1H8AA

Crystal structure of ternary protein-dna complex3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
68
structure length
68
Chain Sequence
VDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords CAAT/ENHANCER BINDING PROTEIN BETA
publication title Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1h8aA00
3I5CA 4LC1A 3M91A 4AUWA 2XZRA 2WPRA 1SLQA 2P7JA 1MFZA 2R32A 2E42A 1GZLA 3TK1A 2XU6A 3L36A 5AW0B 2WPSA 5AVZB 4GKGA 1CI6A 2Q5UA 3KDPB 3VMYA 1GU5A 4C7NA 2BASA 1T2KD 3KQGA 3HTKA 4C46A 5AW8B 4EOTA 3V4QA 1A02F 5AVUB 5AVXB 3HE4B 5AW3B 1GU4A 2P2UA 2YNYA 3NXSA 5APSA 3UIAA 4C7NB 5APQA 1KQLA 1H8AA 1H88A 2W27A 2R5DA 3TNUB 2YO2A 1CZQA 3O8ZA 5AVQB 2QM7A 4M3LA 4AQRD 5AW6B 1S9KE 3HE5A 2WT7A 5AVRB 3NMDA 1NAFA 2WWWA 5AVTB 2YO3A 2ZFCA 3M0DA 3NTNA 4I2LC 2QM8A 2KP8A 4JYBA 5AVSB 3M9BA 1JNMA 3HE5B 4KHXA 3VMXA 3IR9A 2Q7CA 3V4WA 2W6AA 4XE5B 2R5BA 1FOSE 1CI6B 2IPPA 2Z5HA 5CMZA 3TYYA 4HYTB 2C9NY 1A02J 3B8EB 5AVYB 1T2KC 1SP4A 1DH3A 2VRSA 2WPQA 2N9BA 1YYCA 3VMZA 2R3CA 3V5BA 3VYIA 3NFQA 3OAKA 3P32A 3L35A 3T97A 3M0AA 3P7KA 4B86A 1FOSF 2P67A 1FAVA 4DZOA 1HWTC 4RESB 1GK6A 1S9KD 5AW9B 3MGNA 3LIEA 4I6MC 2Z5IA 5APUA 3A3YB 4GT1A 5AW2B 1MV8A 5AW1B 3VTPC 1G2CB 2WT7B 1JUNA 1GK4A 2JJLA 1X8YA 1J2JB 2H7HA 2WTYA 1CSBA 5AW4B 1OWAA 3MD0A 5AW7B 1MUUA 3L37A 5AVWB 2Q3IA 3HE4A 5AW5B 3A5TA 1HUCA 2E43A 1IO4A 3A7OA 2ZXEB 3LIDA 4AYCA 1GD2E 4JYCA 3A2AA 5AVVB 1HJBA 3VN0A 1HBWA 5APWA 3TNUA 3M06A 5APXA 2C9LY 1NWQA 5APYA 3P8MC 3SWFA 2XV5A 1GTWA 5APVA 1OXZA 3M9HA 1H89A 5APTA
chains in the Genus database with same CATH superfamily
1SQPK 5CCHA 3M91A 3H1LD 4AUWA 1QVGO 4GKGA 2KSEA 3H1IG 3SSUA 2P2UA 1DIPA 4L75A 5BVZA 1FJPA 1IFDA 1KN7A 2YMYA 3M9QA 2HPCA 2E76C 2E5YA 2OARA 4WY4A 4A7PA 3EFGA 1IJDB 1SQQE 1JMBA 2W90A 3R2PA 1NU1E 1J1EB 4BXLA 2BCCG 1FZFA 4GOFA 2XNDH 3MP7B 4H44C 3NFQA 4Z1MH 1SQQK 1Q81Q 1Q82Q 4EI2A 4H13D 1NU1K 4H0LB 1FOSF 3ZDMA 4PV1D 1NTMG 3F89A 1SS1A 1SQPG 2AXCA 5AW2B 3VTPC 3E1RA 1L0LD 2JJLA 1X8YA 2J59M 3AE8C 2FFDB 1PPJG 5KTBA 1PP9D 1EDJA 2K37A 3BRVB 2QIWA 5AVVB 2HLOA 4WWIA 2LKMA 1M8OB 2M5AA 3S9OA 2CPSA 5TISE 3AEEC 3V5BA 1SQVD 3PJSK 1LNQA 2G8YA 1BSHA 3KZIH 3AE7C 1G1JA 3KDPB 2XKMA 2LXBA 3HTKA 2W6BA 2JP3A 3VP9A 3K5BA 3USSA 2WZ7A 1SQQG 5B5EE 3QWOC 3H1HG 1EZVE 2W27A 1JY3P 5BU5A 4HKZH 3CC7P 1PL5A 5AW6B 1L4AB 1S9KE 5AVRB 4UB6H 3L70G 1JY2P 1NOHA 3TGUD 3V4WA 1VQ7P 1BE3G 1BCCD 2KNCA 1URQD 4GDOA 1QGKB 1S4XA 4RO0A 3FXEA 1ZOYC 1GK6A 1Q7YQ 2OGUA 3CCJP 5GTHE 2HODB 1SQXJ 2H88C 1PP9E 4D6TG 2LXCB 4R4MA 2O01J 2Y0CA 3H1JE 4XA4A 2M3EA 4Y28J 3CX5H 2OYIC 2C9LY 1SQVE 2PRRA 4LGDE 1OXZA 1AV1A 2QVAA 2ZXXA 1Y8AA 2CPBA 3RK3E 1HGZA 3H32A 3OA7A 1EZVG 3WUVA 4Y99C 2FBWC 4DOJA 2MJZA 1SQVK 3HE4B 3CMEP 2OYIA 2Z4EA 3MZWB 2MKVA 1IK9A 3E1IA 3D6YA 2UWJE 2V7QJ 4EYYQ 2N1TB 2QM7A 4AQRD 1FDMA 5DJTB 1DD3A 2FYNB 2YIUB 1LWUB 3TGUE 2QA4P 1AFOA 3G3ZA 3GHGB 3CPWO 1BCCE 1MFTA 5AVYB 1HVVA 1RF0C 1IK7A 2E74C 1S5LH 2W83C 1IFNA 1GL2D 1DD4A 3L73G 3CXHH 2V4HA 3LIEA 3H1JG 3H1KE 1BGYD 1GK4A 1RF1C 3F5HA 1JO5A 2H7HA 1NTKD 1EQ7A 3L37A 1RF0A 1OW7A 2FYUD 3CWBE 1M7LA 1OW6A 4YTPC 4IL6E 2E76D 3OJAB 1ZRTD 1RF1A 2JO1A 5DJUB 3A0HH 2K3RA 4LC1A 3IF4A 3Q2YA 2H89C 4PD4H 1R5SA 3C9IA 4H44D 4W7YA 1IFIA 3CX5D 4OGQC 1NTZD 2QJPC 3HE5A 4U3FD 1NO4A 3L72D 1RQUA 1E5WA 4WY4B 1LP1B 1K05A 3AE6C 1Y47A 3H1KG 1SP4A 2IZ0A 2K1AA 2N9BA 4DT0A 3P32A 2WPVB 3V2NA 2K88A 3P7KA 4YXDC 4LLHA 4ASWA 3H1ID 3CWBG 3E7KA 1IFMA 4IOIH 5APUA 1DEBA 3U1AA 1NTKE 3RK3C 3S4RA 5AW4B 2FYUE 1PGOA 3U59A 2OYHC 1QVFO 3Q5SA 3A0BH 1NTKK 3BATA 4OWFA 1YTZI 1KYOE 5KLVJ 1GDTA 5TISH 2KLVA 2SPZA 2BCCD 1WT6A 2YKQA 3SWFA 4NPEA 3CXHD 1X79B 3V2PA 1KB9H 3TDKA 1NVOA 4DCKA 2OYHA 4C7NA 1N73A 1NTMD 2WVRA 4C46A 1R8EA 1SQPD 5AW8B 4ZKUA 2IFNA 3KHUA 3H1LJ 5APSA 2KS1A 3D6ZA 3HTKB 2WSEJ 1PPJD 1VPCA 3FGAD 1NTZE 3RL0C 4U3FE 3L72E 4N6JA 2WWWA 3L75J 1AA0A 1PGJA 4PD4D 1CI6B 1NTZK 1NKNA 2RKLA 1DH3A 2VRSA 1VQ5P 2YKPA 1FZCB 3CX5I 4O9BA 1N7SC 3KYQA 3H1IE 2ZT9C 4DZOA 1T3JA 3CCSP 5GTHH 2GM4A 3CC2P 1SQQD 1Z56A 2R44A 4N78D 2WMMA 3I56P 3H1HD 1OWAA 2HYNA 3S1KA 1KC8Q 2K9YA 3KPEA 1SQXG 2M0BA 5CHXA 1N7SA 1BDDA 1IO4A 2HFED 3L70D 1L0LJ 1OIPA 4PJ0E 1KFNA 1HBWA 1J1DC 1JTHB 3CXHE 1BE3D 2GUSA 2E75C 1EXIA 3WUUA 1GZLA 1XTGB 5KKZB 1VQPP 1VQ9P 2KSJA 2AEFA 2Q5UA 3P8CE 1YIJP 1W2EA 3KQGA 5KAFE 5CJ4A 1A02F 1GU4A 3H32B 2E74D 1LTJC 2Q6QA 3BRTB 1PPJE 2FXOA 3L74E 1EC5A 2I1KA 2P10A 2B88A 1KQLA 4D6TD 3B4SA 1H0TA 3L71J 4ZNCA 3W68A 3A0HE 2OYOA 2NPSB 4RJTA 2P58A 1KB9D 3NTNA 1PIXA 1KQGB 3M9BA 4PD4E 1VQOP 4ZKPA 2Q7CA 1LTJA 1OVRA 4Y99B 2Z5HA 3BCCE 1GL2A 3HUSC 3VMZA 5EFWB 1VQLP 3RK2C 1AVYA 1L0NE 1EZVD 2KYVA 4BRYA 2W6JH 1S9KD 2Q3EA 1LTSC 3CCEP 4L73A 4N78E 2WT7B 1ZP0C 3RL0g 3H1HE 3CL3D 1LT9C 1L0NK 1S5LX 3HRNA 3HUSA 1S3JA 1BDCA 4MN4C 3L70E 1HUCA 4IL6H 1VF5C 2FYZA 2I8DA 2PAJA 5APWA 1BE3E 2AXTH 1EDLA 3T97B 4OGQD 2QJKB 2ZYAA 3PLNA 3WUTA 1GMJA 1LT9A 2JWDA 3SFDC 3L74G 4WBAA 3M0DC 3L73D 3H1JD 4GOEA 2O01N 3A0BE 5E79H 3PTZA 1Q2NA 4D6TE 3BCCG 5AVQB 1M56D 1VQKP 4M3LA 1KB9E 3RK3D 5M1BA 5KLVK 3M0DA 1L0NG 1JNMA 3HE5B 1TU3F 3BASA 2WITA 1A02J 2OTKE 3LW5H 1OX3A 2IDBA 2O3JA 1EDKA 3VYIA 3AE4C 1QX8A 3AE5C 4H13B 1GW3A 1FAVA 4PV1B 1HWTC 2YKOA 5KAIE 4K3AA 1MV8A 4OGQB 1J2JB 1M1JB 3JCUE 1FJKA 3B5NC 3HD7C 2KXPB 1KYOH 1EZVI 1JEKA 1BGYJ 3A7OA 3B71A 4JBZA 1SFCC 3RL0D 3TNUA 1X0TA 1KQSO 3H1KD 5KLVG 2GUVA 4ASVA 2O01H 1HF9A 2WPRA 3B5NA 3HD7A 3L73E 2XU6A 3VMYA 1GU5A 2A45H 3CWBD 2BASA 4RKUJ 2D2CC 1LT1A 1N7SD 1T3UA 1SFCA 2JR8A 1LGHB 4C7NB 1N73B 2ZT9D 5APQA 2K9JA 1H8AA 1H88A 2J5UA 3CCVP 2KP8A 3FXDA 2B87A 3L75G 3BVHA 1MKMA 2G3AA 2B9BA 1URQB 2QSIA 2WPQA 2RN0A 2ZAEB 3II6A 1NGMB 3CC4P 2E75D 3MIWA 1EDIA 1UIIA 1CW5A 2IYOA 2WSCH 4GT1A 1JUNA 1G2CB 1P84H 1CSBA 2OTJP 3AEDC 2ITAA 4PJ0H 1YJWP 3LIDA 4KJMA 1KILE 2AEJA 1RE3C 4XFJA 4H0LC 2QJYB 2IZ1A 3EFFK 2R32A 2E42A 1KQFB 2WSFH 5KAFH 1LJ2A 2WPSA 3G6EP 1M1KQ 2BCCJ 2ZVOB 2FFDC 3CMAP 1SQBJ 3NXSA 3RK2D 4OH8B 1KYOD 1HGVA 1RE3A 3CD6P 1RHZB 2AXTE 1DEEG 1NTMJ 4CPGA 1SQXD 1SQPJ 2A06E 2YO3A 3L4FA 3L71G 2FFDA 4KHXA 1OMIA 1T8ZA 3TYYA 1KZUB 1N8RQ 5E79E 1VF5D 2Q1KA 2YMKA 3FX0A 1GL2B 2IX7C 2PFXA 1OFCX 4RESB 2HPCB 1JY3N 5TJHA 3A3YB 5AW1B 1JY2N 1L4AC 1OVUA 1HH0A 4OVNF 1YJNP 2KK7A 3FWLA 1T6AA 1BSNA 5AVWB 1LTBC 1NYHA 3A5TA 1SQQJ 2ZVNB 3A2AA 1NU1J 2IYPA 3RK2B 3EQ2A 3H1HJ 2E76B 1RE4C 5APXA 1N86A 1L4AA 5APVA 3AE3C 3L70J 1P84D 4IL6X 5KLIC 2Y0DA 1BE3J 4H44B 4KT0J 3N4XA 2Y0EA 2A06G 1VQ6P 2JDIH 1RE4A 2KOGA 1SQXE 1FZEA 3O8ZA 1KV4A 4WB4A 2M5AB 1LTAC 1QL2A 5AVSB 3B5ND 3HD7D 3P8CD 2E5TA 1SQXK 3RGUA 1FOSE 2IPPA 1KYOI 3AEAC 2C9NY 2XNXA 3B8EB 4W80A 2M3BA 3L74D 2OTLP 1SFCD 1KILC 3GG2A 2B89A 5KAIH 3PRJA 1X22A 2Z5IA 2N1TC 4BWNA 3JCUH 1Q86Q 2FYNC 2A45I 4UB8H 2YIUC 2D2CD 3BCCD 2QG4A 1VQ4P 2IBZE 3GHGC 3HE4A 1KILA 4NPDA 2KNCB 1FZAA 1VQ8P 1L0ND 2R3SA 3D70A 2JKVA 2N1TA 3AEFC 1P84E 4I7ZC 3GHGA 2O1JA 3L36A 3GLMA 5BU8B 4NPFX 3CCMP 1K73Q 3V4QA 5AVUB 5AW3B 1QEXA 2POHA 4I1LA 1NKZB 1PP9J 2KZIA 1W5CE 1JY3O 4HH2A 1SFCB 2CK3H 3H1JJ 1YHQP 2H43A 1HTLC 1JOCA 1FS0E 3NMDA 1NAFA 4W7ZA 4L76A 1JCDA 1FZBA 1SQVJ 1L2PA 1USDA 3FWNA 4U7JA 5CCHC 5KLVD 3CXHI 2QE7H 1YBKA 2KLUA 1JCCA 5C39A 1XTCC 2OYIB 1FE6A 1OZHA 2IBZG 4H0LD 3I55P 1LTGC 2N9YB 4HB1A 2FXPA 1D7MA 1YQ3C 1RH5B 3QH9A 1VQNP 1KFMA 4JQ0D 3MD0A 2J58A 4WY4C 2E43A 4JPZB 4GODA 3TGUJ 2ZYDA 1BCCJ 3VN0A 1SVFA 3L75D 1FDOA 2AEMA 3AE1C 3V2QA 5APYA 3JC22 4PD4I 3AEBC 1GTWA 5APTA 2KZJA 4QMAA 3AEGC 1U7JA 3N7NA 1LP1A 1MZ9A 2HR3A 3ABVC 5CBOA 3H1KJ 2E74B 3UIAA 3O6QA 4WVZA 1SQBG 1U57A 2R5DA 3CWBJ 4YPCA 1Y9BA 1RF1B 3GF7A 1FBMA 1L4AD 5AVTB 1IFPA 1K8AQ 1DX7A 4IFMA 2W6AA 5KLVE 2M8RA 1UIXA 1KD1Q 1S72P 1T2KC 1ZR2A 1K04A 2PGDA 2P67A 2WQYC 3AECC 2RH0A 2H8PD 3MHVA 1FDIA 1WMKA 1USEA 1IFJA 3H1LE 1ZMEC 3EWKA 2FXMA 1YQ4C 2Q3IA 5AW5B 4K35A 1GD2E 5CJ0A 3L71D 1X9VA 5L8RJ 1IZNB 3L75E 1KB9I 2BEZF 1FZCC 3CI9A 4IFDK 3C1LA 2QJPB 3VP8A 1PGPA 3P8MC 1NU1G 1RY3A 4EDFA 3LW5J 3WU2E 2BEQD 3SFEC 3Q5RA 4IFFA 2XZRA 4UB8E 3TK1A 1CI6A 1R5LA 4EOTA 1NTKJ 2NZ2A 2P1JA 1FZCA 1KILD 1NAYA 3ITKA 5CCGC 3PHLA 2FYUJ 1VDFA 2N1TD 3RK3B 5KJ7C 1ZXGA 1GW4A 2Q9IA 1FC2C 1L0LE 2YXQB 2OYHB 3IAOA 5KLIB 5KKZC 2R5BA 1RQVA 4YXWH 5CCGA 5B66H 3OAKA 3H1LG 2KS1B 1L0LK 1PV3A 3CCRP 2QEXP 1JTHA 5KJ7A 1ZR4A 2A06D 1Q90D 5GTIH 2JWAA 1WRGA 2NPSC 3PP5A 1YJ9P 2V7QH 1NTZJ 4U3FJ 1JM0A 3L72J 2YXRB 3L71E 4AYCA 2L91A 1KMIZ 1KILB 3IN6A 1IC2A 3RL0B 2RMZA 3TSIA 3M9HA 2NPSA 3I5CA 3Q5PA 1AQ5A 1SLQA 1MFZA 3H1IJ 1JMMA 1J1EC 5AVZB 1OW8A 5CCHD 3V2RA 1ZN5A 4TLFA 2YNYA 1N7SB 3Q3DA 2WSCJ 1L0LG 5CBNA 2ZT9B 3C8VA 3R4YA 1AQTA 1PP9G 1YITP 1LTTC 2WT7A 2QJKC 4DJGA 2ZFCA 4I2LC 2OQQA 2QM8A 5H2FH 4JYBA 3WMM0 3D71A 2C0XA 4I7ZB 1JB0J 4WY4D 4XE5B 1S1CX 1SQVG 2R3CA 1FU1A 1J1DB 3VOPA 1AJYA 2WSFJ 3T97A 4B86A 2E75B 2ZJSE 2Y9ZA 1H0TB 1VQMP 3L74J 1K9MQ 2GA1A 5AW7B 2L5GB 2KB7P 1LTJB 2WSSH 4JYCA 4N3YB 2LR2A 3BCCJ 4BRYB 1OVVA 3TGUG 4H13C 1KTMA 4PV1C 2XV5A 1BCCG 1H89A 1L0NJ 1YI2P 3AE9C 1S2EA 3V6IA 2P7JA 2ZYGA 1W2BO 1NJIQ 2IBZD 1NHLA 1M1JC 3HUSB 2KUBA 3KZIE 1T2KD 2KIKA 3SWKA 1E79H 1G1IA 2FY8A 3AE2C 1CZQA 3O6QB 2PP6A 3JSVC 1LT9B 4TT3H 1ZLLA 1BGYE 1M1JA 4UB6E 3IR9A 2HG5D 3H6PA 1VF5B 3CCLP 3GW6A 1YYCA 3MTUE 4HJGH 1M57D 1N73C 3G9RA 3M0AA 2HODA 5AW9B 3MGNA 3PH0A 1ZRTE 2FYUK 4D6TJ 2WSEH 1AVOA 1N2DC 1VL2A 1SQBD 1QL1A 3IFMA 3U1CA 5B66E 5CCGD 1FZGA 2Y9YA 2IFMA 3CCQP 1URQC 5B5EH 4C7RA 3Q1MA 2JEEA 1PFIA 3WU2H 4GIFA 5KJ7D 3CX5E 1ZW0A 3SWYA 5GTIE 2C0WA 1LWUC 4R4LA 1QLED 3RBXA 3MUDC 5AW0B 3G71P 2KI7B 1PGQA 5AVXB 1URQA 1BGYG 3G4SP 5K5GB 1NTKG 4EIJA 3TNUB 2YO2A 1LWUA 1YTZT 1G2CA 2FYUG 3MUDA 3CCUP 2IBZI 2NPSD 2QJYC 3B5NB 3HD7B 2DW3A 3KXDA 3VMXA 1NU1D 5CMZA 4HYTB 3W67A 3CLQA 4JF7A 3L73J 2QRXA 3L35A 1P84I 3TF5A 1JY2O 2K9JB 1S5LE 1PZQA 1N7LA 1EXJA 4I6MC 2BCCE 1NH4A 3RBZA 2I1JA 2NRGA 5H2FE 1SQBE 2A45G 2WTYA 1HJ0A 3H25A 2D2CB 1M90Q 1U7MA 1LTIC 4ZMDA 2B87B 2W8ZA 1MUUA 2O1KA 2FKWB 1NTME 1ZV8A 1NTZG 1SQPE 4U3FG 2ZXEB 3L72G 1SQBK 1HJBA 4L74A 1KORA 3GF3A 3M06A 3VMAA 1NWQA 1GL2C 3OW2O 2XDJA 3GMAA 1NTMK
chains in the Genus database with same CATH topology
1SQPK 5CCHA 3M91A 4AUWA 4IFFA 2XZRA 2R32A 2E42A 3TK1A 2WSFH 2OYHA 2WPSA 4GKGA 1CI6A 4C7NA 1N73A 2FFDC 4C46A 5AW8B 4EOTA 4ZKUA 2IFNA 2P2UA 2P1JA 3RK2D 1KILD 3NXSA 1FZCA 4OH8B 1HGVA 1RE3A 5APSA 5CCGC 5BVZA 1FJPA 1IFDA 3HTKB 2YMYA 3M9QA 2HPCA 1VPCA 1VDFA 2N1TD 3RL0C 3RK3B 2OARA 5KJ7C 4WY4A 4N6JA 3EFGA 2WWWA 2YO3A 1GW4A 1IJDB 2Q9IA 3L4FA 2FFDA 3R2PA 2OYHB 4KHXA 1T8ZA 2R5BA 1J1EB 1CI6B 1NTZK 3TYYA 1KZUB 5CCGA 1FZFA 1NKNA 1DH3A 2VRSA 2YKPA 1FZCB 3NFQA 3OAKA 4O9BA 1N7SC 3KYQA 1SQQK 1L0LK 1GL2B 1NU1K 1JTHA 2IX7C 1FOSF 4DZOA 5KJ7A 1ZR4A 4RESB 1T3JA 2HPCB 1JY3N 3A3YB 2GM4A 5AW2B 5AW1B 3VTPC 1Z56A 1JY2N 1X8YA 1L4AC 1WRGA 1HH0A 2JJLA 4N78D 2NPSC 2J59M 3PP5A 2FFDB 1OWAA 2HYNA 5KTBA 5AVWB 3KPEA 1LTBC 5CHXA 1N7SA 3A5TA 1IO4A 2HFED 4AYCA 3BRVB 3A2AA 5AVVB 2HLOA 3RK2B 3EQ2A 1KILB 1KFNA 1IC2A 3RL0B 2LKMA 1HBWA 1RE4C 1J1DC 1JTHB 5APXA 1N86A 1L4AA 2GUSA 5APVA 2CPSA 3TSIA 3M9HA 2NPSA 3V5BA 3I5CA 1AQ5A 1SLQA 1MFZA 1JMMA 1GZLA 1XTGB 1J1EC 5AVZB 2KSJA 1G1JA 2Q5UA 3KDPB 2XKMA 3P8CE 5CCHD 1W2EA 3KQGA 3HTKA 2W6BA 3V2RA 5CJ4A 1A02F 1ZN5A 3H32B 1GU4A 3N4XA 3VP9A 2YNYA 1N7SB 1LTJC 2WZ7A 1RE4A 3BRTB 2I1KA 2KOGA 1KQLA 1FZEA 2W27A 3O8ZA 1JY3P 5BU5A 4WB4A 5AW6B 1L4AB 1S9KE 1LTTC 1LTAC 5AVRB 2WT7A 1QL2A 2NPSB 2ZFCA 3NTNA 4I2LC 1JY2P 2QM8A 4JYBA 3WMM0 5AVSB 3M9BA 2C0XA 3B5ND 3HD7D 3P8CD 4WY4D 1NOHA 1SQXK 3V4WA 2Q7CA 4ZKPA 1LTJA 4XE5B 4Y99B 2IPPA 1FOSE 2Z5HA 2C9NY 2XNXA 3B8EB 4W80A 1GL2A 3HUSC 2M3BA 1URQD 3VMZA 2R3CA 1FU1A 1SFCD 1J1DB 3RK2C 1KILC 3VOPA 2KYVA 3T97A 4B86A 1GK6A 1S9KD 1LTSC 2Z5IA 2N1TC 4N78E 2WT7B 2HODB 3CL3D 1LT9C 1L0NK 2A45I 3HRNA 5AW7B 2L5GB 3HUSA 2KB7P 1LTJB 3GHGC 3HE4A 1KILA 1HUCA 1FZAA 4XA4A 4JYCA 4N3YB 2FYZA 2PAJA 5APWA 2OYIC 2N1TA 2C9LY 2XV5A 4LGDE 1OXZA 1H89A 1LT9A 2CPBA 2P7JA 1HGZA 3GHGA 3H32A 4WBAA 2O1JA 3L36A 3OA7A 3M0DC 5BU8B 4Y99C 1NHLA 1M1JC 3HUSB 4DOJA 1T2KD 2MJZA 1SQVK 3V4QA 5AVUB 3HE4B 5AW3B 2POHA 4I1LA 1NKZB 2OYIA 2Z4EA 1JY3O 1G1IA 1IK9A 3E1IA 4HH2A 1SFCB 2N1TB 1CZQA 2H43A 5AVQB 2QM7A 2PP6A 4M3LA 1HTLC 1JOCA 4AQRD 1FDMA 3RK3D 3NMDA 1NAFA 1LT9B 5KLVK 3M0DA 1ZLLA 1LWUB 4W7ZA 1M1JA 1AFOA 1JNMA 3G3ZA 3GHGB 3HE5B 1JCDA 3IR9A 1FZBA 3BASA 2HG5D 2WITA 1A02J 5CCHC 3LW5H 5AVYB 3H6PA 1HVVA 1YYCA 1RF0C 3MTUE 3VYIA 1JCCA 1XTCC 2OYIB 1IFNA 1N73C 1GL2D 3M0AA 1GW3A 1FAVA 1HWTC 2YKOA 2HODA 5AW9B 3MGNA 3LIEA 1LTGC 1MV8A 1GK4A 2FYUK 1RF1C 1J2JB 2WSEH 1JO5A 2H7HA 1N2DC 1M1JB 1KFMA 1EQ7A 1QL1A 3MD0A 2J58A 3IFMA 1FJKA 3B5NC 3HD7C 4WY4C 3U1CA 3L37A 1RF0A 5CCGD 2E43A 1FZGA 3A7OA 1M7LA 2IFMA 1URQC 3VN0A 1SVFA 1SFCC 3RL0D 4C7RA 3TNUA 2JEEA 1PFIA 3V2QA 4GIFA 5APYA 5KJ7D 3OJAB 1RF1A 1GTWA 3SWYA 5APTA 2GUVA 2C0WA 4LC1A 1LWUC 2O01H 2WPRA 3B5NA 3HD7A 2XU6A 3N7NA 5AW0B 1MZ9A 3VMYA 1GU5A 2A45H 3C9IA 2BASA 5AVXB 1URQA 1N7SD 1T3UA 1SFCA 4W7YA 1LGHB 3UIAA 4C7NB 1N73B 5APQA 1IFIA 4EIJA 1H8AA 1H88A 2R5DA 3TNUB 2YO2A 1LWUA 1YTZT 1RF1B 1G2CA 1FBMA 3HE5A 1L4AD 5AVTB 3MUDA 1NO4A 2NPSD 1DX7A 4IFMA 2KP8A 3B5NB 1E5WA 3HD7B 4WY4B 3VMXA 2W6AA 2M8RA 5CMZA 4HYTB 3BVHA 3CLQA 1T2KC 1SP4A 4JF7A 1URQB 1ZR2A 2WPQA 2N9BA 3P32A 3L35A 3II6A 3V2NA 1JY2O 3P7KA 2P67A 4LLHA 1N7LA 3MIWA 1IFMA 4I6MC 1CW5A 5APUA 1DEBA 1NH4A 2WSCH 2I1JA 4GT1A 3U1AA 1JUNA 1G2CB 3RK3C 2H8PD 2A45G 2WTYA 1CSBA 1IFJA 5AW4B 1LTIC 2FXMA 3U59A 1MUUA 2OYHC 2O1KA 2Q3IA 5AW5B 2FKWB 1ZV8A 2ZXEB 3LIDA 1NTKK 1GD2E 3BATA 5CJ0A 1X9VA 1SQBK 1YTZI 1HJBA 1FZCC 3CI9A 4IFDK 1RE3C 1GDTA 3M06A 2KLVA 1NWQA 1GL2C 3VP8A 2XDJA 1WT6A 2YKQA 3P8MC 3SWFA 1X79B 1RY3A 1NTMK 3V2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5C A;  4LC1 A;  3M91 A;  4AUW A;  2XZR A;  2WPR A;  1SLQ A;  2P7J A;  1MFZ A;  2R32 A;  2E42 A;  1GZL A;  3TK1 A;  2XU6 A;  3L36 A;  5AW0 B;  2WPS A;  5AVZ B;  4GKG A;  1CI6 A;  2Q5U A;  3KDP B;  3VMY A;  1GU5 A;  4C7N A;  2BAS A;  1T2K D;  3KQG A;  3HTK A;  4C46 A;  5AW8 B;  4EOT A;  3V4Q A;  1A02 F;  5AVU B;  5AVX B;  3HE4 B;  5AW3 B;  1GU4 A;  2P2U A;  2YNY A;  3NXS A;  5APS A;  3UIA A;  4C7N B;  5APQ A;  1KQL A;  1H8A A;  1H88 A;  2W27 A;  2R5D A;  3TNU B;  2YO2 A;  1CZQ A;  3O8Z A;  5AVQ B;  2QM7 A;  4M3L A;  4AQR D;  5AW6 B;  1S9K E;  3HE5 A;  2WT7 A;  5AVR B;  3NMD A;  1NAF A;  2WWW A;  5AVT B;  2YO3 A;  2ZFC A;  3M0D A;  3NTN A;  4I2L C;  2QM8 A;  2KP8 A;  4JYB A;  5AVS B;  3M9B A;  1JNM A;  3HE5 B;  4KHX A;  3VMX A;  3IR9 A;  2Q7C A;  3V4W A;  2W6A A;  4XE5 B;  2R5B A;  1FOS E;  1CI6 B;  2IPP A;  2Z5H A;  5CMZ A;  3TYY A;  4HYT B;  2C9N Y;  1A02 J;  3B8E B;  5AVY B;  1T2K C;  1SP4 A;  1DH3 A;  2VRS A;  2WPQ A;  2N9B A;  1YYC A;  3VMZ A;  2R3C A;  3V5B A;  3VYI A;  3NFQ A;  3OAK A;  3P32 A;  3L35 A;  3T97 A;  3M0A A;  3P7K A;  4B86 A;  1FOS F;  2P67 A;  1FAV A;  4DZO A;  1HWT C;  4RES B;  1GK6 A;  1S9K D;  5AW9 B;  3MGN A;  3LIE A;  4I6M C;  2Z5I A;  5APU A;  3A3Y B;  4GT1 A;  5AW2 B;  1MV8 A;  5AW1 B;  3VTP C;  1G2C B;  2WT7 B;  1JUN A;  1GK4 A;  2JJL A;  1X8Y A;  1J2J B;  2H7H A;  2WTY A;  1CSB A;  5AW4 B;  1OWA A;  3MD0 A;  5AW7 B;  1MUU A;  3L37 A;  5AVW B;  2Q3I A;  3HE4 A;  5AW5 B;  3A5T A;  1HUC A;  2E43 A;  1IO4 A;  3A7O A;  2ZXE B;  3LID A;  4AYC A;  1GD2 E;  4JYC A;  3A2A A;  5AVV B;  1HJB A;  3VN0 A;  1HBW A;  5APW A;  3TNU A;  3M06 A;  5APX A;  2C9L Y;  1NWQ A;  5APY A;  3P8M C;  3SWF A;  2XV5 A;  1GTW A;  5APV A;  1OXZ A;  3M9H A;  1H89 A;  5APT A; 
#chains in the Genus database with same CATH topology
 1SQP K;  5CCH A;  3M91 A;  3H1L D;  4AUW A;  1QVG O;  4GKG A;  2KSE A;  3H1I G;  3SSU A;  2P2U A;  1DIP A;  4L75 A;  5BVZ A;  1FJP A;  1IFD A;  1KN7 A;  2YMY A;  3M9Q A;  2HPC A;  2E76 C;  2E5Y A;  2OAR A;  4WY4 A;  4A7P A;  3EFG A;  1IJD B;  1SQQ E;  1JMB A;  2W90 A;  3R2P A;  1NU1 E;  1J1E B;  4BXL A;  2BCC G;  1FZF A;  4GOF A;  2XND H;  3MP7 B;  4H44 C;  3NFQ A;  4Z1M H;  1SQQ K;  1Q81 Q;  1Q82 Q;  4EI2 A;  4H13 D;  1NU1 K;  4H0L B;  1FOS F;  3ZDM A;  4PV1 D;  1NTM G;  3F89 A;  1SS1 A;  1SQP G;  2AXC A;  5AW2 B;  3VTP C;  3E1R A;  1L0L D;  2JJL A;  1X8Y A;  2J59 M;  3AE8 C;  2FFD B;  1PPJ G;  5KTB A;  1PP9 D;  1EDJ A;  2K37 A;  3BRV B;  2QIW A;  5AVV B;  2HLO A;  4WWI A;  2LKM A;  1M8O B;  2M5A A;  3S9O A;  2CPS A;  5TIS E;  3AEE C;  3V5B A;  1SQV D;  3PJS K;  1LNQ A;  2G8Y A;  1BSH A;  3KZI H;  3AE7 C;  1G1J A;  3KDP B;  2XKM A;  2LXB A;  3HTK A;  2W6B A;  2JP3 A;  3VP9 A;  3K5B A;  3USS A;  2WZ7 A;  1SQQ G;  5B5E E;  3QWO C;  3H1H G;  1EZV E;  2W27 A;  1JY3 P;  5BU5 A;  4HKZ H;  3CC7 P;  1PL5 A;  5AW6 B;  1L4A B;  1S9K E;  5AVR B;  4UB6 H;  3L70 G;  1JY2 P;  1NOH A;  3TGU D;  3V4W A;  1VQ7 P;  1BE3 G;  1BCC D;  2KNC A;  1URQ D;  4GDO A;  1QGK B;  1S4X A;  4RO0 A;  3FXE A;  1ZOY C;  1GK6 A;  1Q7Y Q;  2OGU A;  3CCJ P;  5GTH E;  2HOD B;  1SQX J;  2H88 C;  1PP9 E;  4D6T G;  2LXC B;  4R4M A;  2O01 J;  2Y0C A;  3H1J E;  4XA4 A;  2M3E A;  4Y28 J;  3CX5 H;  2OYI C;  2C9L Y;  1SQV E;  2PRR A;  4LGD E;  1OXZ A;  1AV1 A;  2QVA A;  2ZXX A;  1Y8A A;  2CPB A;  3RK3 E;  1HGZ A;  3H32 A;  3OA7 A;  1EZV G;  3WUV A;  4Y99 C;  2FBW C;  4DOJ A;  2MJZ A;  1SQV K;  3HE4 B;  3CME P;  2OYI A;  2Z4E A;  3MZW B;  2MKV A;  1IK9 A;  3E1I A;  3D6Y A;  2UWJ E;  2V7Q J;  4EYY Q;  2N1T B;  2QM7 A;  4AQR D;  1FDM A;  5DJT B;  1DD3 A;  2FYN B;  2YIU B;  1LWU B;  3TGU E;  2QA4 P;  1AFO A;  3G3Z A;  3GHG B;  3CPW O;  1BCC E;  1MFT A;  5AVY B;  1HVV A;  1RF0 C;  1IK7 A;  2E74 C;  1S5L H;  2W83 C;  1IFN A;  1GL2 D;  1DD4 A;  3L73 G;  3CXH H;  2V4H A;  3LIE A;  3H1J G;  3H1K E;  1BGY D;  1GK4 A;  1RF1 C;  3F5H A;  1JO5 A;  2H7H A;  1NTK D;  1EQ7 A;  3L37 A;  1RF0 A;  1OW7 A;  2FYU D;  3CWB E;  1M7L A;  1OW6 A;  4YTP C;  4IL6 E;  2E76 D;  3OJA B;  1ZRT D;  1RF1 A;  2JO1 A;  5DJU B;  3A0H H;  2K3R A;  4LC1 A;  3IF4 A;  3Q2Y A;  2H89 C;  4PD4 H;  1R5S A;  3C9I A;  4H44 D;  4W7Y A;  1IFI A;  3CX5 D;  4OGQ C;  1NTZ D;  2QJP C;  3HE5 A;  4U3F D;  1NO4 A;  3L72 D;  1RQU A;  1E5W A;  4WY4 B;  1LP1 B;  1K05 A;  3AE6 C;  1Y47 A;  3H1K G;  1SP4 A;  2IZ0 A;  2K1A A;  2N9B A;  4DT0 A;  3P32 A;  2WPV B;  3V2N A;  2K88 A;  3P7K A;  4YXD C;  4LLH A;  4ASW A;  3H1I D;  3CWB G;  3E7K A;  1IFM A;  4IOI H;  5APU A;  1DEB A;  3U1A A;  1NTK E;  3RK3 C;  3S4R A;  5AW4 B;  2FYU E;  1PGO A;  3U59 A;  2OYH C;  1QVF O;  3Q5S A;  3A0B H;  1NTK K;  3BAT A;  4OWF A;  1YTZ I;  1KYO E;  5KLV J;  1GDT A;  5TIS H;  2KLV A;  2SPZ A;  2BCC D;  1WT6 A;  2YKQ A;  3SWF A;  4NPE A;  3CXH D;  1X79 B;  3V2P A;  1KB9 H;  3TDK A;  1NVO A;  4DCK A;  2OYH A;  4C7N A;  1N73 A;  1NTM D;  2WVR A;  4C46 A;  1R8E A;  1SQP D;  5AW8 B;  4ZKU A;  2IFN A;  3KHU A;  3H1L J;  5APS A;  2KS1 A;  3D6Z A;  3HTK B;  2WSE J;  1PPJ D;  1VPC A;  3FGA D;  1NTZ E;  3RL0 C;  4U3F E;  3L72 E;  4N6J A;  2WWW A;  3L75 J;  1AA0 A;  1PGJ A;  4PD4 D;  1CI6 B;  1NTZ K;  1NKN A;  2RKL A;  1DH3 A;  2VRS A;  1VQ5 P;  2YKP A;  1FZC B;  3CX5 I;  4O9B A;  1N7S C;  3KYQ A;  3H1I E;  2ZT9 C;  4DZO A;  1T3J A;  3CCS P;  5GTH H;  2GM4 A;  3CC2 P;  1SQQ D;  1Z56 A;  2R44 A;  4N78 D;  2WMM A;  3I56 P;  3H1H D;  1OWA A;  2HYN A;  3S1K A;  1KC8 Q;  2K9Y A;  3KPE A;  1SQX G;  2M0B A;  5CHX A;  1N7S A;  1BDD A;  1IO4 A;  2HFE D;  3L70 D;  1L0L J;  1OIP A;  4PJ0 E;  1KFN A;  1HBW A;  1J1D C;  1JTH B;  3CXH E;  1BE3 D;  2GUS A;  2E75 C;  1EXI A;  3WUU A;  1GZL A;  1XTG B;  5KKZ B;  1VQP P;  1VQ9 P;  2KSJ A;  2AEF A;  2Q5U A;  3P8C E;  1YIJ P;  1W2E A;  3KQG A;  5KAF E;  5CJ4 A;  1A02 F;  1GU4 A;  3H32 B;  2E74 D;  1LTJ C;  2Q6Q A;  3BRT B;  1PPJ E;  2FXO A;  3L74 E;  1EC5 A;  2I1K A;  2P10 A;  2B88 A;  1KQL A;  4D6T D;  3B4S A;  1H0T A;  3L71 J;  4ZNC A;  3W68 A;  3A0H E;  2OYO A;  2NPS B;  4RJT A;  2P58 A;  1KB9 D;  3NTN A;  1PIX A;  1KQG B;  3M9B A;  4PD4 E;  1VQO P;  4ZKP A;  2Q7C A;  1LTJ A;  1OVR A;  4Y99 B;  2Z5H A;  3BCC E;  1GL2 A;  3HUS C;  3VMZ A;  5EFW B;  1VQL P;  3RK2 C;  1AVY A;  1L0N E;  1EZV D;  2KYV A;  4BRY A;  2W6J H;  1S9K D;  2Q3E A;  1LTS C;  3CCE P;  4L73 A;  4N78 E;  2WT7 B;  1ZP0 C;  3RL0 g;  3H1H E;  3CL3 D;  1LT9 C;  1L0N K;  1S5L X;  3HRN A;  3HUS A;  1S3J A;  1BDC A;  4MN4 C;  3L70 E;  1HUC A;  4IL6 H;  1VF5 C;  2FYZ A;  2I8D A;  2PAJ A;  5APW A;  1BE3 E;  2AXT H;  1EDL A;  3T97 B;  4OGQ D;  2QJK B;  2ZYA A;  3PLN A;  3WUT A;  1GMJ A;  1LT9 A;  2JWD A;  3SFD C;  3L74 G;  4WBA A;  3M0D C;  3L73 D;  3H1J D;  4GOE A;  2O01 N;  3A0B E;  5E79 H;  3PTZ A;  1Q2N A;  4D6T E;  3BCC G;  5AVQ B;  1M56 D;  1VQK P;  4M3L A;  1KB9 E;  3RK3 D;  5M1B A;  5KLV K;  3M0D A;  1L0N G;  1JNM A;  3HE5 B;  1TU3 F;  3BAS A;  2WIT A;  1A02 J;  2OTK E;  3LW5 H;  1OX3 A;  2IDB A;  2O3J A;  1EDK A;  3VYI A;  3AE4 C;  1QX8 A;  3AE5 C;  4H13 B;  1GW3 A;  1FAV A;  4PV1 B;  1HWT C;  2YKO A;  5KAI E;  4K3A A;  1MV8 A;  4OGQ B;  1J2J B;  1M1J B;  3JCU E;  1FJK A;  3B5N C;  3HD7 C;  2KXP B;  1KYO H;  1EZV I;  1JEK A;  1BGY J;  3A7O A;  3B71 A;  4JBZ A;  1SFC C;  3RL0 D;  3TNU A;  1X0T A;  1KQS O;  3H1K D;  5KLV G;  2GUV A;  4ASV A;  2O01 H;  1HF9 A;  2WPR A;  3B5N A;  3HD7 A;  3L73 E;  2XU6 A;  3VMY A;  1GU5 A;  2A45 H;  3CWB D;  2BAS A;  4RKU J;  2D2C C;  1LT1 A;  1N7S D;  1T3U A;  1SFC A;  2JR8 A;  1LGH B;  4C7N B;  1N73 B;  2ZT9 D;  5APQ A;  2K9J A;  1H8A A;  1H88 A;  2J5U A;  3CCV P;  2KP8 A;  3FXD A;  2B87 A;  3L75 G;  3BVH A;  1MKM A;  2G3A A;  2B9B A;  1URQ B;  2QSI A;  2WPQ A;  2RN0 A;  2ZAE B;  3II6 A;  1NGM B;  3CC4 P;  2E75 D;  3MIW A;  1EDI A;  1UII A;  1CW5 A;  2IYO A;  2WSC H;  4GT1 A;  1JUN A;  1G2C B;  1P84 H;  1CSB A;  2OTJ P;  3AED C;  2ITA A;  4PJ0 H;  1YJW P;  3LID A;  4KJM A;  1KIL E;  2AEJ A;  1RE3 C;  4XFJ A;  4H0L C;  2QJY B;  2IZ1 A;  3EFF K;  2R32 A;  2E42 A;  1KQF B;  2WSF H;  5KAF H;  1LJ2 A;  2WPS A;  3G6E P;  1M1K Q;  2BCC J;  2ZVO B;  2FFD C;  3CMA P;  1SQB J;  3NXS A;  3RK2 D;  4OH8 B;  1KYO D;  1HGV A;  1RE3 A;  3CD6 P;  1RHZ B;  2AXT E;  1DEE G;  1NTM J;  4CPG A;  1SQX D;  1SQP J;  2A06 E;  2YO3 A;  3L4F A;  3L71 G;  2FFD A;  4KHX A;  1OMI A;  1T8Z A;  3TYY A;  1KZU B;  1N8R Q;  5E79 E;  1VF5 D;  2Q1K A;  2YMK A;  3FX0 A;  1GL2 B;  2IX7 C;  2PFX A;  1OFC X;  4RES B;  2HPC B;  1JY3 N;  5TJH A;  3A3Y B;  5AW1 B;  1JY2 N;  1L4A C;  1OVU A;  1HH0 A;  4OVN F;  1YJN P;  2KK7 A;  3FWL A;  1T6A A;  1BSN A;  5AVW B;  1LTB C;  1NYH A;  3A5T A;  1SQQ J;  2ZVN B;  3A2A A;  1NU1 J;  2IYP A;  3RK2 B;  3EQ2 A;  3H1H J;  2E76 B;  1RE4 C;  5APX A;  1N86 A;  1L4A A;  5APV A;  3AE3 C;  3L70 J;  1P84 D;  4IL6 X;  5KLI C;  2Y0D A;  1BE3 J;  4H44 B;  4KT0 J;  3N4X A;  2Y0E A;  2A06 G;  1VQ6 P;  2JDI H;  1RE4 A;  2KOG A;  1SQX E;  1FZE A;  3O8Z A;  1KV4 A;  4WB4 A;  2M5A B;  1LTA C;  1QL2 A;  5AVS B;  3B5N D;  3HD7 D;  3P8C D;  2E5T A;  1SQX K;  3RGU A;  1FOS E;  2IPP A;  1KYO I;  3AEA C;  2C9N Y;  2XNX A;  3B8E B;  4W80 A;  2M3B A;  3L74 D;  2OTL P;  1SFC D;  1KIL C;  3GG2 A;  2B89 A;  5KAI H;  3PRJ A;  1X22 A;  2Z5I A;  2N1T C;  4BWN A;  3JCU H;  1Q86 Q;  2FYN C;  2A45 I;  4UB8 H;  2YIU C;  2D2C D;  3BCC D;  2QG4 A;  1VQ4 P;  2IBZ E;  3GHG C;  3HE4 A;  1KIL A;  4NPD A;  2KNC B;  1FZA A;  1VQ8 P;  1L0N D;  2R3S A;  3D70 A;  2JKV A;  2N1T A;  3AEF C;  1P84 E;  4I7Z C;  3GHG A;  2O1J A;  3L36 A;  3GLM A;  5BU8 B;  4NPF X;  3CCM P;  1K73 Q;  3V4Q A;  5AVU B;  5AW3 B;  1QEX A;  2POH A;  4I1L A;  1NKZ B;  1PP9 J;  2KZI A;  1W5C E;  1JY3 O;  4HH2 A;  1SFC B;  2CK3 H;  3H1J J;  1YHQ P;  2H43 A;  1HTL C;  1JOC A;  1FS0 E;  3NMD A;  1NAF A;  4W7Z A;  4L76 A;  1JCD A;  1FZB A;  1SQV J;  1L2P A;  1USD A;  3FWN A;  4U7J A;  5CCH C;  5KLV D;  3CXH I;  2QE7 H;  1YBK A;  2KLU A;  1JCC A;  5C39 A;  1XTC C;  2OYI B;  1FE6 A;  1OZH A;  2IBZ G;  4H0L D;  3I55 P;  1LTG C;  2N9Y B;  4HB1 A;  2FXP A;  1D7M A;  1YQ3 C;  1RH5 B;  3QH9 A;  1VQN P;  1KFM A;  4JQ0 D;  3MD0 A;  2J58 A;  4WY4 C;  2E43 A;  4JPZ B;  4GOD A;  3TGU J;  2ZYD A;  1BCC J;  3VN0 A;  1SVF A;  3L75 D;  1FDO A;  2AEM A;  3AE1 C;  3V2Q A;  5APY A;  3JC2 2;  4PD4 I;  3AEB C;  1GTW A;  5APT A;  2KZJ A;  4QMA A;  3AEG C;  1U7J A;  3N7N A;  1LP1 A;  1MZ9 A;  2HR3 A;  3ABV C;  5CBO A;  3H1K J;  2E74 B;  3UIA A;  3O6Q A;  4WVZ A;  1SQB G;  1U57 A;  2R5D A;  3CWB J;  4YPC A;  1Y9B A;  1RF1 B;  3GF7 A;  1FBM A;  1L4A D;  5AVT B;  1IFP A;  1K8A Q;  1DX7 A;  4IFM A;  2W6A A;  5KLV E;  2M8R A;  1UIX A;  1KD1 Q;  1S72 P;  1T2K C;  1ZR2 A;  1K04 A;  2PGD A;  2P67 A;  2WQY C;  3AEC C;  2RH0 A;  2H8P D;  3MHV A;  1FDI A;  1WMK A;  1USE A;  1IFJ A;  3H1L E;  1ZME C;  3EWK A;  2FXM A;  1YQ4 C;  2Q3I A;  5AW5 B;  4K35 A;  1GD2 E;  5CJ0 A;  3L71 D;  1X9V A;  5L8R J;  1IZN B;  3L75 E;  1KB9 I;  2BEZ F;  1FZC C;  3CI9 A;  4IFD K;  3C1L A;  2QJP B;  3VP8 A;  1PGP A;  3P8M C;  1NU1 G;  1RY3 A;  4EDF A;  3LW5 J;  3WU2 E;  2BEQ D;  3SFE C;  3Q5R A;  4IFF A;  2XZR A;  4UB8 E;  3TK1 A;  1CI6 A;  1R5L A;  4EOT A;  1NTK J;  2NZ2 A;  2P1J A;  1FZC A;  1KIL D;  1NAY A;  3ITK A;  5CCG C;  3PHL A;  2FYU J;  1VDF A;  2N1T D;  3RK3 B;  5KJ7 C;  1ZXG A;  1GW4 A;  2Q9I A;  1FC2 C;  1L0L E;  2YXQ B;  2OYH B;  3IAO A;  5KLI B;  5KKZ C;  2R5B A;  1RQV A;  4YXW H;  5CCG A;  5B66 H;  3OAK A;  3H1L G;  2KS1 B;  1L0L K;  1PV3 A;  3CCR P;  2QEX P;  1JTH A;  5KJ7 A;  1ZR4 A;  2A06 D;  1Q90 D;  5GTI H;  2JWA A;  1WRG A;  2NPS C;  3PP5 A;  1YJ9 P;  2V7Q H;  1NTZ J;  4U3F J;  1JM0 A;  3L72 J;  2YXR B;  3L71 E;  4AYC A;  2L91 A;  1KMI Z;  1KIL B;  3IN6 A;  1IC2 A;  3RL0 B;  2RMZ A;  3TSI A;  3M9H A;  2NPS A;  3I5C A;  3Q5P A;  1AQ5 A;  1SLQ A;  1MFZ A;  3H1I J;  1JMM A;  1J1E C;  5AVZ B;  1OW8 A;  5CCH D;  3V2R A;  1ZN5 A;  4TLF A;  2YNY A;  1N7S B;  3Q3D A;  2WSC J;  1L0L G;  5CBN A;  2ZT9 B;  3C8V A;  3R4Y A;  1AQT A;  1PP9 G;  1YIT P;  1LTT C;  2WT7 A;  2QJK C;  4DJG A;  2ZFC A;  4I2L C;  2OQQ A;  2QM8 A;  5H2F H;  4JYB A;  3WMM 0;  3D71 A;  2C0X A;  4I7Z B;  1JB0 J;  4WY4 D;  4XE5 B;  1S1C X;  1SQV G;  2R3C A;  1FU1 A;  1J1D B;  3VOP A;  1AJY A;  2WSF J;  3T97 A;  4B86 A;  2E75 B;  2ZJS E;  2Y9Z A;  1H0T B;  1VQM P;  3L74 J;  1K9M Q;  2GA1 A;  5AW7 B;  2L5G B;  2KB7 P;  1LTJ B;  2WSS H;  4JYC A;  4N3Y B;  2LR2 A;  3BCC J;  4BRY B;  1OVV A;  3TGU G;  4H13 C;  1KTM A;  4PV1 C;  2XV5 A;  1BCC G;  1H89 A;  1L0N J;  1YI2 P;  3AE9 C;  1S2E A;  3V6I A;  2P7J A;  2ZYG A;  1W2B O;  1NJI Q;  2IBZ D;  1NHL A;  1M1J C;  3HUS B;  2KUB A;  3KZI E;  1T2K D;  2KIK A;  3SWK A;  1E79 H;  1G1I A;  2FY8 A;  3AE2 C;  1CZQ A;  3O6Q B;  2PP6 A;  3JSV C;  1LT9 B;  4TT3 H;  1ZLL A;  1BGY E;  1M1J A;  4UB6 E;  3IR9 A;  2HG5 D;  3H6P A;  1VF5 B;  3CCL P;  3GW6 A;  1YYC A;  3MTU E;  4HJG H;  1M57 D;  1N73 C;  3G9R A;  3M0A A;  2HOD A;  5AW9 B;  3MGN A;  3PH0 A;  1ZRT E;  2FYU K;  4D6T J;  2WSE H;  1AVO A;  1N2D C;  1VL2 A;  1SQB D;  1QL1 A;  3IFM A;  3U1C A;  5B66 E;  5CCG D;  1FZG A;  2Y9Y A;  2IFM A;  3CCQ P;  1URQ C;  5B5E H;  4C7R A;  3Q1M A;  2JEE A;  1PFI A;  3WU2 H;  4GIF A;  5KJ7 D;  3CX5 E;  1ZW0 A;  3SWY A;  5GTI E;  2C0W A;  1LWU C;  4R4L A;  1QLE D;  3RBX A;  3MUD C;  5AW0 B;  3G71 P;  2KI7 B;  1PGQ A;  5AVX B;  1URQ A;  1BGY G;  3G4S P;  5K5G B;  1NTK G;  4EIJ A;  3TNU B;  2YO2 A;  1LWU A;  1YTZ T;  1G2C A;  2FYU G;  3MUD A;  3CCU P;  2IBZ I;  2NPS D;  2QJY C;  3B5N B;  3HD7 B;  2DW3 A;  3KXD A;  3VMX A;  1NU1 D;  5CMZ A;  4HYT B;  3W67 A;  3CLQ A;  4JF7 A;  3L73 J;  2QRX A;  3L35 A;  1P84 I;  3TF5 A;  1JY2 O;  2K9J B;  1S5L E;  1PZQ A;  1N7L A;  1EXJ A;  4I6M C;  2BCC E;  1NH4 A;  3RBZ A;  2I1J A;  2NRG A;  5H2F E;  1SQB E;  2A45 G;  2WTY A;  1HJ0 A;  3H25 A;  2D2C B;  1M90 Q;  1U7M A;  1LTI C;  4ZMD A;  2B87 B;  2W8Z A;  1MUU A;  2O1K A;  2FKW B;  1NTM E;  1ZV8 A;  1NTZ G;  1SQP E;  4U3F G;  2ZXE B;  3L72 G;  1SQB K;  1HJB A;  4L74 A;  1KOR A;  3GF3 A;  3M06 A;  3VMA A;  1NWQ A;  1GL2 C;  3OW2 O;  2XDJ A;  3GMA A;  1NTM K; 
#chains in the Genus database with same CATH homology
 1SQP K;  5CCH A;  3M91 A;  4AUW A;  4IFF A;  2XZR A;  2R32 A;  2E42 A;  3TK1 A;  2WSF H;  2OYH A;  2WPS A;  4GKG A;  1CI6 A;  4C7N A;  1N73 A;  2FFD C;  4C46 A;  5AW8 B;  4EOT A;  4ZKU A;  2IFN A;  2P2U A;  2P1J A;  3RK2 D;  1KIL D;  3NXS A;  1FZC A;  4OH8 B;  1HGV A;  1RE3 A;  5APS A;  5CCG C;  5BVZ A;  1FJP A;  1IFD A;  3HTK B;  2YMY A;  3M9Q A;  2HPC A;  1VPC A;  1VDF A;  2N1T D;  3RL0 C;  3RK3 B;  2OAR A;  5KJ7 C;  4WY4 A;  4N6J A;  3EFG A;  2WWW A;  2YO3 A;  1GW4 A;  1IJD B;  2Q9I A;  3L4F A;  2FFD A;  3R2P A;  2OYH B;  4KHX A;  1T8Z A;  2R5B A;  1J1E B;  1CI6 B;  1NTZ K;  3TYY A;  1KZU B;  5CCG A;  1FZF A;  1NKN A;  1DH3 A;  2VRS A;  2YKP A;  1FZC B;  3NFQ A;  3OAK A;  4O9B A;  1N7S C;  3KYQ A;  1SQQ K;  1L0L K;  1GL2 B;  1NU1 K;  1JTH A;  2IX7 C;  1FOS F;  4DZO A;  5KJ7 A;  1ZR4 A;  4RES B;  1T3J A;  2HPC B;  1JY3 N;  3A3Y B;  2GM4 A;  5AW2 B;  5AW1 B;  3VTP C;  1Z56 A;  1JY2 N;  1X8Y A;  1L4A C;  1WRG A;  1HH0 A;  2JJL A;  4N78 D;  2NPS C;  2J59 M;  3PP5 A;  2FFD B;  1OWA A;  2HYN A;  5KTB A;  5AVW B;  3KPE A;  1LTB C;  5CHX A;  1N7S A;  3A5T A;  1IO4 A;  2HFE D;  4AYC A;  3BRV B;  3A2A A;  5AVV B;  2HLO A;  3RK2 B;  3EQ2 A;  1KIL B;  1KFN A;  1IC2 A;  3RL0 B;  2LKM A;  1HBW A;  1RE4 C;  1J1D C;  1JTH B;  5APX A;  1N86 A;  1L4A A;  2GUS A;  5APV A;  2CPS A;  3TSI A;  3M9H A;  2NPS A;  3V5B A;  3I5C A;  1AQ5 A;  1SLQ A;  1MFZ A;  1JMM A;  1GZL A;  1XTG B;  1J1E C;  5AVZ B;  2KSJ A;  1G1J A;  2Q5U A;  3KDP B;  2XKM A;  3P8C E;  5CCH D;  1W2E A;  3KQG A;  3HTK A;  2W6B A;  3V2R A;  5CJ4 A;  1A02 F;  1ZN5 A;  3H32 B;  1GU4 A;  3N4X A;  3VP9 A;  2YNY A;  1N7S B;  1LTJ C;  2WZ7 A;  1RE4 A;  3BRT B;  2I1K A;  2KOG A;  1KQL A;  1FZE A;  2W27 A;  3O8Z A;  1JY3 P;  5BU5 A;  4WB4 A;  5AW6 B;  1L4A B;  1S9K E;  1LTT C;  1LTA C;  5AVR B;  2WT7 A;  1QL2 A;  2NPS B;  2ZFC A;  3NTN A;  4I2L C;  1JY2 P;  2QM8 A;  4JYB A;  3WMM 0;  5AVS B;  3M9B A;  2C0X A;  3B5N D;  3HD7 D;  3P8C D;  4WY4 D;  1NOH A;  1SQX K;  3V4W A;  2Q7C A;  4ZKP A;  1LTJ A;  4XE5 B;  4Y99 B;  2IPP A;  1FOS E;  2Z5H A;  2C9N Y;  2XNX A;  3B8E B;  4W80 A;  1GL2 A;  3HUS C;  2M3B A;  1URQ D;  3VMZ A;  2R3C A;  1FU1 A;  1SFC D;  1J1D B;  3RK2 C;  1KIL C;  3VOP A;  2KYV A;  3T97 A;  4B86 A;  1GK6 A;  1S9K D;  1LTS C;  2Z5I A;  2N1T C;  4N78 E;  2WT7 B;  2HOD B;  3CL3 D;  1LT9 C;  1L0N K;  2A45 I;  3HRN A;  5AW7 B;  2L5G B;  3HUS A;  2KB7 P;  1LTJ B;  3GHG C;  3HE4 A;  1KIL A;  1HUC A;  1FZA A;  4XA4 A;  4JYC A;  4N3Y B;  2FYZ A;  2PAJ A;  5APW A;  2OYI C;  2N1T A;  2C9L Y;  2XV5 A;  4LGD E;  1OXZ A;  1H89 A;  1LT9 A;  2CPB A;  2P7J A;  1HGZ A;  3GHG A;  3H32 A;  4WBA A;  2O1J A;  3L36 A;  3OA7 A;  3M0D C;  5BU8 B;  4Y99 C;  1NHL A;  1M1J C;  3HUS B;  4DOJ A;  1T2K D;  2MJZ A;  1SQV K;  3V4Q A;  5AVU B;  3HE4 B;  5AW3 B;  2POH A;  4I1L A;  1NKZ B;  2OYI A;  2Z4E A;  1JY3 O;  1G1I A;  1IK9 A;  3E1I A;  4HH2 A;  1SFC B;  2N1T B;  1CZQ A;  2H43 A;  5AVQ B;  2QM7 A;  2PP6 A;  4M3L A;  1HTL C;  1JOC A;  4AQR D;  1FDM A;  3RK3 D;  3NMD A;  1NAF A;  1LT9 B;  5KLV K;  3M0D A;  1ZLL A;  1LWU B;  4W7Z A;  1M1J A;  1AFO A;  1JNM A;  3G3Z A;  3GHG B;  3HE5 B;  1JCD A;  3IR9 A;  1FZB A;  3BAS A;  2HG5 D;  2WIT A;  1A02 J;  5CCH C;  3LW5 H;  5AVY B;  3H6P A;  1HVV A;  1YYC A;  1RF0 C;  3MTU E;  3VYI A;  1JCC A;  1XTC C;  2OYI B;  1IFN A;  1N73 C;  1GL2 D;  3M0A A;  1GW3 A;  1FAV A;  1HWT C;  2YKO A;  2HOD A;  5AW9 B;  3MGN A;  3LIE A;  1LTG C;  1MV8 A;  1GK4 A;  2FYU K;  1RF1 C;  1J2J B;  2WSE H;  1JO5 A;  2H7H A;  1N2D C;  1M1J B;  1KFM A;  1EQ7 A;  1QL1 A;  3MD0 A;  2J58 A;  3IFM A;  1FJK A;  3B5N C;  3HD7 C;  4WY4 C;  3U1C A;  3L37 A;  1RF0 A;  5CCG D;  2E43 A;  1FZG A;  3A7O A;  1M7L A;  2IFM A;  1URQ C;  3VN0 A;  1SVF A;  1SFC C;  3RL0 D;  4C7R A;  3TNU A;  2JEE A;  1PFI A;  3V2Q A;  4GIF A;  5APY A;  5KJ7 D;  3OJA B;  1RF1 A;  1GTW A;  3SWY A;  5APT A;  2GUV A;  2C0W A;  4LC1 A;  1LWU C;  2O01 H;  2WPR A;  3B5N A;  3HD7 A;  2XU6 A;  3N7N A;  5AW0 B;  1MZ9 A;  3VMY A;  1GU5 A;  2A45 H;  3C9I A;  2BAS A;  5AVX B;  1URQ A;  1N7S D;  1T3U A;  1SFC A;  4W7Y A;  1LGH B;  3UIA A;  4C7N B;  1N73 B;  5APQ A;  1IFI A;  4EIJ A;  1H8A A;  1H88 A;  2R5D A;  3TNU B;  2YO2 A;  1LWU A;  1YTZ T;  1RF1 B;  1G2C A;  1FBM A;  3HE5 A;  1L4A D;  5AVT B;  3MUD A;  1NO4 A;  2NPS D;  1DX7 A;  4IFM A;  2KP8 A;  3B5N B;  1E5W A;  3HD7 B;  4WY4 B;  3VMX A;  2W6A A;  2M8R A;  5CMZ A;  4HYT B;  3BVH A;  3CLQ A;  1T2K C;  1SP4 A;  4JF7 A;  1URQ B;  1ZR2 A;  2WPQ A;  2N9B A;  3P32 A;  3L35 A;  3II6 A;  3V2N A;  1JY2 O;  3P7K A;  2P67 A;  4LLH A;  1N7L A;  3MIW A;  1IFM A;  4I6M C;  1CW5 A;  5APU A;  1DEB A;  1NH4 A;  2WSC H;  2I1J A;  4GT1 A;  3U1A A;  1JUN A;  1G2C B;  3RK3 C;  2H8P D;  2A45 G;  2WTY A;  1CSB A;  1IFJ A;  5AW4 B;  1LTI C;  2FXM A;  3U59 A;  1MUU A;  2OYH C;  2O1K A;  2Q3I A;  5AW5 B;  2FKW B;  1ZV8 A;  2ZXE B;  3LID A;  1NTK K;  1GD2 E;  3BAT A;  5CJ0 A;  1X9V A;  1SQB K;  1YTZ I;  1HJB A;  1FZC C;  3CI9 A;  4IFD K;  1RE3 C;  1GDT A;  3M06 A;  2KLV A;  1NWQ A;  1GL2 C;  3VP8 A;  2XDJ A;  1WT6 A;  2YKQ A;  3P8M C;  3SWF A;  1X79 B;  1RY3 A;  1NTM K;  3V2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...