VQ7 P;  3CX5 I;  3RK3 D;  1VQ9 P;  4NPF X;  1NTM E;  2W90 A;  3A0H E;  3G4S P;  4YXD C;  2JDI H;  1J1E B;  2WSC J;  5CCH A;  3H1H D;  3CWB E;  4DJG A;  1JM0 A;  1AV1 A;  3IR9 A;  3TNU A;  1SQB K;  3CCE P;  2IBZ E;  2BEZ F;  1VQ6 P;  1SQX G;  1Q81 Q;  1FZC C;  4AYC A;  2B87 A;  1IFN A;  2GA1 A;  2Q3I A;  3H1H E;  5TIS E;  3OW2 O;  1DEE G;  3HRN A;  5C39 A;  1YTZ I;  2O1J A;  2IFM A;  3JSV C;  1X8Y A;  5AVX B;  1KTM A;  2FXM A;  1WT6 A;  2POH A;  2XU6 A;  1T3J A;  2I8D A;  4PD4 H;  3G6E P;  3M9B A;  3AEE C;  3H32 B;  1PP9 G;  1IC2 A;  1K05 A;  3VMA A;  3CX5 H;  2E74 B;  2WT7 B;  1T3U A;  3WUU A;  1QVF O;  1SP4 A;  2OQQ A;  3GG2 A;  3AE1 C;  1M8O B;  1JNM A;  2KLU A;  1S5L E;  2QJP B;  2QJK B;  3H1L D;  5AW9 B;  3SWK A;  1SQP D;  4W7Z A;  1MV8 A;  1SQX K;  2KSE A;  3H1K J;  2ZVO B;  3L73 J;  1NWQ A;  1IK7 A;  1N7S C;  1LWU B;  1OW8 A;  3LW5 J;  2YMY A;  1HUC A;  2JR8 A;  1ZRT E;  1KQL A;  5DJT B;  2OYH B;  1J1D B;  1TU3 F;  2QSI A;  3HE4 A;  3VP8 A;  4EYY Q;  2O01 J;  2W27 A;  1PGJ A;  1G1J A;  2W83 C;  4PJ0 H;  2KXP B;  1LWU C;  1VQL P;  1NO4 A;  2W8Z A;  3CX5 D;  3H1L G;  4C7N B;  3D6Y A;  1HTL C;  1LTT C;  1Y8A A;  3V2P A;  3CCL P;  3L71 D;  2LKM A;  2MKV A;  3RK2 D;  2QM7 A;  1PZQ A;  2P67 A;  3MUD C;  3NFQ A;  3EFG A;  4IFF A;  4EI2 A;  2Q3E A;  2R32 A;  1ZXG A;  3ZDM A;  1FZG A;  1L0N D;  4OGQ D;  1GK6 A;  1YYC A;  3L37 A;  3A0B H;  1MKM A;  2FXP A;  5AVV B;  1KZU B;  1RE3 C;  1G2C B;  1LGH B;  1SQQ K;  3SWF A;  1BGY E;  2PRR A;  2PAJ A;  2O01 H;  1EQ7 A;  2Q6Q A;  3H1L E;  1LTG C;  1Q2N A;  1USE A;  2YMK A;  2ZT9 C;  3KZI E;  4U3F G;  3D6Z A;  2DW3 A;  1KYO H;  1SQX D;  2I1J A;  3S1K A;  1ZME C;  5CCH C;  1XTC C;  5APY A;  3O8Z A;  1AQT A;  3RBX A;  4ASV A;  3H6P A;  3AEC C;  4HKZ H;  1E5W A;  1KB9 D;  1JCD A;  1VL2 A;  4D6T J;  1UII A;  1DEB A;  1MFT A;  3U59 A;  1HVV A;  2AEJ A;  2Y0D A;  4U3F D;  3FGA D;  2NPS C;  5AW4 B;  3I56 P;  1S3J A;  3PP5 A;  5APW A;  1YQ3 C;  5APU A;  3TNU B;  3O6Q A;  2FYU J;  4AUW A;  1RH5 B;  1HGZ A;  3H1I J;  1EDI A;  5AVZ B;  1SQB J;  1L4A B;  1BE3 J;  2GUS A;  4WVZ A;  3B5N A;  2YKP A;  1ZP0 C;  2NPS B;  4OGQ C;  1X9V A;  3CLQ A;  3H1K G;  3FXD A;  5APV A;  2HYN A;  2YXR B;  1SQP G;  1S5L H;  3VMY A;  1L0N K;  3H32 A;  3ITK A;  3SFE C;  1K73 Q;  2E75 D;  2Z4E A;  4M3L A;  2QEX P;  2E74 C;  3LIE A;  3LW5 H;  1EXI A;  2KYV A;  1GL2 C;  2IFN A;  3HTK B;  3JC2 2;  3L72 E;  1NU1 D;  3P7K A;  1VQO P;  2E43 A;  1OZH A;  3B8E B;  1KIL C;  1P84 I;  1JOC A;  5CCH D;  2FFD B;  2G3A A;  1NTM G;  4WY4 B;  1SFC A;  1SQX E;  1VDF A;  1N7S D;  2WPR A;  4Y99 C;  3V5B A;  5BVZ A;  2GM4 A;  1FDO A;  1YJW P;  1BE3 G;  1CI6 A;  3PHL A;  4C46 A;  1S9K E;  1KOR A;  2BEQ D;  2JKV A;  3AEG C;  3VYI A;  1LT1 A;  1BCC D;  1Q82 Q;  4UB8 H;  1KN7 A;  1T2K D;  1NTK G;  1EZV D;  1L2P A;  1USD A;  3V2Q A;  1KFN A;  3BCC G;  1L0N G;  1OW6 A;  1SQP K;  2KP8 A;  1GZL A;  4C7R A;  3D70 A;  2W6J H;  3IFM A;  2K37 A;  2WSS H;  3AE3 C;  3MUD A;  2C0W A;  3NXS A;  2WVR A;  2AEM A;  1JB0 J;  1KB9 I;  3TF5 A;  3RBZ A;  4C7N A;  2Y9Z A;  1BDD A;  3AE5 C;  4B86 A;  2C9N Y;  1L0L E;  3Q2Y A;  5AW3 B;  1KYO E;  3BRV B;  1DX7 A;  1ZRT D;  1NTZ G;  2OYI C;  3W67 A;  2H88 C;  2QRX A;  1IFP A;  3F89 A;  3H1J D;  3MZW B;  4TT3 H;  1LJ2 A;  1UIX A;  2WPS A;  1IO4 A;  3FXE A;  1AJY A;  1U57 A;  2M3E A;  1SQV D;  1AQ5 A;  3L74 J;  2HR3 A;  4N78 E;  5AW5 B;  5CBO A;  3CXH H;  4LLH A;  1JY2 O;  1SQQ J;  1WRG A;  1R5S A;  4N6J A;  1RY3 A;  2KOG A;  3Q5R A;  3E7K A;  4YXW H;  1YJ9 P;  3L70 D;  1VPC A;  2A06 D;  2Y9Y A;  1AA0 A;  5AVY B;  1FAV A;  1M57 D;  4U3F E;  1ZV8 A;  1EDJ A;  2QE7 H;  5AW0 B;  1SQV G;  1M1K Q;  1GK4 A;  1YJN P;  3CC2 P;  1KB9 E;  2QIW A;  5B5E E;  1OW7 A;  2H7H A;  1P84 H;  2A06 E;  3AE8 C;  3E1I A;  4ZMD A;  1HWT C;  2C9L Y;  3CCV P;  3CMA P;  2D2C D;  2AEF A;  3GHG B;  1DIP A;  2K1A A;  1HGV A;  1LP1 B;  4I7Z B;  1LTI C;  1S5L X;  2FYU K;  5TIS H;  3FWL A;  5GTH E;  5B5E H;  1D7M A;  5APS A;  5KJ7 C;  3Q1M A;  3HUS A;  2OYH A;  1JTH B;  1OX3 A;  1SQV E;  1RF1 B;  1IFM A;  3AED C;  4D6T G;  1A02 F;  1OMI A;  4HH2 A;  3GHG C;  4JPZ B;  1NTM D;  2J5U A;  3MP7 B;  2FYZ A;  1JTH A;  3TGU J;  3TK1 A;  2WTY A;  1W2B O;  3GMA A;  3HE5 A;  3N4X A;  3NTN A;  4L75 A;  1KIL A;  2B87 B;  1JMB A;  2R3C A;  1SQB E;  1J2J B;  1NTK J;  3CX5 E;  4WY4 A;  5BU5 A;  1KYO I;  3V4Q A;  3BCC J;  3HE5 B;  5GTI E;  1KC8 Q;  2OTJ P;  1BCC G;  1KQG B;  3MHV A;  3OA7 A;  3A0B E;  4N3Y B;  3KYQ A;  5KAF E;  2P1J A;  4BRY B;  2KIK A;  1NU1 K;  1IFJ A;  5KAI H;  1QL2 A;  4BRY A;  3KHU A;  3A5T A;  3L4F A;  1VF5 D;  2JWA A;  2PFX A;  2MJZ A;  4KHX A;  5KLV G;  1GW4 A;  1Y47 A;  1BGY D;  1VQP P;  5APQ A;  1K9M Q;  1X79 B;  2E5T A;  1X22 A;  2XNX A;  1ZLL A;  2L5G B;  3M0D C;  2K3R A;  3H1L J;  1M56 D;  2JJL A;  1KFM A;  4WY4 D;  4H13 C;  1SQP J;  3CCQ P;  4WWI A;  3KZI H;  2XV5 A;  5KLV K;  5AW6 B;  5AVR B;  1L0L J;  2YXQ B;  2KUB A;  1KIL D;  3CXH E;  4GOE A;  1EXJ A;  3PLN A;  5CHX A;  2UWJ E;  4PV1 C;  2ZYG A;  2WSF J;  1VQ8 P;  3CME P;  1NTM K;  2V4H A;  3BAT A;  5GTI H;  3BVH A;  3M91 A;  4XE5 B;  2N1T A;  1N7S A;  1JY3 P;  2R5D A;  3PJS K;  2O01 N;  2A06 G;  2OGU A;  1NYH A;  4EIJ A;  3L74 E;  2A45 I;  2QM8 A;  4RES B;  3P32 A;  3CCR P;  3CL3 D;  1KMI Z;  5M1B A;  4LGD E;  4Z1M H;  1URQ D;  3D71 A;  2ZAE B;  3R2P A;  3I5C A;  5CCG C;  2ITA A;  3B5N C;  3FWN A;  3L72 G;  1GDT A;  4EDF A;  1YBK A;  1L0N J;  1SQV K;  2AXC A;  2KSJ A;  3BAS A;  4Y28 J;  5KKZ B;  1FOS F;  2HPC B;  2AXT H;  2A45 G;  1H0T B;  2KK7 A;  3H1J E;  3WU2 H;  1E79 H;  1NH4 A;  2IZ1 A;  3EQ2 A;  1RE4 A;  2KNC A;  1GL2 A;  3H1K E;  3OJA B;  4H13 D;  3V2N A;  4ZNC A;  1H88 A;  4I1L A;  1KB9 H;  5CMZ A;  2KS1 A; 
#chains in the Genus database with same CATH homology
 1KIL E;  2YIU C;  2G3A A;  2NZ2 A;  4I7Z C;  4H0L C;  4RKU J;  2JO1 A;  3Q3D A;  4H13 B;  3AEF C;  1FDO A;  1RQV A;  2K9Y A;  3H25 A;  1KOR A;  2BEQ D;  3AEG C;  4H44 B;  4OGQ B;  3S9O A;  3EWK A;  4H0L B;  4XFJ A;  2WPV B;  1PL5 A;  1OW6 A;  3ABV C;  1VF5 C;  3R4Y A;  3D70 A;  5KKZ C;  1WMK A;  1ZOY C;  3AE3 C;  1HF9 A;  2G8Y A;  1JB0 J;  1FDI A;  1K04 A;  2JP3 A;  1DD3 A;  3AE5 C;  2E74 D;  4IL6 X;  3RL0 g;  4R4M A;  3Q2Y A;  4H44 C;  4R4L A;  2ZT9 D;  4KT0 J;  2H88 C;  1NGM B;  4TT3 H;  2WSC J;  3Q5P A;  1UIX A;  1AJY A;  1U57 A;  2BEZ F;  1GMJ A;  1YQ4 C;  4PV1 B;  3Q5R A;  1KTM A;  3AE9 C;  2E75 C;  3B71 A;  5KLI C;  3AEE C;  2QIW A;  1K05 A;  1OW7 A;  3AE8 C;  2E74 B;  2P10 A;  2D2C D;  2OQQ A;  4GDO A;  2E76 C;  3AE1 C;  3AEA C;  1DIP A;  4I7Z B;  1S5L X;  3Q1M A;  4U7J A;  3AED C;  1IK7 A;  1R8E A;  1OMI A;  2ZT9 B;  1OW8 A;  2E76 B;  3LW5 J;  2J5U A;  4H0L D;  1ZRT E;  1S1C X;  3GMA A;  3IAO A;  1TU3 F;  2QSI A;  3AE4 C;  4H44 D;  4PV1 D;  2O01 J;  2QJY C;  2H89 C;  1KQG B;  3SFD C;  3D6Y A;  4YTP C;  1PIX A;  2MKV A;  4YXD C;  1VF5 D;  1DD4 A;  4OGQ D;  1MKM A;  2FXP A;  2QJK C;  1Q90 D;  5L8R J;  4H13 C;  2IDB A;  2YMK A;  2ZT9 C;  1Y9B A;  3D6Z A;  3G9R A;  1HJ0 A;  1EXJ A;  2FBW C;  1ZME C;  2WQY C;  4PV1 C;  2WSF J;  3GLM A;  2D2C B;  3AEC C;  1VL2 A;  2FYN C;  3FGA D;  1NYH A;  1YQ3 C;  2WSE J;  3O6Q A;  2D2C C;  1KMI Z;  5M1B A;  3D71 A;  4Z1M H;  1RQU A;  3AE7 C;  1PV3 A;  3GF7 A;  1ZP0 C;  4OGQ C;  2E75 B;  2QJP C;  3T97 B;  4Y28 J;  3GF3 A;  2V7Q J;  3SFE C;  3AE2 C;  3AEB C;  2E75 D;  3Q5S A;  3IN6 A;  1KQF B;  2E74 C;  4H13 D;  2E76 D;  1VF5 B;  3AE6 C;  3C8V A;  3RK3 E;  1EXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...