4R4LA

Crystal structure of wt cgmp dependent protein kinase i alpha (pkgi alpha) leucine zipper
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
47
structure length
47
Chain Sequence
b'SELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cGMP-dependent protein kinase 1
publication title Structures of cGMP-Dependent Protein Kinase (PKG) I alpha Leucine Zippers Reveal an Interchain Disulfide Bond Important for Dimer Stability.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 20
structure length 47
sequence length 47
chains with identical sequence B, C
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16808 PKcGMP_CC Coiled-coil N-terminus of cGMP-dependent protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4r4lA00
1R8EA 1EXJA 4R4MA 3Q5RA 3G9RA 1DIPA 3D70A 3Q2YA 3D71A 3D6YA 3Q3DA 3T97B 1EXIA 3IAOA 2J5UA 3Q5SA 3Q5PA 3Q1MA 4R4LA 2OQQA 3D6ZA
chains in the Genus database with same CATH superfamily
1OW7A 3TDKA 2OARA 4U3FG 3V4WA 4YPCA 1IFPA 2KK7A 4PJ0E 5AVSB 2K88A 1K9MQ 3CCUP 2C0XA 3A7OA 3TGUD 2OYHC 2KUBA 1PP9J 4ZMDA 1QVGO 4N78E 2KB7P 3BVHA 1T2KC 4TLFA 2XDJA 3MGNA 2D2CC 3MZWB 3L74E 1W2BO 3TK1A 4PJ0H 1VF5B 3M9HA 1NU1D 2E5TA 4OWFA 3S9OA 2Q6QA 4D6TG 4JBZA 3A0HH 1PGQA 2A06D 2QIWA 2WSEH 1WRGA 3GHGA 4IFFA 1MKMA 3VMZA 4BWNA 3HE5A 4U3FE 5KLVJ 1TU3F 5CHXA 1IFMA 1NTZK 1N86A 1FZFA 1S9KE 1KILD 1YQ3C 5GTHE 3CD6P 2IX7C 3OW2O 2NPSA 2QJPC 1BE3G 3L72D 1Q7YQ 1NKZB 2L5GB 3H1HD 5AVRB 4YXDC 1SQPK 3B8EB 3CX5H 5GTHH 2JDIH 2YIUB 3M0DA 4CPGA 1KQFB 1NTKK 3HD7B 3AECC 1YJWP 2KXPB 4I7ZC 5KLIB 1M56D 4IFMA 1E79H 2C9LY 1S1CX 1GZLA 3VMAA 5CBNA 4IOIH 1YTZT 1GL2C 3G6EP 3BATA 3NMDA 1X9VA 3VMYA 1GMJA 2W6BA 1URQB 1H88A 3B5ND 4OGQC 3H1KE 3EWKA 4N78D 4XA4A 1Q86Q 5H2FE 3CX5I 3JCUE 2C0WA 2R44A 2E42A 1JNMA 2H8PD 2AEFA 1SQBG 5AVVB 3KYQA 1LTGC 3RBZA 2DW3A 3RBXA 1EZVD 1HBWA 2KSJA 3H1LJ 1SFCD 5H2FH 3RK3E 2WVRA 5CBOA 3A5TA 2WPSA 1QLED 1LGHB 3MIWA 2R3SA 3L72J 3GMAA 1BCCG 4U3FD 1HUCA 1LT9A 2QJKB 4DCKA 3PJSK 5CCGC 2K9JA 2OTJP 1AQTA 2E5YA 4NPEA 1RQVA 3V5BA 3Q3DA 5KAFH 2IZ0A 1KMIZ 1L4AA 1SQBE 3BASA 2CK3H 1YI2P 2PRRA 1NH4A 3AE4C 3BCCG 2BEQD 2AXTE 3M0DC 2QEXP 1YBKA 1BCCE 2KS1A 2J58A 1QL1A 2M0BA 2NRGA 2ZYGA 4KHXA 3V4QA 4NPDA 2JEEA 2GM4A 1OZHA 1RE4A 3SSUA 2I8DA 3H25A 2AXTH 2O01J 3Q2YA 1JOCA 1U57A 2MKVA 2Z4EA 1Q2NA 2W83C 4Y99B 1GD2E 1BGYG 3HUSA 3RL0B 1FE6A 1LT1A 3H1KD 2WPQA 1P84E 2OTLP 2P7JA 1JB0J 2M5AB 1N8RQ 1X8YA 1LTBC 2N1TA 1K73Q 1PZQA 2O1JA 4L76A 1P84H 1AV1A 3RK3D 2FYUJ 3CMEP 3RK2C 3VOPA 3CCSP 2Z5HA 3D70A 1DD3A 1JMMA 3AE9C 2V4HA 2V7QJ 1PP9G 2E76D 4IL6H 1VQOP 1LT9C 3IAOA 1ZOYC 5AW8B 5BU5A 3WUUA 3CCMP 1UIXA 2QM7A 3CWBG 2QRXA 1S5LX 1R5LA 1JM0A 5TISE 1N73A 2A45G 1OWAA 1LTJA 4C46A 1NTME 1PGOA 1XTGB 1VQ9P 1ZMEC 4HJGH 1FS0E 1ZRTE 2NZ2A 2P1JA 5KLVG 5TISH 1P84I 1HJBA 1CI6B 2LXBA 2QG4A 4PV1C 2BCCJ 3L37A 1BCCD 2KLVA 1PP9E 3U1AA 1YTZI 3H1IG 1N7SA 4YXWH 1VDFA 1M1JB 2N9BA 5B5EH 2XV5A 3V2PA 1JY2O 1J1DC 3CMAP 1VQKP 2QE7H 2YMKA 1NVOA 3HUSC 1G2CB 5AVQB 4WY4A 5KLVE 5AVYB 1ZR2A 2A45H 3TGUG 2HR3A 2YKOA 3VP9A 4L74A 3WU2H 2BEZF 4WVZA 3B5NB 1NU1G 1Q90D 2WT7A 4JF7A 2NPSD 1ZLLA 3L73J 1LWUA 1SQQJ 2UWJE 1HWTC 4EYYQ 3L35A 2A06G 3TNUA 5CJ4A 5CCHC 2FYZA 1SFCB 1M8OB 2FBWC 2QM8A 1JCDA 2OYHA 2A45I 3HTKA 4HYTB 4B86A 2PP6A 3H1LG 1NTMD 3V6IA 1WMKA 3S1KA 3L72G 1DD4A 1GW3A 3QH9A 4DOJA 1ZRTD 1DX7A 5AW2B 3H1HG 4R4LA 3M91A 1AVOA 1JY2N 3HE4A 3HRNA 3UIAA 4OVNF 3KZIE 2ZT9C 4NPFX 1K05A 1RF1C 3V2NA 3I55P 1USEA 1OX3A 2Q5UA 2GUSA 1KTMA 1KILE 3H1LE 2BASA 4HH2A 5AW7B 4KJMA 3KZIH 5KLVK 3WUVA 3L72E 1KFMA 1FDOA 2ZVOB 1K8AQ 4DT0A 4H0LD 4WY4C 2QA4P 1OMIA 3H1HE 4HB1A 1HH0A 1VQ4P 3NTNA 2OGUA 2Q3EA 1KN7A 2HYNA 1KB9D 1IC2A 3L75J 2HG5D 2WMMA 2KNCA 5AVTB 3M06A 3D71A 4H44D 3TF5A 4H13C 1EZVG 1LWUC 1L4AD 3AEGC 5L8RJ 4BXLA 4Y28J 1GL2A 4R4MA 2FFDB 2WSCJ 3L70J 3RK3B 4UB6H 3RL0g 3ZDMA 4ASWA 3II6A 2W8ZA 1BDDA 2E76B 2JWDA 4PV1D 2OYIB 1IZNB 5E79E 1NU1K 2AXCA 1NOHA 4C7NB 1D7MA 1SQVJ 3W67A 2FYNC 1EZVE 1KQGB 2KLUA 3ABVC 2O01N 1L0NJ 3OA7A 1AVYA 5CCGA 3HD7A 2B9BA 2IZ1A 3G3ZA 3Q5PA 2N1TD 3H1LD 3VTPC 2FYUE 1X0TA 1KZUB 1OW6A 1IFIA 5C39A 1MZ9A 1NTZD 1U7JA 3OAKA 3H1KG 1YIJP 2KP8A 3GW6A 4BRYB 1L0LK 3Q1MA 3H32B 3VN0A 2AEMA 1VQ6P 2YO3A 1JUNA 1J2JB 3F5HA 3GHGB 3EFFK 1KORA 1FZGA 1SQXJ 1EZVI 1VF5C 2E75D 2VRSA 3TSIA 5AW3B 5APUA 2BCCE 1ZV8A 2NPSB 3Q5RA 3CCJP 2Y9YA 4PD4E 1RY3A 1NGMB 2P10A 3CPWO 2WSFJ 3P8CD 1QX8A 1N7SD 2QJYB 1MFZA 3I56P 1IFNA 4XE5B 1CSBA 1G1JA 4LGDE 4AYCA 2HFED 2WQYC 3B4SA 3MUDC 3JCUH 3B71A 1LP1A 1VL2A 2LKMA 2O1KA 3JC22 3VYIA 1H0TA 3LW5J 5AVUB 3AE2C 1GU5A 2YIUC 2P58A 1NTZJ 4OH8B 3HD7C 1BSHA 4AQRD 2E74D 1J1EB 1T8ZA 3JSVC 3CCEP 3H1JJ 1FAVA 4QMAA 4RO0A 5KLIC 2FYUD 3MD0A 2POHA 2IYPA 3L73E 1SQQE 1RF0A 1CZQA 4L73A 2YKPA 2B89A 3L71J 1S5LE 1SQPJ 3KDPB 2WTYA 4W7YA 4ZNCA 1JY3O 2W6JH 1IO4A 1GK6A 5APSA 1URQC 1NTKJ 1EDKA 3Q5SA 1OVVA 4H0LB 1RE3C 3O6QA 1MUUA 1XTCC 2YNYA 3WUTA 1T2KD 1KV4A 2K9YA 1VQMP 3PLNA 2D2CD 3F89A 1YHQP 3P7KA 2K9JB 4H44B 2BCCD 1SS1A 4RKUJ 3PTZA 3IN6A 3P32A 4GKGA 4PD4D 1L4AB 5KJ7C 2RN0A 3AE7C 3FWLA 1YJ9P 2QJKC 1Z56A 3AE5C 1RHZB 1NTMG 2R3CA 3CC4P 1HTLC 1AFOA 1FZEA 2JKVA 3L70G 2G8YA 1BDCA 3QWOC 1HJ0A 2ZXXA 3E1IA 4GOEA 3CC7P 2JJLA 1CI6A 5CCHA 3L75E 1Y9BA 5AVZB 4Z1MH 1JTHA 3A2AA 5AW9B 1SQBK 3G71P 3O8ZA 5APYA 3AE1C 2IBZE 3L73D 1SQQD 3AEEC 1JY3N 1RF0C 4D6TJ 1KQLA 2SPZA 1JY2P 1KILB 4M3LA 5TJHA 1JEKA 2N1TB 1L0NG 3OJAB 3L70E 1HGVA 1RQUA 2XZRA 4Y99C 1IFJA 2H88C 3AEDC 1FOSE 1GL2D 3RL0C 1IFDA 2ZFCA 5APXA 4OGQD 1RF1A 1VQLP 1LNQA 4DZOA 1R8EA 1SQVE 1BE3J 2RKLA 2ZAEB 2OTKE 3P8MC 2Y9ZA 1N73B 1FZCB 5AW1B 1LTJB 2E75B 1L0NE 4I6MC 1FJPA 2KIKA 1S4XA 2YO2A 1CW5A 1NHLA 3CCVP 2IBZI 4IL6X 3CL3D 1KB9E 5CCGD 2HPCA 3HD7D 4HKZH 4LLHA 1OXZA 5KKZB 1U7MA 2OQQA 2H89C 4GT1A 5EFWB 1N7SB 1KFNA 1KD1Q 1S72P 3AE6C 3GF3A 4IFDK 1KB9H 1ZW0A 3IFMA 1VQ8P 3L75D 1EXIA 1LTIC 2B87A 1HVVA 1NTMK 1M1JC 1DEBA 2IBZD 4TT3H 1DEEG 1SQXE 1NJIQ 3M9BA 1NAFA 2E74B 1PGPA 1N2DC 4GODA 4U7JA 3N4XA 3L70D 4DJGA 3M9QA 3KQGA 3VP8A 1NTZG 1QL2A 5AVXB 1KB9I 2C9NY 2Y0DA 3CXHD 2HODA 1SQVD 1OVRA 3NXSA 5KAIE 2YXRB 3B5NC 1SLQA 2WZ7A 2FY8A 1SQPG 3N7NA 1PPJD 2RMZA 3MHVA 1DH3A 1K04A 3T97A 2OYHB 3BCCJ 4EOTA 4K3AA 3HTKB 2QVAA 1L0ND 2IDBA 5KAIH 2JR8A 3RK2D 1VQ5P 2FFDA 3CC2P 1NTZE 1NAYA 1SFCC 3PP5A 3U59A 5APWA 3H1JE 1GK4A 2PGDA 3MP7B 2K3RA 1IJDB 3IR9A 2OYIA 3HE4B 1Q82Q 3IF4A 3PHLA 1KYOD 3GG2A 1FOSF 3RGUA 3L71E 1SQPE 3E7KA 1BGYJ 1SP4A 1FDIA 4C7RA 5APVA 1NTKE 2YKQA 1PL5A 3TYYA 1VQ7P 2QJPB 1ZP0C 2LR2A 1AA0A 1SQXD 3P8CE 2FYUG 1YITP 1N7LA 2FXPA 3MUDA 2KNCB 4I7ZB 1G1IA 2PFXA 3A0HE 5B66E 1LTSC 3CWBJ 2RH0A 1GTWA 2O01H 4ZKPA 1OFCX 5E79H 1T3UA 2I1KA 4UB8E 2XU6A 1DIPA 2JP3A 4BRYA 1OVUA 1GL2B 3CCLP 3H32A 4AUWA 3D6YA 1JO5A 2LXCB 2IPPA 5B66H 1X79B 2ZVNB 1M57D 5APTA 4OGQB 3V2RA 4UB8H 2BCCG 1AQ5A 1HF9A 3SWFA 2FFDC 3CX5E 3C1LA 3H1IJ 4K35A 3RK3C 1OW8A 1S3JA 3H1JD 1URQA 5CCHD 2E76C 2OYIC 1RE3A 2V7QH 3MTUE 4N3YB 1EQ7A 4D6TE 3HE5B 3CCQP 1QGKB 3L71D 1SQPD 2Y0EA 1L0LD 3PRJA 1NTKD 1NWQA 1ZR4A 1A02F 3TGUJ 1WT6A 4EDFA 2JO1A 5KJ7A 2K37A 2GA1A 1PGJA 2J59M 2G3AA 1BE3E 1NU1J 2ZT9D 1A02J 3BRTB 3L73G 3D6ZA 2W27A 1SQQG 2E43A 1BSNA 2L91A 4PD4H 1ZXGA 4WB4A 4N6JA 3KXDA 2N9YB 1T3JA 3L74D 4I1LA 1MV8A 1M90Q 1R5SA 2ZJSE 1H8AA 4WY4D 2Q1KA 2H43A 3CI9A 4EI2A 1FZAA 1JY3P 1M1KQ 2FYUK 1SVFA 2HLOA 3AE8C 2ZYAA 5KAFE 5GTIE 3V2QA 2Z5IA 1IK9A 3GHGC 3H6PA 3H1HJ 2CPSA 3CLQA 3FGAD 2ZYDA 1S9KD 4H13D 4PD4I 3CX5D 2NPSC 1L0LJ 5GTIH 3SFEC 3AEAC 1EDLA 1FDMA 3GLMA 3A3YB 1LP1B 5CMZA 3RK2B 1Y8AA 2M5AA 1W5CE 2QJYC 3EFGA 1S5LH 4D6TD 1GU4A 1H0TB 2FKWB 3NFQA 2WPRA 1LT9B 1FC2C 4O9BA 1LJ2A 2M3BA 1FBMA 1X22A 3L4FA 4JPZB 1YQ4C 3AEBC 5AW4B 3U1CA 4RJTA 3L75G 3SWYA 1EXJA 1MFTA 2WSEJ 1PFIA 3L74J 5AW6B 1BE3D 1J1EC 4W80A 2AEJA 2IBZG 2GUVA 5BU8B 3M0AA 4PV1B 2KS1B 1YJNP 3BCCE 2XKMA 2ZXEB 3O6QB 3G9RA 4U3FJ 4LC1A 2JWAA 1KILA 1J1DB 3L36A 4IL6E 2J5UA 3KHUA 2CPBA 1KQSO 4H0LC 1SQVG 2P2UA 2KI7B 3HUSB 1M1JA 1SQQK 2O3JA 1PIXA 2XNDH 1PPJG 4GOFA 1NKNA 3SWKA 1BGYE 4EIJA 1VF5D 4H44C 1FZCA 4ASVA 2Y0CA 1OIPA 2FXOA 1G2CA 1L4AC 1SQBD 3R4YA 5AW0B 4JYCA 4WBAA 2IFNA 3ITKA 2I1JA 5DJTB 5B5EE 2WSCH 3CXHE 1LTAC 1ZN5A 1S2EA 3B5NA 2FXMA 2KZJA 4JQ0D 5M1BA 2QSIA 1JTHB 1PPJE 1VQPP 1AJYA 2WSSH 2H7HA 3CWBE 3H1KJ 2XNXA 3CXHH 2ITAA 2R32A 3LIEA 1RE4C 3FXEA 3AEFC 1JCCA 1SFCA 4XFJA 3SFDC 1JMBA 1USDA 3WU2E 1VPCA 1SQXG 2M3EA 1IK7A 2P67A 1Q81Q 2Q3IA 2W90A 4L75A 1EDIA 1EDJA 3BCCD 1P84D 1LTTC 3CCRP 1QEXA 1HGZA 1KYOE 1PV3A 5AW5B 2ZT9B 3FX0A 4W7ZA 1RF1B 1QVFO 1KILC 2N1TC 3H1IE 4ZKUA 1W2EA 3LIDA 3USSA 2MJZA 2OYOA 3CXHI 4I2LC 1KYOH 1URQD 1SQBJ 2W6AA 2YXQB 4RESB 3W68A 4WY4B 2M8RA 1BGYD 3G4SP 2KZIA 4A7PA 1FZBA 5KTBA 1N73C 1FZCC 3I5CA 3C9IA 2HPCB 3TGUE 2K1AA 1BCCJ 3PH0A 1GDTA 1Y47A 3VMXA 1H89A 1LTJC 4MN4C 2E75C 3H1JG 4GIFA 2WT7B 2IYOA 4H13B 5K5GB 1LWUB 5KJ7D 1KC8Q 5DJUB 2PAJA 1SQVK 1NU1E 1L2PA 1RH5B 1UIIA 5AVWB 3TNUB 2KOGA 2IFMA 4KT0J 3S4RA 1KYOI 2B87B 2WITA 4YTPC 1PP9D 2YMYA 3L71G 5KKZC 3A0BE 2A06E 1VQNP 3BRVB 2WSFH 2R5DA 1N7SC 3K5BA 1L0LG 3CWBD 1M7LA 1NTKG 1L0NK 1GW4A 2D2CB 1FJKA 3FWNA 1T6AA 1FU1A 3EQ2A 3A0BH 2FYNB 4WWIA 3GF7A 3C8VA 1NO4A 2B88A 2KSEA 1NYHA 3FXDA 4GDOA 2WPVB 3LW5H 1EC5A 4JYBA 5KLVD 2WWWA 3WMM0 3R2PA 2Q7CA 5BVZA 2E74C 5APQA 3KPEA 4C7NA 2HODB 3H1ID 3L74G 1E5WA 1L0LE 1YYCA 2R5BA 4UB6E 5CJ0A 2Q9IA 3T97B 3E1RA 3AE3C 1NTMJ 1SQXK 2KYVA 3RL0D
chains in the Genus database with same CATH topology
2YIUC 4I7ZC 1EXJA 1OW7A 2G8YA 1OW6A 2E75C 3AE4C 2E74D 1K04A 2WSEJ 1DIPA 5M1BA 1S1CX 2JP3A 2BEQD 4IL6X 1HJ0A 4H13B 2QSIA 5KLIC 3D71A 1AJYA 4H44D 3D6YA 2IDBA 1ZMEC 4H13C 2FBWC 3Q1MA 2OQQA 2H89C 4KT0J 2NZ2A 1ZRTE 3AEGC 4PV1B 1Y9BA 2D2CC 4OGQB 5L8RJ 4YTPC 4Z1MH 1GMJA 4Y28J 5KKZC 4R4MA 2WSCJ 3AEFC 4XFJA 1VF5B 3G9RA 3AE6C 3SFDC 3GF3A 1WMKA 4PV1C 3RL0g 2O01J 3H25A 1HF9A 4OGQC 3Q2YA 3AE1C 3EWKA 3S9OA 1IK7A 1KORA 1U57A 3AEEC 2MKVA 1DD4A 1VF5C 3AE8C 2E75D 1EXIA 2J5UA 3Q5SA 1OW8A 2D2CB 2E76B 4PV1D 4H0LB 2QIWA 4R4LA 3O6QA 1MKMA 1PV3A 3FGAD 3GF7A 1FDIA 2E76C 2ZT9B 3C8VA 4H0LC 1RQUA 4TT3H 4H13D 2H88C 1TU3F 3Q5RA 3AEDC 1NYHA 1JB0J 2K9YA 1NGMB 1PL5A 2FYNC 2P10A 3RK3E 4GDOA 2E74B 1PIXA 2D2CD 2WPVB 2ZT9C 1K05A 2WSFJ 2YMKA 1ZP0C 3SFEC 4U7JA 1YQ3C 1KQGB 4H44B 3GMAA 2E74C 3AEAC 3GLMA 4OGQD 3ABVC 4RKUJ 2QJPC 3IN6A 1KTMA 1KILE 1R8EA 1VF5D 4H44C 3AE7C 2QJYC 2WQYC 2QJKC 2JO1A 2BEZF 3D70A 1DD3A 2FXPA 3AE9C 3R4YA 4YXDC 1FDOA 3AE5C 2V7QJ 2E76D 3B71A 1RQVA 3Q3DA 4H0LD 3T97B 3IAOA 1VL2A 1OMIA 1KMIZ 2G3AA 4I7ZB 3Q5PA 1ZOYC 3AE3C 1KQFB 1Q90D 1YQ4C 3LW5J 1UIXA 2E75B 3AEBC 3AE2C 3AECC 2ZT9D 1S5LX 3D6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R8E A;  1EXJ A;  4R4M A;  3Q5R A;  3G9R A;  1DIP A;  3D70 A;  3Q2Y A;  3D71 A;  3D6Y A;  3Q3D A;  3T97 B;  1EXI A;  3IAO A;  2J5U A;  3Q5S A;  3Q5P A;  3Q1M A;  4R4L A;  2OQQ A;  3D6Z A; 
#chains in the Genus database with same CATH topology
 1OW7 A;  3TDK A;  2OAR A;  4U3F G;  3V4W A;  4YPC A;  1IFP A;  2KK7 A;  4PJ0 E;  5AVS B;  2K88 A;  1K9M Q;  3CCU P;  2C0X A;  3A7O A;  3TGU D;  2OYH C;  2KUB A;  1PP9 J;  4ZMD A;  1QVG O;  4N78 E;  2KB7 P;  3BVH A;  1T2K C;  4TLF A;  2XDJ A;  3MGN A;  2D2C C;  3MZW B;  3L74 E;  1W2B O;  3TK1 A;  4PJ0 H;  1VF5 B;  3M9H A;  1NU1 D;  2E5T A;  4OWF A;  3S9O A;  2Q6Q A;  4D6T G;  4JBZ A;  3A0H H;  1PGQ A;  2A06 D;  2QIW A;  2WSE H;  1WRG A;  3GHG A;  4IFF A;  1MKM A;  3VMZ A;  4BWN A;  3HE5 A;  4U3F E;  5KLV J;  1TU3 F;  5CHX A;  1IFM A;  1NTZ K;  1N86 A;  1FZF A;  1S9K E;  1KIL D;  1YQ3 C;  5GTH E;  3CD6 P;  2IX7 C;  3OW2 O;  2NPS A;  2QJP C;  1BE3 G;  3L72 D;  1Q7Y Q;  1NKZ B;  2L5G B;  3H1H D;  5AVR B;  4YXD C;  1SQP K;  3B8E B;  3CX5 H;  5GTH H;  2JDI H;  2YIU B;  3M0D A;  4CPG A;  1KQF B;  1NTK K;  3HD7 B;  3AEC C;  1YJW P;  2KXP B;  4I7Z C;  5KLI B;  1M56 D;  4IFM A;  1E79 H;  2C9L Y;  1S1C X;  1GZL A;  3VMA A;  5CBN A;  4IOI H;  1YTZ T;  1GL2 C;  3G6E P;  3BAT A;  3NMD A;  1X9V A;  3VMY A;  1GMJ A;  2W6B A;  1URQ B;  1H88 A;  3B5N D;  4OGQ C;  3H1K E;  3EWK A;  4N78 D;  4XA4 A;  1Q86 Q;  5H2F E;  3CX5 I;  3JCU E;  2C0W A;  2R44 A;  2E42 A;  1JNM A;  2H8P D;  2AEF A;  1SQB G;  5AVV B;  3KYQ A;  1LTG C;  3RBZ A;  2DW3 A;  3RBX A;  1EZV D;  1HBW A;  2KSJ A;  3H1L J;  1SFC D;  5H2F H;  3RK3 E;  2WVR A;  5CBO A;  3A5T A;  2WPS A;  1QLE D;  1LGH B;  3MIW A;  2R3S A;  3L72 J;  3GMA A;  1BCC G;  4U3F D;  1HUC A;  1LT9 A;  2QJK B;  4DCK A;  3PJS K;  5CCG C;  2K9J A;  2OTJ P;  1AQT A;  2E5Y A;  4NPE A;  1RQV A;  3V5B A;  3Q3D A;  5KAF H;  2IZ0 A;  1KMI Z;  1L4A A;  1SQB E;  3BAS A;  2CK3 H;  1YI2 P;  2PRR A;  1NH4 A;  3AE4 C;  3BCC G;  2BEQ D;  2AXT E;  3M0D C;  2QEX P;  1YBK A;  1BCC E;  2KS1 A;  2J58 A;  1QL1 A;  2M0B A;  2NRG A;  2ZYG A;  4KHX A;  3V4Q A;  4NPD A;  2JEE A;  2GM4 A;  1OZH A;  1RE4 A;  3SSU A;  2I8D A;  3H25 A;  2AXT H;  2O01 J;  3Q2Y A;  1JOC A;  1U57 A;  2MKV A;  2Z4E A;  1Q2N A;  2W83 C;  4Y99 B;  1GD2 E;  1BGY G;  3HUS A;  3RL0 B;  1FE6 A;  1LT1 A;  3H1K D;  2WPQ A;  1P84 E;  2OTL P;  2P7J A;  1JB0 J;  2M5A B;  1N8R Q;  1X8Y A;  1LTB C;  2N1T A;  1K73 Q;  1PZQ A;  2O1J A;  4L76 A;  1P84 H;  1AV1 A;  3RK3 D;  2FYU J;  3CME P;  3RK2 C;  3VOP A;  3CCS P;  2Z5H A;  3D70 A;  1DD3 A;  1JMM A;  3AE9 C;  2V4H A;  2V7Q J;  1PP9 G;  2E76 D;  4IL6 H;  1VQO P;  1LT9 C;  3IAO A;  1ZOY C;  5AW8 B;  5BU5 A;  3WUU A;  3CCM P;  1UIX A;  2QM7 A;  3CWB G;  2QRX A;  1S5L X;  1R5L A;  1JM0 A;  5TIS E;  1N73 A;  2A45 G;  1OWA A;  1LTJ A;  4C46 A;  1NTM E;  1PGO A;  1XTG B;  1VQ9 P;  1ZME C;  4HJG H;  1FS0 E;  1ZRT E;  2NZ2 A;  2P1J A;  5KLV G;  5TIS H;  1P84 I;  1HJB A;  1CI6 B;  2LXB A;  2QG4 A;  4PV1 C;  2BCC J;  3L37 A;  1BCC D;  2KLV A;  1PP9 E;  3U1A A;  1YTZ I;  3H1I G;  1N7S A;  4YXW H;  1VDF A;  1M1J B;  2N9B A;  5B5E H;  2XV5 A;  3V2P A;  1JY2 O;  1J1D C;  3CMA P;  1VQK P;  2QE7 H;  2YMK A;  1NVO A;  3HUS C;  1G2C B;  5AVQ B;  4WY4 A;  5KLV E;  5AVY B;  1ZR2 A;  2A45 H;  3TGU G;  2HR3 A;  2YKO A;  3VP9 A;  4L74 A;  3WU2 H;  2BEZ F;  4WVZ A;  3B5N B;  1NU1 G;  1Q90 D;  2WT7 A;  4JF7 A;  2NPS D;  1ZLL A;  3L73 J;  1LWU A;  1SQQ J;  2UWJ E;  1HWT C;  4EYY Q;  3L35 A;  2A06 G;  3TNU A;  5CJ4 A;  5CCH C;  2FYZ A;  1SFC B;  1M8O B;  2FBW C;  2QM8 A;  1JCD A;  2OYH A;  2A45 I;  3HTK A;  4HYT B;  4B86 A;  2PP6 A;  3H1L G;  1NTM D;  3V6I A;  1WMK A;  3S1K A;  3L72 G;  1DD4 A;  1GW3 A;  3QH9 A;  4DOJ A;  1ZRT D;  1DX7 A;  5AW2 B;  3H1H G;  4R4L A;  3M91 A;  1AVO A;  1JY2 N;  3HE4 A;  3HRN A;  3UIA A;  4OVN F;  3KZI E;  2ZT9 C;  4NPF X;  1K05 A;  1RF1 C;  3V2N A;  3I55 P;  1USE A;  1OX3 A;  2Q5U A;  2GUS A;  1KTM A;  1KIL E;  3H1L E;  2BAS A;  4HH2 A;  5AW7 B;  4KJM A;  3KZI H;  5KLV K;  3WUV A;  3L72 E;  1KFM A;  1FDO A;  2ZVO B;  1K8A Q;  4DT0 A;  4H0L D;  4WY4 C;  2QA4 P;  1OMI A;  3H1H E;  4HB1 A;  1HH0 A;  1VQ4 P;  3NTN A;  2OGU A;  2Q3E A;  1KN7 A;  2HYN A;  1KB9 D;  1IC2 A;  3L75 J;  2HG5 D;  2WMM A;  2KNC A;  5AVT B;  3M06 A;  3D71 A;  4H44 D;  3TF5 A;  4H13 C;  1EZV G;  1LWU C;  1L4A D;  3AEG C;  5L8R J;  4BXL A;  4Y28 J;  1GL2 A;  4R4M A;  2FFD B;  2WSC J;  3L70 J;  3RK3 B;  4UB6 H;  3RL0 g;  3ZDM A;  4ASW A;  3II6 A;  2W8Z A;  1BDD A;  2E76 B;  2JWD A;  4PV1 D;  2OYI B;  1IZN B;  5E79 E;  1NU1 K;  2AXC A;  1NOH A;  4C7N B;  1D7M A;  1SQV J;  3W67 A;  2FYN C;  1EZV E;  1KQG B;  2KLU A;  3ABV C;  2O01 N;  1L0N J;  3OA7 A;  1AVY A;  5CCG A;  3HD7 A;  2B9B A;  2IZ1 A;  3G3Z A;  3Q5P A;  2N1T D;  3H1L D;  3VTP C;  2FYU E;  1X0T A;  1KZU B;  1OW6 A;  1IFI A;  5C39 A;  1MZ9 A;  1NTZ D;  1U7J A;  3OAK A;  3H1K G;  1YIJ P;  2KP8 A;  3GW6 A;  4BRY B;  1L0L K;  3Q1M A;  3H32 B;  3VN0 A;  2AEM A;  1VQ6 P;  2YO3 A;  1JUN A;  1J2J B;  3F5H A;  3GHG B;  3EFF K;  1KOR A;  1FZG A;  1SQX J;  1EZV I;  1VF5 C;  2E75 D;  2VRS A;  3TSI A;  5AW3 B;  5APU A;  2BCC E;  1ZV8 A;  2NPS B;  3Q5R A;  3CCJ P;  2Y9Y A;  4PD4 E;  1RY3 A;  1NGM B;  2P10 A;  3CPW O;  2WSF J;  3P8C D;  1QX8 A;  1N7S D;  2QJY B;  1MFZ A;  3I56 P;  1IFN A;  4XE5 B;  1CSB A;  1G1J A;  4LGD E;  4AYC A;  2HFE D;  2WQY C;  3B4S A;  3MUD C;  3JCU H;  3B71 A;  1LP1 A;  1VL2 A;  2LKM A;  2O1K A;  3JC2 2;  3VYI A;  1H0T A;  3LW5 J;  5AVU B;  3AE2 C;  1GU5 A;  2YIU C;  2P58 A;  1NTZ J;  4OH8 B;  3HD7 C;  1BSH A;  4AQR D;  2E74 D;  1J1E B;  1T8Z A;  3JSV C;  3CCE P;  3H1J J;  1FAV A;  4QMA A;  4RO0 A;  5KLI C;  2FYU D;  3MD0 A;  2POH A;  2IYP A;  3L73 E;  1SQQ E;  1RF0 A;  1CZQ A;  4L73 A;  2YKP A;  2B89 A;  3L71 J;  1S5L E;  1SQP J;  3KDP B;  2WTY A;  4W7Y A;  4ZNC A;  1JY3 O;  2W6J H;  1IO4 A;  1GK6 A;  5APS A;  1URQ C;  1NTK J;  1EDK A;  3Q5S A;  1OVV A;  4H0L B;  1RE3 C;  3O6Q A;  1MUU A;  1XTC C;  2YNY A;  3WUT A;  1T2K D;  1KV4 A;  2K9Y A;  1VQM P;  3PLN A;  2D2C D;  3F89 A;  1YHQ P;  3P7K A;  2K9J B;  4H44 B;  2BCC D;  1SS1 A;  4RKU J;  3PTZ A;  3IN6 A;  3P32 A;  4GKG A;  4PD4 D;  1L4A B;  5KJ7 C;  2RN0 A;  3AE7 C;  3FWL A;  1YJ9 P;  2QJK C;  1Z56 A;  3AE5 C;  1RHZ B;  1NTM G;  2R3C A;  3CC4 P;  1HTL C;  1AFO A;  1FZE A;  2JKV A;  3L70 G;  2G8Y A;  1BDC A;  3QWO C;  1HJ0 A;  2ZXX A;  3E1I A;  4GOE A;  3CC7 P;  2JJL A;  1CI6 A;  5CCH A;  3L75 E;  1Y9B A;  5AVZ B;  4Z1M H;  1JTH A;  3A2A A;  5AW9 B;  1SQB K;  3G71 P;  3O8Z A;  5APY A;  3AE1 C;  2IBZ E;  3L73 D;  1SQQ D;  3AEE C;  1JY3 N;  1RF0 C;  4D6T J;  1KQL A;  2SPZ A;  1JY2 P;  1KIL B;  4M3L A;  5TJH A;  1JEK A;  2N1T B;  1L0N G;  3OJA B;  3L70 E;  1HGV A;  1RQU A;  2XZR A;  4Y99 C;  1IFJ A;  2H88 C;  3AED C;  1FOS E;  1GL2 D;  3RL0 C;  1IFD A;  2ZFC A;  5APX A;  4OGQ D;  1RF1 A;  1VQL P;  1LNQ A;  4DZO A;  1R8E A;  1SQV E;  1BE3 J;  2RKL A;  2ZAE B;  2OTK E;  3P8M C;  2Y9Z A;  1N73 B;  1FZC B;  5AW1 B;  1LTJ B;  2E75 B;  1L0N E;  4I6M C;  1FJP A;  2KIK A;  1S4X A;  2YO2 A;  1CW5 A;  1NHL A;  3CCV P;  2IBZ I;  4IL6 X;  3CL3 D;  1KB9 E;  5CCG D;  2HPC A;  3HD7 D;  4HKZ H;  4LLH A;  1OXZ A;  5KKZ B;  1U7M A;  2OQQ A;  2H89 C;  4GT1 A;  5EFW B;  1N7S B;  1KFN A;  1KD1 Q;  1S72 P;  3AE6 C;  3GF3 A;  4IFD K;  1KB9 H;  1ZW0 A;  3IFM A;  1VQ8 P;  3L75 D;  1EXI A;  1LTI C;  2B87 A;  1HVV A;  1NTM K;  1M1J C;  1DEB A;  2IBZ D;  4TT3 H;  1DEE G;  1SQX E;  1NJI Q;  3M9B A;  1NAF A;  2E74 B;  1PGP A;  1N2D C;  4GOD A;  4U7J A;  3N4X A;  3L70 D;  4DJG A;  3M9Q A;  3KQG A;  3VP8 A;  1NTZ G;  1QL2 A;  5AVX B;  1KB9 I;  2C9N Y;  2Y0D A;  3CXH D;  2HOD A;  1SQV D;  1OVR A;  3NXS A;  5KAI E;  2YXR B;  3B5N C;  1SLQ A;  2WZ7 A;  2FY8 A;  1SQP G;  3N7N A;  1PPJ D;  2RMZ A;  3MHV A;  1DH3 A;  1K04 A;  3T97 A;  2OYH B;  3BCC J;  4EOT A;  4K3A A;  3HTK B;  2QVA A;  1L0N D;  2IDB A;  5KAI H;  2JR8 A;  3RK2 D;  1VQ5 P;  2FFD A;  3CC2 P;  1NTZ E;  1NAY A;  1SFC C;  3PP5 A;  3U59 A;  5APW A;  3H1J E;  1GK4 A;  2PGD A;  3MP7 B;  2K3R A;  1IJD B;  3IR9 A;  2OYI A;  3HE4 B;  1Q82 Q;  3IF4 A;  3PHL A;  1KYO D;  3GG2 A;  1FOS F;  3RGU A;  3L71 E;  1SQP E;  3E7K A;  1BGY J;  1SP4 A;  1FDI A;  4C7R A;  5APV A;  1NTK E;  2YKQ A;  1PL5 A;  3TYY A;  1VQ7 P;  2QJP B;  1ZP0 C;  2LR2 A;  1AA0 A;  1SQX D;  3P8C E;  2FYU G;  1YIT P;  1N7L A;  2FXP A;  3MUD A;  2KNC B;  4I7Z B;  1G1I A;  2PFX A;  3A0H E;  5B66 E;  1LTS C;  3CWB J;  2RH0 A;  1GTW A;  2O01 H;  4ZKP A;  1OFC X;  5E79 H;  1T3U A;  2I1K A;  4UB8 E;  2XU6 A;  1DIP A;  2JP3 A;  4BRY A;  1OVU A;  1GL2 B;  3CCL P;  3H32 A;  4AUW A;  3D6Y A;  1JO5 A;  2LXC B;  2IPP A;  5B66 H;  1X79 B;  2ZVN B;  1M57 D;  5APT A;  4OGQ B;  3V2R A;  4UB8 H;  2BCC G;  1AQ5 A;  1HF9 A;  3SWF A;  2FFD C;  3CX5 E;  3C1L A;  3H1I J;  4K35 A;  3RK3 C;  1OW8 A;  1S3J A;  3H1J D;  1URQ A;  5CCH D;  2E76 C;  2OYI C;  1RE3 A;  2V7Q H;  3MTU E;  4N3Y B;  1EQ7 A;  4D6T E;  3HE5 B;  3CCQ P;  1QGK B;  3L71 D;  1SQP D;  2Y0E A;  1L0L D;  3PRJ A;  1NTK D;  1NWQ A;  1ZR4 A;  1A02 F;  3TGU J;  1WT6 A;  4EDF A;  2JO1 A;  5KJ7 A;  2K37 A;  2GA1 A;  1PGJ A;  2J59 M;  2G3A A;  1BE3 E;  1NU1 J;  2ZT9 D;  1A02 J;  3BRT B;  3L73 G;  3D6Z A;  2W27 A;  1SQQ G;  2E43 A;  1BSN A;  2L91 A;  4PD4 H;  1ZXG A;  4WB4 A;  4N6J A;  3KXD A;  2N9Y B;  1T3J A;  3L74 D;  4I1L A;  1MV8 A;  1M90 Q;  1R5S A;  2ZJS E;  1H8A A;  4WY4 D;  2Q1K A;  2H43 A;  3CI9 A;  4EI2 A;  1FZA A;  1JY3 P;  1M1K Q;  2FYU K;  1SVF A;  2HLO A;  3AE8 C;  2ZYA A;  5KAF E;  5GTI E;  3V2Q A;  2Z5I A;  1IK9 A;  3GHG C;  3H6P A;  3H1H J;  2CPS A;  3CLQ A;  3FGA D;  2ZYD A;  1S9K D;  4H13 D;  4PD4 I;  3CX5 D;  2NPS C;  1L0L J;  5GTI H;  3SFE C;  3AEA C;  1EDL A;  1FDM A;  3GLM A;  3A3Y B;  1LP1 B;  5CMZ A;  3RK2 B;  1Y8A A;  2M5A A;  1W5C E;  2QJY C;  3EFG A;  1S5L H;  4D6T D;  1GU4 A;  1H0T B;  2FKW B;  3NFQ A;  2WPR A;  1LT9 B;  1FC2 C;  4O9B A;  1LJ2 A;  2M3B A;  1FBM A;  1X22 A;  3L4F A;  4JPZ B;  1YQ4 C;  3AEB C;  5AW4 B;  3U1C A;  4RJT A;  3L75 G;  3SWY A;  1EXJ A;  1MFT A;  2WSE J;  1PFI A;  3L74 J;  5AW6 B;  1BE3 D;  1J1E C;  4W80 A;  2AEJ A;  2IBZ G;  2GUV A;  5BU8 B;  3M0A A;  4PV1 B;  2KS1 B;  1YJN P;  3BCC E;  2XKM A;  2ZXE B;  3O6Q B;  3G9R A;  4U3F J;  4LC1 A;  2JWA A;  1KIL A;  1J1D B;  3L36 A;  4IL6 E;  2J5U A;  3KHU A;  2CPB A;  1KQS O;  4H0L C;  1SQV G;  2P2U A;  2KI7 B;  3HUS B;  1M1J A;  1SQQ K;  2O3J A;  1PIX A;  2XND H;  1PPJ G;  4GOF A;  1NKN A;  3SWK A;  1BGY E;  4EIJ A;  1VF5 D;  4H44 C;  1FZC A;  4ASV A;  2Y0C A;  1OIP A;  2FXO A;  1G2C A;  1L4A C;  1SQB D;  3R4Y A;  5AW0 B;  4JYC A;  4WBA A;  2IFN A;  3ITK A;  2I1J A;  5DJT B;  5B5E E;  2WSC H;  3CXH E;  1LTA C;  1ZN5 A;  1S2E A;  3B5N A;  2FXM A;  2KZJ A;  4JQ0 D;  5M1B A;  2QSI A;  1JTH B;  1PPJ E;  1VQP P;  1AJY A;  2WSS H;  2H7H A;  3CWB E;  3H1K J;  2XNX A;  3CXH H;  2ITA A;  2R32 A;  3LIE A;  1RE4 C;  3FXE A;  3AEF C;  1JCC A;  1SFC A;  4XFJ A;  3SFD C;  1JMB A;  1USD A;  3WU2 E;  1VPC A;  1SQX G;  2M3E A;  1IK7 A;  2P67 A;  1Q81 Q;  2Q3I A;  2W90 A;  4L75 A;  1EDI A;  1EDJ A;  3BCC D;  1P84 D;  1LTT C;  3CCR P;  1QEX A;  1HGZ A;  1KYO E;  1PV3 A;  5AW5 B;  2ZT9 B;  3FX0 A;  4W7Z A;  1RF1 B;  1QVF O;  1KIL C;  2N1T C;  3H1I E;  4ZKU A;  1W2E A;  3LID A;  3USS A;  2MJZ A;  2OYO A;  3CXH I;  4I2L C;  1KYO H;  1URQ D;  1SQB J;  2W6A A;  2YXQ B;  4RES B;  3W68 A;  4WY4 B;  2M8R A;  1BGY D;  3G4S P;  2KZI A;  4A7P A;  1FZB A;  5KTB A;  1N73 C;  1FZC C;  3I5C A;  3C9I A;  2HPC B;  3TGU E;  2K1A A;  1BCC J;  3PH0 A;  1GDT A;  1Y47 A;  3VMX A;  1H89 A;  1LTJ C;  4MN4 C;  2E75 C;  3H1J G;  4GIF A;  2WT7 B;  2IYO A;  4H13 B;  5K5G B;  1LWU B;  5KJ7 D;  1KC8 Q;  5DJU B;  2PAJ A;  1SQV K;  1NU1 E;  1L2P A;  1RH5 B;  1UII A;  5AVW B;  3TNU B;  2KOG A;  2IFM A;  4KT0 J;  3S4R A;  1KYO I;  2B87 B;  2WIT A;  4YTP C;  1PP9 D;  2YMY A;  3L71 G;  5KKZ C;  3A0B E;  2A06 E;  1VQN P;  3BRV B;  2WSF H;  2R5D A;  1N7S C;  3K5B A;  1L0L G;  3CWB D;  1M7L A;  1NTK G;  1L0N K;  1GW4 A;  2D2C B;  1FJK A;  3FWN A;  1T6A A;  1FU1 A;  3EQ2 A;  3A0B H;  2FYN B;  4WWI A;  3GF7 A;  3C8V A;  1NO4 A;  2B88 A;  2KSE A;  1NYH A;  3FXD A;  4GDO A;  2WPV B;  3LW5 H;  1EC5 A;  4JYB A;  5KLV D;  2WWW A;  3WMM 0;  3R2P A;  2Q7C A;  5BVZ A;  2E74 C;  5APQ A;  3KPE A;  4C7N A;  2HOD B;  3H1I D;  3L74 G;  1E5W A;  1L0L E;  1YYC A;  2R5B A;  4UB6 E;  5CJ0 A;  2Q9I A;  3T97 B;  3E1R A;  3AE3 C;  1NTM J;  1SQX K;  2KYV A;  3RL0 D; 
#chains in the Genus database with same CATH homology
 2YIU C;  4I7Z C;  1EXJ A;  1OW7 A;  2G8Y A;  1OW6 A;  2E75 C;  3AE4 C;  2E74 D;  1K04 A;  2WSE J;  1DIP A;  5M1B A;  1S1C X;  2JP3 A;  2BEQ D;  4IL6 X;  1HJ0 A;  4H13 B;  2QSI A;  5KLI C;  3D71 A;  1AJY A;  4H44 D;  3D6Y A;  2IDB A;  1ZME C;  4H13 C;  2FBW C;  3Q1M A;  2OQQ A;  2H89 C;  4KT0 J;  2NZ2 A;  1ZRT E;  3AEG C;  4PV1 B;  1Y9B A;  2D2C C;  4OGQ B;  5L8R J;  4YTP C;  4Z1M H;  1GMJ A;  4Y28 J;  5KKZ C;  4R4M A;  2WSC J;  3AEF C;  4XFJ A;  1VF5 B;  3G9R A;  3AE6 C;  3SFD C;  3GF3 A;  1WMK A;  4PV1 C;  3RL0 g;  2O01 J;  3H25 A;  1HF9 A;  4OGQ C;  3Q2Y A;  3AE1 C;  3EWK A;  3S9O A;  1IK7 A;  1KOR A;  1U57 A;  3AEE C;  2MKV A;  1DD4 A;  1VF5 C;  3AE8 C;  2E75 D;  1EXI A;  2J5U A;  3Q5S A;  1OW8 A;  2D2C B;  2E76 B;  4PV1 D;  4H0L B;  2QIW A;  4R4L A;  3O6Q A;  1MKM A;  1PV3 A;  3FGA D;  3GF7 A;  1FDI A;  2E76 C;  2ZT9 B;  3C8V A;  4H0L C;  1RQU A;  4TT3 H;  4H13 D;  2H88 C;  1TU3 F;  3Q5R A;  3AED C;  1NYH A;  1JB0 J;  2K9Y A;  1NGM B;  1PL5 A;  2FYN C;  2P10 A;  3RK3 E;  4GDO A;  2E74 B;  1PIX A;  2D2C D;  2WPV B;  2ZT9 C;  1K05 A;  2WSF J;  2YMK A;  1ZP0 C;  3SFE C;  4U7J A;  1YQ3 C;  1KQG B;  4H44 B;  3GMA A;  2E74 C;  3AEA C;  3GLM A;  4OGQ D;  3ABV C;  4RKU J;  2QJP C;  3IN6 A;  1KTM A;  1KIL E;  1R8E A;  1VF5 D;  4H44 C;  3AE7 C;  2QJY C;  2WQY C;  2QJK C;  2JO1 A;  2BEZ F;  3D70 A;  1DD3 A;  2FXP A;  3AE9 C;  3R4Y A;  4YXD C;  1FDO A;  3AE5 C;  2V7Q J;  2E76 D;  3B71 A;  1RQV A;  3Q3D A;  4H0L D;  3T97 B;  3IAO A;  1VL2 A;  1OMI A;  1KMI Z;  2G3A A;  4I7Z B;  3Q5P A;  1ZOY C;  3AE3 C;  1KQF B;  1Q90 D;  1YQ4 C;  3LW5 J;  1UIX A;  2E75 B;  3AEB C;  3AE2 C;  3AEC C;  2ZT9 D;  1S5L X;  3D6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...