4R4LA

Crystal structure of wt cgmp dependent protein kinase i alpha (pkgi alpha) leucine zipper
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
47
structure length
47
Chain Sequence
SELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords cGMP-dependent protein kinase 1
publication title Structures of cGMP-Dependent Protein Kinase (PKG) I alpha Leucine Zippers Reveal an Interchain Disulfide Bond Important for Dimer Stability.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 47
sequence length 47
chains with identical sequence B, C
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16808 PKcGMP_CC Coiled-coil N-terminus of cGMP-dependent protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4r4lA00
3Q2YA 3Q5RA 1R8EA 3IAOA 3D6ZA 1EXIA 3Q1MA 2J5UA 3D70A 3Q3DA 3D6YA 1DIPA 3T97B 4R4LA 3D71A 3Q5PA 1EXJA 2OQQA 3G9RA 4R4MA 3Q5SA
chains in the Genus database with same CATH superfamily
3CCVP 1RF1B 2KSEA 1T2KC 2ZT9C 3OJAB 2FFDC 1EZVI 2M3BA 2P1JA 1YIJP 2FBWC 4I1LA 2JO1A 3FGAD 3HTKA 1J1DC 1H0TB 3TDKA 1LT9B 1ZXGA 2IPPA 1PZQA 2O01J 4I6MC 4Y99C 1PP9D 3UIAA 1K04A 3VN0A 4AYCA 3CCUP 1PV3A 2KSJA 1SQVE 3B5NB 4IOIH 2OARA 2GM4A 5EFWB 4PJ0E 2QJPB 1QX8A 1SQVD 2YNYA 5AVRB 1KQFB 5GTHE 4U3FD 2KZJA 3U1CA 4DJGA 2FYZA 3AE3C 3BATA 2E5YA 1PGPA 3L71E 4GIFA 2W6JH 3AEBC 1M8OB 3L71D 5GTHH 5CCHD 1BDCA 3AE9C 3SFDC 4EI2A 3V2PA 3L75E 5CCHA 1S1CX 1NTKJ 1H0TA 2FXMA 5AVZB 1RE4A 1SS1A 1HBWA 3CPWO 2K9YA 3TGUE 1KORA 1NKZB 2ZVOB 3CCRP 3G4SP 5KLIC 3B5NA 4K35A 2CK3H 3MZWB 1NHLA 2OGUA 1IK9A 2CPSA 4L75A 2OYHC 1J1EB 4Z1MH 1EDJA 4L74A 2FXOA 2IBZI 3FX0A 3W67A 1WRGA 1N7SC 4ASVA 1LNQA 1JNMA 2N9BA 1SQQE 2HFED 4JYCA 1NU1J 4WBAA 1W2BO 2QJKB 4WY4D 3A0BE 1SQQD 2FYUK 2RKLA 3BASA 3RL0D 1SQBE 2VRSA 1N73A 3VYIA 2IBZG 4GOEA 4GT1A 3JSVC 1SQPK 4WY4A 4L73A 3GMAA 2BCCG 1E79H 3VTPC 5KLVE 3A0BH 2AEMA 3CC4P 2R3CA 2LXCB 5KLVD 2OQQA 1G1IA 2WT7B 1MKMA 5CCGC 2H89C 4RJTA 4I2LC 3O8ZA 1PPJD 3AEFC 1Q82Q 4BWNA 4UB6E 2A45H 2MKVA 1IK7A 2KOGA 4IL6H 1N2DC 2H88C 3L73E 1G1JA 3AE2C 5AVYB 2WSCH 1SFCD 1RH5B 2GUSA 1IFIA 4UB6H 2WQYC 3SFEC 3SWKA 1JOCA 1YI2P 1IO4A 2O1JA 3WU2E 4JQ0D 2LKMA 3AE6C 1NTKD 2PP6A 3Q1MA 2YMKA 3HUSA 1SFCC 1GW4A 1AQ5A 5CMZA 3NTNA 1L0NJ 2XZRA 3BRVB 3WU2H 3CC7P 2M8RA 2W90A 3IF4A 1CI6B 2Y0CA 1LWUC 1BCCG 1TU3F 3C8VA 2KNCB 1L4AB 3FXDA 4IFFA 5AW9B 1GZLA 2AXTE 3BCCG 4IL6X 1NAFA 5AW7B 2JR8A 1KC8Q 2XNXA 4D6TG 1M1JB 1IFNA 4A7PA 1BGYG 4LLHA 3O6QB 1NU1D 4RKUJ 1PGJA 3H32B 1OW8A 5KKZC 1LTBC 3L36A 1EXIA 1VL2A 3P7KA 4WB4A 3D6YA 1M56D 3A3YB 5APTA 1IFMA 1NTKK 2FYUG 3GHGA 1J2JB 4R4MA 1OVUA 1ZRTE 1YJWP 3BVHA 3KQGA 4HH2A 1BSHA 1ZRTD 2HLOA 3L74G 1CI6A 3A2AA 4NPFX 2KNCA 2PGDA 1L4AA 1KV4A 2KIKA 1LTTC 4M3LA 3CCSP 1HJBA 1KYOE 1RE3C 1M1JA 5CJ4A 2BCCJ 3PJSK 3VOPA 1KYOD 4OGQD 3CX5E 3H32A 5GTIH 3AE8C 1EQ7A 1KMIZ 1GMJA 3I55P 1DD4A 3PLNA 1EZVE 2YIUB 3H1LE 1BE3J 2N1TC 5AVSB 3TNUB 4L76A 1EZVD 2E76B 3CX5H 5APUA 3LW5J 3H1JJ 3M06A 4TT3H 4I7ZB 2YO3A 4YTPC 5APQA 1PFIA 1IFDA 3S4RA 1FZEA 1T3JA 3P8CE 2WSEH 4H44C 1K05A 3P8CD 1S2EA 2M5AB 3KYQA 5BU5A 1XTGB 1VF5B 4AUWA 2BASA 2K9JB 1JY2O 2BEQD 1VQLP 1P84E 3VMYA 2E76D 2AEFA 3RK3B 3B4SA 1P84D 1DH3A 3TNUA 1EDLA 1SQXE 5BVZA 1FZFA 3AEDC 2SPZA 1LGHB 3CCEP 1FJPA 2YKOA 4JPZB 1M57D 2L91A 2W6BA 5AVXB 1BCCJ 2W6AA 1KB9H 1KTMA 3PRJA 1KZUB 1PIXA 3A5TA 3BCCJ 2IFNA 1L0NK 4D6TJ 4H0LC 1VF5D 1DD3A 1BGYJ 1MV8A 2QSIA 3H1IE 1MFTA 1KFNA 1DEEG 4U7JA 3CWBG 5AW1B 3E1IA 1H88A 2K9JA 2IBZD 1ZMEC 1U57A 4GODA 2KS1B 3F5HA 3PH0A 2JWDA 1FS0E 1GL2C 3H25A 2Q1KA 3OA7A 5KAIH 2Y9ZA 3D70A 2FFDB 1X0TA 1X22A 3L74J 3GLMA 3V6IA 2B89A 2Z5HA 1NTME 1QGKB 1J1DB 2KYVA 4H13C 2WMMA 2E74C 1NTZG 3MGNA 4Y99B 3M0DC 2H43A 3NXSA 1SLQA 1OVVA 4JBZA 2R5DA 1FDMA 1JM0A 5TJHA 2PFXA 3FXEA 2KP8A 4ZKUA 4WWIA 2ZFCA 4TLFA 2R3SA 1KILE 2H8PD 1U7JA 3AE4C 2E75B 3CXHI 1FZCA 1KILD 1N86A 3CMEP 1FDOA 1JY3O 3IN6A 1KILA 3W68A 2FFDA 2A06E 2QVAA 2QJYB 2Y9YA 2A06D 1OFCX 1BSNA 2V4HA 2XNDH 1PP9E 1S3JA 1L0LG 1DX7A 1QVFO 3RK2B 4Y28J 5APXA 1G2CB 2OYIC 1LTJB 2ITAA 3H1HE 2HG5D 1VQ9P 3H1KJ 4KHXA 3A7OA 3BCCD 4U3FE 3H1HD 3FWLA 1FAVA 4D6TD 2E75D 2OYHB 2XV5A 3L72G 1L0NG 1RY3A 1RF1A 4W80A 3V2QA 4PJ0H 2NZ2A 1N7SB 2FYUE 1JEKA 5CBOA 2L5GB 3EFFK 2Z5IA 5B66E 1PL5A 2FYUD 1SQPE 4PD4E 1SQPD 1LT9A 1IFPA 4PD4D 2NPSB 4DCKA 3A0HE 3B5ND 5B66H 1RQUA 1LP1B 5KAFE 1KB9I 1YHQP 5CCHC 4OWFA 1LTJA 1AVOA 1NJIQ 2J5UA 1RE4C 3FWNA 2B87B 1YITP 3QWOC 2Y0DA 3CWBJ 3L70G 3C9IA 3GF3A 1FZBA 1S5LE 1GU4A 1OWAA 1ZV8A 2QE7H 1JUNA 4GDOA 1KQGB 1H8AA 2J58A 1YQ4C 3KDPB 4BRYB 2PRRA 3MUDA 3B71A 2ZJSE 1N7SA 1IJDB 3GF7A 3CCJP 1EDKA 2K37A 1M7LA 1Y47A 1QVGO 3KHUA 2O01N 5K5GB 3MD0A 4OH8B 3I56P 2WPSA 2W27A 1NTZJ 2NPSA 2HYNA 3SSUA 3LIDA 1N73C 1T3UA 1LP1A 3N7NA 3D71A 4WY4C 1NWQA 3RL0C 2B87A 5APVA 3ITKA 1AQTA 2E42A 1BE3G 1KFMA 3Q2YA 1LT1A 3VMAA 1T6AA 1PPJE 1URQB 3H6PA 3H1JG 1FU1A 3T97B 1LWUB 1CZQA 2P2UA 4EYYQ 2R44A 4BXLA 2E5TA 2I1JA 3PP5A 4PV1B 5M1BA 1L0LJ 3V2NA 3AEEC 3M0AA 2QJKC 1VQOP 3HD7B 2WSFH 1NTKE 5KKZB 3VP9A 2IFMA 2WT7A 1YYCA 2OTKE 1URQD 1SQBK 4K3AA 1DIPA 1NO4A 3H1LJ 2ZYGA 2HODB 1URQA 3M9HA 3L72J 3HUSC 2JEEA 4HB1A 2WSEJ 3TSIA 2KUBA 3D6ZA 1HF9A 5AW0B 1YTZI 3PTZA 4C7NB 2FY8A 1KD1Q 2D2CB 1EDIA 1NU1E 5KJ7D 1DEBA 2ZYAA 3HD7D 1IC2A 3SWYA 1OW6A 3M91A 2KZIA 2AXTH 5KJ7A 1NGMB 1SQVG 3HD7A 5AW6B 4N3YB 2KB7P 1HGZA 3L70J 2Q3IA 2M3EA 2UWJE 2Q7CA 4LGDE 3EFGA 2N1TB 1JY3P 3Q5RA 5C39A 1VQPP 2YKPA 1SQXJ 3GHGC 2KLUA 2WVRA 1L4AD 3L71G 2P58A 2O3JA 2Y0EA 1FC2C 2N9YB 1HTLC 2JKVA 3L75G 4C7NA 4QMAA 3JCUE 4H44B 3QH9A 3VP8A 2DW3A 1X9VA 3TGUG 3O6QA 1RHZB 1M1JC 3CXHD 1L0LD 1KYOH 3RGUA 1GDTA 3S9OA 1X79B 1NTZK 1Q2NA 1USEA 1AFOA 4OGQC 1FBMA 1VQ4P 5KTBA 3E1RA 2I8DA 2IYOA 1OW7A 3Q5SA 1SQQG 1Y9BA 3KXDA 1U7MA 1L0NE 1SQBG 3TK1A 1L0ND 2WPQA 1NTMJ 1OIPA 3K5BA 2WITA 2A45I 5CHXA 1VDFA 1HWTC 2ZXXA 4H0LB 5KLVG 3H1KG 1VQ6P 1S4XA 2KXPB 1JCDA 3EQ2A 1R5LA 2G3AA 3IFMA 1QL1A 1L0LK 2A45G 1JB0J 1YJNP 2KLVA 1OX3A 4RESB 2LXBA 3EWKA 2YMYA 1ZR2A 2YIUC 1T8ZA 1GL2B 1P84H 2QIWA 4YXWH 4C46A 2G8YA 2E76C 1Q90D 2QEXP 4KJMA 5AW2B 4I7ZC 3NFQA 3L73G 4H13B 4XA4A 2E74B 2B88A 5TISE 2M5AA 3RK3E 2RH0A 1NYHA 1W2EA 2IBZE 1SQVJ 3RK3D 2AXCA 2BCCE 2YXRB 2IZ0A 2Q6QA 2BCCD 1VF5C 3CL3D 1LJ2A 3MIWA 2ZT9B 1MZ9A 1JTHB 1H89A 1BE3E 2IYPA 3L71J 5APSA 1K73Q 1VQ8P 1BE3D 1VQMP 1KQSO 2WTYA 1ZN5A 3H1JD 3L75J 1AVYA 1SQXK 1USDA 1FE6A 2O1KA 2IDBA 4JF7A 2OYIB 1VQNP 1N7LA 2GA1A 3TGUJ 1NAYA 1RF0A 3CLQA 3OAKA 2H7HA 3M9BA 3HRNA 1WT6A 1T2KD 2KS1A 2ZT9D 2I1KA 2FYNC 4GKGA 2XKMA 1JTHA 1KYOI 5APWA 1FZCC 4W7YA 1SQQJ 3RBXA 2J59M 3CX5I 4ASWA 3P32A 2ZAEB 1KILC 1SQBJ 1NKNA 1BCCE 1GK6A 1HVVA 4GOFA 1WMKA 1FZGA 1BCCD 3BCCE 3F89A 4EIJA 1FZAA 2OYIA 1KQLA 5KLVJ 4D6TE 5KLIB 1UIIA 2QM7A 1GW3A 3V2RA 2P7JA 1BGYE 1EZVG 1NTMK 4EDFA 3H1LG 2JDIH 1OMIA 1BGYD 2B9BA 3II6A 1NOHA 2BEZF 1PGOA 5E79E 4AQRD 2WSCJ 1YBKA 3G71P 4O9BA 3VMZA 5L8RJ 1KN7A 1MUUA 3L4FA 1RF1C 2E75C 4HJGH 2MJZA 2Q9IA 3RK2D 2WSFJ 5E79H 3L74E 1OXZA 1P84I 3L73J 1W5CE 2QJYC 1ZR4A 3L74D 1G2CA 3R2PA 2P67A 1PGQA 1N73B 2R32A 1Q7YQ 4PD4H 1LT9C 1SVFA 3ABVC 4WY4B 4DOJA 1CW5A 2V7QH 4EOTA 2IZ1A 3RL0B 3RK2C 3L75D 3A0HH 1LTJC 3L37A 5KAFH 1UIXA 3WUUA 3B5NC 2IX7C 1N7SD 2OYHA 2C9LY 1SQXG 3TGUD 2QJPC 5AW4B 4NPDA 1SQVK 1S5LH 4NPEA 4R4LA 2KI7B 4IFDK 1JMMA 3MUDC 1MFZA 2NPSD 2YKQA 1HH0A 1E5WA 3M9QA 1VPCA 3I5CA 1JO5A 1JY2P 1LTAC 1EXJA 4W7ZA 3H1IG 1ZW0A 3OW2O 1S72P 5CCGD 3Q3DA 5CBNA 3WMM0 1SQBD 2NPSC 5AW8B 1Q81Q 1GU5A 5CCGA 1AJYA 1SFCB 1FOSF 3AE1C 3H1KE 2O01H 2FKWB 2QG4A 3H1KD 3C1LA 3NMDA 4BRYA 3HUSB 5DJUB 4ZMDA 1M1KQ 1FOSE 1LTIC 2C0XA 1S5LX 1N8RQ 1NH4A 4KT0J 1J1EC 1OVRA 2C9NY 4IL6E 1RQVA 2QM8A 2RMZA 5AVVB 1NTMG 2WSSH 3HE4B 3U59A 3B8EB 1VQ7P 4YXDC 1FDIA 1QLED 1SQQK 3V5BA 3CMAP 1HGVA 5APYA 3L73D 1SFCA 2GUVA 3CWBE 3V4QA 1ZLLA 4JYBA 3CWBD 3AECC 3RL0g 5KLVK 3T97A 3GHGB 5DJTB 2A06G 1ZP0C 1URQC 1A02J 3KPEA 3G6EP 1LWUA 1VQ5P 4PV1D 3Q5PA 3CC2P 4N6JA 2Q5UA 4DT0A 1LTSC 2K1AA 1HJ0A 1PP9G 4HKZH 3HE4A 2XDJA 4YPCA 3IAOA 3WUVA 1OZHA 2NRGA 3H1HG 1EC5A 4PV1C 1GTWA 1JCCA 1NTZE 4U3FG 1Q86Q 2YXQB 3TF5A 2HPCB 5KJ7C 1NTZD 1IZNB 3HD7C 4PD4I 3GW6A 1JY2N 3KZIE 2HODA 4OGQB 1SP4A 3E7KA 1SQPG 2D2CD 1YJ9P 1QL2A 2HR3A 3KZIH 4MN4C 3IR9A 1CSBA 1IFJA 2WWWA 4IFMA 2LR2A 5AVUB 3P8MC 1BDDA 1L4AC 1Y8AA 3USSA 1Z56A 2JJLA 1K8AQ 1RE3A 2FXPA 3CXHE 5GTIE 2YO2A 1L0LE 3H1IJ 2D2CC 3HE5B 3BRTB 1K9MQ 2OTJP 5H2FE 2N1TD 3JCUH 1AV1A 4XE5B 5AW3B 3CCQP 2W83C 2HPCA 2N1TA 2XU6A 1NU1K 3CXHH 2WPRA 2K88A 3CX5D 5AVWB 5AVTB 1X8YA 3PHLA 5H2FH 2E43A 1HUCA 3CD6P 3MP7B 3TYYA 4RO0A 1R8EA 1A02F 3L72E 3R4YA 3H1LD 1QEXA 1NVOA 3L72D 4H44D 3CI9A 1ZOYC 3AEGC 1GD2E 3GG2A 1D7MA 1YQ3C 4ZNCA 2CPBA 1M90Q 2OTLP 2P10A 3HE5A 4XFJA 4HYTB 3SWFA 2M0BA 1PPJG 3CCMP 3L70E 1AA0A 2ZVNB 1L2PA 3N4XA 3L70D 1S9KE 1KB9E 4C7RA 2ZYDA 4CPGA 3MHVA 3G9RA 1S9KD 1JY3N 1KB9D 1SQXD 2POHA 2QRXA 1PP9J 4H0LD 1YTZT 2K3RA 1R5SA 4WVZA 3CCLP 3MTUE 4DZOA 1NTKG 3WUTA 3H1HJ 5AW5B 3L35A 3U1AA 5BU8B 3AE5C 3AE7C 2WZ7A 4U3FJ 2JWAA 5TISH 2RN0A 4LC1A 4OVNF 4UB8E 2QA4P 3VMXA 1GL2D 5B5EE 2FYNB 2R5BA 4ZKPA 3AEAC 2Z4EA 3H1ID 2JP3A 5KAIE 1FJKA 4B86A 3RK3C 1GL2A 2C0WA 2FYUJ 3V4WA 1FZCB 4UB8H 3H1JE 4H13D 3RBZA 1SQPJ 5B5EH 2E74D 4N78E 2WPVB 1GK4A 1KILB 2V7QJ 1NU1G 4N78D 3LIEA 3HTKB 3LW5H 3M0DA 2ZXEB 2PAJA 2AEJA 5CJ0A 3JC22 1NTMD 3S1KA 1JMBA 3ZDMA 2Q3EA 1VQKP 1RF0C 2W8ZA 2OYOA 5AVQB 1LTGC 2KK7A 3G3ZA 1XTCC
chains in the Genus database with same CATH topology
1ZRTE 1Y9BA 2K9YA 4H0LD 4H13C 3Q2YA 1VF5C 3AECC 3RL0g 1KORA 2E74C 1OW6A 2H88C 2BEQD 1PL5A 5KLIC 2ZT9B 3AE2C 2E76D 1VF5B 1NGMB 2ZT9C 1ZP0C 2WQYC 3SFEC 3T97B 4PV1D 1OMIA 3Q5PA 1EXJA 2FBWC 3AE5C 3AE7C 3AEDC 4H0LB 1HJ0A 2JO1A 4Z1MH 3Q3DA 2BEZF 3FGAD 3Q5RA 1RQUA 1R8EA 3AE6C 1KILE 2WSCJ 3IAOA 1AJYA 3R4YA 3Q1MA 2YMKA 2J5UA 2O01J 3AE4C 2IDBA 2E75B 5L8RJ 3AE1C 1KTMA 2G3AA 3AEAC 4H44D 4PV1B 5M1BA 2JP3A 2E75C 4OGQD 3AEEC 1PIXA 3GF3A 4PV1C 1ZOYC 1K04A 3AE8C 1JB0J 3AEGC 1FDOA 2WSFJ 2QJKC 1PV3A 3IN6A 1KMIZ 1GMJA 1DD4A 1S5LX 1YQ3C 3EWKA 4H13D 4KT0J 4GDOA 1KQGB 4H0LC 1VF5D 2YIUC 1DD3A 2QJYC 2E74D 2QIWA 1YQ4C 2QSIA 1TU3F 3C8VA 2WPVB 1RQVA 2E76B 4H44B 3GMAA 2G8YA 4U7JA 1KQFB 3B71A 2E76C 1Q90D 4OGQB 2P10A 2ZT9D 2V7QJ 4XFJA 4IL6X 2FYNC 3LW5J 3ABVC 1DIPA 4TT3H 4Y28J 3GF7A 4I7ZB 3O6QA 1ZMEC 3AE3C 4I7ZC 4YXDC 1FDIA 2OQQA 1U57A 4YTPC 4H13B 1MKMA 2D2CD 2H89C 2E74B 1UIXA 3AEBC 4RKUJ 1OW8A 2WSEJ 5KKZC 3S9OA 3D6ZA 2QJPC 3RK3E 1EXIA 3H25A 1VL2A 3D70A 1NYHA 1HF9A 3AE9C 3SFDC 4H44C 3D6YA 2E75D 3AEFC 4OGQC 3GLMA 1K05A 1S1CX 2FXPA 4R4LA 3D71A 3G9RA 2D2CB 4R4MA 1WMKA 2MKVA 2D2CC 1IK7A 1OW7A 3Q5SA 2NZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2Y A;  3Q5R A;  1R8E A;  3IAO A;  3D6Z A;  1EXI A;  3Q1M A;  2J5U A;  3D70 A;  3Q3D A;  3D6Y A;  1DIP A;  3T97 B;  4R4L A;  3D71 A;  3Q5P A;  1EXJ A;  2OQQ A;  3G9R A;  4R4M A;  3Q5S A; 
#chains in the Genus database with same CATH topology
 3CCV P;  1RF1 B;  2KSE A;  1T2K C;  2ZT9 C;  3OJA B;  2FFD C;  1EZV I;  2M3B A;  2P1J A;  1YIJ P;  2FBW C;  4I1L A;  2JO1 A;  3FGA D;  3HTK A;  1J1D C;  1H0T B;  3TDK A;  1LT9 B;  1ZXG A;  2IPP A;  1PZQ A;  2O01 J;  4I6M C;  4Y99 C;  1PP9 D;  3UIA A;  1K04 A;  3VN0 A;  4AYC A;  3CCU P;  1PV3 A;  2KSJ A;  1SQV E;  3B5N B;  4IOI H;  2OAR A;  2GM4 A;  5EFW B;  4PJ0 E;  2QJP B;  1QX8 A;  1SQV D;  2YNY A;  5AVR B;  1KQF B;  5GTH E;  4U3F D;  2KZJ A;  3U1C A;  4DJG A;  2FYZ A;  3AE3 C;  3BAT A;  2E5Y A;  1PGP A;  3L71 E;  4GIF A;  2W6J H;  3AEB C;  1M8O B;  3L71 D;  5GTH H;  5CCH D;  1BDC A;  3AE9 C;  3SFD C;  4EI2 A;  3V2P A;  3L75 E;  5CCH A;  1S1C X;  1NTK J;  1H0T A;  2FXM A;  5AVZ B;  1RE4 A;  1SS1 A;  1HBW A;  3CPW O;  2K9Y A;  3TGU E;  1KOR A;  1NKZ B;  2ZVO B;  3CCR P;  3G4S P;  5KLI C;  3B5N A;  4K35 A;  2CK3 H;  3MZW B;  1NHL A;  2OGU A;  1IK9 A;  2CPS A;  4L75 A;  2OYH C;  1J1E B;  4Z1M H;  1EDJ A;  4L74 A;  2FXO A;  2IBZ I;  3FX0 A;  3W67 A;  1WRG A;  1N7S C;  4ASV A;  1LNQ A;  1JNM A;  2N9B A;  1SQQ E;  2HFE D;  4JYC A;  1NU1 J;  4WBA A;  1W2B O;  2QJK B;  4WY4 D;  3A0B E;  1SQQ D;  2FYU K;  2RKL A;  3BAS A;  3RL0 D;  1SQB E;  2VRS A;  1N73 A;  3VYI A;  2IBZ G;  4GOE A;  4GT1 A;  3JSV C;  1SQP K;  4WY4 A;  4L73 A;  3GMA A;  2BCC G;  1E79 H;  3VTP C;  5KLV E;  3A0B H;  2AEM A;  3CC4 P;  2R3C A;  2LXC B;  5KLV D;  2OQQ A;  1G1I A;  2WT7 B;  1MKM A;  5CCG C;  2H89 C;  4RJT A;  4I2L C;  3O8Z A;  1PPJ D;  3AEF C;  1Q82 Q;  4BWN A;  4UB6 E;  2A45 H;  2MKV A;  1IK7 A;  2KOG A;  4IL6 H;  1N2D C;  2H88 C;  3L73 E;  1G1J A;  3AE2 C;  5AVY B;  2WSC H;  1SFC D;  1RH5 B;  2GUS A;  1IFI A;  4UB6 H;  2WQY C;  3SFE C;  3SWK A;  1JOC A;  1YI2 P;  1IO4 A;  2O1J A;  3WU2 E;  4JQ0 D;  2LKM A;  3AE6 C;  1NTK D;  2PP6 A;  3Q1M A;  2YMK A;  3HUS A;  1SFC C;  1GW4 A;  1AQ5 A;  5CMZ A;  3NTN A;  1L0N J;  2XZR A;  3BRV B;  3WU2 H;  3CC7 P;  2M8R A;  2W90 A;  3IF4 A;  1CI6 B;  2Y0C A;  1LWU C;  1BCC G;  1TU3 F;  3C8V A;  2KNC B;  1L4A B;  3FXD A;  4IFF A;  5AW9 B;  1GZL A;  2AXT E;  3BCC G;  4IL6 X;  1NAF A;  5AW7 B;  2JR8 A;  1KC8 Q;  2XNX A;  4D6T G;  1M1J B;  1IFN A;  4A7P A;  1BGY G;  4LLH A;  3O6Q B;  1NU1 D;  4RKU J;  1PGJ A;  3H32 B;  1OW8 A;  5KKZ C;  1LTB C;  3L36 A;  1EXI A;  1VL2 A;  3P7K A;  4WB4 A;  3D6Y A;  1M56 D;  3A3Y B;  5APT A;  1IFM A;  1NTK K;  2FYU G;  3GHG A;  1J2J B;  4R4M A;  1OVU A;  1ZRT E;  1YJW P;  3BVH A;  3KQG A;  4HH2 A;  1BSH A;  1ZRT D;  2HLO A;  3L74 G;  1CI6 A;  3A2A A;  4NPF X;  2KNC A;  2PGD A;  1L4A A;  1KV4 A;  2KIK A;  1LTT C;  4M3L A;  3CCS P;  1HJB A;  1KYO E;  1RE3 C;  1M1J A;  5CJ4 A;  2BCC J;  3PJS K;  3VOP A;  1KYO D;  4OGQ D;  3CX5 E;  3H32 A;  5GTI H;  3AE8 C;  1EQ7 A;  1KMI Z;  1GMJ A;  3I55 P;  1DD4 A;  3PLN A;  1EZV E;  2YIU B;  3H1L E;  1BE3 J;  2N1T C;  5AVS B;  3TNU B;  4L76 A;  1EZV D;  2E76 B;  3CX5 H;  5APU A;  3LW5 J;  3H1J J;  3M06 A;  4TT3 H;  4I7Z B;  2YO3 A;  4YTP C;  5APQ A;  1PFI A;  1IFD A;  3S4R A;  1FZE A;  1T3J A;  3P8C E;  2WSE H;  4H44 C;  1K05 A;  3P8C D;  1S2E A;  2M5A B;  3KYQ A;  5BU5 A;  1XTG B;  1VF5 B;  4AUW A;  2BAS A;  2K9J B;  1JY2 O;  2BEQ D;  1VQL P;  1P84 E;  3VMY A;  2E76 D;  2AEF A;  3RK3 B;  3B4S A;  1P84 D;  1DH3 A;  3TNU A;  1EDL A;  1SQX E;  5BVZ A;  1FZF A;  3AED C;  2SPZ A;  1LGH B;  3CCE P;  1FJP A;  2YKO A;  4JPZ B;  1M57 D;  2L91 A;  2W6B A;  5AVX B;  1BCC J;  2W6A A;  1KB9 H;  1KTM A;  3PRJ A;  1KZU B;  1PIX A;  3A5T A;  3BCC J;  2IFN A;  1L0N K;  4D6T J;  4H0L C;  1VF5 D;  1DD3 A;  1BGY J;  1MV8 A;  2QSI A;  3H1I E;  1MFT A;  1KFN A;  1DEE G;  4U7J A;  3CWB G;  5AW1 B;  3E1I A;  1H88 A;  2K9J A;  2IBZ D;  1ZME C;  1U57 A;  4GOD A;  2KS1 B;  3F5H A;  3PH0 A;  2JWD A;  1FS0 E;  1GL2 C;  3H25 A;  2Q1K A;  3OA7 A;  5KAI H;  2Y9Z A;  3D70 A;  2FFD B;  1X0T A;  1X22 A;  3L74 J;  3GLM A;  3V6I A;  2B89 A;  2Z5H A;  1NTM E;  1QGK B;  1J1D B;  2KYV A;  4H13 C;  2WMM A;  2E74 C;  1NTZ G;  3MGN A;  4Y99 B;  3M0D C;  2H43 A;  3NXS A;  1SLQ A;  1OVV A;  4JBZ A;  2R5D A;  1FDM A;  1JM0 A;  5TJH A;  2PFX A;  3FXE A;  2KP8 A;  4ZKU A;  4WWI A;  2ZFC A;  4TLF A;  2R3S A;  1KIL E;  2H8P D;  1U7J A;  3AE4 C;  2E75 B;  3CXH I;  1FZC A;  1KIL D;  1N86 A;  3CME P;  1FDO A;  1JY3 O;  3IN6 A;  1KIL A;  3W68 A;  2FFD A;  2A06 E;  2QVA A;  2QJY B;  2Y9Y A;  2A06 D;  1OFC X;  1BSN A;  2V4H A;  2XND H;  1PP9 E;  1S3J A;  1L0L G;  1DX7 A;  1QVF O;  3RK2 B;  4Y28 J;  5APX A;  1G2C B;  2OYI C;  1LTJ B;  2ITA A;  3H1H E;  2HG5 D;  1VQ9 P;  3H1K J;  4KHX A;  3A7O A;  3BCC D;  4U3F E;  3H1H D;  3FWL A;  1FAV A;  4D6T D;  2E75 D;  2OYH B;  2XV5 A;  3L72 G;  1L0N G;  1RY3 A;  1RF1 A;  4W80 A;  3V2Q A;  4PJ0 H;  2NZ2 A;  1N7S B;  2FYU E;  1JEK A;  5CBO A;  2L5G B;  3EFF K;  2Z5I A;  5B66 E;  1PL5 A;  2FYU D;  1SQP E;  4PD4 E;  1SQP D;  1LT9 A;  1IFP A;  4PD4 D;  2NPS B;  4DCK A;  3A0H E;  3B5N D;  5B66 H;  1RQU A;  1LP1 B;  5KAF E;  1KB9 I;  1YHQ P;  5CCH C;  4OWF A;  1LTJ A;  1AVO A;  1NJI Q;  2J5U A;  1RE4 C;  3FWN A;  2B87 B;  1YIT P;  3QWO C;  2Y0D A;  3CWB J;  3L70 G;  3C9I A;  3GF3 A;  1FZB A;  1S5L E;  1GU4 A;  1OWA A;  1ZV8 A;  2QE7 H;  1JUN A;  4GDO A;  1KQG B;  1H8A A;  2J58 A;  1YQ4 C;  3KDP B;  4BRY B;  2PRR A;  3MUD A;  3B71 A;  2ZJS E;  1N7S A;  1IJD B;  3GF7 A;  3CCJ P;  1EDK A;  2K37 A;  1M7L A;  1Y47 A;  1QVG O;  3KHU A;  2O01 N;  5K5G B;  3MD0 A;  4OH8 B;  3I56 P;  2WPS A;  2W27 A;  1NTZ J;  2NPS A;  2HYN A;  3SSU A;  3LID A;  1N73 C;  1T3U A;  1LP1 A;  3N7N A;  3D71 A;  4WY4 C;  1NWQ A;  3RL0 C;  2B87 A;  5APV A;  3ITK A;  1AQT A;  2E42 A;  1BE3 G;  1KFM A;  3Q2Y A;  1LT1 A;  3VMA A;  1T6A A;  1PPJ E;  1URQ B;  3H6P A;  3H1J G;  1FU1 A;  3T97 B;  1LWU B;  1CZQ A;  2P2U A;  4EYY Q;  2R44 A;  4BXL A;  2E5T A;  2I1J A;  3PP5 A;  4PV1 B;  5M1B A;  1L0L J;  3V2N A;  3AEE C;  3M0A A;  2QJK C;  1VQO P;  3HD7 B;  2WSF H;  1NTK E;  5KKZ B;  3VP9 A;  2IFM A;  2WT7 A;  1YYC A;  2OTK E;  1URQ D;  1SQB K;  4K3A A;  1DIP A;  1NO4 A;  3H1L J;  2ZYG A;  2HOD B;  1URQ A;  3M9H A;  3L72 J;  3HUS C;  2JEE A;  4HB1 A;  2WSE J;  3TSI A;  2KUB A;  3D6Z A;  1HF9 A;  5AW0 B;  1YTZ I;  3PTZ A;  4C7N B;  2FY8 A;  1KD1 Q;  2D2C B;  1EDI A;  1NU1 E;  5KJ7 D;  1DEB A;  2ZYA A;  3HD7 D;  1IC2 A;  3SWY A;  1OW6 A;  3M91 A;  2KZI A;  2AXT H;  5KJ7 A;  1NGM B;  1SQV G;  3HD7 A;  5AW6 B;  4N3Y B;  2KB7 P;  1HGZ A;  3L70 J;  2Q3I A;  2M3E A;  2UWJ E;  2Q7C A;  4LGD E;  3EFG A;  2N1T B;  1JY3 P;  3Q5R A;  5C39 A;  1VQP P;  2YKP A;  1SQX J;  3GHG C;  2KLU A;  2WVR A;  1L4A D;  3L71 G;  2P58 A;  2O3J A;  2Y0E A;  1FC2 C;  2N9Y B;  1HTL C;  2JKV A;  3L75 G;  4C7N A;  4QMA A;  3JCU E;  4H44 B;  3QH9 A;  3VP8 A;  2DW3 A;  1X9V A;  3TGU G;  3O6Q A;  1RHZ B;  1M1J C;  3CXH D;  1L0L D;  1KYO H;  3RGU A;  1GDT A;  3S9O A;  1X79 B;  1NTZ K;  1Q2N A;  1USE A;  1AFO A;  4OGQ C;  1FBM A;  1VQ4 P;  5KTB A;  3E1R A;  2I8D A;  2IYO A;  1OW7 A;  3Q5S A;  1SQQ G;  1Y9B A;  3KXD A;  1U7M A;  1L0N E;  1SQB G;  3TK1 A;  1L0N D;  2WPQ A;  1NTM J;  1OIP A;  3K5B A;  2WIT A;  2A45 I;  5CHX A;  1VDF A;  1HWT C;  2ZXX A;  4H0L B;  5KLV G;  3H1K G;  1VQ6 P;  1S4X A;  2KXP B;  1JCD A;  3EQ2 A;  1R5L A;  2G3A A;  3IFM A;  1QL1 A;  1L0L K;  2A45 G;  1JB0 J;  1YJN P;  2KLV A;  1OX3 A;  4RES B;  2LXB A;  3EWK A;  2YMY A;  1ZR2 A;  2YIU C;  1T8Z A;  1GL2 B;  1P84 H;  2QIW A;  4YXW H;  4C46 A;  2G8Y A;  2E76 C;  1Q90 D;  2QEX P;  4KJM A;  5AW2 B;  4I7Z C;  3NFQ A;  3L73 G;  4H13 B;  4XA4 A;  2E74 B;  2B88 A;  5TIS E;  2M5A A;  3RK3 E;  2RH0 A;  1NYH A;  1W2E A;  2IBZ E;  1SQV J;  3RK3 D;  2AXC A;  2BCC E;  2YXR B;  2IZ0 A;  2Q6Q A;  2BCC D;  1VF5 C;  3CL3 D;  1LJ2 A;  3MIW A;  2ZT9 B;  1MZ9 A;  1JTH B;  1H89 A;  1BE3 E;  2IYP A;  3L71 J;  5APS A;  1K73 Q;  1VQ8 P;  1BE3 D;  1VQM P;  1KQS O;  2WTY A;  1ZN5 A;  3H1J D;  3L75 J;  1AVY A;  1SQX K;  1USD A;  1FE6 A;  2O1K A;  2IDB A;  4JF7 A;  2OYI B;  1VQN P;  1N7L A;  2GA1 A;  3TGU J;  1NAY A;  1RF0 A;  3CLQ A;  3OAK A;  2H7H A;  3M9B A;  3HRN A;  1WT6 A;  1T2K D;  2KS1 A;  2ZT9 D;  2I1K A;  2FYN C;  4GKG A;  2XKM A;  1JTH A;  1KYO I;  5APW A;  1FZC C;  4W7Y A;  1SQQ J;  3RBX A;  2J59 M;  3CX5 I;  4ASW A;  3P32 A;  2ZAE B;  1KIL C;  1SQB J;  1NKN A;  1BCC E;  1GK6 A;  1HVV A;  4GOF A;  1WMK A;  1FZG A;  1BCC D;  3BCC E;  3F89 A;  4EIJ A;  1FZA A;  2OYI A;  1KQL A;  5KLV J;  4D6T E;  5KLI B;  1UII A;  2QM7 A;  1GW3 A;  3V2R A;  2P7J A;  1BGY E;  1EZV G;  1NTM K;  4EDF A;  3H1L G;  2JDI H;  1OMI A;  1BGY D;  2B9B A;  3II6 A;  1NOH A;  2BEZ F;  1PGO A;  5E79 E;  4AQR D;  2WSC J;  1YBK A;  3G71 P;  4O9B A;  3VMZ A;  5L8R J;  1KN7 A;  1MUU A;  3L4F A;  1RF1 C;  2E75 C;  4HJG H;  2MJZ A;  2Q9I A;  3RK2 D;  2WSF J;  5E79 H;  3L74 E;  1OXZ A;  1P84 I;  3L73 J;  1W5C E;  2QJY C;  1ZR4 A;  3L74 D;  1G2C A;  3R2P A;  2P67 A;  1PGQ A;  1N73 B;  2R32 A;  1Q7Y Q;  4PD4 H;  1LT9 C;  1SVF A;  3ABV C;  4WY4 B;  4DOJ A;  1CW5 A;  2V7Q H;  4EOT A;  2IZ1 A;  3RL0 B;  3RK2 C;  3L75 D;  3A0H H;  1LTJ C;  3L37 A;  5KAF H;  1UIX A;  3WUU A;  3B5N C;  2IX7 C;  1N7S D;  2OYH A;  2C9L Y;  1SQX G;  3TGU D;  2QJP C;  5AW4 B;  4NPD A;  1SQV K;  1S5L H;  4NPE A;  4R4L A;  2KI7 B;  4IFD K;  1JMM A;  3MUD C;  1MFZ A;  2NPS D;  2YKQ A;  1HH0 A;  1E5W A;  3M9Q A;  1VPC A;  3I5C A;  1JO5 A;  1JY2 P;  1LTA C;  1EXJ A;  4W7Z A;  3H1I G;  1ZW0 A;  3OW2 O;  1S72 P;  5CCG D;  3Q3D A;  5CBN A;  3WMM 0;  1SQB D;  2NPS C;  5AW8 B;  1Q81 Q;  1GU5 A;  5CCG A;  1AJY A;  1SFC B;  1FOS F;  3AE1 C;  3H1K E;  2O01 H;  2FKW B;  2QG4 A;  3H1K D;  3C1L A;  3NMD A;  4BRY A;  3HUS B;  5DJU B;  4ZMD A;  1M1K Q;  1FOS E;  1LTI C;  2C0X A;  1S5L X;  1N8R Q;  1NH4 A;  4KT0 J;  1J1E C;  1OVR A;  2C9N Y;  4IL6 E;  1RQV A;  2QM8 A;  2RMZ A;  5AVV B;  1NTM G;  2WSS H;  3HE4 B;  3U59 A;  3B8E B;  1VQ7 P;  4YXD C;  1FDI A;  1QLE D;  1SQQ K;  3V5B A;  3CMA P;  1HGV A;  5APY A;  3L73 D;  1SFC A;  2GUV A;  3CWB E;  3V4Q A;  1ZLL A;  4JYB A;  3CWB D;  3AEC C;  3RL0 g;  5KLV K;  3T97 A;  3GHG B;  5DJT B;  2A06 G;  1ZP0 C;  1URQ C;  1A02 J;  3KPE A;  3G6E P;  1LWU A;  1VQ5 P;  4PV1 D;  3Q5P A;  3CC2 P;  4N6J A;  2Q5U A;  4DT0 A;  1LTS C;  2K1A A;  1HJ0 A;  1PP9 G;  4HKZ H;  3HE4 A;  2XDJ A;  4YPC A;  3IAO A;  3WUV A;  1OZH A;  2NRG A;  3H1H G;  1EC5 A;  4PV1 C;  1GTW A;  1JCC A;  1NTZ E;  4U3F G;  1Q86 Q;  2YXQ B;  3TF5 A;  2HPC B;  5KJ7 C;  1NTZ D;  1IZN B;  3HD7 C;  4PD4 I;  3GW6 A;  1JY2 N;  3KZI E;  2HOD A;  4OGQ B;  1SP4 A;  3E7K A;  1SQP G;  2D2C D;  1YJ9 P;  1QL2 A;  2HR3 A;  3KZI H;  4MN4 C;  3IR9 A;  1CSB A;  1IFJ A;  2WWW A;  4IFM A;  2LR2 A;  5AVU B;  3P8M C;  1BDD A;  1L4A C;  1Y8A A;  3USS A;  1Z56 A;  2JJL A;  1K8A Q;  1RE3 A;  2FXP A;  3CXH E;  5GTI E;  2YO2 A;  1L0L E;  3H1I J;  2D2C C;  3HE5 B;  3BRT B;  1K9M Q;  2OTJ P;  5H2F E;  2N1T D;  3JCU H;  1AV1 A;  4XE5 B;  5AW3 B;  3CCQ P;  2W83 C;  2HPC A;  2N1T A;  2XU6 A;  1NU1 K;  3CXH H;  2WPR A;  2K88 A;  3CX5 D;  5AVW B;  5AVT B;  1X8Y A;  3PHL A;  5H2F H;  2E43 A;  1HUC A;  3CD6 P;  3MP7 B;  3TYY A;  4RO0 A;  1R8E A;  1A02 F;  3L72 E;  3R4Y A;  3H1L D;  1QEX A;  1NVO A;  3L72 D;  4H44 D;  3CI9 A;  1ZOY C;  3AEG C;  1GD2 E;  3GG2 A;  1D7M A;  1YQ3 C;  4ZNC A;  2CPB A;  1M90 Q;  2OTL P;  2P10 A;  3HE5 A;  4XFJ A;  4HYT B;  3SWF A;  2M0B A;  1PPJ G;  3CCM P;  3L70 E;  1AA0 A;  2ZVN B;  1L2P A;  3N4X A;  3L70 D;  1S9K E;  1KB9 E;  4C7R A;  2ZYD A;  4CPG A;  3MHV A;  3G9R A;  1S9K D;  1JY3 N;  1KB9 D;  1SQX D;  2POH A;  2QRX A;  1PP9 J;  4H0L D;  1YTZ T;  2K3R A;  1R5S A;  4WVZ A;  3CCL P;  3MTU E;  4DZO A;  1NTK G;  3WUT A;  3H1H J;  5AW5 B;  3L35 A;  3U1A A;  5BU8 B;  3AE5 C;  3AE7 C;  2WZ7 A;  4U3F J;  2JWA A;  5TIS H;  2RN0 A;  4LC1 A;  4OVN F;  4UB8 E;  2QA4 P;  3VMX A;  1GL2 D;  5B5E E;  2FYN B;  2R5B A;  4ZKP A;  3AEA C;  2Z4E A;  3H1I D;  2JP3 A;  5KAI E;  1FJK A;  4B86 A;  3RK3 C;  1GL2 A;  2C0W A;  2FYU J;  3V4W A;  1FZC B;  4UB8 H;  3H1J E;  4H13 D;  3RBZ A;  1SQP J;  5B5E H;  2E74 D;  4N78 E;  2WPV B;  1GK4 A;  1KIL B;  2V7Q J;  1NU1 G;  4N78 D;  3LIE A;  3HTK B;  3LW5 H;  3M0D A;  2ZXE B;  2PAJ A;  2AEJ A;  5CJ0 A;  3JC2 2;  1NTM D;  3S1K A;  1JMB A;  3ZDM A;  2Q3E A;  1VQK P;  1RF0 C;  2W8Z A;  2OYO A;  5AVQ B;  1LTG C;  2KK7 A;  3G3Z A;  1XTC C; 
#chains in the Genus database with same CATH homology
 1ZRT E;  1Y9B A;  2K9Y A;  4H0L D;  4H13 C;  3Q2Y A;  1VF5 C;  3AEC C;  3RL0 g;  1KOR A;  2E74 C;  1OW6 A;  2H88 C;  2BEQ D;  1PL5 A;  5KLI C;  2ZT9 B;  3AE2 C;  2E76 D;  1VF5 B;  1NGM B;  2ZT9 C;  1ZP0 C;  2WQY C;  3SFE C;  3T97 B;  4PV1 D;  1OMI A;  3Q5P A;  1EXJ A;  2FBW C;  3AE5 C;  3AE7 C;  3AED C;  4H0L B;  1HJ0 A;  2JO1 A;  4Z1M H;  3Q3D A;  2BEZ F;  3FGA D;  3Q5R A;  1RQU A;  1R8E A;  3AE6 C;  1KIL E;  2WSC J;  3IAO A;  1AJY A;  3R4Y A;  3Q1M A;  2YMK A;  2J5U A;  2O01 J;  3AE4 C;  2IDB A;  2E75 B;  5L8R J;  3AE1 C;  1KTM A;  2G3A A;  3AEA C;  4H44 D;  4PV1 B;  5M1B A;  2JP3 A;  2E75 C;  4OGQ D;  3AEE C;  1PIX A;  3GF3 A;  4PV1 C;  1ZOY C;  1K04 A;  3AE8 C;  1JB0 J;  3AEG C;  1FDO A;  2WSF J;  2QJK C;  1PV3 A;  3IN6 A;  1KMI Z;  1GMJ A;  1DD4 A;  1S5L X;  1YQ3 C;  3EWK A;  4H13 D;  4KT0 J;  4GDO A;  1KQG B;  4H0L C;  1VF5 D;  2YIU C;  1DD3 A;  2QJY C;  2E74 D;  2QIW A;  1YQ4 C;  2QSI A;  1TU3 F;  3C8V A;  2WPV B;  1RQV A;  2E76 B;  4H44 B;  3GMA A;  2G8Y A;  4U7J A;  1KQF B;  3B71 A;  2E76 C;  1Q90 D;  4OGQ B;  2P10 A;  2ZT9 D;  2V7Q J;  4XFJ A;  4IL6 X;  2FYN C;  3LW5 J;  3ABV C;  1DIP A;  4TT3 H;  4Y28 J;  3GF7 A;  4I7Z B;  3O6Q A;  1ZME C;  3AE3 C;  4I7Z C;  4YXD C;  1FDI A;  2OQQ A;  1U57 A;  4YTP C;  4H13 B;  1MKM A;  2D2C D;  2H89 C;  2E74 B;  1UIX A;  3AEB C;  4RKU J;  1OW8 A;  2WSE J;  5KKZ C;  3S9O A;  3D6Z A;  2QJP C;  3RK3 E;  1EXI A;  3H25 A;  1VL2 A;  3D70 A;  1NYH A;  1HF9 A;  3AE9 C;  3SFD C;  4H44 C;  3D6Y A;  2E75 D;  3AEF C;  4OGQ C;  3GLM A;  1K05 A;  1S1C X;  2FXP A;  4R4L A;  3D71 A;  3G9R A;  2D2C B;  4R4M A;  1WMK A;  2MKV A;  2D2C C;  1IK7 A;  1OW7 A;  3Q5S A;  2NZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...