3BCCG

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
RQFGHLTRVRHLITYSLSPFEQRPFPHYFSKGVPNVWRRLRACILRVAPPFLAFYLLYTWGTQEFEKSKRKNPAAYVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
total genus 16
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3bccG00
3L72G 2FYUG 1SQPG 2A06G 1P84H 3H1KG 1NTKG 1SQBG 1NTZG 5KLVG 1L0NG 1PPJG 1KYOH 3CWBG 1SQXG 3L74G 4U3FG 3TGUG 1NTMG 2IBZG 3BCCG 3CXHH 1L0LG 1BCCG 3H1LG 3H1HG 3L71G 1PP9G 4PD4H 3H1JG 3H1IG 1SQVG 1BGYG 1EZVG 2BCCG 3CX5H 3L73G 3L70G 1NU1G 1SQQG 4D6TG 3L75G 1KB9H 1BE3G
chains in the Genus database with same CATH superfamily
1DD3A 1OXZA 1LTBC 2QM7A 1NKZB 2M3BA 2AEJA 2H8PD 2WSEJ 1JY2P 1QL1A 1SQBK 3L70D 1BCCE 3MIWA 4LGDE 2HPCA 3SWFA 1RE3A 2I1KA 1KQFB 2KLVA 2QJKB 3GF3A 3I56P 2W6JH 1VDFA 1FOSE 1KB9D 3AEEC 1K05A 3IF4A 2Y9ZA 1KB9E 2IDBA 3VYIA 5GTIE 1VQ8P 4BRYA 2W27A 2OTLP 2E74B 1Y9BA 2K9YA 3NMDA 2ZT9D 4H13C 4D6TJ 1S72P 1OFCX 2OYHA 4EDFA 3OA7A 5GTHH 3G9RA 3L71D 1KD1Q 1QVFO 3CX5H 1NTME 2KI7B 3N4XA 2J58A 3NTNA 4N78E 4NPDA 1ZMEC 1PP9D 5KLVK 3P8CE 4OVNF 3JCUE 1OVUA 2Y9YA 2OARA 3NXSA 1BE3E 3H25A 1FJPA 2LKMA 1KORA 1L0NG 1ZN5A 1JY3P 1N86A 2P67A 3BCCD 4OH8B 1L0LE 1ZOYC 2B87B 2XU6A 2XNDH 2E75C 2FXPA 1NTMJ 4ASVA 1J2JB 1PGPA 4IFFA 1X8YA 1Q7YQ 4EI2A 5AW1B 2B89A 3RK2C 2XNXA 4GIFA 3U59A 2A45G 4XE5B 2Q6QA 2DW3A 1NTKE 2W8ZA 3FXEA 2YO2A 1LP1B 5AVRB 3MGNA 1IJDB 5KJ7A 3UIAA 1M1KQ 1RF1A 1DX7A 3GHGA 2Y0CA 4Z1MH 1H0TB 1OIPA 5AVYB 1SVFA 3R4YA 3A0HE 4K35A 3L70J 2PP6A 3L75G 4BXLA 1BE3G 1IFIA 1NWQA 3CXHE 1VQLP 4R4MA 3L71E 5KKZC 2C9LY 2IFNA 3O6QB 4K3AA 4TLFA 2M3EA 3H6PA 2FFDB 4IFMA 5KLVJ 1ZLLA 2N9YB 3TK1A 4EIJA 3B5ND 3HTKA 5KJ7D 4PD4D 3H32B 2ZFCA 5KLIC 2YXRB 4L73A 1L0NJ 1AQ5A 5KAIE 3II6A 4LC1A 3AE8C 1JNMA 2L91A 3H1KD 2P1JA 3L71J 3T97B 3WUTA 2GM4A 1J1EC 4PD4H 1PP9J 5CCGA 1VF5B 3H1IG 1URQD 3L70E 5E79H 2OQQA 4OGQB 4YXWH 3PJSK 5AW5B 2WZ7A 4IFDK 1K73Q 1BDDA 4RESB 1TU3F 2N9BA 3BRTB 1G2CB 2J5UA 1NTKD 5CCGC 4AUWA 2HPCB 2WSCH 1L4AD 1SQPD 1JTHB 2WWWA 3V2RA 2FBWC 1KB9I 1S5LX 3B71A 1VQ6P 2BEQD 1QGKB 1FZBA 2B88A 2N1TB 5AW2B 2KS1A 1RF1B 1YYCA 1YITP 1IZNB 1YIJP 3LIEA 4DCKA 5CHXA 3RK3B 2FYZA 2GA1A 1JTHA 3JC22 3VMYA 2BCCE 2CK3H 2KUBA 3C9IA 2WMMA 3AE9C 1SQVD 1KQLA 1KZUB 1PGOA 1PP9E 2IX7C 2PRRA 2JWAA 1KILC 1BCCG 1S3JA 2KIKA 3AE5C 3LW5J 3PHLA 4M3LA 1R8EA 1P84E 1JY2N 1PL5A 5K5GB 2QSIA 3V2NA 4C46A 3AEFC 4WWIA 1KYOE 3V6IA 5DJTB 3G71P 3L75D 1NAYA 4N3YB 4PV1D 3RL0g 3MUDC 4H0LB 3AE7C 1OZHA 1LGHB 1EC5A 2D2CD 2WQYC 4PD4I 1G1JA 3VP8A 2E74C 4AQRD 3CPWO 1PFIA 2O1KA 1DIPA 3ABVC 1SQPK 1SQXJ 1GU4A 2QG4A 1G1IA 2Q7CA 1N7SD 1J1DB 2FFDA 2IPPA 4OGQD 5GTIH 1MKMA 4GODA 5DJUB 1NGMB 1S2EA 2KSEA 5BU8B 3CWBD 2C0XA 4WVZA 3MZWB 4GKGA 1KILB 1FJKA 4HYTB 3CCSP 4B86A 1YJ9P 3L74G 4IL6H 1SQQJ 1L0NE 1L2PA 5B5EH 1MFZA 1MUUA 3CX5D 4ASWA 2Q9IA 3AE2C 2V7QJ 1T2KC 3CX5E 3TDKA 1NTKJ 1HGVA 2OYIB 1CW5A 1SQPJ 1SQXK 2E75B 2KZIA 2QE7H 2W90A 1CZQA 3KDPB 1T8ZA 3KYQA 1T2KD 2OYHB 3JCUH 5B66E 2KNCA 3M9BA 3QWOC 3HE4A 4YXDC 2KZJA 1KYOD 1VPCA 1K9MQ 1N7LA 1T3JA 3GHGC 1MV8A 4C7NA 1P84I 5BU5A 2QJYB 3B5NC 1U57A 3H1KE 2HLOA 4WY4D 1RHZB 1A02F 3TSIA 1RQUA 3CMEP 1SQVJ 1E5WA 3H1HE 4PV1B 4D6TE 3HUSB 1SQBG 1SFCA 4UB8E 1OWAA 5APTA 1ZRTD 1RE4C 4TT3H 5APSA 2OYHC 1UIIA 2M5AB 1OW6A 1XTGB 2W6BA 3N7NA 1VQ5P 3A0HH 2L5GB 3G3ZA 4WY4A 4RJTA 3CC2P 1S9KD 1G2CA 1YI2P 1JO5A 3H1HG 3GW6A 1IFJA 3A0BH 2JP3A 3Q5RA 3P7KA 3CCQP 3H1JG 2FXMA 1BE3J 1J1DC 1AQTA 2O01H 2H7HA 1S4XA 1ZXGA 2WVRA 5AVSB 1AV1A 3AEAC 2A45H 4I7ZC 5KLVD 1J1EB 3OW2O 1SP4A 3E7KA 1X79B 3Q3DA 5L8RJ 5AVVB 1PGQA 3F5HA 4HB1A 3L72G 2IFMA 4H0LD 2E76B 1L0NK 1JUNA 2KOGA 3GMAA 3RL0C 4HJGH 5APYA 5H2FH 1LTJB 5CCHA 1GDTA 3D70A 1R5SA 1WT6A 3IR9A 1BSNA 2O01N 1KYOI 4WBAA 5E79E 5AVXB 1H88A 3V5BA 5AVUB 1NHLA 1CI6A 1RH5B 3M0AA 4D6TD 2FYNC 3B8EB 1W5CE 2JDIH 3M0DA 1CSBA 2IBZG 2E76C 2QIWA 3BATA 3M06A 1R5LA 1QL2A 2AEFA 2WITA 1JMMA 2E76D 1JY2O 1SQPE 3AE6C 3FXDA 4W80A 5CBNA 3OAKA 3W67A 2K9JA 1URQC 3H1LD 4L76A 3JSVC 5CCHC 1GW3A 4DJGA 3H1HJ 1Q2NA 2QJPC 4H13B 1URQA 2C0WA 3WU2H 3BCCJ 3I55P 4JPZB 1USDA 2P2UA 1M90Q 5APXA 1QLED 3CC7P 2JR8A 1BGYE 1LWUB 1PGJA 3CXHD 3L74J 1QEXA 1NTMD 3CX5I 3HE5A 3RK2B 3C1LA 2OYIA 1GK6A 1DEEG 1NTKG 1NU1K 1NTZG 1VF5D 2NPSA 2QVAA 1ZW0A 1VQMP 4H13D 1GMJA 1BE3D 2XV5A 3C8VA 1X0TA 3CWBG 4DOJA 5TISH 2OGUA 2YXQB 3Q5PA 4UB6H 1S5LE 1NTMG 1IFNA 2IZ0A 2IYPA 2O1JA 2PFXA 2ZYDA 3GLMA 3RBXA 3WUVA 4EYYQ 3TF5A 1VQPP 2FFDC 1EXJA 3RK3C 1NTMK 2AXTH 1MZ9A 3AEBC 4IL6X 1KN7A 2YKOA 3L71G 4WY4B 3P8MC 4L74A 1OVRA 1T3UA 1LWUC 2K3RA 2LXBA 1M1JC 3CWBE 1K04A 3TNUB 2BCCG 1EDLA 2KSJA 1M56D 2NPSD 3L73G 4HH2A 1NJIQ 3F89A 2I8DA 4D6TG 1NTZE 4EOTA 1Y47A 2K9JB 5B5EE 1S9KE 1NTZD 4OGQC 1SS1A 2FYUG 2QJYC 2FKWB 3B5NB 1L0ND 5KAFH 3GHGB 1N73C 3H1KG 1SQQK 4GOFA 3RL0D 1FZAA 2WSEH 3H1KJ 3KZIH 3PRJA 4U3FD 4L75A 4C7NB 3IN6A 2IBZI 1M1JA 5CBOA 3FX0A 2YO3A 2KNCB 2VRSA 2KS1B 3BRVB 1LJ2A 1Y8AA 2M0BA 1FAVA 1GTWA 3L74D 2ZT9C 2WSFJ 3SFEC 3OJAB 3AE1C 1L4AB 2N1TC 1L0LD 2XDJA 2IZ1A 1PV3A 2YMYA 2YMKA 1SQVG 2YNYA 2H88C 1OVVA 1UIXA 3MTUE 4GDOA 4UB8H 2WT7B 1PPJD 1VQOP 1N73B 1DH3A 3CL3D 1NO4A 1HH0A 1KFNA 1NTKK 1NU1G 1WMKA 2OTKE 1VQNP 2B9BA 4GOEA 3IFMA 2OTJP 2GUSA 4GT1A 1Q81Q 4LLHA 2WSSH 2CPSA 1IK7A 2Y0EA 2JO1A 1GL2D 3L72D 2QEXP 3ZDMA 2P58A 2IYOA 4CPGA 2M5AA 5KLVG 1PPJG 1FZEA 3G6EP 2YKPA 5CCGD 1SFCD 1U7MA 1HVVA 5AVQB 3TGUG 3L75J 3L35A 2UWJE 2NZ2A 3K5BA 5CJ4A 3HUSA 3BCCG 1IFMA 1N7SA 3CXHI 3GG2A 1DEBA 3M91A 1SQVE 1IFPA 1SQXD 3FWLA 4NPFX 5TJHA 3S1KA 2HR3A 4N6JA 2IBZE 1NTZJ 3HE5B 4I2LC 1EDJA 2RKLA 5H2FE 1NU1E 3VMXA 1BSHA 1IFDA 1BGYG 1NU1D 4C7RA 2WPQA 3CWBJ 2HYNA 5AW3B 1RF1C 1URQB 1N8RQ 1FOSF 1OW8A 1BGYJ 1NYHA 1EZVI 1PIXA 1LP1A 2CPBA 2A06D 3L74E 4DZOA 1GL2B 3CLQA 3CCUP 3GF7A 4Y99C 1YTZT 2QM8A 2H89C 1K8AQ 1LT9B 4WB4A 3H1JE 3VMZA 2QA4P 3L4FA 1BCCD 3PTZA 3TGUD 1KQGB 1JB0J 2XKMA 3M0DC 3D71A 5APWA 3ITKA 4QMAA 3H1LE 1KTMA 4XA4A 2OYOA 1NTZK 3AE4C 3HRNA 2D2CC 3RL0B 2FXOA 3HE4B 2JEEA 2R5BA 2E5TA 3FGAD 1FS0E 2WSFH 3M9QA 1VL2A 1JM0A 3I5CA 1YQ3C 1KMIZ 2RH0A 1LT9A 3WMM0 1SQBE 2KB7P 1FBMA 3CCEP 3AEGC 3L72J 2QRXA 5KTBA 1LWUA 1X22A 3CI9A 3RK3E 2H43A 2IBZD 1LT9C 5CMZA 1FE6A 1SQXE 3P8CD 1M1JB 5KAIH 1D7MA 2MKVA 3A2AA 3G4SP 1ZR2A 2NPSB 1HTLC 5C39A 4PD4E 4Y28J 1P84H 3VOPA 4HKZH 2JKVA 2QJPB 2YKQA 2ZJSE 1KYOH 1NAFA 3MHVA 1ZRTE 2GUVA 2HODA 2Q3EA 5AW4B 3RGUA 4DT0A 1HJBA 2OYIC 2JWDA 1BDCA 4U3FG 1SQXG 4I1LA 4JF7A 3BASA 1EZVD 4XFJA 1FC2C 1EDKA 1NU1J 4JYBA 1EDIA 1M57D 2YIUC 3L37A 2R3SA 3H1IJ 2BCCJ 1RQVA 3E1IA 3M9HA 3PH0A 2WPSA 4H44D 3RK2D 3SWKA 2E43A 3MUDA 3NFQA 3A5TA 1GK4A 4YTPC 4Y99B 3CCRP 1GL2C 3HD7A 2NPSC 3KHUA 3KXDA 2ZYGA 3KZIE 2Z5HA 1LTJC 1EZVG 4RO0A 4U3FE 3CCVP 3RBZA 3TGUJ 3U1AA 2Q1KA 2WTYA 4R4LA 1KILE 2ZT9B 3H1IE 1SQQG 3L70G 3SWYA 1FZCB 1VQ7P 2G3AA 1RF0A 2ZVNB 2E5YA 3E1RA 3SFDC 1L4AA 1SQPG 3R2PA 5APQA 2N1TA 3CCJP 3P32A 2ZAEB 3V4QA 1AVOA 2NRGA 1JOCA 3HD7D 2PAJA 3EFFK 5B66H 3BCCE 1W2BO 3H1LJ 1GL2A 2D2CB 2R5DA 3HD7C 4PJ0H 3AECC 3D6YA 1PZQA 5CJ0A 1W2EA 2Y0DA 1X9VA 2R3CA 1Z56A 1YQ4C 2KXPB 1KILA 2W83C 1AVYA 2R44A 3EQ2A 3H1HD 5EFWB 1HGZA 2HG5D 2W6AA 1OX3A 1RF0C 2V7QH 5APVA 1N7SC 1QX8A 2AXCA 1EZVE 2KLUA 3EWKA 1PP9G 4KT0J 3A7OA 1SQBJ 4ZNCA 3HD7B 1LTIC 1ZV8A 2WT7A 1H89A 1FDIA 2P10A 1FZCC 4JQ0D 1FDMA 1Q82Q 1IC2A 3V2QA 1MFTA 2N1TD 1LT1A 3L72E 4IL6E 1VQKP 5CCHD 1ZR4A 1FU1A 2BASA 2SPZA 3KPEA 4WY4C 3USSA 3L73J 1CI6B 2C9NY 1KB9H 3VMAA 1L4AC 2FY8A 5AVTB 1VF5C 3O6QA 2A06G 1JY3N 1KILD 2KK7A 2BCCD 2HODB 2YIUB 2ZXEB 2FYNB 3A0BE 3H1ID 1WRGA 3QH9A 4KJMA 3S9OA 1VQ4P 1NOHA 1IO4A 4OWFA 1USEA 4U7JA 5GTHE 3TYYA 1IK9A 3CCMP 1N7SB 1Q86Q 1NKNA 4IOIH 1LNQA 1P84D 3L73E 1N73A 2WPVB 2Z4EA 2ITAA 2Z5IA 2I1JA 3H1LG 2A06E 5AW7B 3T97A 4ZKUA 2QJKC 3AE3C 2M8RA 3Q1MA 1FZGA 1AJYA 2R32A 2FYUD 1RE3C 1HJ0A 1PPJE 2K37A 2O01J 2O3JA 5M1BA 2J59M 3PLNA 3TGUE 2LXCB 1YJNP 1FZFA 1A02J 4YPCA 1JEKA 1RE4A 1XTCC 4U3FJ 4H44C 4W7ZA 2WPRA 3H1JD 2B87A 1GU5A 3O8ZA 1OW7A 1E79H 1M8OB 2E74D 4BRYB 1HUCA 1LTGC 5KLIB 2MJZA 1DD4A 1SFCB 1JMBA 4H0LC 2FYUK 4A7PA 1ZP0C 3B5NA 2HFED 2RN0A 3S4RA 5KJ7C 2ZVOB 5BVZA 1JCDA 1SQBD 1HWTC 1GW4A 3CD6P 1AFOA 1L0LJ 1QVGO 1HF9A 1KQSO 3WU2E 3PP5A 3HUSC 1GZLA 3CXHH 1L0LG 1NVOA 4N78D 1LTTC 1FDOA 2KYVA 2K1AA 3CMAP 3L73D 1EQ7A 1H8AA 4MN4C 1M7LA 1OMIA 1KFMA 2WSCJ 3V4WA 3Q5SA 3SSUA 3IAOA 4H44B 4W7YA 1SQQE 2XZRA 1YTZI 3VTPC 4AYCA 3L75E 1SQQD 3LIDA 5AW0B 5AW9B 3VN0A 1YHQP 3KQGA 2BEZF 4I6MC 1YJWP 1LTAC 1NH4A 2FYUE 3AEDC 5AVZB 3W68A 5KKZB 1KV4A 1VQ9P 3MD0A 1S5LH 3Q2YA 1SQVK 2PGDA 4JYCA 4RKUJ 3L36A 3A3YB 1YBKA 2K88A 4KHXA 5AVWB 4ZMDA 1LTSC 4I7ZB 5APUA 2AXTE 5AW6B 2G8YA 3CCLP 3TNUA 1AA0A 3LW5H 2RMZA 1U7JA 2POHA 2JJLA 2Q5UA 1LTJA 1Q90D 2E75D 3EFGA 2FYUJ 2Q3IA 1SLQA 1T6AA 3CC4P 4BWNA 2E42A 1KC8Q 1EXIA 2AEMA 2P7JA 3HTKB 3D6ZA 3WUUA 1JY3O 1RY3A 3H1JJ 1GD2E 1BGYD 2ZXXA 3MP7B 5KLVE 2A45I 5KAFE 1S1CX 3RK3D 1HBWA 1N2DC 3VP9A 1L0LK 2KP8A 2ZYAA 4NPEA 1FZCA 3V2PA 5AW8B 1JCCA 5TISE 1BCCJ 3H32A 4JBZA 4ZKPA 4PJ0E 4PV1C 1SFCC 4UB6E 2LR2A 3B4SA 3BVHA 2V4HA 4O9BA 1H0TA 3FWNA 3U1CA
chains in the Genus database with same CATH topology
3L72G 2FYUG 1SQPG 2A06G 1P84H 3H1KG 1NTKG 1SQBG 1NTZG 5KLVG 1L0NG 1PPJG 1KYOH 3CWBG 1SQXG 3L74G 4U3FG 3TGUG 1NTMG 2IBZG 3BCCG 3CXHH 1L0LG 1BCCG 3H1LG 3H1HG 3L71G 1PP9G 4PD4H 3H1JG 3H1IG 1SQVG 1BGYG 1EZVG 2BCCG 3CX5H 3L73G 3L70G 1NU1G 1SQQG 4D6TG 3L75G 1KB9H 1BE3G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L72 G;  2FYU G;  1SQP G;  2A06 G;  1P84 H;  3H1K G;  1NTK G;  1SQB G;  1NTZ G;  5KLV G;  1L0N G;  1PPJ G;  1KYO H;  3CWB G;  1SQX G;  3L74 G;  4U3F G;  3TGU G;  1NTM G;  2IBZ G;  3BCC G;  3CXH H;  1L0L G;  1BCC G;  3H1L G;  3H1H G;  3L71 G;  1PP9 G;  4PD4 H;  3H1J G;  3H1I G;  1SQV G;  1BGY G;  1EZV G;  2BCC G;  3CX5 H;  3L73 G;  3L70 G;  1NU1 G;  1SQQ G;  4D6T G;  3L75 G;  1KB9 H;  1BE3 G; 
#chains in the Genus database with same CATH topology
 1DD3 A;  1OXZ A;  1LTB C;  2QM7 A;  1NKZ B;  2M3B A;  2AEJ A;  2H8P D;  2WSE J;  1JY2 P;  1QL1 A;  1SQB K;  3L70 D;  1BCC E;  3MIW A;  4LGD E;  2HPC A;  3SWF A;  1RE3 A;  2I1K A;  1KQF B;  2KLV A;  2QJK B;  3GF3 A;  3I56 P;  2W6J H;  1VDF A;  1FOS E;  1KB9 D;  3AEE C;  1K05 A;  3IF4 A;  2Y9Z A;  1KB9 E;  2IDB A;  3VYI A;  5GTI E;  1VQ8 P;  4BRY A;  2W27 A;  2OTL P;  2E74 B;  1Y9B A;  2K9Y A;  3NMD A;  2ZT9 D;  4H13 C;  4D6T J;  1S72 P;  1OFC X;  2OYH A;  4EDF A;  3OA7 A;  5GTH H;  3G9R A;  3L71 D;  1KD1 Q;  1QVF O;  3CX5 H;  1NTM E;  2KI7 B;  3N4X A;  2J58 A;  3NTN A;  4N78 E;  4NPD A;  1ZME C;  1PP9 D;  5KLV K;  3P8C E;  4OVN F;  3JCU E;  1OVU A;  2Y9Y A;  2OAR A;  3NXS A;  1BE3 E;  3H25 A;  1FJP A;  2LKM A;  1KOR A;  1L0N G;  1ZN5 A;  1JY3 P;  1N86 A;  2P67 A;  3BCC D;  4OH8 B;  1L0L E;  1ZOY C;  2B87 B;  2XU6 A;  2XND H;  2E75 C;  2FXP A;  1NTM J;  4ASV A;  1J2J B;  1PGP A;  4IFF A;  1X8Y A;  1Q7Y Q;  4EI2 A;  5AW1 B;  2B89 A;  3RK2 C;  2XNX A;  4GIF A;  3U59 A;  2A45 G;  4XE5 B;  2Q6Q A;  2DW3 A;  1NTK E;  2W8Z A;  3FXE A;  2YO2 A;  1LP1 B;  5AVR B;  3MGN A;  1IJD B;  5KJ7 A;  3UIA A;  1M1K Q;  1RF1 A;  1DX7 A;  3GHG A;  2Y0C A;  4Z1M H;  1H0T B;  1OIP A;  5AVY B;  1SVF A;  3R4Y A;  3A0H E;  4K35 A;  3L70 J;  2PP6 A;  3L75 G;  4BXL A;  1BE3 G;  1IFI A;  1NWQ A;  3CXH E;  1VQL P;  4R4M A;  3L71 E;  5KKZ C;  2C9L Y;  2IFN A;  3O6Q B;  4K3A A;  4TLF A;  2M3E A;  3H6P A;  2FFD B;  4IFM A;  5KLV J;  1ZLL A;  2N9Y B;  3TK1 A;  4EIJ A;  3B5N D;  3HTK A;  5KJ7 D;  4PD4 D;  3H32 B;  2ZFC A;  5KLI C;  2YXR B;  4L73 A;  1L0N J;  1AQ5 A;  5KAI E;  3II6 A;  4LC1 A;  3AE8 C;  1JNM A;  2L91 A;  3H1K D;  2P1J A;  3L71 J;  3T97 B;  3WUT A;  2GM4 A;  1J1E C;  4PD4 H;  1PP9 J;  5CCG A;  1VF5 B;  3H1I G;  1URQ D;  3L70 E;  5E79 H;  2OQQ A;  4OGQ B;  4YXW H;  3PJS K;  5AW5 B;  2WZ7 A;  4IFD K;  1K73 Q;  1BDD A;  4RES B;  1TU3 F;  2N9B A;  3BRT B;  1G2C B;  2J5U A;  1NTK D;  5CCG C;  4AUW A;  2HPC B;  2WSC H;  1L4A D;  1SQP D;  1JTH B;  2WWW A;  3V2R A;  2FBW C;  1KB9 I;  1S5L X;  3B71 A;  1VQ6 P;  2BEQ D;  1QGK B;  1FZB A;  2B88 A;  2N1T B;  5AW2 B;  2KS1 A;  1RF1 B;  1YYC A;  1YIT P;  1IZN B;  1YIJ P;  3LIE A;  4DCK A;  5CHX A;  3RK3 B;  2FYZ A;  2GA1 A;  1JTH A;  3JC2 2;  3VMY A;  2BCC E;  2CK3 H;  2KUB A;  3C9I A;  2WMM A;  3AE9 C;  1SQV D;  1KQL A;  1KZU B;  1PGO A;  1PP9 E;  2IX7 C;  2PRR A;  2JWA A;  1KIL C;  1BCC G;  1S3J A;  2KIK A;  3AE5 C;  3LW5 J;  3PHL A;  4M3L A;  1R8E A;  1P84 E;  1JY2 N;  1PL5 A;  5K5G B;  2QSI A;  3V2N A;  4C46 A;  3AEF C;  4WWI A;  1KYO E;  3V6I A;  5DJT B;  3G71 P;  3L75 D;  1NAY A;  4N3Y B;  4PV1 D;  3RL0 g;  3MUD C;  4H0L B;  3AE7 C;  1OZH A;  1LGH B;  1EC5 A;  2D2C D;  2WQY C;  4PD4 I;  1G1J A;  3VP8 A;  2E74 C;  4AQR D;  3CPW O;  1PFI A;  2O1K A;  1DIP A;  3ABV C;  1SQP K;  1SQX J;  1GU4 A;  2QG4 A;  1G1I A;  2Q7C A;  1N7S D;  1J1D B;  2FFD A;  2IPP A;  4OGQ D;  5GTI H;  1MKM A;  4GOD A;  5DJU B;  1NGM B;  1S2E A;  2KSE A;  5BU8 B;  3CWB D;  2C0X A;  4WVZ A;  3MZW B;  4GKG A;  1KIL B;  1FJK A;  4HYT B;  3CCS P;  4B86 A;  1YJ9 P;  3L74 G;  4IL6 H;  1SQQ J;  1L0N E;  1L2P A;  5B5E H;  1MFZ A;  1MUU A;  3CX5 D;  4ASW A;  2Q9I A;  3AE2 C;  2V7Q J;  1T2K C;  3CX5 E;  3TDK A;  1NTK J;  1HGV A;  2OYI B;  1CW5 A;  1SQP J;  1SQX K;  2E75 B;  2KZI A;  2QE7 H;  2W90 A;  1CZQ A;  3KDP B;  1T8Z A;  3KYQ A;  1T2K D;  2OYH B;  3JCU H;  5B66 E;  2KNC A;  3M9B A;  3QWO C;  3HE4 A;  4YXD C;  2KZJ A;  1KYO D;  1VPC A;  1K9M Q;  1N7L A;  1T3J A;  3GHG C;  1MV8 A;  4C7N A;  1P84 I;  5BU5 A;  2QJY B;  3B5N C;  1U57 A;  3H1K E;  2HLO A;  4WY4 D;  1RHZ B;  1A02 F;  3TSI A;  1RQU A;  3CME P;  1SQV J;  1E5W A;  3H1H E;  4PV1 B;  4D6T E;  3HUS B;  1SQB G;  1SFC A;  4UB8 E;  1OWA A;  5APT A;  1ZRT D;  1RE4 C;  4TT3 H;  5APS A;  2OYH C;  1UII A;  2M5A B;  1OW6 A;  1XTG B;  2W6B A;  3N7N A;  1VQ5 P;  3A0H H;  2L5G B;  3G3Z A;  4WY4 A;  4RJT A;  3CC2 P;  1S9K D;  1G2C A;  1YI2 P;  1JO5 A;  3H1H G;  3GW6 A;  1IFJ A;  3A0B H;  2JP3 A;  3Q5R A;  3P7K A;  3CCQ P;  3H1J G;  2FXM A;  1BE3 J;  1J1D C;  1AQT A;  2O01 H;  2H7H A;  1S4X A;  1ZXG A;  2WVR A;  5AVS B;  1AV1 A;  3AEA C;  2A45 H;  4I7Z C;  5KLV D;  1J1E B;  3OW2 O;  1SP4 A;  3E7K A;  1X79 B;  3Q3D A;  5L8R J;  5AVV B;  1PGQ A;  3F5H A;  4HB1 A;  3L72 G;  2IFM A;  4H0L D;  2E76 B;  1L0N K;  1JUN A;  2KOG A;  3GMA A;  3RL0 C;  4HJG H;  5APY A;  5H2F H;  1LTJ B;  5CCH A;  1GDT A;  3D70 A;  1R5S A;  1WT6 A;  3IR9 A;  1BSN A;  2O01 N;  1KYO I;  4WBA A;  5E79 E;  5AVX B;  1H88 A;  3V5B A;  5AVU B;  1NHL A;  1CI6 A;  1RH5 B;  3M0A A;  4D6T D;  2FYN C;  3B8E B;  1W5C E;  2JDI H;  3M0D A;  1CSB A;  2IBZ G;  2E76 C;  2QIW A;  3BAT A;  3M06 A;  1R5L A;  1QL2 A;  2AEF A;  2WIT A;  1JMM A;  2E76 D;  1JY2 O;  1SQP E;  3AE6 C;  3FXD A;  4W80 A;  5CBN A;  3OAK A;  3W67 A;  2K9J A;  1URQ C;  3H1L D;  4L76 A;  3JSV C;  5CCH C;  1GW3 A;  4DJG A;  3H1H J;  1Q2N A;  2QJP C;  4H13 B;  1URQ A;  2C0W A;  3WU2 H;  3BCC J;  3I55 P;  4JPZ B;  1USD A;  2P2U A;  1M90 Q;  5APX A;  1QLE D;  3CC7 P;  2JR8 A;  1BGY E;  1LWU B;  1PGJ A;  3CXH D;  3L74 J;  1QEX A;  1NTM D;  3CX5 I;  3HE5 A;  3RK2 B;  3C1L A;  2OYI A;  1GK6 A;  1DEE G;  1NTK G;  1NU1 K;  1NTZ G;  1VF5 D;  2NPS A;  2QVA A;  1ZW0 A;  1VQM P;  4H13 D;  1GMJ A;  1BE3 D;  2XV5 A;  3C8V A;  1X0T A;  3CWB G;  4DOJ A;  5TIS H;  2OGU A;  2YXQ B;  3Q5P A;  4UB6 H;  1S5L E;  1NTM G;  1IFN A;  2IZ0 A;  2IYP A;  2O1J A;  2PFX A;  2ZYD A;  3GLM A;  3RBX A;  3WUV A;  4EYY Q;  3TF5 A;  1VQP P;  2FFD C;  1EXJ A;  3RK3 C;  1NTM K;  2AXT H;  1MZ9 A;  3AEB C;  4IL6 X;  1KN7 A;  2YKO A;  3L71 G;  4WY4 B;  3P8M C;  4L74 A;  1OVR A;  1T3U A;  1LWU C;  2K3R A;  2LXB A;  1M1J C;  3CWB E;  1K04 A;  3TNU B;  2BCC G;  1EDL A;  2KSJ A;  1M56 D;  2NPS D;  3L73 G;  4HH2 A;  1NJI Q;  3F89 A;  2I8D A;  4D6T G;  1NTZ E;  4EOT A;  1Y47 A;  2K9J B;  5B5E E;  1S9K E;  1NTZ D;  4OGQ C;  1SS1 A;  2FYU G;  2QJY C;  2FKW B;  3B5N B;  1L0N D;  5KAF H;  3GHG B;  1N73 C;  3H1K G;  1SQQ K;  4GOF A;  3RL0 D;  1FZA A;  2WSE H;  3H1K J;  3KZI H;  3PRJ A;  4U3F D;  4L75 A;  4C7N B;  3IN6 A;  2IBZ I;  1M1J A;  5CBO A;  3FX0 A;  2YO3 A;  2KNC B;  2VRS A;  2KS1 B;  3BRV B;  1LJ2 A;  1Y8A A;  2M0B A;  1FAV A;  1GTW A;  3L74 D;  2ZT9 C;  2WSF J;  3SFE C;  3OJA B;  3AE1 C;  1L4A B;  2N1T C;  1L0L D;  2XDJ A;  2IZ1 A;  1PV3 A;  2YMY A;  2YMK A;  1SQV G;  2YNY A;  2H88 C;  1OVV A;  1UIX A;  3MTU E;  4GDO A;  4UB8 H;  2WT7 B;  1PPJ D;  1VQO P;  1N73 B;  1DH3 A;  3CL3 D;  1NO4 A;  1HH0 A;  1KFN A;  1NTK K;  1NU1 G;  1WMK A;  2OTK E;  1VQN P;  2B9B A;  4GOE A;  3IFM A;  2OTJ P;  2GUS A;  4GT1 A;  1Q81 Q;  4LLH A;  2WSS H;  2CPS A;  1IK7 A;  2Y0E A;  2JO1 A;  1GL2 D;  3L72 D;  2QEX P;  3ZDM A;  2P58 A;  2IYO A;  4CPG A;  2M5A A;  5KLV G;  1PPJ G;  1FZE A;  3G6E P;  2YKP A;  5CCG D;  1SFC D;  1U7M A;  1HVV A;  5AVQ B;  3TGU G;  3L75 J;  3L35 A;  2UWJ E;  2NZ2 A;  3K5B A;  5CJ4 A;  3HUS A;  3BCC G;  1IFM A;  1N7S A;  3CXH I;  3GG2 A;  1DEB A;  3M91 A;  1SQV E;  1IFP A;  1SQX D;  3FWL A;  4NPF X;  5TJH A;  3S1K A;  2HR3 A;  4N6J A;  2IBZ E;  1NTZ J;  3HE5 B;  4I2L C;  1EDJ A;  2RKL A;  5H2F E;  1NU1 E;  3VMX A;  1BSH A;  1IFD A;  1BGY G;  1NU1 D;  4C7R A;  2WPQ A;  3CWB J;  2HYN A;  5AW3 B;  1RF1 C;  1URQ B;  1N8R Q;  1FOS F;  1OW8 A;  1BGY J;  1NYH A;  1EZV I;  1PIX A;  1LP1 A;  2CPB A;  2A06 D;  3L74 E;  4DZO A;  1GL2 B;  3CLQ A;  3CCU P;  3GF7 A;  4Y99 C;  1YTZ T;  2QM8 A;  2H89 C;  1K8A Q;  1LT9 B;  4WB4 A;  3H1J E;  3VMZ A;  2QA4 P;  3L4F A;  1BCC D;  3PTZ A;  3TGU D;  1KQG B;  1JB0 J;  2XKM A;  3M0D C;  3D71 A;  5APW A;  3ITK A;  4QMA A;  3H1L E;  1KTM A;  4XA4 A;  2OYO A;  1NTZ K;  3AE4 C;  3HRN A;  2D2C C;  3RL0 B;  2FXO A;  3HE4 B;  2JEE A;  2R5B A;  2E5T A;  3FGA D;  1FS0 E;  2WSF H;  3M9Q A;  1VL2 A;  1JM0 A;  3I5C A;  1YQ3 C;  1KMI Z;  2RH0 A;  1LT9 A;  3WMM 0;  1SQB E;  2KB7 P;  1FBM A;  3CCE P;  3AEG C;  3L72 J;  2QRX A;  5KTB A;  1LWU A;  1X22 A;  3CI9 A;  3RK3 E;  2H43 A;  2IBZ D;  1LT9 C;  5CMZ A;  1FE6 A;  1SQX E;  3P8C D;  1M1J B;  5KAI H;  1D7M A;  2MKV A;  3A2A A;  3G4S P;  1ZR2 A;  2NPS B;  1HTL C;  5C39 A;  4PD4 E;  4Y28 J;  1P84 H;  3VOP A;  4HKZ H;  2JKV A;  2QJP B;  2YKQ A;  2ZJS E;  1KYO H;  1NAF A;  3MHV A;  1ZRT E;  2GUV A;  2HOD A;  2Q3E A;  5AW4 B;  3RGU A;  4DT0 A;  1HJB A;  2OYI C;  2JWD A;  1BDC A;  4U3F G;  1SQX G;  4I1L A;  4JF7 A;  3BAS A;  1EZV D;  4XFJ A;  1FC2 C;  1EDK A;  1NU1 J;  4JYB A;  1EDI A;  1M57 D;  2YIU C;  3L37 A;  2R3S A;  3H1I J;  2BCC J;  1RQV A;  3E1I A;  3M9H A;  3PH0 A;  2WPS A;  4H44 D;  3RK2 D;  3SWK A;  2E43 A;  3MUD A;  3NFQ A;  3A5T A;  1GK4 A;  4YTP C;  4Y99 B;  3CCR P;  1GL2 C;  3HD7 A;  2NPS C;  3KHU A;  3KXD A;  2ZYG A;  3KZI E;  2Z5H A;  1LTJ C;  1EZV G;  4RO0 A;  4U3F E;  3CCV P;  3RBZ A;  3TGU J;  3U1A A;  2Q1K A;  2WTY A;  4R4L A;  1KIL E;  2ZT9 B;  3H1I E;  1SQQ G;  3L70 G;  3SWY A;  1FZC B;  1VQ7 P;  2G3A A;  1RF0 A;  2ZVN B;  2E5Y A;  3E1R A;  3SFD C;  1L4A A;  1SQP G;  3R2P A;  5APQ A;  2N1T A;  3CCJ P;  3P32 A;  2ZAE B;  3V4Q A;  1AVO A;  2NRG A;  1JOC A;  3HD7 D;  2PAJ A;  3EFF K;  5B66 H;  3BCC E;  1W2B O;  3H1L J;  1GL2 A;  2D2C B;  2R5D A;  3HD7 C;  4PJ0 H;  3AEC C;  3D6Y A;  1PZQ A;  5CJ0 A;  1W2E A;  2Y0D A;  1X9V A;  2R3C A;  1Z56 A;  1YQ4 C;  2KXP B;  1KIL A;  2W83 C;  1AVY A;  2R44 A;  3EQ2 A;  3H1H D;  5EFW B;  1HGZ A;  2HG5 D;  2W6A A;  1OX3 A;  1RF0 C;  2V7Q H;  5APV A;  1N7S C;  1QX8 A;  2AXC A;  1EZV E;  2KLU A;  3EWK A;  1PP9 G;  4KT0 J;  3A7O A;  1SQB J;  4ZNC A;  3HD7 B;  1LTI C;  1ZV8 A;  2WT7 A;  1H89 A;  1FDI A;  2P10 A;  1FZC C;  4JQ0 D;  1FDM A;  1Q82 Q;  1IC2 A;  3V2Q A;  1MFT A;  2N1T D;  1LT1 A;  3L72 E;  4IL6 E;  1VQK P;  5CCH D;  1ZR4 A;  1FU1 A;  2BAS A;  2SPZ A;  3KPE A;  4WY4 C;  3USS A;  3L73 J;  1CI6 B;  2C9N Y;  1KB9 H;  3VMA A;  1L4A C;  2FY8 A;  5AVT B;  1VF5 C;  3O6Q A;  2A06 G;  1JY3 N;  1KIL D;  2KK7 A;  2BCC D;  2HOD B;  2YIU B;  2ZXE B;  2FYN B;  3A0B E;  3H1I D;  1WRG A;  3QH9 A;  4KJM A;  3S9O A;  1VQ4 P;  1NOH A;  1IO4 A;  4OWF A;  1USE A;  4U7J A;  5GTH E;  3TYY A;  1IK9 A;  3CCM P;  1N7S B;  1Q86 Q;  1NKN A;  4IOI H;  1LNQ A;  1P84 D;  3L73 E;  1N73 A;  2WPV B;  2Z4E A;  2ITA A;  2Z5I A;  2I1J A;  3H1L G;  2A06 E;  5AW7 B;  3T97 A;  4ZKU A;  2QJK C;  3AE3 C;  2M8R A;  3Q1M A;  1FZG A;  1AJY A;  2R32 A;  2FYU D;  1RE3 C;  1HJ0 A;  1PPJ E;  2K37 A;  2O01 J;  2O3J A;  5M1B A;  2J59 M;  3PLN A;  3TGU E;  2LXC B;  1YJN P;  1FZF A;  1A02 J;  4YPC A;  1JEK A;  1RE4 A;  1XTC C;  4U3F J;  4H44 C;  4W7Z A;  2WPR A;  3H1J D;  2B87 A;  1GU5 A;  3O8Z A;  1OW7 A;  1E79 H;  1M8O B;  2E74 D;  4BRY B;  1HUC A;  1LTG C;  5KLI B;  2MJZ A;  1DD4 A;  1SFC B;  1JMB A;  4H0L C;  2FYU K;  4A7P A;  1ZP0 C;  3B5N A;  2HFE D;  2RN0 A;  3S4R A;  5KJ7 C;  2ZVO B;  5BVZ A;  1JCD A;  1SQB D;  1HWT C;  1GW4 A;  3CD6 P;  1AFO A;  1L0L J;  1QVG O;  1HF9 A;  1KQS O;  3WU2 E;  3PP5 A;  3HUS C;  1GZL A;  3CXH H;  1L0L G;  1NVO A;  4N78 D;  1LTT C;  1FDO A;  2KYV A;  2K1A A;  3CMA P;  3L73 D;  1EQ7 A;  1H8A A;  4MN4 C;  1M7L A;  1OMI A;  1KFM A;  2WSC J;  3V4W A;  3Q5S A;  3SSU A;  3IAO A;  4H44 B;  4W7Y A;  1SQQ E;  2XZR A;  1YTZ I;  3VTP C;  4AYC A;  3L75 E;  1SQQ D;  3LID A;  5AW0 B;  5AW9 B;  3VN0 A;  1YHQ P;  3KQG A;  2BEZ F;  4I6M C;  1YJW P;  1LTA C;  1NH4 A;  2FYU E;  3AED C;  5AVZ B;  3W68 A;  5KKZ B;  1KV4 A;  1VQ9 P;  3MD0 A;  1S5L H;  3Q2Y A;  1SQV K;  2PGD A;  4JYC A;  4RKU J;  3L36 A;  3A3Y B;  1YBK A;  2K88 A;  4KHX A;  5AVW B;  4ZMD A;  1LTS C;  4I7Z B;  5APU A;  2AXT E;  5AW6 B;  2G8Y A;  3CCL P;  3TNU A;  1AA0 A;  3LW5 H;  2RMZ A;  1U7J A;  2POH A;  2JJL A;  2Q5U A;  1LTJ A;  1Q90 D;  2E75 D;  3EFG A;  2FYU J;  2Q3I A;  1SLQ A;  1T6A A;  3CC4 P;  4BWN A;  2E42 A;  1KC8 Q;  1EXI A;  2AEM A;  2P7J A;  3HTK B;  3D6Z A;  3WUU A;  1JY3 O;  1RY3 A;  3H1J J;  1GD2 E;  1BGY D;  2ZXX A;  3MP7 B;  5KLV E;  2A45 I;  5KAF E;  1S1C X;  3RK3 D;  1HBW A;  1N2D C;  3VP9 A;  1L0L K;  2KP8 A;  2ZYA A;  4NPE A;  1FZC A;  3V2P A;  5AW8 B;  1JCC A;  5TIS E;  1BCC J;  3H32 A;  4JBZ A;  4ZKP A;  4PJ0 E;  4PV1 C;  1SFC C;  4UB6 E;  2LR2 A;  3B4S A;  3BVH A;  2V4H A;  4O9B A;  1H0T A;  3FWN A;  3U1C A; 
#chains in the Genus database with same CATH homology
 3L72 G;  2FYU G;  1SQP G;  2A06 G;  1P84 H;  3H1K G;  1NTK G;  1SQB G;  1NTZ G;  5KLV G;  1L0N G;  1PPJ G;  1KYO H;  3CWB G;  1SQX G;  3L74 G;  4U3F G;  3TGU G;  1NTM G;  2IBZ G;  3BCC G;  3CXH H;  1L0L G;  1BCC G;  3H1L G;  3H1H G;  3L71 G;  1PP9 G;  4PD4 H;  3H1J G;  3H1I G;  1SQV G;  1BGY G;  1EZV G;  2BCC G;  3CX5 H;  3L73 G;  3L70 G;  1NU1 G;  1SQQ G;  4D6T G;  3L75 G;  1KB9 H;  1BE3 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...