3BCCG

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
RQFGHLTRVRHLITYSLSPFEQRPFPHYFSKGVPNVWRRLRACILRVAPPFLAFYLLYTWGTQEFEKSKRKNPAAYVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
total genus 16
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3bccG00
1PP9G 3BCCG 3L75G 3H1HG 1BE3G 1NTKG 2A06G 3H1LG 1SQVG 1SQQG 1PPJG 1SQBG 1NTZG 1SQPG 5KLVG 3CXHH 3L70G 3L72G 1L0NG 3H1JG 1BCCG 1EZVG 2BCCG 1KYOH 1SQXG 3L73G 4U3FG 1L0LG 3TGUG 4D6TG 3L71G 2IBZG 4PD4H 3CX5H 3L74G 1KB9H 2FYUG 1NTMG 1NU1G 1P84H 1BGYG 3H1KG 3H1IG 3CWBG
chains in the Genus database with same CATH superfamily
1SQPK 2E43A 1IC2A 3CWBJ 2M8RA 3TGUE 2E76C 3L75G 1YITP 1EXIA 1ZOYC 3L35A 3A0HH 4IFMA 5H2FH 1BE3D 2J58A 3LW5J 5AW3B 1J1DC 1J1EB 3MGNA 1KV4A 1AQTA 3M0AA 1LTJB 1S3JA 4HYTB 1SQPD 2FYNB 1SQVK 3II6A 1OVRA 1YTZT 1ZR4A 4OGQC 1MUUA 4PV1C 1DEEG 3H1HE 1KYOD 3B5NC 3RK3E 3PLNA 4U7JA 1SQXG 2C0WA 2XNXA 2IYOA 3AE3C 3GG2A 4K3AA 4I2LC 1M1KQ 1LWUC 1RY3A 4LC1A 4OGQD 4PV1D 5AVUB 2KS1A 2QSIA 1YTZI 2KZJA 4HJGH 1UIIA 2YKOA 2K9JA 1KB9H 2RKLA 3L74G 4I7ZB 1NTMD 4IFFA 1K9MQ 1VQ4P 1GU4A 3FXEA 2M0BA 3LIEA 3H1IG 3RK2B 1KD1Q 1IFNA 3CXHI 4C7NB 2BCCJ 1Q90D 1T2KD 1GL2C 2ZYGA 3HUSA 2FXOA 1PP9D 2W6BA 1BSNA 3G3ZA 3BRTB 2GA1A 4JF7A 3VMAA 1PIXA 5BU5A 3CD6P 1EDLA 1FDMA 2P7JA 1NKNA 1W5CE 3H1HJ 3LW5H 3M91A 1SQBG 1NAYA 3P8CE 3RK2D 2FBWC 1LJ2A 1GMJA 3G4SP 3G71P 1XTGB 4UB6H 1VPCA 5KKZC 4Y99C 3O6QA 1NO4A 1SFCC 2J5UA 1OZHA 1PZQA 2W27A 2XU6A 2Y0CA 3GF7A 4Y99B 3L73G 2XNDH 3L75J 5B66E 1EQ7A 1TU3F 2D2CC 4OVNF 2WITA 2PP6A 2ITAA 2O01H 4PD4H 3H6PA 2OTJP 3B5NA 5APXA 1MZ9A 4YXDC 1N7SD 2PGDA 2R5DA 3H1KD 3D6ZA 1VQ7P 1LTSC 3A0HE 1Q86Q 3A5TA 2E75D 3CCJP 2FFDA 3M0DC 4K35A 1Z56A 5APTA 1NTZK 2N1TD 1CI6B 4UB6E 3RL0g 3IAOA 1SQBE 4W7ZA 5DJTB 3RK2C 2RMZA 4TT3H 3G6EP 2VRSA 1NTKG 5CCGA 1KTMA 3ITKA 3L74J 2R3SA 1HJ0A 2KNCB 2POHA 1PPJD 1AVYA 2E5YA 3TDKA 2K9YA 2ZVNB 5TISE 2MJZA 2QJPC 1IZNB 1Y8AA 1L0ND 4RESB 1IJDB 2WSSH 3SSUA 2N1TB 4PD4E 2QJKC 5M1BA 1JB0J 2QE7H 1OXZA 2JWAA 1FJPA 1IK9A 5CHXA 4LLHA 4N6JA 2IYPA 1RF1A 1N7SB 4U3FG 5B5EH 1JCCA 1SQXJ 3A0BH 3HUSB 3U1AA 3CCUP 3V5BA 1Q7YQ 2FFDC 1FOSF 4IL6H 5CCHD 2YNYA 2KIKA 1EC5A 5EFWB 1LTJC 1RQVA 2KLVA 2Q3EA 1S5LH 3O6QB 3AE1C 2FY8A 1EZVI 3AE8C 4GT1A 3P8MC 2HG5D 2NZ2A 2LKMA 3RK3B 2YKQA 2WSFJ 5B5EE 1OWAA 3E1RA 3L75D 4H13D 3CX5E 1M1JA 1VF5D 1ZRTD 2HYNA 2N9BA 3QWOC 2E75B 1OFCX 5AW7B 1KORA 3D71A 2Y9ZA 1NTZG 4PJ0E 1R8EA 1FC2C 1HJBA 1G1IA 2Q6QA 3AEBC 4JPZB 4XE5B 1H0TA 4NPDA 4BXLA 2SPZA 3JCUH 5AW4B 2WSEJ 5AVQB 3MP7B 1ZMEC 4WVZA 3RBZA 1PFIA 3OW2O 1KILB 1KMIZ 1BDCA 1T8ZA 3AEGC 1YIJP 1YJWP 1AVOA 2QRXA 3PP5A 5CCGD 4R4LA 4WY4A 1YBKA 2YXRB 2YXQB 1GU5A 4EDFA 3BVHA 4AYCA 1QL1A 3B4SA 1NTMG 3KZIH 3L73E 4DZOA 1L0NJ 2NPSB 2O3JA 5AVWB 1KILE 2YO3A 5KJ7C 5KLVJ 1D7MA 3W67A 1BSHA 2E74C 3IFMA 3PH0A 1L2PA 1N7SC 3H32A 4YTPC 1PP9G 3RK3D 3HTKB 2KOGA 2QA4P 4L75A 4QMAA 4IL6X 1JY2N 1YHQP 3TNUA 1GK4A 1KQGB 2WZ7A 1SQBD 2E76D 1DX7A 4IL6E 3TF5A 2R32A 2M5AA 1GK6A 3HD7B 4EOTA 4JYBA 1PPJE 2KZIA 2N9YB 3GHGA 2PAJA 2HFED 3GHGC 3W68A 5KKZB 5CJ4A 1K05A 1S9KD 1N86A 1KILD 4HB1A 4A7PA 1KB9D 2KSJA 2KYVA 1K04A 1FZCA 1VDFA 1JEKA 3HD7D 1NU1D 3S4RA 3H1KG 1RHZB 5CCHA 1HVVA 1PGQA 3VTPC 2KLUA 1L4AC 2LXBA 2PRRA 4C7RA 2BASA 5AVYB 1ZLLA 1S4XA 1JTHB 4D6TE 4Z1MH 3FWLA 3BCCG 3H1HG 3TYYA 1SFCB 4MN4C 3V2QA 1L0LJ 1NTKD 2NPSD 3BATA 3H32B 3L37A 2YIUC 1NKZB 3M0DA 4UB8E 2C9LY 1SFCA 2P1JA 1PPJG 4I7ZC 2O01J 1BGYJ 1SFCD 3H1JE 4BRYA 1CZQA 1M56D 5AW1B 1CW5A 3L72J 2WPQA 1FS0E 5BU8B 2ZT9C 2GM4A 1JCDA 1KYOH 1KB9I 2N1TA 3RGUA 2L91A 2CPSA 4JBZA 3AE7C 2JP3A 5DJUB 4U3FD 5APQA 2E74B 3O8ZA 1RF1C 3L71J 1KYOI 3PJSK 2Q7CA 1PL5A 1K8AQ 1L0NE 1URQA 1VQ8P 1J1DB 1HTLC 1X8YA 3F89A 1LTJA 3P32A 4DT0A 2Z4EA 1Q2NA 2E76B 4Y28J 4I6MC 1VF5B 1IFIA 1FZCC 2JKVA 4OWFA 1KILC 3PHLA 2I8DA 1OX3A 2JJLA 3B5NB 4GOFA 1KILA 5AVSB 1FZFA 2Q9IA 1SQXK 2G8YA 2H43A 1NTZD 1N7LA 1EDKA 3SFEC 3T97A 3HRNA 2R44A 2BEZF 1QL2A 3HE4B 2QVAA 1W2BO 2HODA 1HUCA 1KN7A 2K1AA 1LTBC 3IR9A 3N4XA 4H0LB 1XTCC 3I56P 2CK3H 2C9NY 3JCUE 2P2UA 1BE3E 1G2CB 3JSVC 4EYYQ 2P10A 3TGUD 1IFMA 1JTHA 1OW6A 1USDA 3A7OA 4L76A 4D6TG 1N73A 1USEA 2B87A 1SQPE 2KB7P 3FXDA 2E74D 3FX0A 1N73B 5E79H 3VMXA 1L4AB 3CLQA 5GTIE 5KJ7A 2YO2A 1ZW0A 3S9OA 3MD0A 2Y0DA 1X0TA 3HTKA 4B86A 1VQNP 1PGOA 1SQXE 5H2FE 1DD3A 2WSEH 3H1KE 3L73J 4U3FJ 3HE5A 3E1IA 3EFFK 2ZAEB 2QJYC 3PTZA 1YJ9P 2QM8A 3F5HA 3SFDC 2AXCA 2N1TC 3CPWO 3HD7A 1GL2A 2YKPA 1LTAC 2QJPB 4ZKUA 3VOPA 3HD7C 3USSA 1T3UA 4I1LA 1RE3A 1L0NK 3RL0C 5KLVK 1GW4A 4H13C 2G3AA 5GTIH 3CXHE 1VQ9P 3VN0A 2WT7B 1L0LG 1NHLA 3H25A 1ZXGA 1JOCA 1FZBA 3Q2YA 1NTMK 5APWA 1FZAA 3M9QA 3V2RA 2FKWB 3FGAD 1NU1G 1NJIQ 1QX8A 3Q5PA 2WQYC 4XFJA 3TK1A 4H13B 3Q5SA 1JY2O 3MIWA 5CCHC 2NPSC 3CWBD 1AQ5A 1N73C 1PP9J 1OMIA 3L4FA 1HGVA 4WWIA 2O01N 3CL3D 3BCCD 3AE9C 3RL0D 3TGUJ 3H1HD 3KHUA 3S1KA 1AFOA 2OARA 4DJGA 3HE5B 3CCEP 5KLVE 2FYUK 1X22A 5CJ0A 1SQQD 1PGJA 2C0XA 2R3CA 5APVA 1JM0A 3NTNA 3KQGA 2OQQA 2P67A 3FWNA 1L0LE 1NOHA 1NTME 1K73Q 5CCGC 2M5AB 3CMEP 1LT9A 2BCCD 3L70E 2QEXP 4N3YB 1H8AA 3D70A 4W80A 1S5LE 1SLQA 1EDJA 5KAIE 1GL2B 5AVTB 2DW3A 4W7YA 1KC8Q 2W8ZA 1S5LX 1L0LK 3H1IJ 1P84H 1QEXA 1URQC 4H0LC 2OGUA 1KZUB 2B89A 2QM7A 2Y9YA 3OAKA 1HF9A 3C1LA 5GTHE 1LWUB 1Y9BA 1YQ4C 1M1JB 2HR3A 2KS1B 4U3FE 2FFDB 2Q1KA 5AVRB 2OTLP 2KSEA 4DCKA 1VQKP 1LP1B 1AV1A 1LT1A 1JY3O 2Q3IA 3BCCE 1HGZA 2WPVB 3C9IA 3RBXA 1NGMB 3CWBE 1RE4A 2ZFCA 3CCQP 2FYNC 2Z5IA 1BCCJ 1T6AA 3L70G 2H7HA 3H1JD 2CPBA 4IFDK 1QLED 5APUA 3Q1MA 2UWJE 3V6IA 3A0BE 1NVOA 5C39A 3TSIA 1EDIA 1SQVE 3TGUG 2K9JB 1U7MA 4D6TD 3L71D 2IBZD 2WSCJ 5E79E 3CX5D 1VQPP 1L4AA 2K37A 3CI9A 1GL2D 3MZWB 3VP8A 1FAVA 2Q5UA 1X9VA 1BGYG 1RE4C 2BCCE 2YMYA 3LIDA 1LT9B 1NU1J 3IN6A 3M9HA 4NPEA 4NPFX 3CCSP 3VMYA 3AE4C 3I5CA 4KT0J 1JNMA 5AW6B 1H88A 2ZT9D 4RJTA 1NAFA 2IFMA 2XKMA 1LTGC 2IDBA 1ZP0C 2KP8A 1JMBA 1UIXA 2FYZA 2V7QH 2AXTE 2YIUB 1N7SA 2V7QJ 3GHGB 3H1LD 3U59A 3B5ND 4EI2A 3H1KJ 4PD4I 2NRGA 4L73A 2WSFH 1U7JA 2W6AA 1CSBA 2IBZE 4TLFA 5TJHA 2A06E 1HWTC 1A02F 1S1CX 5APYA 3A3YB 1P84E 4KJMA 2KNCA 3WUVA 1L0LD 1NTKJ 1QGKB 2KI7B 4H0LD 1FDOA 4KHXA 4AQRD 1FBMA 2E5TA 2J59M 2JWDA 2B88A 3JC22 3ABVC 3L72E 4H44B 2R5BA 3SWKA 4ZNCA 3HE4A 2WSCH 5KLIB 2XV5A 2JDIH 3MTUE 1G1JA 4EIJA 3V2NA 1OVUA 3RL0B 2W83C 3KXDA 3CWBG 2AEFA 3P7KA 3CCVP 1KQSO 4GODA 4YXWH 3CC2P 4PJ0H 2A45G 3AE5C 3CXHD 4CPGA 3Q3DA 3WU2H 4AUWA 2H88C 1AJYA 3KDPB 1SQBJ 4WBAA 1R5SA 1SQVD 1SQQG 2A45I 4H44C 2WVRA 2ZJSE 1NTMJ 3SWFA 1BCCG 1LGHB 1IFDA 2D2CD 1EZVG 2P58A 2BCCG 1ZRTE 1WMKA 4H44D 1M57D 5K5GB 1GZLA 1SQQK 1IFJA 2FXPA 3BASA 5AVXB 1JY3N 1LTTC 2YMKA 5KTBA 3AEAC 5KJ7D 1RE3C 1VL2A 3H1LJ 1JUNA 1T3JA 3NMDA 3M06A 3WUTA 4R4MA 4C46A 2QIWA 4HH2A 5KLIC 2BEQD 3KPEA 2FYUJ 2JO1A 1MKMA 2RN0A 1N8RQ 2I1KA 1KFMA 3AE6C 1QVFO 3L75E 2OYOA 5AW8B 1JY3P 3WU2E 1BGYE 5B66H 1QVGO 1RF0C 5AW0B 3VP9A 2IPPA 1FJKA 1RH5B 3G9RA 3HUSC 1L4AD 3MUDC 3CCMP 2A06D 4HKZH 4RO0A 1BE3J 1BCCE 2O1KA 2QG4A 1EZVE 1HBWA 5KLVD 1S2EA 3L70D 2QJKB 3AEFC 2WMMA 3L72D 1KYOE 1SQPJ 1VF5C 3H1JG 5CMZA 5CBNA 1FZCB 3H1LE 2GUSA 3NFQA 2KK7A 3CX5I 1M8OB 1OW8A 2HODB 1RF0A 2ZYDA 1M7LA 4RKUJ 3L71G 2IBZG 3CC4P 4GDOA 1RF1B 1NYHA 1SQVJ 5TISH 1BDDA 1NTZE 1IO4A 2FYUG 1KFNA 2LR2A 3H1IE 3M9BA 3CCRP 3GMAA 3K5BA 1BGYD 1FZEA 2IFNA 2HPCA 5AVVB 3TNUB 1OIPA 5BVZA 5KAFE 2ZT9B 1J2JB 1E5WA 2XZRA 3CC7P 3C8VA 3AEEC 3GF3A 2ZYAA 1URQD 3OA7A 4IOIH 3QH9A 3VYIA 2LXCB 2OYIA 3V4QA 2HLOA 1U57A 1BE3G 2H8PD 3BCCJ 5L8RJ 3OJAB 3V2PA 1HH0A 1URQB 1JY2P 4LGDE 1GTWA 2WT7A 2OTKE 3B8EB 3H1LG 1A02J 4ZKPA 2AEJA 2W6JH 1SQPG 3H1JJ 1SS1A 1ZV8A 3CXHH 1GD2E 3GW6A 5AVZB 3CCLP 4ZMDA 2O1JA 4UB8H 1KQFB 1JO5A 2IBZI 1NTKE 1NU1K 4L74A 3CMAP 4WB4A 1SQXD 1YI2P 1P84I 1M1JC 1PP9E 1AA0A 1KB9E 1LWUA 4N78E 1FZGA 4WY4D 4XA4A 4O9BA 2V4HA 4BRYB 1G2CA 2D2CB 1FU1A 3L74D 3P8CD 4PD4D 1IFPA 1DEBA 3L70J 3N7NA 1VQLP 3H1ID 4OH8B 1CI6A 1FOSE 2W90A 1WRGA 1OW7A 3T97B 1SVFA 4BWNA 3AECC 1YJNP 1S9KE 2B87B 4D6TJ 2KXPB 2FXMA 2IX7C 4ASWA 1GDTA 1X79B 2HPCB 3KZIE 4GOEA 1NTKK 1NU1E 1SQVG 3NXSA 2H89C 4JQ0D 4M3LA 5AW9B 4C7NA 4OGQB 4PV1B 1NTZJ 2WPSA 5KAIH 1ZR2A 1BCCD 1R5LA 5AW5B 1EZVD 3B71A 2WPRA 3MUDA 5APSA 3SWYA 3MHVA 5KAFH 2ZXEB 1ZN5A 1MFTA 2PFXA 3L73D 1T2KC 1WT6A 2WTYA 2WWWA 3U1CA 1GW3A 2B9BA 3CX5H 5CBOA 5GTHH 1LP1A 1M90Q 2M3EA 1SQBK 3ZDMA 2XDJA 2ZXXA 3AE2C 3A2AA 3PRJA 1FDIA 1MFZA 2A45H 3IF4A 1N2DC 3L71E 4GKGA 2Y0EA 1H89A 1YQ3C 3L36A 1FE6A 2FYUE 1NH4A 3EFGA 3EQ2A 1DD4A 3GLMA 3I55P 2OYHA 1VQOP 3WUUA 1H0TB 1Q82Q 1OVVA 2KUBA 3L74E 2L5GB 2OYHB 2E75C 2K3RA 1DIPA 2A06G 3V4WA 1SQQJ 1J1EC 2AEMA 2NPSA 1SP4A 2ZVOB 1VQMP 4N78D 5AW2B 2E42A 1RQUA 4WY4B 5KLVG 3L72G 1W2EA 1L0NG 2JEEA 4YPCA 1EXJA 4GIFA 1LTIC 4WY4C 1PV3A 1LNQA 2I1JA 2IZ0A 3RK3C 2QJYB 3R2PA 4ASVA 1E79H 1YYCA 3KYQA 1PGPA 3BRVB 3VMZA 4DOJA 3Q5RA 1Q81Q 2JR8A 1JMMA 1NWQA 3UIAA 2GUVA 2RH0A 3EWKA 1IK7A 1VQ5P 2OYIC 2OYHC 3D6YA 1VQ6P 3WMM0 2OYIB 2MKVA 3E7KA 1LT9C 1MV8A 1P84D 2FYUD 2IZ1A 2AXTH 1DH3A 1KQLA 2Z5HA 1Y47A 3R4YA 4JYCA 1S72P 1SQQE 2M3BA 3AEDC 2K88A
chains in the Genus database with same CATH topology
1PP9G 3BCCG 3L75G 3H1HG 1BE3G 1NTKG 2A06G 3H1LG 1SQVG 1SQQG 1PPJG 1SQBG 1NTZG 1SQPG 5KLVG 3CXHH 3L70G 3L72G 1L0NG 3H1JG 1BCCG 1EZVG 2BCCG 1KYOH 1SQXG 3L73G 4U3FG 1L0LG 3TGUG 4D6TG 3L71G 2IBZG 4PD4H 3CX5H 3L74G 1KB9H 2FYUG 1NTMG 1NU1G 1P84H 1BGYG 3H1KG 3H1IG 3CWBG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP9 G;  3BCC G;  3L75 G;  3H1H G;  1BE3 G;  1NTK G;  2A06 G;  3H1L G;  1SQV G;  1SQQ G;  1PPJ G;  1SQB G;  1NTZ G;  1SQP G;  5KLV G;  3CXH H;  3L70 G;  3L72 G;  1L0N G;  3H1J G;  1BCC G;  1EZV G;  2BCC G;  1KYO H;  1SQX G;  3L73 G;  4U3F G;  1L0L G;  3TGU G;  4D6T G;  3L71 G;  2IBZ G;  4PD4 H;  3CX5 H;  3L74 G;  1KB9 H;  2FYU G;  1NTM G;  1NU1 G;  1P84 H;  1BGY G;  3H1K G;  3H1I G;  3CWB G; 
#chains in the Genus database with same CATH topology
 1SQP K;  2E43 A;  1IC2 A;  3CWB J;  2M8R A;  3TGU E;  2E76 C;  3L75 G;  1YIT P;  1EXI A;  1ZOY C;  3L35 A;  3A0H H;  4IFM A;  5H2F H;  1BE3 D;  2J58 A;  3LW5 J;  5AW3 B;  1J1D C;  1J1E B;  3MGN A;  1KV4 A;  1AQT A;  3M0A A;  1LTJ B;  1S3J A;  4HYT B;  1SQP D;  2FYN B;  1SQV K;  3II6 A;  1OVR A;  1YTZ T;  1ZR4 A;  4OGQ C;  1MUU A;  4PV1 C;  1DEE G;  3H1H E;  1KYO D;  3B5N C;  3RK3 E;  3PLN A;  4U7J A;  1SQX G;  2C0W A;  2XNX A;  2IYO A;  3AE3 C;  3GG2 A;  4K3A A;  4I2L C;  1M1K Q;  1LWU C;  1RY3 A;  4LC1 A;  4OGQ D;  4PV1 D;  5AVU B;  2KS1 A;  2QSI A;  1YTZ I;  2KZJ A;  4HJG H;  1UII A;  2YKO A;  2K9J A;  1KB9 H;  2RKL A;  3L74 G;  4I7Z B;  1NTM D;  4IFF A;  1K9M Q;  1VQ4 P;  1GU4 A;  3FXE A;  2M0B A;  3LIE A;  3H1I G;  3RK2 B;  1KD1 Q;  1IFN A;  3CXH I;  4C7N B;  2BCC J;  1Q90 D;  1T2K D;  1GL2 C;  2ZYG A;  3HUS A;  2FXO A;  1PP9 D;  2W6B A;  1BSN A;  3G3Z A;  3BRT B;  2GA1 A;  4JF7 A;  3VMA A;  1PIX A;  5BU5 A;  3CD6 P;  1EDL A;  1FDM A;  2P7J A;  1NKN A;  1W5C E;  3H1H J;  3LW5 H;  3M91 A;  1SQB G;  1NAY A;  3P8C E;  3RK2 D;  2FBW C;  1LJ2 A;  1GMJ A;  3G4S P;  3G71 P;  1XTG B;  4UB6 H;  1VPC A;  5KKZ C;  4Y99 C;  3O6Q A;  1NO4 A;  1SFC C;  2J5U A;  1OZH A;  1PZQ A;  2W27 A;  2XU6 A;  2Y0C A;  3GF7 A;  4Y99 B;  3L73 G;  2XND H;  3L75 J;  5B66 E;  1EQ7 A;  1TU3 F;  2D2C C;  4OVN F;  2WIT A;  2PP6 A;  2ITA A;  2O01 H;  4PD4 H;  3H6P A;  2OTJ P;  3B5N A;  5APX A;  1MZ9 A;  4YXD C;  1N7S D;  2PGD A;  2R5D A;  3H1K D;  3D6Z A;  1VQ7 P;  1LTS C;  3A0H E;  1Q86 Q;  3A5T A;  2E75 D;  3CCJ P;  2FFD A;  3M0D C;  4K35 A;  1Z56 A;  5APT A;  1NTZ K;  2N1T D;  1CI6 B;  4UB6 E;  3RL0 g;  3IAO A;  1SQB E;  4W7Z A;  5DJT B;  3RK2 C;  2RMZ A;  4TT3 H;  3G6E P;  2VRS A;  1NTK G;  5CCG A;  1KTM A;  3ITK A;  3L74 J;  2R3S A;  1HJ0 A;  2KNC B;  2POH A;  1PPJ D;  1AVY A;  2E5Y A;  3TDK A;  2K9Y A;  2ZVN B;  5TIS E;  2MJZ A;  2QJP C;  1IZN B;  1Y8A A;  1L0N D;  4RES B;  1IJD B;  2WSS H;  3SSU A;  2N1T B;  4PD4 E;  2QJK C;  5M1B A;  1JB0 J;  2QE7 H;  1OXZ A;  2JWA A;  1FJP A;  1IK9 A;  5CHX A;  4LLH A;  4N6J A;  2IYP A;  1RF1 A;  1N7S B;  4U3F G;  5B5E H;  1JCC A;  1SQX J;  3A0B H;  3HUS B;  3U1A A;  3CCU P;  3V5B A;  1Q7Y Q;  2FFD C;  1FOS F;  4IL6 H;  5CCH D;  2YNY A;  2KIK A;  1EC5 A;  5EFW B;  1LTJ C;  1RQV A;  2KLV A;  2Q3E A;  1S5L H;  3O6Q B;  3AE1 C;  2FY8 A;  1EZV I;  3AE8 C;  4GT1 A;  3P8M C;  2HG5 D;  2NZ2 A;  2LKM A;  3RK3 B;  2YKQ A;  2WSF J;  5B5E E;  1OWA A;  3E1R A;  3L75 D;  4H13 D;  3CX5 E;  1M1J A;  1VF5 D;  1ZRT D;  2HYN A;  2N9B A;  3QWO C;  2E75 B;  1OFC X;  5AW7 B;  1KOR A;  3D71 A;  2Y9Z A;  1NTZ G;  4PJ0 E;  1R8E A;  1FC2 C;  1HJB A;  1G1I A;  2Q6Q A;  3AEB C;  4JPZ B;  4XE5 B;  1H0T A;  4NPD A;  4BXL A;  2SPZ A;  3JCU H;  5AW4 B;  2WSE J;  5AVQ B;  3MP7 B;  1ZME C;  4WVZ A;  3RBZ A;  1PFI A;  3OW2 O;  1KIL B;  1KMI Z;  1BDC A;  1T8Z A;  3AEG C;  1YIJ P;  1YJW P;  1AVO A;  2QRX A;  3PP5 A;  5CCG D;  4R4L A;  4WY4 A;  1YBK A;  2YXR B;  2YXQ B;  1GU5 A;  4EDF A;  3BVH A;  4AYC A;  1QL1 A;  3B4S A;  1NTM G;  3KZI H;  3L73 E;  4DZO A;  1L0N J;  2NPS B;  2O3J A;  5AVW B;  1KIL E;  2YO3 A;  5KJ7 C;  5KLV J;  1D7M A;  3W67 A;  1BSH A;  2E74 C;  3IFM A;  3PH0 A;  1L2P A;  1N7S C;  3H32 A;  4YTP C;  1PP9 G;  3RK3 D;  3HTK B;  2KOG A;  2QA4 P;  4L75 A;  4QMA A;  4IL6 X;  1JY2 N;  1YHQ P;  3TNU A;  1GK4 A;  1KQG B;  2WZ7 A;  1SQB D;  2E76 D;  1DX7 A;  4IL6 E;  3TF5 A;  2R32 A;  2M5A A;  1GK6 A;  3HD7 B;  4EOT A;  4JYB A;  1PPJ E;  2KZI A;  2N9Y B;  3GHG A;  2PAJ A;  2HFE D;  3GHG C;  3W68 A;  5KKZ B;  5CJ4 A;  1K05 A;  1S9K D;  1N86 A;  1KIL D;  4HB1 A;  4A7P A;  1KB9 D;  2KSJ A;  2KYV A;  1K04 A;  1FZC A;  1VDF A;  1JEK A;  3HD7 D;  1NU1 D;  3S4R A;  3H1K G;  1RHZ B;  5CCH A;  1HVV A;  1PGQ A;  3VTP C;  2KLU A;  1L4A C;  2LXB A;  2PRR A;  4C7R A;  2BAS A;  5AVY B;  1ZLL A;  1S4X A;  1JTH B;  4D6T E;  4Z1M H;  3FWL A;  3BCC G;  3H1H G;  3TYY A;  1SFC B;  4MN4 C;  3V2Q A;  1L0L J;  1NTK D;  2NPS D;  3BAT A;  3H32 B;  3L37 A;  2YIU C;  1NKZ B;  3M0D A;  4UB8 E;  2C9L Y;  1SFC A;  2P1J A;  1PPJ G;  4I7Z C;  2O01 J;  1BGY J;  1SFC D;  3H1J E;  4BRY A;  1CZQ A;  1M56 D;  5AW1 B;  1CW5 A;  3L72 J;  2WPQ A;  1FS0 E;  5BU8 B;  2ZT9 C;  2GM4 A;  1JCD A;  1KYO H;  1KB9 I;  2N1T A;  3RGU A;  2L91 A;  2CPS A;  4JBZ A;  3AE7 C;  2JP3 A;  5DJU B;  4U3F D;  5APQ A;  2E74 B;  3O8Z A;  1RF1 C;  3L71 J;  1KYO I;  3PJS K;  2Q7C A;  1PL5 A;  1K8A Q;  1L0N E;  1URQ A;  1VQ8 P;  1J1D B;  1HTL C;  1X8Y A;  3F89 A;  1LTJ A;  3P32 A;  4DT0 A;  2Z4E A;  1Q2N A;  2E76 B;  4Y28 J;  4I6M C;  1VF5 B;  1IFI A;  1FZC C;  2JKV A;  4OWF A;  1KIL C;  3PHL A;  2I8D A;  1OX3 A;  2JJL A;  3B5N B;  4GOF A;  1KIL A;  5AVS B;  1FZF A;  2Q9I A;  1SQX K;  2G8Y A;  2H43 A;  1NTZ D;  1N7L A;  1EDK A;  3SFE C;  3T97 A;  3HRN A;  2R44 A;  2BEZ F;  1QL2 A;  3HE4 B;  2QVA A;  1W2B O;  2HOD A;  1HUC A;  1KN7 A;  2K1A A;  1LTB C;  3IR9 A;  3N4X A;  4H0L B;  1XTC C;  3I56 P;  2CK3 H;  2C9N Y;  3JCU E;  2P2U A;  1BE3 E;  1G2C B;  3JSV C;  4EYY Q;  2P10 A;  3TGU D;  1IFM A;  1JTH A;  1OW6 A;  1USD A;  3A7O A;  4L76 A;  4D6T G;  1N73 A;  1USE A;  2B87 A;  1SQP E;  2KB7 P;  3FXD A;  2E74 D;  3FX0 A;  1N73 B;  5E79 H;  3VMX A;  1L4A B;  3CLQ A;  5GTI E;  5KJ7 A;  2YO2 A;  1ZW0 A;  3S9O A;  3MD0 A;  2Y0D A;  1X0T A;  3HTK A;  4B86 A;  1VQN P;  1PGO A;  1SQX E;  5H2F E;  1DD3 A;  2WSE H;  3H1K E;  3L73 J;  4U3F J;  3HE5 A;  3E1I A;  3EFF K;  2ZAE B;  2QJY C;  3PTZ A;  1YJ9 P;  2QM8 A;  3F5H A;  3SFD C;  2AXC A;  2N1T C;  3CPW O;  3HD7 A;  1GL2 A;  2YKP A;  1LTA C;  2QJP B;  4ZKU A;  3VOP A;  3HD7 C;  3USS A;  1T3U A;  4I1L A;  1RE3 A;  1L0N K;  3RL0 C;  5KLV K;  1GW4 A;  4H13 C;  2G3A A;  5GTI H;  3CXH E;  1VQ9 P;  3VN0 A;  2WT7 B;  1L0L G;  1NHL A;  3H25 A;  1ZXG A;  1JOC A;  1FZB A;  3Q2Y A;  1NTM K;  5APW A;  1FZA A;  3M9Q A;  3V2R A;  2FKW B;  3FGA D;  1NU1 G;  1NJI Q;  1QX8 A;  3Q5P A;  2WQY C;  4XFJ A;  3TK1 A;  4H13 B;  3Q5S A;  1JY2 O;  3MIW A;  5CCH C;  2NPS C;  3CWB D;  1AQ5 A;  1N73 C;  1PP9 J;  1OMI A;  3L4F A;  1HGV A;  4WWI A;  2O01 N;  3CL3 D;  3BCC D;  3AE9 C;  3RL0 D;  3TGU J;  3H1H D;  3KHU A;  3S1K A;  1AFO A;  2OAR A;  4DJG A;  3HE5 B;  3CCE P;  5KLV E;  2FYU K;  1X22 A;  5CJ0 A;  1SQQ D;  1PGJ A;  2C0X A;  2R3C A;  5APV A;  1JM0 A;  3NTN A;  3KQG A;  2OQQ A;  2P67 A;  3FWN A;  1L0L E;  1NOH A;  1NTM E;  1K73 Q;  5CCG C;  2M5A B;  3CME P;  1LT9 A;  2BCC D;  3L70 E;  2QEX P;  4N3Y B;  1H8A A;  3D70 A;  4W80 A;  1S5L E;  1SLQ A;  1EDJ A;  5KAI E;  1GL2 B;  5AVT B;  2DW3 A;  4W7Y A;  1KC8 Q;  2W8Z A;  1S5L X;  1L0L K;  3H1I J;  1P84 H;  1QEX A;  1URQ C;  4H0L C;  2OGU A;  1KZU B;  2B89 A;  2QM7 A;  2Y9Y A;  3OAK A;  1HF9 A;  3C1L A;  5GTH E;  1LWU B;  1Y9B A;  1YQ4 C;  1M1J B;  2HR3 A;  2KS1 B;  4U3F E;  2FFD B;  2Q1K A;  5AVR B;  2OTL P;  2KSE A;  4DCK A;  1VQK P;  1LP1 B;  1AV1 A;  1LT1 A;  1JY3 O;  2Q3I A;  3BCC E;  1HGZ A;  2WPV B;  3C9I A;  3RBX A;  1NGM B;  3CWB E;  1RE4 A;  2ZFC A;  3CCQ P;  2FYN C;  2Z5I A;  1BCC J;  1T6A A;  3L70 G;  2H7H A;  3H1J D;  2CPB A;  4IFD K;  1QLE D;  5APU A;  3Q1M A;  2UWJ E;  3V6I A;  3A0B E;  1NVO A;  5C39 A;  3TSI A;  1EDI A;  1SQV E;  3TGU G;  2K9J B;  1U7M A;  4D6T D;  3L71 D;  2IBZ D;  2WSC J;  5E79 E;  3CX5 D;  1VQP P;  1L4A A;  2K37 A;  3CI9 A;  1GL2 D;  3MZW B;  3VP8 A;  1FAV A;  2Q5U A;  1X9V A;  1BGY G;  1RE4 C;  2BCC E;  2YMY A;  3LID A;  1LT9 B;  1NU1 J;  3IN6 A;  3M9H A;  4NPE A;  4NPF X;  3CCS P;  3VMY A;  3AE4 C;  3I5C A;  4KT0 J;  1JNM A;  5AW6 B;  1H88 A;  2ZT9 D;  4RJT A;  1NAF A;  2IFM A;  2XKM A;  1LTG C;  2IDB A;  1ZP0 C;  2KP8 A;  1JMB A;  1UIX A;  2FYZ A;  2V7Q H;  2AXT E;  2YIU B;  1N7S A;  2V7Q J;  3GHG B;  3H1L D;  3U59 A;  3B5N D;  4EI2 A;  3H1K J;  4PD4 I;  2NRG A;  4L73 A;  2WSF H;  1U7J A;  2W6A A;  1CSB A;  2IBZ E;  4TLF A;  5TJH A;  2A06 E;  1HWT C;  1A02 F;  1S1C X;  5APY A;  3A3Y B;  1P84 E;  4KJM A;  2KNC A;  3WUV A;  1L0L D;  1NTK J;  1QGK B;  2KI7 B;  4H0L D;  1FDO A;  4KHX A;  4AQR D;  1FBM A;  2E5T A;  2J59 M;  2JWD A;  2B88 A;  3JC2 2;  3ABV C;  3L72 E;  4H44 B;  2R5B A;  3SWK A;  4ZNC A;  3HE4 A;  2WSC H;  5KLI B;  2XV5 A;  2JDI H;  3MTU E;  1G1J A;  4EIJ A;  3V2N A;  1OVU A;  3RL0 B;  2W83 C;  3KXD A;  3CWB G;  2AEF A;  3P7K A;  3CCV P;  1KQS O;  4GOD A;  4YXW H;  3CC2 P;  4PJ0 H;  2A45 G;  3AE5 C;  3CXH D;  4CPG A;  3Q3D A;  3WU2 H;  4AUW A;  2H88 C;  1AJY A;  3KDP B;  1SQB J;  4WBA A;  1R5S A;  1SQV D;  1SQQ G;  2A45 I;  4H44 C;  2WVR A;  2ZJS E;  1NTM J;  3SWF A;  1BCC G;  1LGH B;  1IFD A;  2D2C D;  1EZV G;  2P58 A;  2BCC G;  1ZRT E;  1WMK A;  4H44 D;  1M57 D;  5K5G B;  1GZL A;  1SQQ K;  1IFJ A;  2FXP A;  3BAS A;  5AVX B;  1JY3 N;  1LTT C;  2YMK A;  5KTB A;  3AEA C;  5KJ7 D;  1RE3 C;  1VL2 A;  3H1L J;  1JUN A;  1T3J A;  3NMD A;  3M06 A;  3WUT A;  4R4M A;  4C46 A;  2QIW A;  4HH2 A;  5KLI C;  2BEQ D;  3KPE A;  2FYU J;  2JO1 A;  1MKM A;  2RN0 A;  1N8R Q;  2I1K A;  1KFM A;  3AE6 C;  1QVF O;  3L75 E;  2OYO A;  5AW8 B;  1JY3 P;  3WU2 E;  1BGY E;  5B66 H;  1QVG O;  1RF0 C;  5AW0 B;  3VP9 A;  2IPP A;  1FJK A;  1RH5 B;  3G9R A;  3HUS C;  1L4A D;  3MUD C;  3CCM P;  2A06 D;  4HKZ H;  4RO0 A;  1BE3 J;  1BCC E;  2O1K A;  2QG4 A;  1EZV E;  1HBW A;  5KLV D;  1S2E A;  3L70 D;  2QJK B;  3AEF C;  2WMM A;  3L72 D;  1KYO E;  1SQP J;  1VF5 C;  3H1J G;  5CMZ A;  5CBN A;  1FZC B;  3H1L E;  2GUS A;  3NFQ A;  2KK7 A;  3CX5 I;  1M8O B;  1OW8 A;  2HOD B;  1RF0 A;  2ZYD A;  1M7L A;  4RKU J;  3L71 G;  2IBZ G;  3CC4 P;  4GDO A;  1RF1 B;  1NYH A;  1SQV J;  5TIS H;  1BDD A;  1NTZ E;  1IO4 A;  2FYU G;  1KFN A;  2LR2 A;  3H1I E;  3M9B A;  3CCR P;  3GMA A;  3K5B A;  1BGY D;  1FZE A;  2IFN A;  2HPC A;  5AVV B;  3TNU B;  1OIP A;  5BVZ A;  5KAF E;  2ZT9 B;  1J2J B;  1E5W A;  2XZR A;  3CC7 P;  3C8V A;  3AEE C;  3GF3 A;  2ZYA A;  1URQ D;  3OA7 A;  4IOI H;  3QH9 A;  3VYI A;  2LXC B;  2OYI A;  3V4Q A;  2HLO A;  1U57 A;  1BE3 G;  2H8P D;  3BCC J;  5L8R J;  3OJA B;  3V2P A;  1HH0 A;  1URQ B;  1JY2 P;  4LGD E;  1GTW A;  2WT7 A;  2OTK E;  3B8E B;  3H1L G;  1A02 J;  4ZKP A;  2AEJ A;  2W6J H;  1SQP G;  3H1J J;  1SS1 A;  1ZV8 A;  3CXH H;  1GD2 E;  3GW6 A;  5AVZ B;  3CCL P;  4ZMD A;  2O1J A;  4UB8 H;  1KQF B;  1JO5 A;  2IBZ I;  1NTK E;  1NU1 K;  4L74 A;  3CMA P;  4WB4 A;  1SQX D;  1YI2 P;  1P84 I;  1M1J C;  1PP9 E;  1AA0 A;  1KB9 E;  1LWU A;  4N78 E;  1FZG A;  4WY4 D;  4XA4 A;  4O9B A;  2V4H A;  4BRY B;  1G2C A;  2D2C B;  1FU1 A;  3L74 D;  3P8C D;  4PD4 D;  1IFP A;  1DEB A;  3L70 J;  3N7N A;  1VQL P;  3H1I D;  4OH8 B;  1CI6 A;  1FOS E;  2W90 A;  1WRG A;  1OW7 A;  3T97 B;  1SVF A;  4BWN A;  3AEC C;  1YJN P;  1S9K E;  2B87 B;  4D6T J;  2KXP B;  2FXM A;  2IX7 C;  4ASW A;  1GDT A;  1X79 B;  2HPC B;  3KZI E;  4GOE A;  1NTK K;  1NU1 E;  1SQV G;  3NXS A;  2H89 C;  4JQ0 D;  4M3L A;  5AW9 B;  4C7N A;  4OGQ B;  4PV1 B;  1NTZ J;  2WPS A;  5KAI H;  1ZR2 A;  1BCC D;  1R5L A;  5AW5 B;  1EZV D;  3B71 A;  2WPR A;  3MUD A;  5APS A;  3SWY A;  3MHV A;  5KAF H;  2ZXE B;  1ZN5 A;  1MFT A;  2PFX A;  3L73 D;  1T2K C;  1WT6 A;  2WTY A;  2WWW A;  3U1C A;  1GW3 A;  2B9B A;  3CX5 H;  5CBO A;  5GTH H;  1LP1 A;  1M90 Q;  2M3E A;  1SQB K;  3ZDM A;  2XDJ A;  2ZXX A;  3AE2 C;  3A2A A;  3PRJ A;  1FDI A;  1MFZ A;  2A45 H;  3IF4 A;  1N2D C;  3L71 E;  4GKG A;  2Y0E A;  1H89 A;  1YQ3 C;  3L36 A;  1FE6 A;  2FYU E;  1NH4 A;  3EFG A;  3EQ2 A;  1DD4 A;  3GLM A;  3I55 P;  2OYH A;  1VQO P;  3WUU A;  1H0T B;  1Q82 Q;  1OVV A;  2KUB A;  3L74 E;  2L5G B;  2OYH B;  2E75 C;  2K3R A;  1DIP A;  2A06 G;  3V4W A;  1SQQ J;  1J1E C;  2AEM A;  2NPS A;  1SP4 A;  2ZVO B;  1VQM P;  4N78 D;  5AW2 B;  2E42 A;  1RQU A;  4WY4 B;  5KLV G;  3L72 G;  1W2E A;  1L0N G;  2JEE A;  4YPC A;  1EXJ A;  4GIF A;  1LTI C;  4WY4 C;  1PV3 A;  1LNQ A;  2I1J A;  2IZ0 A;  3RK3 C;  2QJY B;  3R2P A;  4ASV A;  1E79 H;  1YYC A;  3KYQ A;  1PGP A;  3BRV B;  3VMZ A;  4DOJ A;  3Q5R A;  1Q81 Q;  2JR8 A;  1JMM A;  1NWQ A;  3UIA A;  2GUV A;  2RH0 A;  3EWK A;  1IK7 A;  1VQ5 P;  2OYI C;  2OYH C;  3D6Y A;  1VQ6 P;  3WMM 0;  2OYI B;  2MKV A;  3E7K A;  1LT9 C;  1MV8 A;  1P84 D;  2FYU D;  2IZ1 A;  2AXT H;  1DH3 A;  1KQL A;  2Z5H A;  1Y47 A;  3R4Y A;  4JYC A;  1S72 P;  1SQQ E;  2M3B A;  3AED C;  2K88 A; 
#chains in the Genus database with same CATH homology
 1PP9 G;  3BCC G;  3L75 G;  3H1H G;  1BE3 G;  1NTK G;  2A06 G;  3H1L G;  1SQV G;  1SQQ G;  1PPJ G;  1SQB G;  1NTZ G;  1SQP G;  5KLV G;  3CXH H;  3L70 G;  3L72 G;  1L0N G;  3H1J G;  1BCC G;  1EZV G;  2BCC G;  1KYO H;  1SQX G;  3L73 G;  4U3F G;  1L0L G;  3TGU G;  4D6T G;  3L71 G;  2IBZ G;  4PD4 H;  3CX5 H;  3L74 G;  1KB9 H;  2FYU G;  1NTM G;  1NU1 G;  1P84 H;  1BGY G;  3H1K G;  3H1I G;  3CWB G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...