3BCCG

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
RQFGHLTRVRHLITYSLSPFEQRPFPHYFSKGVPNVWRRLRACILRVAPPFLAFYLLYTWGTQEFEKSKRKNPAAYVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
total genus 16
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3bccG00
3H1HG 3BCCG 2A06G 1BE3G 4D6TG 1BCCG 1NU1G 3CXHH 1NTZG 3H1KG 1SQVG 3H1JG 1BGYG 3CX5H 1SQQG 3H1IG 4U3FG 1SQXG 3H1LG 3L74G 1KYOH 1NTKG 2FYUG 3L72G 2IBZG 3L70G 1KB9H 3L75G 1PP9G 2BCCG 4PD4H 1L0LG 1SQPG 1SQBG 5KLVG 3CWBG 3L71G 1P84H 1PPJG 3L73G 1EZVG 3TGUG 1L0NG 1NTMG
chains in the Genus database with same CATH superfamily
3PTZA 4D6TJ 1KTMA 3CWBD 3H6PA 4XA4A 4YTPC 2QM7A 1SQXG 2WSEH 2WSCJ 3A0BH 1FZEA 2FYUD 3AE2C 2Z5HA 4WVZA 2WSFH 1HTLC 1NWQA 1HF9A 3WU2E 1DD4A 4WBAA 2G8YA 1S3JA 3VP8A 1GW3A 3FXEA 1KYOE 2ZVOB 3H1JE 4WB4A 1A02J 3LIDA 2GUSA 2WSCH 2OYOA 2HLOA 3AEFC 3B71A 4IFDK 3H1KJ 3KXDA 4JYBA 1J1EC 2GA1A 2ZT9C 1YQ3C 3L75J 4BRYB 1FE6A 2E42A 1MFTA 1SQPD 1EZVD 1N73B 3MP7B 3NTNA 4DCKA 1Y8AA 1Y47A 2OYHA 1T3JA 1ZOYC 1PIXA 3H1HE 5KAFE 5CCGA 5CCHD 2KYVA 1IFIA 2BEQD 1GU5A 3L75G 1LWUC 2C0WA 3IN6A 1X9VA 3AE7C 3KPEA 2ZXXA 3K5BA 5EFWB 1YHQP 3VOPA 4GOEA 1KQFB 1K8AQ 1MKMA 3SWFA 1W5CE 2KSEA 1KB9E 1VQ8P 2KXPB 3NMDA 1E5WA 3CX5I 1R8EA 1J1DC 1PP9D 1SQXE 2JKVA 4EOTA 1NTMJ 1PPJD 3BCCG 3KQGA 1GMJA 1S1CX 2K37A 1PV3A 4U3FJ 1L4AB 2NPSD 3L74J 2J59M 2FXOA 4IFMA 3T97A 1FOSF 5B66H 3QH9A 1Q82Q 3Q5SA 2W83C 1CI6A 5AW5B 4L74A 5KAIH 2W6BA 2A45H 4KHXA 2A06D 3AEDC 2WPQA 3H32A 2E74D 4IL6H 1R5LA 4PD4H 1NTZK 5GTIH 5KLVG 2K1AA 2OGUA 1RF0C 1VQ9P 1JY2N 4LGDE 1JOCA 4I7ZB 3GG2A 1OZHA 5APSA 2N1TD 1L0NE 1BCCD 2FYNB 2Y0CA 2KI7B 1MFZA 1ZV8A 2I8DA 1L0LD 1E79H 2HR3A 2KS1A 3M06A 1G2CB 1EDLA 4JF7A 3TNUB 1QVGO 3RK3B 1AA0A 1L2PA 2FYUG 1NAYA 1JY2O 2IZ0A 1OVUA 2K3RA 4HYTB 3AECC 1GU4A 1CSBA 5CJ4A 1NVOA 2QSIA 1QL2A 3CXHH 3VMZA 4C7NA 1HGVA 1KB9I 3BCCE 3L72J 3NFQA 3HUSB 3VYIA 1ZMEC 1SQVK 4I2LC 3P8MC 3M91A 3F5HA 2AXTH 4IFFA 5BU5A 1Y9BA 2FKWB 3BRVB 1KYOD 4GKGA 1QGKB 1S5LE 4WY4B 2ZT9D 1SQPG 1EZVG 3V4QA 4TT3H 4ZNCA 1N73C 1SLQA 3ZDMA 2WQYC 3AEAC 1VQPP 3VMYA 5KLVE 4K3AA 1URQB 2K9YA 2GM4A 5AW3B 2Q7CA 5BVZA 4R4LA 1VQOP 3H1HD 1NU1D 3CWBE 2PRRA 1KZUB 3B5NB 1VPCA 4AUWA 4LLHA 4IL6X 1P84I 1PP9G 2ZAEB 4OWFA 2GUVA 1PPJG 3HE5A 3OAKA 1BDCA 5B5EE 5GTHE 1FZCA 3HRNA 1L4AC 2RH0A 1PGOA 3CCEP 4AYCA 4N3YB 1PGPA 2YNYA 5C39A 1USEA 4UB8E 1HJ0A 5CCHA 5APUA 1VQMP 2A06G 1SQBE 1X22A 2HPCA 3EQ2A 1K73Q 1WRGA 2IBZG 1NTKD 1OWAA 2O3JA 2QG4A 1K04A 4U7JA 2CK3H 1EC5A 2CPBA 1SFCB 4L75A 1BCCG 4I7ZC 1SQVJ 1T6AA 4HH2A 3RL0g 4YXDC 3D70A 1EZVE 2K88A 3ABVC 3MUDA 2SPZA 2FYNC 2RMZA 1LGHB 4B86A 1HJBA 1L0LG 1FJKA 1RF1A 2FFDA 2NPSA 4I1LA 2WPSA 1L0ND 2OTLP 3A0HH 3RK3C 4KT0J 1FC2C 5CBOA 3CC2P 2QA4P 2W90A 2BEZF 2XV5A 1DD3A 3CX5H 4PJ0E 1PP9E 4XFJA 2DW3A 3H1JJ 2W6AA 1PPJE 1KORA 3P8CD 1AJYA 3RBZA 5CMZA 3HUSC 3CMAP 3VP9A 1Q2NA 1QL1A 2AXCA 2N1TA 2LR2A 1DEEG 3WU2H 1RH5B 1GD2E 1PL5A 1G1JA 2RKLA 2WMMA 3F89A 2E5TA 2HODA 2KLUA 1IFJA 1NGMB 3ITKA 5CJ0A 1SQQD 2JWDA 4WY4C 2E76B 4HJGH 1KQSO 1S2EA 3U1CA 1LP1A 3H1HJ 3VN0A 1N86A 3NXSA 1URQC 2YXQB 3IFMA 1ZN5A 3QWOC 3L73J 2OYIA 1YJNP 1JY3N 2Q9IA 1EZVI 1SP4A 3H1HG 1L0LE 1NKZB 2ZYDA 3HTKA 3B5NC 5APXA 1KILD 5M1BA 1UIXA 1CW5A 1NHLA 1SQXJ 1ZXGA 4RESB 3CCUP 2R3SA 1X8YA 3I55P 3H1LD 1LT9B 4ASVA 1LTAC 1OVVA 2QE7H 4EYYQ 1N7SB 3FGAD 1YITP 1JY3O 2WPRA 2XU6A 2ZVNB 3D6YA 3CPWO 1M57D 1DH3A 1Z56A 3CC4P 1NKNA 3O8ZA 3M0AA 1VF5D 3EFFK 3D71A 3BRTB 1AQ5A 3JC22 1OFCX 2WSSH 1RHZB 1S9KD 3PHLA 1HH0A 1LWUA 1NTKG 1RE4A 2WPVB 5L8RJ 1YI2P 2H88C 1MUUA 1FZGA 3V5BA 4IOIH 3H32B 3WUVA 1L0NJ 2K9JA 2Q5UA 3PLNA 1SQBD 1SFCC 1RE3C 3E7KA 2FYUK 3V2RA 5TJHA 3MTUE 1KC8Q 2WVRA 2I1JA 3RL0B 5APVA 2B88A 1FZAA 2B87A 2PFXA 5KJ7C 1ZR4A 1HWTC 2IBZI 4DT0A 3HD7B 3V2PA 1IC2A 1L0NG 3VTPC 3MHVA 3RGUA 1DEBA 5AW6B 1NU1E 2JR8A 1VQ7P 1M56D 1VQKP 3M9QA 1LTJB 1P84H 1YJ9P 3AEGC 3FXDA 4RJTA 2LXCB 3BCCJ 2Y9YA 1GL2D 1HVVA 1OW8A 4WWIA 3AE6C 1SQPK 3CC7P 2KZJA 3V4WA 1WMKA 4DZOA 4C7NB 1T2KC 1PGJA 2IYPA 1FZFA 1ZLLA 3AE9C 3CCRP 1RF0A 1U7JA 4H0LB 1M1JA 3W67A 4GIFA 3L71D 2P7JA 3TGUD 1JY2P 5E79H 1SQQG 2B9BA 2ZXEB 4H44D 1LTBC 2OQQA 2UWJE 2E76C 3FX0A 4UB6E 2O01J 2E43A 5KLVJ 3WUUA 1NTKE 2KIKA 3RK2D 4JPZB 1VL2A 1KD1Q 3KDPB 1KYOI 3AE8C 2PGDA 1S5LH 2M3EA 1FJPA 1BSNA 1BGYE 3MIWA 1OIPA 3IR9A 2HFED 3CWBJ 3N4XA 2O01H 4H13C 4A7PA 3TYYA 5H2FH 1CZQA 3G4SP 3H1LG 2FYUJ 2JP3A 3B5ND 4OVNF 1LT9C 1DIPA 5AVYB 5APYA 3CWBG 2WT7B 3HE5B 1N7SC 1LTGC 3AE3C 3GHGB 2M3BA 4BRYA 1KV4A 1W2BO 1FZCB 2YXRB 3H1KE 3P8CE 1KFMA 1SQBJ 5CHXA 2IDBA 2C9NY 1N73A 1W2EA 4O9BA 5AW4B 2QVAA 5B5EH 5AW2B 5GTHH 1USDA 3A5TA 2IX7C 1FDOA 2L91A 4L73A 3OA7A 3HE4A 1SQPJ 2OTKE 3E1RA 5AVUB 1SQBG 1SQQE 3LW5J 4M3LA 3GW6A 1KILA 1IO4A 1LT1A 4OGQB 1BE3D 2WITA 3RL0C 1GK4A 3C8VA 5TISH 3CLQA 5AW8B 4GDOA 1JB0J 3HD7C 2Y0EA 5KJ7D 4Y99B 3UIAA 4BXLA 1RF1B 1TU3F 4AQRD 1OW7A 4HKZH 3CCSP 3LW5H 4HB1A 2NPSB 1KFNA 4RKUJ 1AQTA 5APQA 4W7YA 1KILE 1X0TA 3H1ID 4MN4C 2Y0DA 3MD0A 1LTJC 1PP9J 1JCCA 1HBWA 4U3FE 5GTIE 3H1LE 1AFOA 1HGZA 2P10A 1JEKA 2J58A 1S5LX 5AW0B 1IFMA 4H0LC 3L70D 2IPPA 4XE5B 3L71G 3R2PA 2QJKB 1T2KD 3TGUG 2BCCD 4PJ0H 2N1TB 1VQLP 3O6QB 1H8AA 2KNCA 2HODB 1S9KE 3JCUH 2E75B 2N9YB 2R5BA 2E76D 5CBNA 4Z1MH 1G2CA 1GZLA 1LP1B 2CPSA 1M1KQ 1FOSE 1BCCJ 3CXHE 4OH8B 4PV1B 3BVHA 2W27A 1QLED 1L0LJ 3Q1MA 1GL2A 1LTTC 1HUCA 4EI2A 1SQXK 2OYIB 2RN0A 3L36A 2Q6QA 4H13D 4D6TD 3KZIH 1BGYD 2JO1A 3W68A 4NPFX 5BU8B 1ZR2A 4BWNA 1VDFA 2QJPB 2FY8A 2YKOA 3RK3E 2VRSA 1ZRTE 3U59A 2H43A 4JYCA 2MJZA 1Q86Q 2KOGA 2QRXA 3GHGC 4JQ0D 2R32A 1FZCC 1N7SD 2D2CB 1GK6A 3EWKA 3M0DC 3WUTA 2QJYB 2HG5D 2R44A 2ZYGA 4EIJA 2MKVA 4K35A 2BASA 2IFNA 5CCHC 2KK7A 1FAVA 2ZJSE 3L71E 2YMKA 3TGUE 3H1KD 2YIUB 4CPGA 1JM0A 1L0NK 1G1IA 2KB7P 3M9BA 1Q90D 1NH4A 1JY3P 3KYQA 1YTZI 2KSJA 4OGQC 1BE3G 3B5NA 2K9JB 3MUDC 1KYOH 1NTZE 4GOFA 1JO5A 1RQUA 2Q3IA 2B87B 4Y99C 4TLFA 2M5AA 1RF1C 1MZ9A 3HD7D 1NAFA 3L4FA 1AV1A 3SFDC 1NU1J 3CI9A 5APWA 2NPSC 3H1IG 3IF4A 1VQNP 2OYHB 4ZKPA 2IYOA 2QM8A 2HYNA 4N6JA 3CCMP 1NU1G 1NTMD 2JWAA 2NRGA 5KAFH 3FWLA 1JUNA 4PD4D 3L70G 4U3FD 2BCCG 3L74D 2QJKC 2FXMA 1N8RQ 3BATA 1U57A 3D6ZA 2XZRA 4H0LD 2N1TC 2FXPA 1M1JB 4LC1A 2C9LY 2YKQA 3A0HE 2WSFJ 5KLVK 5AW9B 4GT1A 5KJ7A 1NTKJ 2E75C 3VMAA 1FS0E 1L4AD 2WWWA 1KB9H 4W7ZA 1EXJA 3T97B 3CX5E 2L5GB 1BGYJ 1LTIC 1CI6B 4DJGA 1OXZA 4PV1C 2O1KA 1J2JB 3OW2O 1BE3E 2ZFCA 1FDMA 4UB6H 3TF5A 1WT6A 2AEFA 2OARA 2W6JH 2OYIC 3CXHD 1Q7YQ 2C0XA 4D6TG 1BGYG 2B89A 2JDIH 2QJPC 1IZNB 2AEMA 2LXBA 2P58A 2H8PD 3H1IE 5DJUB 2V4HA 5AW7B 2G3AA 2KUBA 5APTA 5KLIB 2KS1B 1YJWP 2D2CC 3AE5C 2KZIA 5AVVB 3GF7A 1JTHA 1SQBK 2WZ7A 3Q5PA 3GLMA 3RK3D 1H0TA 1ZRTD 3L72D 2QJYC 1FBMA 2KLVA 3I56P 3G3ZA 3L70E 2BCCE 3SSUA 3H1KG 1EDIA 2YIUC 1SQQJ 1T8ZA 2R5DA 3Q3DA 1RE4C 4DOJA 2NZ2A 1JMMA 3HE4B 3KHUA 4QMAA 1R5SA 1KILB 3L73E 4OGQD 3CMEP 3PRJA 1LT9A 5AVRB 3GF3A 1M90Q 3PP5A 4N78D 3CCJP 3A0BE 1GDTA 1OVRA 4WY4D 1FDIA 3AE1C 1YQ4C 1ZP0C 1N7SA 2YMYA 5AVSB 1PZQA 1T3UA 3B8EB 4KJMA 1QVFO 1NTZD 2H89C 1IFPA 3FWNA 3H1LJ 2OYHC 3A2AA 4D6TE 1URQD 5CCGC 1BDDA 2A45G 1EDJA 1VF5B 1NTMG 3Q2YA 2YO2A 1DX7A 2P1JA 1MV8A 2PP6A 4GODA 4RO0A 4U3FG 3L74G 3P7KA 3V6IA 1PFIA 2M0BA 1D7MA 2IBZD 1AVYA 4ZKUA 1OW6A 1NYHA 3G9RA 3AE4C 1M1JC 5AVWB 1ZW0A 1FU1A 3TK1A 2Q1KA 5KKZB 3AEBC 4YXWH 1IK7A 3HD7A 3IAOA 2KNCB 3CCLP 2E75D 5K5GB 1P84E 2XKMA 3PH0A 3L75E 1Q81Q 3OJAB 2O01N 3N7NA 4I6MC 1L0LK 1SQVD 1SVFA 1LTJA 4PV1D 2YO3A 2HPCB 2JEEA 4Y28J 2ITAA 1S72P 1EXIA 4UB8H 1VQ6P 1N2DC 1N7LA 3CX5D 3RBXA 2FBWC 1X79B 1K9MQ 1GL2B 3LIEA 2YKPA 3PJSK 5E79E 1SFCD 4C7RA 2PAJA 2KP8A 1KQLA 2IFMA 1YYCA 5B66E 2Y9ZA 4ZMDA 4L76A 4ASWA 2H7HA 5AVZB 5KLIC 5KAIE 1FZBA 1YTZT 1L4AA 4H44B 2W8ZA 1GTWA 2FFDB 1NTME 1VQ5P 3H1JD 2D2CD 3L72G 4IL6E 4PD4E 3L71J 1QX8A 3TGUJ 3EFGA 3RK2B 1K05A 3L74E 1GW4A 3II6A 3S1KA 5AVQB 2Q3EA 5H2FE 2E5YA 1AVOA 2E74B 3R4YA 4JBZA 3CL3D 3B4SA 1EDKA 1IK9A 3I5CA 1KILC 1NTZJ 3GMAA 1KMIZ 4R4MA 5KTBA 1XTGB 1NU1K 2WT7A 2FYUE 3GHGA 1SS1A 3L73D 3CCQP 1H89A 2M5AB 3TNUA 1NTZG 1YIJP 1IFDA 4EDFA 1LNQA 2OTJP 3M0DA 1KB9D 2FYZA 1SQXD 5CCGD 1VF5C 4C46A 3M9HA 1BSHA 5AW1B 3L37A 2AXTE 3MGNA 3G71P 1NJIQ 2M8RA 3HUSA 3U1AA 1UIIA 5TISE 3HTKB 4YPCA 2A45I 2I1KA 3L72E 3JSVC 3BASA 1SQPE 1M8OB 1NTKK 1OMIA 5KKZC 3H25A 1S4XA 4WY4A 4PD4I 3V2NA 1J1EB 2ZT9B 3SWYA 3CCVP 1JNMA 2POHA 1H88A 3TSIA 1IJDB 1YBKA 1BE3J 3USSA 1URQA 1SQVG 2QIWA 1JCDA 1U7MA 2P67A 3P32A 3AEEC 1P84D 1NO4A 1NOHA 1LWUB 1PGQA 5AVTB 3L75D 4N78E 1GL2C 1KQGB 2JJLA 3H1IJ 1LJ2A 3JCUE 3RL0D 2XNXA 3SFEC 2LKMA 2N9BA 1J1DB 3O6QA 3CXHI 1M7LA 4NPDA 1RQVA 2V7QJ 2QEXP 4H44C 2IZ1A 3H1JG 2FFDC 3BCCD 3A3YB 3S4RA 2Z4EA 2ZYAA 2A06E 5AVXB 3C1LA 3L70J 2O1JA 1JTHB 1VQ4P 3SWKA 2BCCJ 3VMXA 2P2UA 3RK2C 3G6EP 1IFNA 1JMBA 5DJTB 1H0TB 2IBZE 1SQQK 2R3CA 2XNDH 3L35A 1OX3A 2E74C 4NPEA 3KZIE 3C9IA 1BCCE 2V7QH 2XDJA 4W80A 1LTSC 3WMM0 2WTYA 1SFCA 3MZWB 1RE3A 2J5UA 1KN7A 5KLVD 2AEJA 3S9OA 3TDKA 3V2QA 4H13B 2WSEJ 1EQ7A 3A7OA 1NTMK 3CD6P 1SQVE 1A02F 3E1IA 2Z5IA 3L73G 1XTCC 3Q5RA 1RY3A 1QEXA
chains in the Genus database with same CATH topology
3H1HG 3BCCG 2A06G 1BE3G 4D6TG 1BCCG 1NU1G 3CXHH 1NTZG 3H1KG 1SQVG 3H1JG 1BGYG 3CX5H 1SQQG 3H1IG 4U3FG 1SQXG 3H1LG 3L74G 1KYOH 1NTKG 2FYUG 3L72G 2IBZG 3L70G 1KB9H 3L75G 1PP9G 2BCCG 4PD4H 1L0LG 1SQPG 1SQBG 5KLVG 3CWBG 3L71G 1P84H 1PPJG 3L73G 1EZVG 3TGUG 1L0NG 1NTMG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1H G;  3BCC G;  2A06 G;  1BE3 G;  4D6T G;  1BCC G;  1NU1 G;  3CXH H;  1NTZ G;  3H1K G;  1SQV G;  3H1J G;  1BGY G;  3CX5 H;  1SQQ G;  3H1I G;  4U3F G;  1SQX G;  3H1L G;  3L74 G;  1KYO H;  1NTK G;  2FYU G;  3L72 G;  2IBZ G;  3L70 G;  1KB9 H;  3L75 G;  1PP9 G;  2BCC G;  4PD4 H;  1L0L G;  1SQP G;  1SQB G;  5KLV G;  3CWB G;  3L71 G;  1P84 H;  1PPJ G;  3L73 G;  1EZV G;  3TGU G;  1L0N G;  1NTM G; 
#chains in the Genus database with same CATH topology
 3PTZ A;  4D6T J;  1KTM A;  3CWB D;  3H6P A;  4XA4 A;  4YTP C;  2QM7 A;  1SQX G;  2WSE H;  2WSC J;  3A0B H;  1FZE A;  2FYU D;  3AE2 C;  2Z5H A;  4WVZ A;  2WSF H;  1HTL C;  1NWQ A;  1HF9 A;  3WU2 E;  1DD4 A;  4WBA A;  2G8Y A;  1S3J A;  3VP8 A;  1GW3 A;  3FXE A;  1KYO E;  2ZVO B;  3H1J E;  4WB4 A;  1A02 J;  3LID A;  2GUS A;  2WSC H;  2OYO A;  2HLO A;  3AEF C;  3B71 A;  4IFD K;  3H1K J;  3KXD A;  4JYB A;  1J1E C;  2GA1 A;  2ZT9 C;  1YQ3 C;  3L75 J;  4BRY B;  1FE6 A;  2E42 A;  1MFT A;  1SQP D;  1EZV D;  1N73 B;  3MP7 B;  3NTN A;  4DCK A;  1Y8A A;  1Y47 A;  2OYH A;  1T3J A;  1ZOY C;  1PIX A;  3H1H E;  5KAF E;  5CCG A;  5CCH D;  2KYV A;  1IFI A;  2BEQ D;  1GU5 A;  3L75 G;  1LWU C;  2C0W A;  3IN6 A;  1X9V A;  3AE7 C;  3KPE A;  2ZXX A;  3K5B A;  5EFW B;  1YHQ P;  3VOP A;  4GOE A;  1KQF B;  1K8A Q;  1MKM A;  3SWF A;  1W5C E;  2KSE A;  1KB9 E;  1VQ8 P;  2KXP B;  3NMD A;  1E5W A;  3CX5 I;  1R8E A;  1J1D C;  1PP9 D;  1SQX E;  2JKV A;  4EOT A;  1NTM J;  1PPJ D;  3BCC G;  3KQG A;  1GMJ A;  1S1C X;  2K37 A;  1PV3 A;  4U3F J;  1L4A B;  2NPS D;  3L74 J;  2J59 M;  2FXO A;  4IFM A;  3T97 A;  1FOS F;  5B66 H;  3QH9 A;  1Q82 Q;  3Q5S A;  2W83 C;  1CI6 A;  5AW5 B;  4L74 A;  5KAI H;  2W6B A;  2A45 H;  4KHX A;  2A06 D;  3AED C;  2WPQ A;  3H32 A;  2E74 D;  4IL6 H;  1R5L A;  4PD4 H;  1NTZ K;  5GTI H;  5KLV G;  2K1A A;  2OGU A;  1RF0 C;  1VQ9 P;  1JY2 N;  4LGD E;  1JOC A;  4I7Z B;  3GG2 A;  1OZH A;  5APS A;  2N1T D;  1L0N E;  1BCC D;  2FYN B;  2Y0C A;  2KI7 B;  1MFZ A;  1ZV8 A;  2I8D A;  1L0L D;  1E79 H;  2HR3 A;  2KS1 A;  3M06 A;  1G2C B;  1EDL A;  4JF7 A;  3TNU B;  1QVG O;  3RK3 B;  1AA0 A;  1L2P A;  2FYU G;  1NAY A;  1JY2 O;  2IZ0 A;  1OVU A;  2K3R A;  4HYT B;  3AEC C;  1GU4 A;  1CSB A;  5CJ4 A;  1NVO A;  2QSI A;  1QL2 A;  3CXH H;  3VMZ A;  4C7N A;  1HGV A;  1KB9 I;  3BCC E;  3L72 J;  3NFQ A;  3HUS B;  3VYI A;  1ZME C;  1SQV K;  4I2L C;  3P8M C;  3M91 A;  3F5H A;  2AXT H;  4IFF A;  5BU5 A;  1Y9B A;  2FKW B;  3BRV B;  1KYO D;  4GKG A;  1QGK B;  1S5L E;  4WY4 B;  2ZT9 D;  1SQP G;  1EZV G;  3V4Q A;  4TT3 H;  4ZNC A;  1N73 C;  1SLQ A;  3ZDM A;  2WQY C;  3AEA C;  1VQP P;  3VMY A;  5KLV E;  4K3A A;  1URQ B;  2K9Y A;  2GM4 A;  5AW3 B;  2Q7C A;  5BVZ A;  4R4L A;  1VQO P;  3H1H D;  1NU1 D;  3CWB E;  2PRR A;  1KZU B;  3B5N B;  1VPC A;  4AUW A;  4LLH A;  4IL6 X;  1P84 I;  1PP9 G;  2ZAE B;  4OWF A;  2GUV A;  1PPJ G;  3HE5 A;  3OAK A;  1BDC A;  5B5E E;  5GTH E;  1FZC A;  3HRN A;  1L4A C;  2RH0 A;  1PGO A;  3CCE P;  4AYC A;  4N3Y B;  1PGP A;  2YNY A;  5C39 A;  1USE A;  4UB8 E;  1HJ0 A;  5CCH A;  5APU A;  1VQM P;  2A06 G;  1SQB E;  1X22 A;  2HPC A;  3EQ2 A;  1K73 Q;  1WRG A;  2IBZ G;  1NTK D;  1OWA A;  2O3J A;  2QG4 A;  1K04 A;  4U7J A;  2CK3 H;  1EC5 A;  2CPB A;  1SFC B;  4L75 A;  1BCC G;  4I7Z C;  1SQV J;  1T6A A;  4HH2 A;  3RL0 g;  4YXD C;  3D70 A;  1EZV E;  2K88 A;  3ABV C;  3MUD A;  2SPZ A;  2FYN C;  2RMZ A;  1LGH B;  4B86 A;  1HJB A;  1L0L G;  1FJK A;  1RF1 A;  2FFD A;  2NPS A;  4I1L A;  2WPS A;  1L0N D;  2OTL P;  3A0H H;  3RK3 C;  4KT0 J;  1FC2 C;  5CBO A;  3CC2 P;  2QA4 P;  2W90 A;  2BEZ F;  2XV5 A;  1DD3 A;  3CX5 H;  4PJ0 E;  1PP9 E;  4XFJ A;  2DW3 A;  3H1J J;  2W6A A;  1PPJ E;  1KOR A;  3P8C D;  1AJY A;  3RBZ A;  5CMZ A;  3HUS C;  3CMA P;  3VP9 A;  1Q2N A;  1QL1 A;  2AXC A;  2N1T A;  2LR2 A;  1DEE G;  3WU2 H;  1RH5 B;  1GD2 E;  1PL5 A;  1G1J A;  2RKL A;  2WMM A;  3F89 A;  2E5T A;  2HOD A;  2KLU A;  1IFJ A;  1NGM B;  3ITK A;  5CJ0 A;  1SQQ D;  2JWD A;  4WY4 C;  2E76 B;  4HJG H;  1KQS O;  1S2E A;  3U1C A;  1LP1 A;  3H1H J;  3VN0 A;  1N86 A;  3NXS A;  1URQ C;  2YXQ B;  3IFM A;  1ZN5 A;  3QWO C;  3L73 J;  2OYI A;  1YJN P;  1JY3 N;  2Q9I A;  1EZV I;  1SP4 A;  3H1H G;  1L0L E;  1NKZ B;  2ZYD A;  3HTK A;  3B5N C;  5APX A;  1KIL D;  5M1B A;  1UIX A;  1CW5 A;  1NHL A;  1SQX J;  1ZXG A;  4RES B;  3CCU P;  2R3S A;  1X8Y A;  3I55 P;  3H1L D;  1LT9 B;  4ASV A;  1LTA C;  1OVV A;  2QE7 H;  4EYY Q;  1N7S B;  3FGA D;  1YIT P;  1JY3 O;  2WPR A;  2XU6 A;  2ZVN B;  3D6Y A;  3CPW O;  1M57 D;  1DH3 A;  1Z56 A;  3CC4 P;  1NKN A;  3O8Z A;  3M0A A;  1VF5 D;  3EFF K;  3D71 A;  3BRT B;  1AQ5 A;  3JC2 2;  1OFC X;  2WSS H;  1RHZ B;  1S9K D;  3PHL A;  1HH0 A;  1LWU A;  1NTK G;  1RE4 A;  2WPV B;  5L8R J;  1YI2 P;  2H88 C;  1MUU A;  1FZG A;  3V5B A;  4IOI H;  3H32 B;  3WUV A;  1L0N J;  2K9J A;  2Q5U A;  3PLN A;  1SQB D;  1SFC C;  1RE3 C;  3E7K A;  2FYU K;  3V2R A;  5TJH A;  3MTU E;  1KC8 Q;  2WVR A;  2I1J A;  3RL0 B;  5APV A;  2B88 A;  1FZA A;  2B87 A;  2PFX A;  5KJ7 C;  1ZR4 A;  1HWT C;  2IBZ I;  4DT0 A;  3HD7 B;  3V2P A;  1IC2 A;  1L0N G;  3VTP C;  3MHV A;  3RGU A;  1DEB A;  5AW6 B;  1NU1 E;  2JR8 A;  1VQ7 P;  1M56 D;  1VQK P;  3M9Q A;  1LTJ B;  1P84 H;  1YJ9 P;  3AEG C;  3FXD A;  4RJT A;  2LXC B;  3BCC J;  2Y9Y A;  1GL2 D;  1HVV A;  1OW8 A;  4WWI A;  3AE6 C;  1SQP K;  3CC7 P;  2KZJ A;  3V4W A;  1WMK A;  4DZO A;  4C7N B;  1T2K C;  1PGJ A;  2IYP A;  1FZF A;  1ZLL A;  3AE9 C;  3CCR P;  1RF0 A;  1U7J A;  4H0L B;  1M1J A;  3W67 A;  4GIF A;  3L71 D;  2P7J A;  3TGU D;  1JY2 P;  5E79 H;  1SQQ G;  2B9B A;  2ZXE B;  4H44 D;  1LTB C;  2OQQ A;  2UWJ E;  2E76 C;  3FX0 A;  4UB6 E;  2O01 J;  2E43 A;  5KLV J;  3WUU A;  1NTK E;  2KIK A;  3RK2 D;  4JPZ B;  1VL2 A;  1KD1 Q;  3KDP B;  1KYO I;  3AE8 C;  2PGD A;  1S5L H;  2M3E A;  1FJP A;  1BSN A;  1BGY E;  3MIW A;  1OIP A;  3IR9 A;  2HFE D;  3CWB J;  3N4X A;  2O01 H;  4H13 C;  4A7P A;  3TYY A;  5H2F H;  1CZQ A;  3G4S P;  3H1L G;  2FYU J;  2JP3 A;  3B5N D;  4OVN F;  1LT9 C;  1DIP A;  5AVY B;  5APY A;  3CWB G;  2WT7 B;  3HE5 B;  1N7S C;  1LTG C;  3AE3 C;  3GHG B;  2M3B A;  4BRY A;  1KV4 A;  1W2B O;  1FZC B;  2YXR B;  3H1K E;  3P8C E;  1KFM A;  1SQB J;  5CHX A;  2IDB A;  2C9N Y;  1N73 A;  1W2E A;  4O9B A;  5AW4 B;  2QVA A;  5B5E H;  5AW2 B;  5GTH H;  1USD A;  3A5T A;  2IX7 C;  1FDO A;  2L91 A;  4L73 A;  3OA7 A;  3HE4 A;  1SQP J;  2OTK E;  3E1R A;  5AVU B;  1SQB G;  1SQQ E;  3LW5 J;  4M3L A;  3GW6 A;  1KIL A;  1IO4 A;  1LT1 A;  4OGQ B;  1BE3 D;  2WIT A;  3RL0 C;  1GK4 A;  3C8V A;  5TIS H;  3CLQ A;  5AW8 B;  4GDO A;  1JB0 J;  3HD7 C;  2Y0E A;  5KJ7 D;  4Y99 B;  3UIA A;  4BXL A;  1RF1 B;  1TU3 F;  4AQR D;  1OW7 A;  4HKZ H;  3CCS P;  3LW5 H;  4HB1 A;  2NPS B;  1KFN A;  4RKU J;  1AQT A;  5APQ A;  4W7Y A;  1KIL E;  1X0T A;  3H1I D;  4MN4 C;  2Y0D A;  3MD0 A;  1LTJ C;  1PP9 J;  1JCC A;  1HBW A;  4U3F E;  5GTI E;  3H1L E;  1AFO A;  1HGZ A;  2P10 A;  1JEK A;  2J58 A;  1S5L X;  5AW0 B;  1IFM A;  4H0L C;  3L70 D;  2IPP A;  4XE5 B;  3L71 G;  3R2P A;  2QJK B;  1T2K D;  3TGU G;  2BCC D;  4PJ0 H;  2N1T B;  1VQL P;  3O6Q B;  1H8A A;  2KNC A;  2HOD B;  1S9K E;  3JCU H;  2E75 B;  2N9Y B;  2R5B A;  2E76 D;  5CBN A;  4Z1M H;  1G2C A;  1GZL A;  1LP1 B;  2CPS A;  1M1K Q;  1FOS E;  1BCC J;  3CXH E;  4OH8 B;  4PV1 B;  3BVH A;  2W27 A;  1QLE D;  1L0L J;  3Q1M A;  1GL2 A;  1LTT C;  1HUC A;  4EI2 A;  1SQX K;  2OYI B;  2RN0 A;  3L36 A;  2Q6Q A;  4H13 D;  4D6T D;  3KZI H;  1BGY D;  2JO1 A;  3W68 A;  4NPF X;  5BU8 B;  1ZR2 A;  4BWN A;  1VDF A;  2QJP B;  2FY8 A;  2YKO A;  3RK3 E;  2VRS A;  1ZRT E;  3U59 A;  2H43 A;  4JYC A;  2MJZ A;  1Q86 Q;  2KOG A;  2QRX A;  3GHG C;  4JQ0 D;  2R32 A;  1FZC C;  1N7S D;  2D2C B;  1GK6 A;  3EWK A;  3M0D C;  3WUT A;  2QJY B;  2HG5 D;  2R44 A;  2ZYG A;  4EIJ A;  2MKV A;  4K35 A;  2BAS A;  2IFN A;  5CCH C;  2KK7 A;  1FAV A;  2ZJS E;  3L71 E;  2YMK A;  3TGU E;  3H1K D;  2YIU B;  4CPG A;  1JM0 A;  1L0N K;  1G1I A;  2KB7 P;  3M9B A;  1Q90 D;  1NH4 A;  1JY3 P;  3KYQ A;  1YTZ I;  2KSJ A;  4OGQ C;  1BE3 G;  3B5N A;  2K9J B;  3MUD C;  1KYO H;  1NTZ E;  4GOF A;  1JO5 A;  1RQU A;  2Q3I A;  2B87 B;  4Y99 C;  4TLF A;  2M5A A;  1RF1 C;  1MZ9 A;  3HD7 D;  1NAF A;  3L4F A;  1AV1 A;  3SFD C;  1NU1 J;  3CI9 A;  5APW A;  2NPS C;  3H1I G;  3IF4 A;  1VQN P;  2OYH B;  4ZKP A;  2IYO A;  2QM8 A;  2HYN A;  4N6J A;  3CCM P;  1NU1 G;  1NTM D;  2JWA A;  2NRG A;  5KAF H;  3FWL A;  1JUN A;  4PD4 D;  3L70 G;  4U3F D;  2BCC G;  3L74 D;  2QJK C;  2FXM A;  1N8R Q;  3BAT A;  1U57 A;  3D6Z A;  2XZR A;  4H0L D;  2N1T C;  2FXP A;  1M1J B;  4LC1 A;  2C9L Y;  2YKQ A;  3A0H E;  2WSF J;  5KLV K;  5AW9 B;  4GT1 A;  5KJ7 A;  1NTK J;  2E75 C;  3VMA A;  1FS0 E;  1L4A D;  2WWW A;  1KB9 H;  4W7Z A;  1EXJ A;  3T97 B;  3CX5 E;  2L5G B;  1BGY J;  1LTI C;  1CI6 B;  4DJG A;  1OXZ A;  4PV1 C;  2O1K A;  1J2J B;  3OW2 O;  1BE3 E;  2ZFC A;  1FDM A;  4UB6 H;  3TF5 A;  1WT6 A;  2AEF A;  2OAR A;  2W6J H;  2OYI C;  3CXH D;  1Q7Y Q;  2C0X A;  4D6T G;  1BGY G;  2B89 A;  2JDI H;  2QJP C;  1IZN B;  2AEM A;  2LXB A;  2P58 A;  2H8P D;  3H1I E;  5DJU B;  2V4H A;  5AW7 B;  2G3A A;  2KUB A;  5APT A;  5KLI B;  2KS1 B;  1YJW P;  2D2C C;  3AE5 C;  2KZI A;  5AVV B;  3GF7 A;  1JTH A;  1SQB K;  2WZ7 A;  3Q5P A;  3GLM A;  3RK3 D;  1H0T A;  1ZRT D;  3L72 D;  2QJY C;  1FBM A;  2KLV A;  3I56 P;  3G3Z A;  3L70 E;  2BCC E;  3SSU A;  3H1K G;  1EDI A;  2YIU C;  1SQQ J;  1T8Z A;  2R5D A;  3Q3D A;  1RE4 C;  4DOJ A;  2NZ2 A;  1JMM A;  3HE4 B;  3KHU A;  4QMA A;  1R5S A;  1KIL B;  3L73 E;  4OGQ D;  3CME P;  3PRJ A;  1LT9 A;  5AVR B;  3GF3 A;  1M90 Q;  3PP5 A;  4N78 D;  3CCJ P;  3A0B E;  1GDT A;  1OVR A;  4WY4 D;  1FDI A;  3AE1 C;  1YQ4 C;  1ZP0 C;  1N7S A;  2YMY A;  5AVS B;  1PZQ A;  1T3U A;  3B8E B;  4KJM A;  1QVF O;  1NTZ D;  2H89 C;  1IFP A;  3FWN A;  3H1L J;  2OYH C;  3A2A A;  4D6T E;  1URQ D;  5CCG C;  1BDD A;  2A45 G;  1EDJ A;  1VF5 B;  1NTM G;  3Q2Y A;  2YO2 A;  1DX7 A;  2P1J A;  1MV8 A;  2PP6 A;  4GOD A;  4RO0 A;  4U3F G;  3L74 G;  3P7K A;  3V6I A;  1PFI A;  2M0B A;  1D7M A;  2IBZ D;  1AVY A;  4ZKU A;  1OW6 A;  1NYH A;  3G9R A;  3AE4 C;  1M1J C;  5AVW B;  1ZW0 A;  1FU1 A;  3TK1 A;  2Q1K A;  5KKZ B;  3AEB C;  4YXW H;  1IK7 A;  3HD7 A;  3IAO A;  2KNC B;  3CCL P;  2E75 D;  5K5G B;  1P84 E;  2XKM A;  3PH0 A;  3L75 E;  1Q81 Q;  3OJA B;  2O01 N;  3N7N A;  4I6M C;  1L0L K;  1SQV D;  1SVF A;  1LTJ A;  4PV1 D;  2YO3 A;  2HPC B;  2JEE A;  4Y28 J;  2ITA A;  1S72 P;  1EXI A;  4UB8 H;  1VQ6 P;  1N2D C;  1N7L A;  3CX5 D;  3RBX A;  2FBW C;  1X79 B;  1K9M Q;  1GL2 B;  3LIE A;  2YKP A;  3PJS K;  5E79 E;  1SFC D;  4C7R A;  2PAJ A;  2KP8 A;  1KQL A;  2IFM A;  1YYC A;  5B66 E;  2Y9Z A;  4ZMD A;  4L76 A;  4ASW A;  2H7H A;  5AVZ B;  5KLI C;  5KAI E;  1FZB A;  1YTZ T;  1L4A A;  4H44 B;  2W8Z A;  1GTW A;  2FFD B;  1NTM E;  1VQ5 P;  3H1J D;  2D2C D;  3L72 G;  4IL6 E;  4PD4 E;  3L71 J;  1QX8 A;  3TGU J;  3EFG A;  3RK2 B;  1K05 A;  3L74 E;  1GW4 A;  3II6 A;  3S1K A;  5AVQ B;  2Q3E A;  5H2F E;  2E5Y A;  1AVO A;  2E74 B;  3R4Y A;  4JBZ A;  3CL3 D;  3B4S A;  1EDK A;  1IK9 A;  3I5C A;  1KIL C;  1NTZ J;  3GMA A;  1KMI Z;  4R4M A;  5KTB A;  1XTG B;  1NU1 K;  2WT7 A;  2FYU E;  3GHG A;  1SS1 A;  3L73 D;  3CCQ P;  1H89 A;  2M5A B;  3TNU A;  1NTZ G;  1YIJ P;  1IFD A;  4EDF A;  1LNQ A;  2OTJ P;  3M0D A;  1KB9 D;  2FYZ A;  1SQX D;  5CCG D;  1VF5 C;  4C46 A;  3M9H A;  1BSH A;  5AW1 B;  3L37 A;  2AXT E;  3MGN A;  3G71 P;  1NJI Q;  2M8R A;  3HUS A;  3U1A A;  1UII A;  5TIS E;  3HTK B;  4YPC A;  2A45 I;  2I1K A;  3L72 E;  3JSV C;  3BAS A;  1SQP E;  1M8O B;  1NTK K;  1OMI A;  5KKZ C;  3H25 A;  1S4X A;  4WY4 A;  4PD4 I;  3V2N A;  1J1E B;  2ZT9 B;  3SWY A;  3CCV P;  1JNM A;  2POH A;  1H88 A;  3TSI A;  1IJD B;  1YBK A;  1BE3 J;  3USS A;  1URQ A;  1SQV G;  2QIW A;  1JCD A;  1U7M A;  2P67 A;  3P32 A;  3AEE C;  1P84 D;  1NO4 A;  1NOH A;  1LWU B;  1PGQ A;  5AVT B;  3L75 D;  4N78 E;  1GL2 C;  1KQG B;  2JJL A;  3H1I J;  1LJ2 A;  3JCU E;  3RL0 D;  2XNX A;  3SFE C;  2LKM A;  2N9B A;  1J1D B;  3O6Q A;  3CXH I;  1M7L A;  4NPD A;  1RQV A;  2V7Q J;  2QEX P;  4H44 C;  2IZ1 A;  3H1J G;  2FFD C;  3BCC D;  3A3Y B;  3S4R A;  2Z4E A;  2ZYA A;  2A06 E;  5AVX B;  3C1L A;  3L70 J;  2O1J A;  1JTH B;  1VQ4 P;  3SWK A;  2BCC J;  3VMX A;  2P2U A;  3RK2 C;  3G6E P;  1IFN A;  1JMB A;  5DJT B;  1H0T B;  2IBZ E;  1SQQ K;  2R3C A;  2XND H;  3L35 A;  1OX3 A;  2E74 C;  4NPE A;  3KZI E;  3C9I A;  1BCC E;  2V7Q H;  2XDJ A;  4W80 A;  1LTS C;  3WMM 0;  2WTY A;  1SFC A;  3MZW B;  1RE3 A;  2J5U A;  1KN7 A;  5KLV D;  2AEJ A;  3S9O A;  3TDK A;  3V2Q A;  4H13 B;  2WSE J;  1EQ7 A;  3A7O A;  1NTM K;  3CD6 P;  1SQV E;  1A02 F;  3E1I A;  2Z5I A;  3L73 G;  1XTC C;  3Q5R A;  1RY3 A;  1QEX A; 
#chains in the Genus database with same CATH homology
 3H1H G;  3BCC G;  2A06 G;  1BE3 G;  4D6T G;  1BCC G;  1NU1 G;  3CXH H;  1NTZ G;  3H1K G;  1SQV G;  3H1J G;  1BGY G;  3CX5 H;  1SQQ G;  3H1I G;  4U3F G;  1SQX G;  3H1L G;  3L74 G;  1KYO H;  1NTK G;  2FYU G;  3L72 G;  2IBZ G;  3L70 G;  1KB9 H;  3L75 G;  1PP9 G;  2BCC G;  4PD4 H;  1L0L G;  1SQP G;  1SQB G;  5KLV G;  3CWB G;  3L71 G;  1P84 H;  1PPJ G;  3L73 G;  1EZV G;  3TGU G;  1L0N G;  1NTM G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...