3BCCG

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
RQFGHLTRVRHLITYSLSPFEQRPFPHYFSKGVPNVWRRLRACILRVAPPFLAFYLLYTWGTQEFEKSKRKNPAAYVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 16
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3bccG00
3L75G 1L0LG 1KB9H 5KLVG 1BGYG 1NTMG 1KYOH 3H1LG 4D6TG 3L73G 4PD4H 1PPJG 1NU1G 3CX5H 1SQXG 2A06G 3H1HG 1SQBG 3CWBG 1PP9G 3CXHH 3L70G 1L0NG 1P84H 1EZVG 3BCCG 3H1IG 1SQVG 3H1KG 3TGUG 1BCCG 1NTZG 2FYUG 4U3FG 3H1JG 1SQQG 3L72G 3L71G 1NTKG 1SQPG 2IBZG 1BE3G 2BCCG 3L74G
chains in the Genus database with same CATH superfamily
3VN0A 3AEGC 2UWJE 4UB6H 1T3JA 1LTJC 3M9QA 3O8ZA 3CWBE 3H1ID 2XNDH 2WSEH 1NTZE 1AVYA 1W2BO 4L74A 1NJIQ 5AVUB 4WBAA 1AQTA 3M9HA 3G71P 1DEBA 4LGDE 2WSCJ 5AVQB 3L70D 1G1IA 1URQB 5AVXB 4Y99B 1K9MQ 2YKPA 3L75J 2HPCB 1DH3A 1LTTC 1RY3A 2JEEA 1FAVA 3B5NC 3C1LA 1S5LX 2I1KA 1N7SC 5KTBA 3CCRP 1KV4A 1LGHB 3H1HD 1G2CA 3CX5D 2FYNC 5KJ7C 4DOJA 1Z56A 1MV8A 3H1JD 4PD4I 2FYUD 2OTJP 2FFDA 2N1TB 1M56D 1KILB 1ZOYC 5CCHA 1YITP 5KLVD 1JOCA 3FXEA 1Q90D 1VQPP 1L2PA 3RK2C 4YXDC 1QLED 1PIXA 1LWUB 1D7MA 1NTKJ 2FFDB 2CPSA 3M91A 1GW4A 2HYNA 4EDFA 1JB0J 2E74D 3JCUH 3MIWA 4H13C 4IFDK 4BXLA 2FXPA 5AW9B 1S9KD 1VF5D 3D6ZA 1JMMA 1IFDA 1FC2C 1AVOA 2NPSD 3H1JJ 3A2AA 1DD3A 3F5HA 3B71A 2FYZA 3QH9A 1PPJE 1NU1G 4IL6X 1IC2A 2HLOA 2KS1A 2LKMA 1Q2NA 3OJAB 5AVRB 1E79H 4Y99C 2FKWB 3LW5J 4HKZH 1WT6A 2O3JA 2MKVA 1YYCA 2W8ZA 2C0XA 1L0LK 1VL2A 3PH0A 1KYOE 3AEFC 1WRGA 3L37A 2O01H 3CD6P 4OGQB 3AEAC 2WT7B 2N1TC 1G1JA 3L74G 1E5WA 3ABVC 2J5UA 3SFDC 2E5TA 2YKQA 1KMIZ 4CPGA 2KI7B 4UB6E 3CWBG 2Q9IA 4BWNA 1NTZG 1LWUC 3L71J 1NKZB 2B89A 2FFDC 3P8MC 2BCCD 3CXHI 1KB9H 5CCHC 2QM7A 3GHGB 3S9OA 4L73A 1EDKA 1N86A 2ZAEB 3RK2D 1PL5A 1MFZA 2QJKB 1SFCA 1OW8A 3L72D 1YHQP 4Z1MH 1YQ3C 2D2CC 1OVUA 2AXTE 4YPCA 3D70A 1LTIC 4YTPC 5CBNA 3BCCD 3GG2A 1EZVE 5AW8B 2WZ7A 1K05A 3SWFA 3V2QA 2BCCJ 1OVRA 1SQPE 3CPWO 1BE3D 2IZ1A 3FGAD 2KLVA 5APXA 1SQQK 2JWDA 1FDIA 1PP9D 4PD4D 2PAJA 3CXHH 2ZYAA 3PLNA 4PV1B 1JY3O 3SWYA 4OGQC 3L72J 1URQD 3OAKA 1Q7YQ 3JCUE 1H88A 3BCCJ 3H1HG 4KJMA 1ZN5A 1OIPA 1SQVE 3H1KE 1ZV8A 3GW6A 3V2NA 2FYUG 2O01N 3H1LD 5KLVG 3L73D 2N1TD 3GHGC 1PPJG 1KILD 1PP9J 4TT3H 2WWWA 3M0AA 1QL1A 4DCKA 2QJYB 2R32A 3A0BH 1BCCD 2QM8A 1JCCA 4NPEA 2K9YA 2L91A 1WMKA 2QJKC 1FJPA 2GA1A 2V7QJ 3BRTB 1FZCA 3HRNA 3NTNA 1NGMB 1MFTA 1LP1A 3A5TA 2YIUC 2N9YB 2G8YA 4I7ZC 1RQUA 1FZAA 4C7NA 2WPRA 1W2EA 3A7OA 4L75A 1SFCC 2A06D 3H1LJ 3Q5RA 3CCVP 1KQSO 2QIWA 4N6JA 2FY8A 3GLMA 3TGUJ 1GU5A 3MUDA 2KNCA 4PV1C 1P84D 4WY4A 3Q2YA 3SFEC 4WWIA 3O6QB 3PHLA 2BASA 4L76A 1KQLA 1KB9E 2QSIA 2NPSA 4N3YB 5AVWB 2W27A 3CX5I 2E74B 4WY4B 1OVVA 1RE4A 3RK3B 1GL2B 1ZRTD 3VMZA 1IZNB 1FOSE 1T3UA 1LT1A 3HUSB 1BDDA 2Q5UA 3CCMP 2AEJA 4TLFA 2IYPA 1EZVG 1X8YA 2QJYC 2WITA 2BEZF 1YJ9P 1BSNA 2Q1KA 5CJ0A 1HF9A 4W80A 2P67A 1SQPG 1SLQA 1L0LD 1EDJA 4ASVA 1L4AD 1QVGO 1SQXD 4WB4A 1TU3F 2E42A 3TDKA 3JSVC 3MGNA 3EFFK 4W7YA 5M1BA 3CXHE 3V6IA 4EYYQ 1Q82Q 3BASA 1FZCC 1OMIA 3KDPB 1N73A 5AW2B 3TSIA 2ITAA 1GDTA 1NH4A 5KKZB 1LNQA 3KYQA 4XFJA 1H8AA 1Q81Q 2Y9YA 1L0LJ 1BE3G 3TNUA 3D6YA 5KAFE 4D6TE 1KQFB 1UIIA 1NAYA 2WVRA 2H89C 3MUDC 1FU1A 4HB1A 1NYHA 4MN4C 3H6PA 4PV1D 1YTZI 2E74C 4WY4C 1M90Q 1FZFA 2H7HA 1NU1J 5CJ4A 3RK3C 4HH2A 1VF5C 3G4SP 1HUCA 1NTMK 1SQBE 2NPSC 4AQRD 3P8CE 1KFMA 3CC4P 2ZT9B 3Q5PA 1M8OB 1K04A 1SQQD 1SQVK 1AA0A 1YBKA 2KB7P 1RE4C 3L73G 5AW3B 2J58A 1N2DC 1Y8AA 2AXCA 2OARA 5BU5A 4R4LA 2KOGA 1URQA 3CCUP 4IOIH 5AW1B 1L0NK 1GW3A 1GK6A 2ZJSE 2HPCA 4K3AA 2FXOA 2SPZA 1MZ9A 3U59A 3USSA 2K9JB 1M57D 3VOPA 4JF7A 3FWLA 4N78E 1SQQJ 5KKZC 1DIPA 1NTKD 2A06G 2N1TA 1EQ7A 3L75E 2AXTH 1KILA 3F89A 2K1AA 1JNMA 3RL0B 5GTIH 1N73C 2YKOA 3CL3D 3H1IE 1LWUA 2E76B 4JQ0D 1QX8A 4H0LB 4RESB 1KN7A 2KSJA 1T2KD 1J1EC 2LXBA 3L70E 3GF3A 4XA4A 5AVZB 1NAFA 3FWNA 2WSFJ 1PV3A 2KSEA 2YXQB 2WPVB 4WY4D 2WPSA 3V4WA 1YJWP 2OYIB 3LIEA 3CC7P 3RK3D 1RE3A 1GL2D 3H1HE 3RBZA 1VQNP 3CX5E 4I1LA 3H25A 1DX7A 1USDA 1XTGB 1ZR2A 3H1JE 2FYUE 1YJNP 4I6MC 2Z4EA 2JDIH 2PRRA 5AVVB 2OGUA 3AEBC 3AE6C 1BGYD 3AE3C 5KLVE 4D6TG 4PD4H 1GMJA 1SQXG 3M06A 1HJ0A 1JCDA 1MUUA 4NPDA 1URQC 3KXDA 5K5GB 3JC22 1RHZB 1YTZT 2YXRB 2V7QH 3L71D 2WT7A 2HODB 2MJZA 1JUNA 1RQVA 2KZJA 1S9KE 3RL0C 1SQBG 1Q86Q 1X22A 2JKVA 5BU8B 1JM0A 5B5EE 1FE6A 1L4AA 2IBZD 2WPQA 1BGYJ 2AEMA 2Q7CA 1KILC 1P84I 2O1JA 3HD7A 3GHGA 4H0LC 5EFWB 1A02F 1NU1K 5AW5B 2ZYDA 1LT9B 4ASWA 1L4AB 1VQ5P 1GD2E 3WUTA 3HD7B 4KT0J 2HG5D 2P1JA 3NFQA 4JYBA 1IFJA 1KFNA 2WSEJ 1ZP0C 1RH5B 3RBXA 1ZLLA 3TYYA 3L75G 2ZT9D 4JYCA 3IR9A 1X9VA 2M5AB 1RE3C 3H1IG 3E1IA 2R5DA 5GTIE 1QGKB 2RMZA 1NTZK 3PP5A 2BCCE 1KC8Q 1NTMD 3ZDMA 3E1RA 2ZVNB 5L8RJ 3L70G 2YMKA 4U3FD 2XKMA 4IFFA 3L72E 1RF0A 1VQ8P 3AECC 1NTKG 1KORA 4NPFX 3TK1A 2XU6A 3AE9C 4M3LA 3WU2E 1IK7A 1S5LH 2R3CA 3MP7B 1L0ND 1A02J 1MKMA 3BCCE 1SS1A 3MHVA 3RL0D 1HVVA 3L4FA 1Y9BA 3H1JG 5DJUB 4C46A 1JY2O 5KAFH 1L4AC 3Q1MA 3B8EB 1NTMJ 3FXDA 1BE3E 2OQQA 2E76D 3HD7C 1EC5A 2IZ0A 1YQ4C 1NKNA 3HE4B 4H0LD 1PP9E 1SQVJ 3H1KJ 4PD4E 3TGUD 4U3FJ 4B86A 1LJ2A 2J59M 1GTWA 2P58A 2HFED 1W5CE 4R4MA 4WVZA 1FOSF 4Y28J 1JTHB 3E7KA 1IFMA 2B87A 3AE2C 1L0NJ 3AE8C 4HJGH 1HTLC 2Z5IA 3KHUA 1PGPA 3V2RA 2IFMA 2P10A 5AVYB 2FYUK 2JO1A 3L36A 3H1LE 3O6QA 2NRGA 3L73E 1KILE 2B87B 5KLVK 5AVTB 4AYCA 2IFNA 4IL6H 2W6AA 1HWTC 2O01J 1BCCE 1J1DB 3SSUA 2LXCB 3OW2O 3L71G 5CBOA 1BDCA 1FS0E 2XNXA 1KQGB 1QVFO 1GL2A 2WSCH 1EXJA 3V5BA 3CMAP 3HUSA 1USEA 4H44D 1LTBC 3WUVA 2GUVA 1NO4A 1S3JA 5TJHA 1VQ7P 3CI9A 4KHXA 1VQLP 1RF0C 2A06E 3AE4C 2Y0EA 1OFCX 2N9BA 4LLHA 1NWQA 1AFOA 1YI2P 2ZFCA 3S4RA 3NXSA 1LTAC 2XV5A 2M3BA 4UB8H 1OWAA 1T6AA 1P84E 5APSA 1U57A 2BEQD 4W7ZA 2BCCG 4PJ0H 2QEXP 2VRSA 3A0HH 3HD7D 2OTKE 2IYOA 3WMM0 1M1JA 1T8ZA 4GDOA 1IK9A 3PRJA 3GF7A 3L72G 3CCLP 4EIJA 3G3ZA 1LTJB 1NU1D 1ZRTE 2H88C 1EDLA 3CX5H 1JEKA 1CSBA 3I5CA 1M1JB 3BCCG 1S5LE 4DZOA 2H8PD 1J1DC 1ZW0A 3LIDA 5GTHE 3P7KA 2WQYC 2YMYA 3P32A 5TISH 1L0LE 1T2KC 3FX0A 2Y0DA 1SQPK 1SQXE 1PP9G 1JMBA 3KZIH 2V4HA 3M0DA 1H89A 2YNYA 3EFGA 3LW5H 4I2LC 1N7SB 2FBWC 2IBZI 1GL2C 1LTSC 3S1KA 5APYA 3CWBD 2FYNB 5E79E 2R44A 2RH0A 3HUSC 1HGZA 2R5BA 2I1JA 1NTZD 5B5EH 1AQ5A 4OVNF 4U7JA 1HH0A 3AE1C 1R8EA 2KIKA 2IDBA 5AW4B 3W68A 2QE7H 2M8RA 3H1LG 5APVA 1SQBJ 2Y9ZA 1FJKA 3AE7C 5AW7B 4GKGA 2PFXA 1PZQA 3VMYA 2JP3A 2FXMA 4BRYA 1FZBA 2K9JA 1BCCG 4IL6E 4GIFA 3L74J 4H13B 3I56P 3B4SA 4ZKPA 2W6JH 3CWBJ 2R3SA 3C9IA 1NTZJ 1M1JC 2XZRA 4BRYB 4XE5B 1KTMA 1SQQE 1ZXGA 1ZR4A 3C8VA 1IFIA 4O9BA 1KD1Q 2KXPB 5CCGC 3IN6A 2B88A 2JR8A 1HBWA 3D71A 3Q5SA 2QA4P 4AUWA 3W67A 4UB8E 2M0BA 3N4XA 2ZXEB 1EXIA 2A45I 3KPEA 3QWOC 2NZ2A 2GM4A 4PJ0E 2OYIA 3H1IJ 2H43A 3A0HE 3TF5A 3M0DC 2ZT9C 1NTKE 3WU2H 2K3RA 1PPJD 3L70J 1G2CB 2KK7A 3R4YA 4ZNCA 3WUUA 5H2FH 3Q3DA 1OX3A 1X0TA 3ITKA 1L0LG 1SVFA 2B9BA 2HODA 5KAIH 3HTKA 5TISE 1R5SA 3H1HJ 1KYOD 3CCJP 2CPBA 1J2JB 1GZLA 2A45H 4RKUJ 2FYUJ 3K5BA 2Q3EA 3T97A 3KZIE 3U1CA 2RN0A 3I55P 5KLVJ 2D2CB 3H32A 2YO3A 2C9LY 3HTKB 4IFMA 1IJDB 4H44B 3RK3E 1PGOA 4RO0A 3G9RA 1KB9I 4YXWH 2K37A 3T97B 2P2UA 1LT9A 1M7LA 1OW6A 2KYVA 1XTCC 2E76C 1FDOA 1BGYE 2M3EA 3H32B 5APWA 2KLUA 3MZWB 1DD4A 2KS1B 4JPZB 3IFMA 5CCGD 5DJTB 1SQXK 1QL2A 1S2EA 1VQMP 2Z5HA 3PTZA 3L71E 3V4QA 3VYIA 3N7NA 3VMAA 1S4XA 3B5ND 2JWAA 2M5AA 4OWFA 4OH8B 2OYIC 2Q6QA 1N7SD 3M9BA 5AW6B 1EZVD 5APUA 1OZHA 1S72P 2ZYGA 5AW0B 1SQBK 2E75B 2OTLP 5KJ7D 3MTUE 1SQPD 1SQQG 2IBZE 1IFNA 1NOHA 3VTPC 2KP8A 1VQOP 1GK4A 1P84H 2E5YA 5APTA 1JY3P 1JY3N 1FZGA 2YIUB 4H13D 1AJYA 2W6BA 4I7ZB 4H44C 1SQVD 1DEEG 3H1KD 5APQA 2XDJA 3VP9A 1R5LA 1SFCB 3II6A 1SQPJ 2IX7C 3AEDC 3RL0g 3EWKA 1PFIA 2Q3IA 1JY2P 1JY2N 1FZEA 3NMDA 4JBZA 3HE4A 2W83C 4QMAA 1VQ6P 1Y47A 2QG4A 5GTHH 1OW7A 2WMMA 5KLIB 1QEXA 1LT9C 3CCQP 5H2FE 2KUBA 1NTME 3CCSP 3SWKA 1JTHA 2POHA 5KAIE 2AEFA 4RJTA 2QRXA 4U3FE 2E75C 2P7JA 1K73Q 2G3AA 1IFPA 1BE3J 2HR3A 3PJSK 3V2PA 2I8DA 1NTKK 3L35A 5E79H 3MD0A 3EQ2A 2L5GB 3GMAA 1NVOA 1RF1A 1L0NE 1BSHA 3BATA 4A7PA 4EOTA 3G6EP 1BGYG 3VMXA 2C9NY 5B66H 5CCHD 4EI2A 1N8RQ 1KB9D 1VPCA 1X79B 1RF1B 1VDFA 2KZIA 2YO2A 3TGUE 1U7JA 1VQ9P 3L73J 2WTYA 1FZCB 5CHXA 2WSSH 3AEEC 2QVAA 1LP1B 2Y0CA 1KZUB 2D2CD 3KQGA 1S1CX 2E43A 1BCCJ 4C7NB 2ZVOB 1HGVA 3VP8A 1VQ4P 2ZXXA 1YIJP 5KLIC 2PP6A 2IBZG 2O1KA 1VQKP 1HJBA 4C7RA 3CC2P 2QJPB 4GOFA 5AVSB 2KNCB 2K88A 2OYHA 1N7LA 3CXHD 4HYTB 3OA7A 4OGQD 3CMEP 3HE5A 1VF5B 2W90A 1U7MA 3IF4A 1LTJA 2NPSB 1NHLA 1SP4A 2OYHB 2GUSA 2WSFH 4ZMDA 3IAOA 4K35A 2JJLA 2IPPA 1ZMEC 4GODA 2E75D 1IO4A 3HE5B 4D6TD 3AE5C 5CCGA 1M1KQ 1PGQA 3BVHA 1RF1C 3BRVB 5CMZA 1CZQA 2OYOA 1FBMA 1KYOI 2C0WA 1FDMA 3B5NA 3CLQA 1NTMG 1H0TA 1N7SA 5BVZA 1SQBD 3U1AA 1GU4A 5KJ7A 3P8CD 1SQVG 3H1KG 2PGDA 4U3FG 5C39A 2A45G 3B5NB 3L74D 4D6TJ 1LTGC 1SFCD 2RKLA 4LC1A 4ZKUA 1H0TB 1SQXJ 1NU1E 1CW5A 1N73B 2QJPC 4GT1A 1CI6A 2LR2A 1L0NG 4GOEA 3RGUA 4DJGA 3A0BE 1OXZA 3TNUB 1JO5A 1KYOH 3R2PA 2CK3H 3RK2B 2DW3A 1J1EB 3A3YB 3UIAA 1PGJA 3CCEP 5B66E 1CI6B 1AV1A 3TGUG 1K8AQ 2OYHC 4N78D 4DT0A 1EZVI 1EDIA 1UIXA 3L75D 3L74E
chains in the Genus database with same CATH topology
3L75G 1L0LG 1KB9H 5KLVG 1BGYG 1NTMG 1KYOH 3H1LG 4D6TG 3L73G 4PD4H 1PPJG 1NU1G 3CX5H 1SQXG 2A06G 3H1HG 1SQBG 3CWBG 1PP9G 3CXHH 3L70G 1L0NG 1P84H 1EZVG 3BCCG 3H1IG 1SQVG 3H1KG 3TGUG 1BCCG 1NTZG 2FYUG 4U3FG 3H1JG 1SQQG 3L72G 3L71G 1NTKG 1SQPG 2IBZG 1BE3G 2BCCG 3L74G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L75 G;  1L0L G;  1KB9 H;  5KLV G;  1BGY G;  1NTM G;  1KYO H;  3H1L G;  4D6T G;  3L73 G;  4PD4 H;  1PPJ G;  1NU1 G;  3CX5 H;  1SQX G;  2A06 G;  3H1H G;  1SQB G;  3CWB G;  1PP9 G;  3CXH H;  3L70 G;  1L0N G;  1P84 H;  1EZV G;  3BCC G;  3H1I G;  1SQV G;  3H1K G;  3TGU G;  1BCC G;  1NTZ G;  2FYU G;  4U3F G;  3H1J G;  1SQQ G;  3L72 G;  3L71 G;  1NTK G;  1SQP G;  2IBZ G;  1BE3 G;  2BCC G;  3L74 G; 
#chains in the Genus database with same CATH topology
 3VN0 A;  3AEG C;  2UWJ E;  4UB6 H;  1T3J A;  1LTJ C;  3M9Q A;  3O8Z A;  3CWB E;  3H1I D;  2XND H;  2WSE H;  1NTZ E;  1AVY A;  1W2B O;  4L74 A;  1NJI Q;  5AVU B;  4WBA A;  1AQT A;  3M9H A;  3G71 P;  1DEB A;  4LGD E;  2WSC J;  5AVQ B;  3L70 D;  1G1I A;  1URQ B;  5AVX B;  4Y99 B;  1K9M Q;  2YKP A;  3L75 J;  2HPC B;  1DH3 A;  1LTT C;  1RY3 A;  2JEE A;  1FAV A;  3B5N C;  3C1L A;  1S5L X;  2I1K A;  1N7S C;  5KTB A;  3CCR P;  1KV4 A;  1LGH B;  3H1H D;  1G2C A;  3CX5 D;  2FYN C;  5KJ7 C;  4DOJ A;  1Z56 A;  1MV8 A;  3H1J D;  4PD4 I;  2FYU D;  2OTJ P;  2FFD A;  2N1T B;  1M56 D;  1KIL B;  1ZOY C;  5CCH A;  1YIT P;  5KLV D;  1JOC A;  3FXE A;  1Q90 D;  1VQP P;  1L2P A;  3RK2 C;  4YXD C;  1QLE D;  1PIX A;  1LWU B;  1D7M A;  1NTK J;  2FFD B;  2CPS A;  3M91 A;  1GW4 A;  2HYN A;  4EDF A;  1JB0 J;  2E74 D;  3JCU H;  3MIW A;  4H13 C;  4IFD K;  4BXL A;  2FXP A;  5AW9 B;  1S9K D;  1VF5 D;  3D6Z A;  1JMM A;  1IFD A;  1FC2 C;  1AVO A;  2NPS D;  3H1J J;  3A2A A;  1DD3 A;  3F5H A;  3B71 A;  2FYZ A;  3QH9 A;  1PPJ E;  1NU1 G;  4IL6 X;  1IC2 A;  2HLO A;  2KS1 A;  2LKM A;  1Q2N A;  3OJA B;  5AVR B;  1E79 H;  4Y99 C;  2FKW B;  3LW5 J;  4HKZ H;  1WT6 A;  2O3J A;  2MKV A;  1YYC A;  2W8Z A;  2C0X A;  1L0L K;  1VL2 A;  3PH0 A;  1KYO E;  3AEF C;  1WRG A;  3L37 A;  2O01 H;  3CD6 P;  4OGQ B;  3AEA C;  2WT7 B;  2N1T C;  1G1J A;  3L74 G;  1E5W A;  3ABV C;  2J5U A;  3SFD C;  2E5T A;  2YKQ A;  1KMI Z;  4CPG A;  2KI7 B;  4UB6 E;  3CWB G;  2Q9I A;  4BWN A;  1NTZ G;  1LWU C;  3L71 J;  1NKZ B;  2B89 A;  2FFD C;  3P8M C;  2BCC D;  3CXH I;  1KB9 H;  5CCH C;  2QM7 A;  3GHG B;  3S9O A;  4L73 A;  1EDK A;  1N86 A;  2ZAE B;  3RK2 D;  1PL5 A;  1MFZ A;  2QJK B;  1SFC A;  1OW8 A;  3L72 D;  1YHQ P;  4Z1M H;  1YQ3 C;  2D2C C;  1OVU A;  2AXT E;  4YPC A;  3D70 A;  1LTI C;  4YTP C;  5CBN A;  3BCC D;  3GG2 A;  1EZV E;  5AW8 B;  2WZ7 A;  1K05 A;  3SWF A;  3V2Q A;  2BCC J;  1OVR A;  1SQP E;  3CPW O;  1BE3 D;  2IZ1 A;  3FGA D;  2KLV A;  5APX A;  1SQQ K;  2JWD A;  1FDI A;  1PP9 D;  4PD4 D;  2PAJ A;  3CXH H;  2ZYA A;  3PLN A;  4PV1 B;  1JY3 O;  3SWY A;  4OGQ C;  3L72 J;  1URQ D;  3OAK A;  1Q7Y Q;  3JCU E;  1H88 A;  3BCC J;  3H1H G;  4KJM A;  1ZN5 A;  1OIP A;  1SQV E;  3H1K E;  1ZV8 A;  3GW6 A;  3V2N A;  2FYU G;  2O01 N;  3H1L D;  5KLV G;  3L73 D;  2N1T D;  3GHG C;  1PPJ G;  1KIL D;  1PP9 J;  4TT3 H;  2WWW A;  3M0A A;  1QL1 A;  4DCK A;  2QJY B;  2R32 A;  3A0B H;  1BCC D;  2QM8 A;  1JCC A;  4NPE A;  2K9Y A;  2L91 A;  1WMK A;  2QJK C;  1FJP A;  2GA1 A;  2V7Q J;  3BRT B;  1FZC A;  3HRN A;  3NTN A;  1NGM B;  1MFT A;  1LP1 A;  3A5T A;  2YIU C;  2N9Y B;  2G8Y A;  4I7Z C;  1RQU A;  1FZA A;  4C7N A;  2WPR A;  1W2E A;  3A7O A;  4L75 A;  1SFC C;  2A06 D;  3H1L J;  3Q5R A;  3CCV P;  1KQS O;  2QIW A;  4N6J A;  2FY8 A;  3GLM A;  3TGU J;  1GU5 A;  3MUD A;  2KNC A;  4PV1 C;  1P84 D;  4WY4 A;  3Q2Y A;  3SFE C;  4WWI A;  3O6Q B;  3PHL A;  2BAS A;  4L76 A;  1KQL A;  1KB9 E;  2QSI A;  2NPS A;  4N3Y B;  5AVW B;  2W27 A;  3CX5 I;  2E74 B;  4WY4 B;  1OVV A;  1RE4 A;  3RK3 B;  1GL2 B;  1ZRT D;  3VMZ A;  1IZN B;  1FOS E;  1T3U A;  1LT1 A;  3HUS B;  1BDD A;  2Q5U A;  3CCM P;  2AEJ A;  4TLF A;  2IYP A;  1EZV G;  1X8Y A;  2QJY C;  2WIT A;  2BEZ F;  1YJ9 P;  1BSN A;  2Q1K A;  5CJ0 A;  1HF9 A;  4W80 A;  2P67 A;  1SQP G;  1SLQ A;  1L0L D;  1EDJ A;  4ASV A;  1L4A D;  1QVG O;  1SQX D;  4WB4 A;  1TU3 F;  2E42 A;  3TDK A;  3JSV C;  3MGN A;  3EFF K;  4W7Y A;  5M1B A;  3CXH E;  3V6I A;  4EYY Q;  1Q82 Q;  3BAS A;  1FZC C;  1OMI A;  3KDP B;  1N73 A;  5AW2 B;  3TSI A;  2ITA A;  1GDT A;  1NH4 A;  5KKZ B;  1LNQ A;  3KYQ A;  4XFJ A;  1H8A A;  1Q81 Q;  2Y9Y A;  1L0L J;  1BE3 G;  3TNU A;  3D6Y A;  5KAF E;  4D6T E;  1KQF B;  1UII A;  1NAY A;  2WVR A;  2H89 C;  3MUD C;  1FU1 A;  4HB1 A;  1NYH A;  4MN4 C;  3H6P A;  4PV1 D;  1YTZ I;  2E74 C;  4WY4 C;  1M90 Q;  1FZF A;  2H7H A;  1NU1 J;  5CJ4 A;  3RK3 C;  4HH2 A;  1VF5 C;  3G4S P;  1HUC A;  1NTM K;  1SQB E;  2NPS C;  4AQR D;  3P8C E;  1KFM A;  3CC4 P;  2ZT9 B;  3Q5P A;  1M8O B;  1K04 A;  1SQQ D;  1SQV K;  1AA0 A;  1YBK A;  2KB7 P;  1RE4 C;  3L73 G;  5AW3 B;  2J58 A;  1N2D C;  1Y8A A;  2AXC A;  2OAR A;  5BU5 A;  4R4L A;  2KOG A;  1URQ A;  3CCU P;  4IOI H;  5AW1 B;  1L0N K;  1GW3 A;  1GK6 A;  2ZJS E;  2HPC A;  4K3A A;  2FXO A;  2SPZ A;  1MZ9 A;  3U59 A;  3USS A;  2K9J B;  1M57 D;  3VOP A;  4JF7 A;  3FWL A;  4N78 E;  1SQQ J;  5KKZ C;  1DIP A;  1NTK D;  2A06 G;  2N1T A;  1EQ7 A;  3L75 E;  2AXT H;  1KIL A;  3F89 A;  2K1A A;  1JNM A;  3RL0 B;  5GTI H;  1N73 C;  2YKO A;  3CL3 D;  3H1I E;  1LWU A;  2E76 B;  4JQ0 D;  1QX8 A;  4H0L B;  4RES B;  1KN7 A;  2KSJ A;  1T2K D;  1J1E C;  2LXB A;  3L70 E;  3GF3 A;  4XA4 A;  5AVZ B;  1NAF A;  3FWN A;  2WSF J;  1PV3 A;  2KSE A;  2YXQ B;  2WPV B;  4WY4 D;  2WPS A;  3V4W A;  1YJW P;  2OYI B;  3LIE A;  3CC7 P;  3RK3 D;  1RE3 A;  1GL2 D;  3H1H E;  3RBZ A;  1VQN P;  3CX5 E;  4I1L A;  3H25 A;  1DX7 A;  1USD A;  1XTG B;  1ZR2 A;  3H1J E;  2FYU E;  1YJN P;  4I6M C;  2Z4E A;  2JDI H;  2PRR A;  5AVV B;  2OGU A;  3AEB C;  3AE6 C;  1BGY D;  3AE3 C;  5KLV E;  4D6T G;  4PD4 H;  1GMJ A;  1SQX G;  3M06 A;  1HJ0 A;  1JCD A;  1MUU A;  4NPD A;  1URQ C;  3KXD A;  5K5G B;  3JC2 2;  1RHZ B;  1YTZ T;  2YXR B;  2V7Q H;  3L71 D;  2WT7 A;  2HOD B;  2MJZ A;  1JUN A;  1RQV A;  2KZJ A;  1S9K E;  3RL0 C;  1SQB G;  1Q86 Q;  1X22 A;  2JKV A;  5BU8 B;  1JM0 A;  5B5E E;  1FE6 A;  1L4A A;  2IBZ D;  2WPQ A;  1BGY J;  2AEM A;  2Q7C A;  1KIL C;  1P84 I;  2O1J A;  3HD7 A;  3GHG A;  4H0L C;  5EFW B;  1A02 F;  1NU1 K;  5AW5 B;  2ZYD A;  1LT9 B;  4ASW A;  1L4A B;  1VQ5 P;  1GD2 E;  3WUT A;  3HD7 B;  4KT0 J;  2HG5 D;  2P1J A;  3NFQ A;  4JYB A;  1IFJ A;  1KFN A;  2WSE J;  1ZP0 C;  1RH5 B;  3RBX A;  1ZLL A;  3TYY A;  3L75 G;  2ZT9 D;  4JYC A;  3IR9 A;  1X9V A;  2M5A B;  1RE3 C;  3H1I G;  3E1I A;  2R5D A;  5GTI E;  1QGK B;  2RMZ A;  1NTZ K;  3PP5 A;  2BCC E;  1KC8 Q;  1NTM D;  3ZDM A;  3E1R A;  2ZVN B;  5L8R J;  3L70 G;  2YMK A;  4U3F D;  2XKM A;  4IFF A;  3L72 E;  1RF0 A;  1VQ8 P;  3AEC C;  1NTK G;  1KOR A;  4NPF X;  3TK1 A;  2XU6 A;  3AE9 C;  4M3L A;  3WU2 E;  1IK7 A;  1S5L H;  2R3C A;  3MP7 B;  1L0N D;  1A02 J;  1MKM A;  3BCC E;  1SS1 A;  3MHV A;  3RL0 D;  1HVV A;  3L4F A;  1Y9B A;  3H1J G;  5DJU B;  4C46 A;  1JY2 O;  5KAF H;  1L4A C;  3Q1M A;  3B8E B;  1NTM J;  3FXD A;  1BE3 E;  2OQQ A;  2E76 D;  3HD7 C;  1EC5 A;  2IZ0 A;  1YQ4 C;  1NKN A;  3HE4 B;  4H0L D;  1PP9 E;  1SQV J;  3H1K J;  4PD4 E;  3TGU D;  4U3F J;  4B86 A;  1LJ2 A;  2J59 M;  1GTW A;  2P58 A;  2HFE D;  1W5C E;  4R4M A;  4WVZ A;  1FOS F;  4Y28 J;  1JTH B;  3E7K A;  1IFM A;  2B87 A;  3AE2 C;  1L0N J;  3AE8 C;  4HJG H;  1HTL C;  2Z5I A;  3KHU A;  1PGP A;  3V2R A;  2IFM A;  2P10 A;  5AVY B;  2FYU K;  2JO1 A;  3L36 A;  3H1L E;  3O6Q A;  2NRG A;  3L73 E;  1KIL E;  2B87 B;  5KLV K;  5AVT B;  4AYC A;  2IFN A;  4IL6 H;  2W6A A;  1HWT C;  2O01 J;  1BCC E;  1J1D B;  3SSU A;  2LXC B;  3OW2 O;  3L71 G;  5CBO A;  1BDC A;  1FS0 E;  2XNX A;  1KQG B;  1QVF O;  1GL2 A;  2WSC H;  1EXJ A;  3V5B A;  3CMA P;  3HUS A;  1USE A;  4H44 D;  1LTB C;  3WUV A;  2GUV A;  1NO4 A;  1S3J A;  5TJH A;  1VQ7 P;  3CI9 A;  4KHX A;  1VQL P;  1RF0 C;  2A06 E;  3AE4 C;  2Y0E A;  1OFC X;  2N9B A;  4LLH A;  1NWQ A;  1AFO A;  1YI2 P;  2ZFC A;  3S4R A;  3NXS A;  1LTA C;  2XV5 A;  2M3B A;  4UB8 H;  1OWA A;  1T6A A;  1P84 E;  5APS A;  1U57 A;  2BEQ D;  4W7Z A;  2BCC G;  4PJ0 H;  2QEX P;  2VRS A;  3A0H H;  3HD7 D;  2OTK E;  2IYO A;  3WMM 0;  1M1J A;  1T8Z A;  4GDO A;  1IK9 A;  3PRJ A;  3GF7 A;  3L72 G;  3CCL P;  4EIJ A;  3G3Z A;  1LTJ B;  1NU1 D;  1ZRT E;  2H88 C;  1EDL A;  3CX5 H;  1JEK A;  1CSB A;  3I5C A;  1M1J B;  3BCC G;  1S5L E;  4DZO A;  2H8P D;  1J1D C;  1ZW0 A;  3LID A;  5GTH E;  3P7K A;  2WQY C;  2YMY A;  3P32 A;  5TIS H;  1L0L E;  1T2K C;  3FX0 A;  2Y0D A;  1SQP K;  1SQX E;  1PP9 G;  1JMB A;  3KZI H;  2V4H A;  3M0D A;  1H89 A;  2YNY A;  3EFG A;  3LW5 H;  4I2L C;  1N7S B;  2FBW C;  2IBZ I;  1GL2 C;  1LTS C;  3S1K A;  5APY A;  3CWB D;  2FYN B;  5E79 E;  2R44 A;  2RH0 A;  3HUS C;  1HGZ A;  2R5B A;  2I1J A;  1NTZ D;  5B5E H;  1AQ5 A;  4OVN F;  4U7J A;  1HH0 A;  3AE1 C;  1R8E A;  2KIK A;  2IDB A;  5AW4 B;  3W68 A;  2QE7 H;  2M8R A;  3H1L G;  5APV A;  1SQB J;  2Y9Z A;  1FJK A;  3AE7 C;  5AW7 B;  4GKG A;  2PFX A;  1PZQ A;  3VMY A;  2JP3 A;  2FXM A;  4BRY A;  1FZB A;  2K9J A;  1BCC G;  4IL6 E;  4GIF A;  3L74 J;  4H13 B;  3I56 P;  3B4S A;  4ZKP A;  2W6J H;  3CWB J;  2R3S A;  3C9I A;  1NTZ J;  1M1J C;  2XZR A;  4BRY B;  4XE5 B;  1KTM A;  1SQQ E;  1ZXG A;  1ZR4 A;  3C8V A;  1IFI A;  4O9B A;  1KD1 Q;  2KXP B;  5CCG C;  3IN6 A;  2B88 A;  2JR8 A;  1HBW A;  3D71 A;  3Q5S A;  2QA4 P;  4AUW A;  3W67 A;  4UB8 E;  2M0B A;  3N4X A;  2ZXE B;  1EXI A;  2A45 I;  3KPE A;  3QWO C;  2NZ2 A;  2GM4 A;  4PJ0 E;  2OYI A;  3H1I J;  2H43 A;  3A0H E;  3TF5 A;  3M0D C;  2ZT9 C;  1NTK E;  3WU2 H;  2K3R A;  1PPJ D;  3L70 J;  1G2C B;  2KK7 A;  3R4Y A;  4ZNC A;  3WUU A;  5H2F H;  3Q3D A;  1OX3 A;  1X0T A;  3ITK A;  1L0L G;  1SVF A;  2B9B A;  2HOD A;  5KAI H;  3HTK A;  5TIS E;  1R5S A;  3H1H J;  1KYO D;  3CCJ P;  2CPB A;  1J2J B;  1GZL A;  2A45 H;  4RKU J;  2FYU J;  3K5B A;  2Q3E A;  3T97 A;  3KZI E;  3U1C A;  2RN0 A;  3I55 P;  5KLV J;  2D2C B;  3H32 A;  2YO3 A;  2C9L Y;  3HTK B;  4IFM A;  1IJD B;  4H44 B;  3RK3 E;  1PGO A;  4RO0 A;  3G9R A;  1KB9 I;  4YXW H;  2K37 A;  3T97 B;  2P2U A;  1LT9 A;  1M7L A;  1OW6 A;  2KYV A;  1XTC C;  2E76 C;  1FDO A;  1BGY E;  2M3E A;  3H32 B;  5APW A;  2KLU A;  3MZW B;  1DD4 A;  2KS1 B;  4JPZ B;  3IFM A;  5CCG D;  5DJT B;  1SQX K;  1QL2 A;  1S2E A;  1VQM P;  2Z5H A;  3PTZ A;  3L71 E;  3V4Q A;  3VYI A;  3N7N A;  3VMA A;  1S4X A;  3B5N D;  2JWA A;  2M5A A;  4OWF A;  4OH8 B;  2OYI C;  2Q6Q A;  1N7S D;  3M9B A;  5AW6 B;  1EZV D;  5APU A;  1OZH A;  1S72 P;  2ZYG A;  5AW0 B;  1SQB K;  2E75 B;  2OTL P;  5KJ7 D;  3MTU E;  1SQP D;  1SQQ G;  2IBZ E;  1IFN A;  1NOH A;  3VTP C;  2KP8 A;  1VQO P;  1GK4 A;  1P84 H;  2E5Y A;  5APT A;  1JY3 P;  1JY3 N;  1FZG A;  2YIU B;  4H13 D;  1AJY A;  2W6B A;  4I7Z B;  4H44 C;  1SQV D;  1DEE G;  3H1K D;  5APQ A;  2XDJ A;  3VP9 A;  1R5L A;  1SFC B;  3II6 A;  1SQP J;  2IX7 C;  3AED C;  3RL0 g;  3EWK A;  1PFI A;  2Q3I A;  1JY2 P;  1JY2 N;  1FZE A;  3NMD A;  4JBZ A;  3HE4 A;  2W83 C;  4QMA A;  1VQ6 P;  1Y47 A;  2QG4 A;  5GTH H;  1OW7 A;  2WMM A;  5KLI B;  1QEX A;  1LT9 C;  3CCQ P;  5H2F E;  2KUB A;  1NTM E;  3CCS P;  3SWK A;  1JTH A;  2POH A;  5KAI E;  2AEF A;  4RJT A;  2QRX A;  4U3F E;  2E75 C;  2P7J A;  1K73 Q;  2G3A A;  1IFP A;  1BE3 J;  2HR3 A;  3PJS K;  3V2P A;  2I8D A;  1NTK K;  3L35 A;  5E79 H;  3MD0 A;  3EQ2 A;  2L5G B;  3GMA A;  1NVO A;  1RF1 A;  1L0N E;  1BSH A;  3BAT A;  4A7P A;  4EOT A;  3G6E P;  1BGY G;  3VMX A;  2C9N Y;  5B66 H;  5CCH D;  4EI2 A;  1N8R Q;  1KB9 D;  1VPC A;  1X79 B;  1RF1 B;  1VDF A;  2KZI A;  2YO2 A;  3TGU E;  1U7J A;  1VQ9 P;  3L73 J;  2WTY A;  1FZC B;  5CHX A;  2WSS H;  3AEE C;  2QVA A;  1LP1 B;  2Y0C A;  1KZU B;  2D2C D;  3KQG A;  1S1C X;  2E43 A;  1BCC J;  4C7N B;  2ZVO B;  1HGV A;  3VP8 A;  1VQ4 P;  2ZXX A;  1YIJ P;  5KLI C;  2PP6 A;  2IBZ G;  2O1K A;  1VQK P;  1HJB A;  4C7R A;  3CC2 P;  2QJP B;  4GOF A;  5AVS B;  2KNC B;  2K88 A;  2OYH A;  1N7L A;  3CXH D;  4HYT B;  3OA7 A;  4OGQ D;  3CME P;  3HE5 A;  1VF5 B;  2W90 A;  1U7M A;  3IF4 A;  1LTJ A;  2NPS B;  1NHL A;  1SP4 A;  2OYH B;  2GUS A;  2WSF H;  4ZMD A;  3IAO A;  4K35 A;  2JJL A;  2IPP A;  1ZME C;  4GOD A;  2E75 D;  1IO4 A;  3HE5 B;  4D6T D;  3AE5 C;  5CCG A;  1M1K Q;  1PGQ A;  3BVH A;  1RF1 C;  3BRV B;  5CMZ A;  1CZQ A;  2OYO A;  1FBM A;  1KYO I;  2C0W A;  1FDM A;  3B5N A;  3CLQ A;  1NTM G;  1H0T A;  1N7S A;  5BVZ A;  1SQB D;  3U1A A;  1GU4 A;  5KJ7 A;  3P8C D;  1SQV G;  3H1K G;  2PGD A;  4U3F G;  5C39 A;  2A45 G;  3B5N B;  3L74 D;  4D6T J;  1LTG C;  1SFC D;  2RKL A;  4LC1 A;  4ZKU A;  1H0T B;  1SQX J;  1NU1 E;  1CW5 A;  1N73 B;  2QJP C;  4GT1 A;  1CI6 A;  2LR2 A;  1L0N G;  4GOE A;  3RGU A;  4DJG A;  3A0B E;  1OXZ A;  3TNU B;  1JO5 A;  1KYO H;  3R2P A;  2CK3 H;  3RK2 B;  2DW3 A;  1J1E B;  3A3Y B;  3UIA A;  1PGJ A;  3CCE P;  5B66 E;  1CI6 B;  1AV1 A;  3TGU G;  1K8A Q;  2OYH C;  4N78 D;  4DT0 A;  1EZV I;  1EDI A;  1UIX A;  3L75 D;  3L74 E; 
#chains in the Genus database with same CATH homology
 3L75 G;  1L0L G;  1KB9 H;  5KLV G;  1BGY G;  1NTM G;  1KYO H;  3H1L G;  4D6T G;  3L73 G;  4PD4 H;  1PPJ G;  1NU1 G;  3CX5 H;  1SQX G;  2A06 G;  3H1H G;  1SQB G;  3CWB G;  1PP9 G;  3CXH H;  3L70 G;  1L0N G;  1P84 H;  1EZV G;  3BCC G;  3H1I G;  1SQV G;  3H1K G;  3TGU G;  1BCC G;  1NTZ G;  2FYU G;  4U3F G;  3H1J G;  1SQQ G;  3L72 G;  3L71 G;  1NTK G;  1SQP G;  2IBZ G;  1BE3 G;  2BCC G;  3L74 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...