3V2RA

Compcc in complex with fatty acids
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
45
structure length
45
Chain Sequence
MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title COMPcc in complex with fatty acids
rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Cartilage Oligomerization matrix protein (coiled-coil domain
total genus 18
structure length 45
sequence length 45
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3v2rA00
3V2QA 3V2NA 1VDFA 1MZ9A 1DEBA 3V2RA 3V2PA 1FBMA
chains in the Genus database with same CATH superfamily
1JTHB 1NAFA 2RMZA 1FC2C 1CI6B 2Z5IA 3LIDA 4MN4C 5KLVK 1LWUB 4DJGA 3CMAP 2KOGA 3M9HA 2WQYC 3L71D 3O6QB 4I7ZC 3H1IG 4CPGA 2ZYAA 1NU1G 2FXPA 1QL2A 1N7SC 1SP4A 2E76B 3HTKB 4A7PA 2Y0CA 3WMM0 1PGJA 4RJTA 1L4AA 1GK4A 2D2CB 2YKPA 1S2EA 2FYNC 1N86A 4KT0J 3SWKA 1MV8A 1RF1B 1JUNA 3A5TA 1LTGC 5AW9B 4C46A 1RF0C 1GW3A 1SQXE 5AVSB 4UB8E 4PV1D 3BCCE 3H1JD 1KYOD 1OW6A 2AXTH 3Q5SA 1RE3A 5C39A 1M56D 3V4QA 4LC1A 2N1TD 1URQA 2H88C 1R5LA 3SWYA 3TGUD 2FYNB 1JMMA 2M5AB 3L70E 3RK3E 3VP9A 1ZXGA 3CPWO 1NTME 3L72D 3V2PA 3H32B 1K04A 1EZVI 1X0TA 2IFNA 4N78D 4JPZB 2KLVA 4YTPC 2BCCJ 4HB1A 1H89A 5AVXB 2V7QH 3PHLA 1FAVA 3LW5H 3R4YA 3ABVC 2OYHA 4I7ZB 4R4LA 1G1IA 4NPEA 2QVAA 4N78E 4KHXA 3H1JJ 5APTA 3TSIA 2BEZF 1QEXA 2KUBA 2R44A 2QJKC 2CPSA 2HR3A 3NFQA 1VF5B 3P7KA 5KJ7D 4BWNA 3VP8A 2WPSA 3AE3C 1J2JB 1U7MA 1ZW0A 4GOEA 1GL2B 1Q90D 1JEKA 3VOPA 5TISH 2Y9ZA 1YJNP 2P58A 2NPSD 3KQGA 3CCLP 3IF4A 4IOIH 2KB7P 1PPJG 1PP9E 3N4XA 1VL2A 1FZCA 4IL6E 1S5LE 2HODA 1HJ0A 1HGZA 1YI2P 1T2KC 2YMYA 3L71J 5KAIH 2B87A 1HH0A 1SQBK 1EDJA 2O01J 1G1JA 3L75G 2HG5D 3RK2C 1FS0E 2E75C 2R32A 1LTAC 1S1CX 3BCCG 3CCRP 3RBZA 1S5LX 1YTZT 2QEXP 1S9KD 1JMBA 2QJYC 2ZXEB 3H1KJ 4W80A 4OGQD 1RF1C 2ZAEB 2ZT9D 1G2CB 2KS1A 1EQ7A 3A0HE 2J59M 2W27A 1LNQA 3EFGA 3HE5B 1NTKG 3MD0A 3RK3C 3VMZA 1H0TA 3A7OA 3G4SP 2ZYGA 1BGYJ 4U7JA 1LWUA 2D2CC 2BCCD 2H89C 1VQ6P 1QLED 3H1HG 4H13B 1VQ4P 1LT9C 3L72J 3B71A 1N7SB 1NKNA 2E74D 2Q1KA 3MHVA 1BE3E 1KYOH 1SFCD 1X9VA 1NTKJ 4HYTB 4IL6H 4RESB 3TGUJ 5APXA 3KYQA 3S1KA 1PZQA 2AEMA 1LWUC 3C9IA 2XZRA 2CPBA 1KZUB 3BASA 5E79H 4WWIA 5AVVB 3HTKA 4DT0A 4GT1A 5CCGD 3B8EB 5M1BA 2WITA 1NTZE 1AVYA 4N6JA 3MP7B 1LTJA 1OVVA 3AEEC 1EDKA 2ZVOB 3L75D 1BGYE 5APSA 3TYYA 4AQRD 1KD1Q 5L8RJ 4TLFA 3W68A 1JTHA 3VMXA 1Q82Q 5CJ4A 2QM8A 1MUUA 1LTJB 4WVZA 1IFIA 3L75E 1L4AD 2WSEH 2OYIA 1LTTC 1SLQA 2JO1A 5AW4B 5KAIE 1HGVA 4IFDK 3RL0C 2UWJE 2J58A 1NHLA 2JJLA 4ASWA 4AYCA 3B4SA 3AEDC 1MKMA 3H1LE 3OW2O 5AW6B 5CCGC 1CZQA 3USSA 3S9OA 4GDOA 1FU1A 1AJYA 3H1IJ 1PP9J 1ZMEC 1VQPP 3VTPC 3HE5A 3L73E 2IYOA 2HODB 2E76C 3GLMA 3HE4B 3L36A 4LGDE 3G3ZA 2E74B 3GMAA 3PRJA 4DOJA 2J5UA 1VQ5P 1SQPG 1UIXA 4TT3H 2ITAA 2L5GB 2RN0A 4EI2A 3SFEC 3I56P 1VPCA 1D7MA 5CMZA 1SQVG 4ASVA 1S9KE 1OXZA 5AW5B 4I1LA 1NTMG 3AE9C 3CC4P 1USDA 1KILC 1A02J 1Q7YQ 2P1JA 1KQFB 3VMYA 3SWFA 3CCVP 4Y28J 3P32A 2AEFA 1M90Q 1LGHB 1PGPA 2AXCA 3RK2B 2BCCG 3H32A 1T6AA 2OQQA 4ZKUA 1Q86Q 1KTMA 2KZIA 3H25A 1FBMA 3AEBC 5CHXA 1NJIQ 4D6TG 4WY4A 2KIKA 2R5BA 4NPFX 3L72E 4JYBA 1OX3A 2K9JA 2IX7C 1GZLA 5KLVE 4U3FJ 2FYUD 3D71A 1GL2C 3IR9A 2JR8A 1EZVD 2QRXA 5TISE 1U57A 1VQOP 1VQ8P 4GODA 3G9RA 5CJ0A 3BCCD 1SQPD 3H1JE 3OAKA 3KPEA 2FFDC 1SQVD 1SS1A 1KB9D 1LJ2A 3WUUA 1M8OB 2PP6A 1FE6A 1IFDA 2RH0A 2Y0DA 3E1IA 2IDBA 4H0LB 2WSCJ 5DJUB 1LT9B 1FDIA 2N9BA 1GL2D 1W2EA 1JY3P 3PJSK 1EDIA 3A3YB 4EYYQ 1CSBA 1KB9I 3WUVA 3L71E 1YQ3C 2YIUC 3NXSA 4H44D 3CCMP 1USEA 1N2DC 1FJPA 3F89A 4HKZH 3HD7B 2YNYA 3PH0A 2WPQA 1NTZK 2GUSA 2FY8A 2W6JH 4EDFA 2AEJA 2K3RA 3RK2D 1L0LE 1GMJA 2G3AA 3L4FA 4OGQC 1OWAA 2YKQA 3E7KA 3M9BA 1X79B 2K88A 1PL5A 2E75B 2Q3EA 3C1LA 1LTSC 3KXDA 1HUCA 4HJGH 4BRYB 1JCCA 1KILD 1AQTA 1Y8AA 2C9NY 2O1JA 3O6QA 2BEQD 2WSFH 3MGNA 3A0BH 1L0LD 1BE3D 2AXTE 1CI6A 1L0NK 2K9YA 2V7QJ 2QSIA 2ZYDA 1M1JC 2RKLA 3E1RA 5BU8B 1QVGO 4PJ0H 4NPDA 1FDOA 1MFTA 1QGKB 1SQQE 1PGQA 5AVRB 1NU1D 1UIIA 3BRVB 5CCHD 1SQQG 4N3YB 1NTZD 1OW8A 4B86A 2NPSC 2Z4EA 2XKMA 1KQGB 4KJMA 3G6EP 1H88A 1X22A 3CD6P 1CW5A 3V6IA 1IFNA 1Q2NA 2LR2A 1M1KQ 1SQXJ 1YYCA 3FXDA 3H1JG 5CCHA 2D2CD 3M0AA 1FZCC 4ZMDA 3HRNA 2P2UA 4H44B 2B89A 3TNUB 1K8AQ 2M3EA 3L37A 3CMEP 1G2CA 2KS1B 1SQXG 3H1LD 1NU1K 1OMIA 4UB6E 3H1HJ 2JWAA 4H44C 5CBNA 2WT7A 1R8EA 1L0LG 1N73A 1OFCX 3AEFC 1KILE 2N1TB 1M1JA 1NTMD 2FXMA 4IL6X 4PJ0E 3CWBD 5KLIB 2IFMA 1FZEA 1P84E 4PD4D 1SQVE 4IFFA 1S3JA 1NYHA 3L73D 2IZ1A 4PV1C 1YITP 2YXRB 3ZDMA 4Z1MH 4U3FG 1SQQD 3JC22 2JEEA 5B5EH 3D70A 1AVOA 3JSVC 5KLVJ 2WSFJ 4GIFA 4D6TJ 3GHGB 3MUDC 2JWDA 1RQUA 5AVYB 4ZKPA 3LW5J 5KAFH 3CCQP 2FYUE 4EOTA 2I8DA 4XFJA 1GL2A 2E76D 3FXEA 3JCUE 3T97A 3U1CA 2WVRA 4ZNCA 2GM4A 2W6BA 2FYUG 3S4RA 2H43A 2Z5HA 3RK3D 4D6TE 2QJPC 1URQD 4L76A 3W67A 1SQBG 1L2PA 5EFWB 3Q5PA 1S72P 3O8ZA 2A06E 1BCCG 1JY3O 1JY2P 1KQLA 1PIXA 3B5NB 3TF5A 3L74J 1S4XA 1FJKA 2Q5UA 1KB9H 3BATA 4PV1B 1IO4A 3WU2H 2H7HA 3IN6A 1DD4A 1SVFA 2B87B 2QM7A 5AW3B 5KLIC 3RL0g 3RL0D 3D6YA 3R2PA 2OTJP 3P8CE 1T2KD 2NZ2A 2KYVA 3HD7C 1KMIZ 1KORA 1URQC 2BASA 2OARA 1PP9G 2OYOA 3GF7A 3L70D 5AW1B 5B5EE 1IJDB 5KKZC 4XE5B 1RH5B 1RE3C 2SPZA 4PD4E 2WT7B 3Q2YA 2HPCA 3AE7C 3GHGA 2OTKE 2ZT9B 1J1DB 1JCDA 4WY4C 1NTMK 2KSJA 2Q3IA 5AW2B 4DCKA 2M8RA 1VQ7P 3KDPB 2I1JA 3FX0A 1FZFA 4U3FE 2XNDH 5AW8B 1L0NE 4R4MA 1LP1A 4O9BA 1L0NJ 2C9LY 3AE2C 2MKVA 4W7YA 3L35A 5CCGA 1XTGB 3CI9A 1L0NG 1SQBD 2VRSA 3EFFK 3FWLA 5BVZA 1YHQP 2NPSB 1BCCD 1BE3G 1KILA 1SFCC 5APYA 2FBWC 1PGOA 3BRTB 3L74G 4C7NA 2Y0EA 5AVUB 4YXWH 1J1EB 2NRGA 1IFJA 3CWBG 3JCUH 1URQB 3HUSA 4L75A 1GU5A 3GG2A 3IAOA 2OYIB 2A45I 3H1HE 1NGMB 1LTIC 1YQ4C 2C0WA 4Y99C 1H0TB 2BCCE 1KFMA 1FZGA 1T3UA 1IFPA 1EDLA 2CK3H 3U59A 1N73C 1BSHA 5GTIH 1NO4A 1SQBE 1AFOA 3Q5RA 1L4AB 1JY3N 1GD2E 1OVRA 3CC2P 4C7NB 1J1EC 1NU1E 1BGYG 2HFED 3MUDA 1LP1B 2O1KA 3CC7P 1T8ZA 2O3JA 2E43A 4YPCA 2KP8A 3M0DA 4YXDC 2KLUA 2OYIC 1N7LA 4W7ZA 3WUTA 2B9BA 1RE4A 4GKGA 1YJWP 1N8RQ 1SFCB 2ZXXA 5APVA 1RHZB 2A45G 2YO2A 1VQ9P 3CCJP 1QVFO 2NPSA 3L74D 2V4HA 3QH9A 3CL3D 3Q3DA 4QMAA 1VQMP 1KFNA 3L73G 2PFXA 4UB8H 3P8MC 1PV3A 2IYPA 3L70G 3AE6C 2W90A 1IFMA 3WU2E 1AQ5A 3G71P 1ZR4A 5AVTB 4OWFA 2ZJSE 1NAYA 1ZRTE 2JKVA 4L73A 1E5WA 5KKZB 2IZ0A 4D6TD 2QIWA 1BCCJ 2WPVB 2ZFCA 3M0DC 5KLVD 3K5BA 1JO5A 2PGDA 2M5AA 1SQBJ 3KZIE 4BRYA 3CX5I 1FZCB 1BDDA 1U7JA 2WMMA 3A0BE 3B5NC 1YJ9P 2Q9IA 2JP3A 1L0ND 1LT1A 3EQ2A 3VN0A 1IK7A 3AEAC 1P84D 1OVUA 3UIAA 2N9YB 3TGUG 4Y99B 2XNXA 2KI7B 5KJ7C 3D6ZA 2P7JA 4WB4A 1KQSO 3FWNA 4EIJA 2KZJA 2FKWB 1K9MQ 1FOSE 2WPRA 3CCUP 4H13D 3L70J 2O01N 1MFZA 2WSSH 1EXJA 2YXQB 3HUSC 1BSNA 2QG4A 1M1JB 3AEGC 3V2QA 2FFDA 1NTKK 2E74C 1A02F 4M3LA 2B88A 2Y9YA 2R3SA 5GTHE 5K5GB 1JY2N 1ZOYC 1DX7A 1IK9A 2LXCB 2O01H 1JNMA 4AUWA 1JM0A 2A06D 2FXOA 3MTUE 1VDFA 1GW4A 2WSCH 3CXHH 1NTKE 2ZT9C 1PPJD 4I2LC 1RY3A 2IBZG 3HD7D 3CCEP 1NU1J 1X8YA 2OYHB 3VMAA 1RF0A 3M91A 1GK6A 1NVOA 4K35A 1FDMA 1H8AA 5B66E 1KN7A 2LXBA 2JDIH 2OYHC 3LIEA 2W8ZA 1ZLLA 3M06A 3BVHA 2L91A 1HF9A 2HYNA 2N1TA 2G8YA 4JQ0D 5APWA 3TNUA 3L74E 1SQQJ 2R5DA 1EXIA 1SFCA 1ZP0C 1K73Q 3AE1C 2IPPA 1NTZG 3MZWB 1FZAA 2Q6QA 3L73J 4PD4H 1RQVA 3OA7A 1BDCA 2DW3A 2QJKB 1Y47A 1DEEG 3CWBJ 1FZBA 1WMKA 1NTMJ 5E79E 5H2FE 1DIPA 3HUSB 2KSEA 1Y9BA 3H1HD 3QWOC 5KLVG 4HH2A 3CX5H 2LKMA 3H1LJ 4XA4A 3TGUE 1JOCA 1MZ9A 3OJAB 5TJHA 3GHGC 4OH8B 1YIJP 1L4AC 4OVNF 3CLQA 4H13C 2IBZD 3CXHD 3N7NA 2K1AA 1N7SA 1GTWA 3ITKA 3PP5A 1XTCC 2W6AA 3H1KG 1SQXD 2YKOA 3H1LG 3HD7A 1SQVJ 1WRGA 3CX5D 3CCSP 1S5LH 2P10A 1NOHA 3H1KE 2K37A 1HVVA 2IBZE 2N1TC 3CXHE 3H6PA 2POHA 2KXPB 2M3BA 2P67A 3I55P 1VQKP 2QE7H 1KILB 5AVWB 3GF3A 1NTZJ 1HWTC 3PLNA 2YIUB 3AECC 3L71G 1L0LK 1SQPK 2E5TA 3EWKA 4U3FD 2WSEJ 5KJ7A 4UB6H 3P8CD 4H0LC 4PD4I 1NH4A 3GW6A 5AVQB 1PFIA 1BE3J 1L0LJ 1P84H 1KC8Q 1FOSF 1DD3A 1SQPE 2MJZA 2YMKA 1VF5D 1E79H 4JBZA 3B5NA 1AV1A 4JF7A 2K9JB 1IC2A 2XV5A 1LTBC 4IFMA 5CCHC 3F5HA 3T97B 1Z56A 1J1DC 2XDJA 4WY4B 5AVZB 3V5BA 2WTYA 2HPCB 3RBXA 1QX8A 2FFDB 2FYZA 1LT9A 4GOFA 5H2FH 3RGUA 1SQXK 4WBAA 2ZVNB 5APUA 4C7RA 2YO3A 2A45H 4JYCA 3L72G 2XU6A 3CX5E 3KZIH 2QA4P 1LTJC 1ZRTD 1M57D 2Q7CA 5AW7B 1PP9D 3H1ID 1IZNB 2GA1A 1W5CE 2M0BA 3PTZA 1KB9E 5APQA 2KNCB 1DEBA 1N73B 3AE4C 2E5YA 1WT6A 1GDTA 4OGQB 1KYOI 2WWWA 4RKUJ 1OW7A 1SQPJ 3BCCJ 1OZHA 2A06G 1SQQK 1ZV8A 2PAJA 3FGAD 2KNCA 1KYOE 1YTZI 3H1IE 3NMDA 4I6MC 4RO0A 3IFMA 1P84I 4DZOA 1VQLP 1VQNP 1EZVE 2W83C 3M9QA 3VYIA 2WZ7A 5CBOA 3U1AA 2FYUJ 1N7SD 1JY2O 1EZVG 1KV4A 4K3AA 3A0HH 5AW0B 1RF1A 2C0XA 2IBZI 3CXHI 4H0LD 5KTBA 1TU3F 3L75J 3RK3B 1R5SA 4WY4D 3V2NA 5BU5A 3SFDC 3A2AA 4L74A 2QJYB 1NWQA 4LLHA 3B5ND 1RE4C 1OIPA 3HE4A 2HLOA 5B66H 1W2BO 2OTLP 5DJTB 1NTKD 3KHUA 1T3JA 3TDKA 1GU4A 5GTHH 3RL0B 4BXLA 2I1KA 3V2RA 1ZR2A 2PRRA 2E75D 1NKZB 2KK7A 3AE8C 3SSUA 1BGYD 1JB0J 1HTLC 1AA0A 1M7LA 1SQVK 2GUVA 3AE5C 3II6A 2R3CA 1QL1A 3C8VA 2OGUA 1HBWA 1EC5A 1YBKA 3CWBE 1BCCE 5KAFE 5GTIE 3NTNA 3H1KD 3V4WA 3Q1MA 3MIWA 1Q81Q 1DH3A 2H8PD 3I5CA 1K05A 3TK1A 1HJBA 1ZN5A 1VF5C 2FYUK 1PPJE 2E42A 2QJPB
chains in the Genus database with same CATH topology
1JTHB 1NAFA 1CI6B 2Z5IA 3LIDA 5KLVK 1LWUB 2KOGA 3M9HA 1QL2A 1N7SC 1SP4A 3HTKB 3WMM0 1L4AA 1GK4A 2YKPA 1RF1B 1JUNA 1N86A 1MV8A 3A5TA 1LTGC 5AW9B 4C46A 1RF0C 1GW3A 5AVSB 1RE3A 3V4QA 4LC1A 2N1TD 1URQA 3SWYA 1JMMA 3VP9A 3V2PA 3H32B 4N78D 2IFNA 1H89A 2KLVA 5AVXB 3LW5H 1FAVA 2OYHA 1G1IA 4N78E 4KHXA 5APTA 3TSIA 3P7KA 3NFQA 2CPSA 5KJ7D 3VP8A 2WPSA 1J2JB 3VOPA 1GL2B 3KQGA 2NPSD 2KB7P 3N4XA 1FZCA 2HODA 1HGZA 1T2KC 2YMYA 1HH0A 1SQBK 1G1JA 3RK2C 2HG5D 2R32A 1LTAC 1YTZT 1S9KD 2ZXEB 1RF1C 4W80A 1G2CB 3EFGA 1EQ7A 2J59M 2W27A 3HE5B 3MD0A 3RK3C 3VMZA 3A7OA 1LWUA 1LT9C 1N7SB 1NKNA 3V5BA 1SFCD 1X9VA 4HYTB 4RESB 5APXA 3KYQA 3C9IA 1LWUC 2XZRA 2CPBA 1KZUB 3BASA 5AVVB 3HTKA 4GT1A 5CCGD 3B8EB 2WITA 4N6JA 1LTJA 4AQRD 3TYYA 5APSA 1JTHA 3VMXA 5CJ4A 2QM8A 1MUUA 1LTJB 1IFIA 1L4AD 2WSEH 2OYIA 1LTTC 1SLQA 5AW4B 1HGVA 4IFDK 3RL0C 2J58A 1NHLA 2JJLA 4AYCA 5AW6B 5CCGC 1CZQA 1FU1A 3VTPC 3HE5A 2HODB 4LGDE 3L36A 3HE4B 4DOJA 3G3ZA 2L5GB 1VPCA 5CMZA 1S9KE 1OXZA 5AW5B 4I1LA 1KILC 1A02J 2P1JA 3VMYA 3SWFA 3P32A 1LGHB 3RK2B 3H32A 4ZKUA 1FBMA 5CHXA 4WY4A 2R5BA 4JYBA 2IX7C 1GZLA 1GL2C 3IR9A 5CJ0A 3OAKA 3KPEA 2FFDC 2PP6A 1IFDA 3E1IA 1LT9B 2N9BA 1GL2D 1W2EA 1JY3P 3A3YB 1CSBA 1FJPA 3NXSA 1N2DC 3HD7B 2YNYA 2WPQA 1NTZK 2GUSA 3RK2D 3L4FA 1OWAA 2YKQA 3M9BA 1X79B 1LTSC 1HUCA 2C9NY 1JCCA 1KILD 2O1JA 2WSFH 3MGNA 1L0NK 1CI6A 5BU8B 1M1JC 5AVRB 3BRVB 5CCHD 4N3YB 2Z4EA 4B86A 2NPSC 2XKMA 1H88A 1CW5A 1IFNA 1YYCA 5CCHA 3M0AA 1FZCC 3HRNA 2P2UA 3TNUB 3L37A 1G2CA 1NU1K 1N73A 2WT7A 2N1TB 1M1JA 2FXMA 2IFMA 1FZEA 4IFFA 2JEEA 4GIFA 3GHGB 4ZKPA 5AVYB 4EOTA 1GL2A 3T97A 3U1CA 2GM4A 2W6BA 2H43A 2Z5HA 3RK3D 1URQD 3O8ZA 1JY3O 1JY2P 1KQLA 3B5NB 3BATA 2Q5UA 1FJKA 1IO4A 2H7HA 1SVFA 3RL0D 5AW3B 2QM7A 3R2PA 3P8CE 1T2KD 3HD7C 2KYVA 1URQC 2BASA 5AW1B 2OARA 1IJDB 4XE5B 2WT7B 1RE3C 2HPCA 3GHGA 1J1DB 1JCDA 4WY4C 1NTMK 2KSJA 2Q3IA 5AW2B 2M8RA 3KDPB 2I1JA 1FZFA 5AW8B 4O9BA 2C9LY 4W7YA 3L35A 5CCGA 1XTGB 3CI9A 2VRSA 5BVZA 2NPSB 1SFCC 1KILA 5APYA 4C7NA 3BRTB 5AVUB 2Q9IA 1GU5A 1J1EB 1IFJA 2OYIB 1URQB 3HUSA 2A45I 1LTIC 2C0WA 4Y99C 1KFMA 1FZGA 1T3UA 3U59A 1N73C 1NO4A 1AFOA 1L4AB 1JY3N 1GD2E 4C7NB 1J1EC 3MUDA 2HFED 2O1KA 1T8ZA 2E43A 2KP8A 3M0DA 2OYIC 1N7LA 4W7ZA 1RE4A 4GKGA 1SFCB 5APVA 2A45G 2YO2A 2NPSA 3CL3D 1KFNA 3P8MC 1IFMA 1AQ5A 1ZR4A 5AVTB 1E5WA 2ZFCA 3M0DC 1JO5A 1FZCB 3B5NC 3EQ2A 3VN0A 3UIAA 4Y99B 2XNXA 5KJ7C 2P7JA 4WB4A 4EIJA 1FOSE 2FKWB 2WPRA 1MFZA 3HUSC 3V2QA 1M1JB 2FFDA 1NTKK 1A02F 4M3LA 1JY2N 1DX7A 1IK9A 2O01H 1JNMA 4AUWA 3MTUE 1VDFA 1GW4A 2WSCH 4I2LC 1RY3A 3HD7D 1X8YA 2OYHB 1RF0A 3M91A 1GK6A 1FDMA 1H8AA 2OYHC 3LIEA 1ZLLA 3M06A 3BVHA 2HYNA 2N1TA 5APWA 3TNUA 2R5DA 1SFCA 2IPPA 1FZAA 3OA7A 1FZBA 3HUSB 4HH2A 2LKMA 4XA4A 1JOCA 1MZ9A 3OJAB 3GHGC 4OH8B 1L4AC 3CLQA 3N7NA 1N7SA 1GTWA 3PP5A 1XTCC 2W6AA 1FOSF 2YKOA 3HD7A 1WRGA 1NOHA 1HVVA 2N1TC 3H6PA 2POHA 2P67A 2M3BA 5AVWB 1KILB 1HWTC 1L0LK 1SQPK 5KJ7A 3P8CD 1NH4A 1PFIA 5AVQB 2MJZA 4JF7A 3B5NA 1IC2A 2XV5A 1LTBC 4IFMA 5CCHC 2HPCB 1Z56A 1J1DC 2XDJA 4WY4B 5AVZB 2WTYA 2FFDB 2FYZA 1LT9A 1SQXK 4WBAA 5APUA 4C7RA 2YO3A 2A45H 4JYCA 2XU6A 1LTJC 2Q7CA 5AW7B 5APQA 1DEBA 1N73B 1GDTA 1WT6A 2WWWA 3NMDA 1SQQK 1ZV8A 2PAJA 1YTZI 4DZOA 4I6MC 3IFMA 3M9QA 3VYIA 2WZ7A 3U1AA 1N7SD 5AW0B 1RF1A 2C0XA 5KTBA 3RK3B 4WY4D 3V2NA 5BU5A 3A2AA 1NWQA 4LLHA 3B5ND 1RE4C 3HE4A 2HLOA 1GU4A 1T3JA 3RL0B 2I1KA 3V2RA 1ZR2A 1NKZB 2GUVA 1HTLC 1SQVK 1M7LA 1HBWA 3II6A 2R3CA 1QL1A 3NTNA 3V4WA 3MIWA 1DH3A 2H8PD 3I5CA 1HJBA 3TK1A 1ZN5A 2FYUK 1JY2O 2E42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2Q A;  3V2N A;  1VDF A;  1MZ9 A;  1DEB A;  3V2R A;  3V2P A;  1FBM A; 
#chains in the Genus database with same CATH topology
 1JTH B;  1NAF A;  2RMZ A;  1FC2 C;  1CI6 B;  2Z5I A;  3LID A;  4MN4 C;  5KLV K;  1LWU B;  4DJG A;  3CMA P;  2KOG A;  3M9H A;  2WQY C;  3L71 D;  3O6Q B;  4I7Z C;  3H1I G;  4CPG A;  2ZYA A;  1NU1 G;  2FXP A;  1QL2 A;  1N7S C;  1SP4 A;  2E76 B;  3HTK B;  4A7P A;  2Y0C A;  3WMM 0;  1PGJ A;  4RJT A;  1L4A A;  1GK4 A;  2D2C B;  2YKP A;  1S2E A;  2FYN C;  1N86 A;  4KT0 J;  3SWK A;  1MV8 A;  1RF1 B;  1JUN A;  3A5T A;  1LTG C;  5AW9 B;  4C46 A;  1RF0 C;  1GW3 A;  1SQX E;  5AVS B;  4UB8 E;  4PV1 D;  3BCC E;  3H1J D;  1KYO D;  1OW6 A;  2AXT H;  3Q5S A;  1RE3 A;  5C39 A;  1M56 D;  3V4Q A;  4LC1 A;  2N1T D;  1URQ A;  2H88 C;  1R5L A;  3SWY A;  3TGU D;  2FYN B;  1JMM A;  2M5A B;  3L70 E;  3RK3 E;  3VP9 A;  1ZXG A;  3CPW O;  1NTM E;  3L72 D;  3V2P A;  3H32 B;  1K04 A;  1EZV I;  1X0T A;  2IFN A;  4N78 D;  4JPZ B;  2KLV A;  4YTP C;  2BCC J;  4HB1 A;  1H89 A;  5AVX B;  2V7Q H;  3PHL A;  1FAV A;  3LW5 H;  3R4Y A;  3ABV C;  2OYH A;  4I7Z B;  4R4L A;  1G1I A;  4NPE A;  2QVA A;  4N78 E;  4KHX A;  3H1J J;  5APT A;  3TSI A;  2BEZ F;  1QEX A;  2KUB A;  2R44 A;  2QJK C;  2CPS A;  2HR3 A;  3NFQ A;  1VF5 B;  3P7K A;  5KJ7 D;  4BWN A;  3VP8 A;  2WPS A;  3AE3 C;  1J2J B;  1U7M A;  1ZW0 A;  4GOE A;  1GL2 B;  1Q90 D;  1JEK A;  3VOP A;  5TIS H;  2Y9Z A;  1YJN P;  2P58 A;  2NPS D;  3KQG A;  3CCL P;  3IF4 A;  4IOI H;  2KB7 P;  1PPJ G;  1PP9 E;  3N4X A;  1VL2 A;  1FZC A;  4IL6 E;  1S5L E;  2HOD A;  1HJ0 A;  1HGZ A;  1YI2 P;  1T2K C;  2YMY A;  3L71 J;  5KAI H;  2B87 A;  1HH0 A;  1SQB K;  1EDJ A;  2O01 J;  1G1J A;  3L75 G;  2HG5 D;  3RK2 C;  1FS0 E;  2E75 C;  2R32 A;  1LTA C;  1S1C X;  3BCC G;  3CCR P;  3RBZ A;  1S5L X;  1YTZ T;  2QEX P;  1S9K D;  1JMB A;  2QJY C;  2ZXE B;  3H1K J;  4W80 A;  4OGQ D;  1RF1 C;  2ZAE B;  2ZT9 D;  1G2C B;  2KS1 A;  1EQ7 A;  3A0H E;  2J59 M;  2W27 A;  1LNQ A;  3EFG A;  3HE5 B;  1NTK G;  3MD0 A;  3RK3 C;  3VMZ A;  1H0T A;  3A7O A;  3G4S P;  2ZYG A;  1BGY J;  4U7J A;  1LWU A;  2D2C C;  2BCC D;  2H89 C;  1VQ6 P;  1QLE D;  3H1H G;  4H13 B;  1VQ4 P;  1LT9 C;  3L72 J;  3B71 A;  1N7S B;  1NKN A;  2E74 D;  2Q1K A;  3MHV A;  1BE3 E;  1KYO H;  1SFC D;  1X9V A;  1NTK J;  4HYT B;  4IL6 H;  4RES B;  3TGU J;  5APX A;  3KYQ A;  3S1K A;  1PZQ A;  2AEM A;  1LWU C;  3C9I A;  2XZR A;  2CPB A;  1KZU B;  3BAS A;  5E79 H;  4WWI A;  5AVV B;  3HTK A;  4DT0 A;  4GT1 A;  5CCG D;  3B8E B;  5M1B A;  2WIT A;  1NTZ E;  1AVY A;  4N6J A;  3MP7 B;  1LTJ A;  1OVV A;  3AEE C;  1EDK A;  2ZVO B;  3L75 D;  1BGY E;  5APS A;  3TYY A;  4AQR D;  1KD1 Q;  5L8R J;  4TLF A;  3W68 A;  1JTH A;  3VMX A;  1Q82 Q;  5CJ4 A;  2QM8 A;  1MUU A;  1LTJ B;  4WVZ A;  1IFI A;  3L75 E;  1L4A D;  2WSE H;  2OYI A;  1LTT C;  1SLQ A;  2JO1 A;  5AW4 B;  5KAI E;  1HGV A;  4IFD K;  3RL0 C;  2UWJ E;  2J58 A;  1NHL A;  2JJL A;  4ASW A;  4AYC A;  3B4S A;  3AED C;  1MKM A;  3H1L E;  3OW2 O;  5AW6 B;  5CCG C;  1CZQ A;  3USS A;  3S9O A;  4GDO A;  1FU1 A;  1AJY A;  3H1I J;  1PP9 J;  1ZME C;  1VQP P;  3VTP C;  3HE5 A;  3L73 E;  2IYO A;  2HOD B;  2E76 C;  3GLM A;  3HE4 B;  3L36 A;  4LGD E;  3G3Z A;  2E74 B;  3GMA A;  3PRJ A;  4DOJ A;  2J5U A;  1VQ5 P;  1SQP G;  1UIX A;  4TT3 H;  2ITA A;  2L5G B;  2RN0 A;  4EI2 A;  3SFE C;  3I56 P;  1VPC A;  1D7M A;  5CMZ A;  1SQV G;  4ASV A;  1S9K E;  1OXZ A;  5AW5 B;  4I1L A;  1NTM G;  3AE9 C;  3CC4 P;  1USD A;  1KIL C;  1A02 J;  1Q7Y Q;  2P1J A;  1KQF B;  3VMY A;  3SWF A;  3CCV P;  4Y28 J;  3P32 A;  2AEF A;  1M90 Q;  1LGH B;  1PGP A;  2AXC A;  3RK2 B;  2BCC G;  3H32 A;  1T6A A;  2OQQ A;  4ZKU A;  1Q86 Q;  1KTM A;  2KZI A;  3H25 A;  1FBM A;  3AEB C;  5CHX A;  1NJI Q;  4D6T G;  4WY4 A;  2KIK A;  2R5B A;  4NPF X;  3L72 E;  4JYB A;  1OX3 A;  2K9J A;  2IX7 C;  1GZL A;  5KLV E;  4U3F J;  2FYU D;  3D71 A;  1GL2 C;  3IR9 A;  2JR8 A;  1EZV D;  2QRX A;  5TIS E;  1U57 A;  1VQO P;  1VQ8 P;  4GOD A;  3G9R A;  5CJ0 A;  3BCC D;  1SQP D;  3H1J E;  3OAK A;  3KPE A;  2FFD C;  1SQV D;  1SS1 A;  1KB9 D;  1LJ2 A;  3WUU A;  1M8O B;  2PP6 A;  1FE6 A;  1IFD A;  2RH0 A;  2Y0D A;  3E1I A;  2IDB A;  4H0L B;  2WSC J;  5DJU B;  1LT9 B;  1FDI A;  2N9B A;  1GL2 D;  1W2E A;  1JY3 P;  3PJS K;  1EDI A;  3A3Y B;  4EYY Q;  1CSB A;  1KB9 I;  3WUV A;  3L71 E;  1YQ3 C;  2YIU C;  3NXS A;  4H44 D;  3CCM P;  1USE A;  1N2D C;  1FJP A;  3F89 A;  4HKZ H;  3HD7 B;  2YNY A;  3PH0 A;  2WPQ A;  1NTZ K;  2GUS A;  2FY8 A;  2W6J H;  4EDF A;  2AEJ A;  2K3R A;  3RK2 D;  1L0L E;  1GMJ A;  2G3A A;  3L4F A;  4OGQ C;  1OWA A;  2YKQ A;  3E7K A;  3M9B A;  1X79 B;  2K88 A;  1PL5 A;  2E75 B;  2Q3E A;  3C1L A;  1LTS C;  3KXD A;  1HUC A;  4HJG H;  4BRY B;  1JCC A;  1KIL D;  1AQT A;  1Y8A A;  2C9N Y;  2O1J A;  3O6Q A;  2BEQ D;  2WSF H;  3MGN A;  3A0B H;  1L0L D;  1BE3 D;  2AXT E;  1CI6 A;  1L0N K;  2K9Y A;  2V7Q J;  2QSI A;  2ZYD A;  1M1J C;  2RKL A;  3E1R A;  5BU8 B;  1QVG O;  4PJ0 H;  4NPD A;  1FDO A;  1MFT A;  1QGK B;  1SQQ E;  1PGQ A;  5AVR B;  1NU1 D;  1UII A;  3BRV B;  5CCH D;  1SQQ G;  4N3Y B;  1NTZ D;  1OW8 A;  4B86 A;  2NPS C;  2Z4E A;  2XKM A;  1KQG B;  4KJM A;  3G6E P;  1H88 A;  1X22 A;  3CD6 P;  1CW5 A;  3V6I A;  1IFN A;  1Q2N A;  2LR2 A;  1M1K Q;  1SQX J;  1YYC A;  3FXD A;  3H1J G;  5CCH A;  2D2C D;  3M0A A;  1FZC C;  4ZMD A;  3HRN A;  2P2U A;  4H44 B;  2B89 A;  3TNU B;  1K8A Q;  2M3E A;  3L37 A;  3CME P;  1G2C A;  2KS1 B;  1SQX G;  3H1L D;  1NU1 K;  1OMI A;  4UB6 E;  3H1H J;  2JWA A;  4H44 C;  5CBN A;  2WT7 A;  1R8E A;  1L0L G;  1N73 A;  1OFC X;  3AEF C;  1KIL E;  2N1T B;  1M1J A;  1NTM D;  2FXM A;  4IL6 X;  4PJ0 E;  3CWB D;  5KLI B;  2IFM A;  1FZE A;  1P84 E;  4PD4 D;  1SQV E;  4IFF A;  1S3J A;  1NYH A;  3L73 D;  2IZ1 A;  4PV1 C;  1YIT P;  2YXR B;  3ZDM A;  4Z1M H;  4U3F G;  1SQQ D;  3JC2 2;  2JEE A;  5B5E H;  3D70 A;  1AVO A;  3JSV C;  5KLV J;  2WSF J;  4GIF A;  4D6T J;  3GHG B;  3MUD C;  2JWD A;  1RQU A;  5AVY B;  4ZKP A;  3LW5 J;  5KAF H;  3CCQ P;  2FYU E;  4EOT A;  2I8D A;  4XFJ A;  1GL2 A;  2E76 D;  3FXE A;  3JCU E;  3T97 A;  3U1C A;  2WVR A;  4ZNC A;  2GM4 A;  2W6B A;  2FYU G;  3S4R A;  2H43 A;  2Z5H A;  3RK3 D;  4D6T E;  2QJP C;  1URQ D;  4L76 A;  3W67 A;  1SQB G;  1L2P A;  5EFW B;  3Q5P A;  1S72 P;  3O8Z A;  2A06 E;  1BCC G;  1JY3 O;  1JY2 P;  1KQL A;  1PIX A;  3B5N B;  3TF5 A;  3L74 J;  1S4X A;  1FJK A;  2Q5U A;  1KB9 H;  3BAT A;  4PV1 B;  1IO4 A;  3WU2 H;  2H7H A;  3IN6 A;  1DD4 A;  1SVF A;  2B87 B;  2QM7 A;  5AW3 B;  5KLI C;  3RL0 g;  3RL0 D;  3D6Y A;  3R2P A;  2OTJ P;  3P8C E;  1T2K D;  2NZ2 A;  2KYV A;  3HD7 C;  1KMI Z;  1KOR A;  1URQ C;  2BAS A;  2OAR A;  1PP9 G;  2OYO A;  3GF7 A;  3L70 D;  5AW1 B;  5B5E E;  1IJD B;  5KKZ C;  4XE5 B;  1RH5 B;  1RE3 C;  2SPZ A;  4PD4 E;  2WT7 B;  3Q2Y A;  2HPC A;  3AE7 C;  3GHG A;  2OTK E;  2ZT9 B;  1J1D B;  1JCD A;  4WY4 C;  1NTM K;  2KSJ A;  2Q3I A;  5AW2 B;  4DCK A;  2M8R A;  1VQ7 P;  3KDP B;  2I1J A;  3FX0 A;  1FZF A;  4U3F E;  2XND H;  5AW8 B;  1L0N E;  4R4M A;  1LP1 A;  4O9B A;  1L0N J;  2C9L Y;  3AE2 C;  2MKV A;  4W7Y A;  3L35 A;  5CCG A;  1XTG B;  3CI9 A;  1L0N G;  1SQB D;  2VRS A;  3EFF K;  3FWL A;  5BVZ A;  1YHQ P;  2NPS B;  1BCC D;  1BE3 G;  1KIL A;  1SFC C;  5APY A;  2FBW C;  1PGO A;  3BRT B;  3L74 G;  4C7N A;  2Y0E A;  5AVU B;  4YXW H;  1J1E B;  2NRG A;  1IFJ A;  3CWB G;  3JCU H;  1URQ B;  3HUS A;  4L75 A;  1GU5 A;  3GG2 A;  3IAO A;  2OYI B;  2A45 I;  3H1H E;  1NGM B;  1LTI C;  1YQ4 C;  2C0W A;  4Y99 C;  1H0T B;  2BCC E;  1KFM A;  1FZG A;  1T3U A;  1IFP A;  1EDL A;  2CK3 H;  3U59 A;  1N73 C;  1BSH A;  5GTI H;  1NO4 A;  1SQB E;  1AFO A;  3Q5R A;  1L4A B;  1JY3 N;  1GD2 E;  1OVR A;  3CC2 P;  4C7N B;  1J1E C;  1NU1 E;  1BGY G;  2HFE D;  3MUD A;  1LP1 B;  2O1K A;  3CC7 P;  1T8Z A;  2O3J A;  2E43 A;  4YPC A;  2KP8 A;  3M0D A;  4YXD C;  2KLU A;  2OYI C;  1N7L A;  4W7Z A;  3WUT A;  2B9B A;  1RE4 A;  4GKG A;  1YJW P;  1N8R Q;  1SFC B;  2ZXX A;  5APV A;  1RHZ B;  2A45 G;  2YO2 A;  1VQ9 P;  3CCJ P;  1QVF O;  2NPS A;  3L74 D;  2V4H A;  3QH9 A;  3CL3 D;  3Q3D A;  4QMA A;  1VQM P;  1KFN A;  3L73 G;  2PFX A;  4UB8 H;  3P8M C;  1PV3 A;  2IYP A;  3L70 G;  3AE6 C;  2W90 A;  1IFM A;  3WU2 E;  1AQ5 A;  3G71 P;  1ZR4 A;  5AVT B;  4OWF A;  2ZJS E;  1NAY A;  1ZRT E;  2JKV A;  4L73 A;  1E5W A;  5KKZ B;  2IZ0 A;  4D6T D;  2QIW A;  1BCC J;  2WPV B;  2ZFC A;  3M0D C;  5KLV D;  3K5B A;  1JO5 A;  2PGD A;  2M5A A;  1SQB J;  3KZI E;  4BRY A;  3CX5 I;  1FZC B;  1BDD A;  1U7J A;  2WMM A;  3A0B E;  3B5N C;  1YJ9 P;  2Q9I A;  2JP3 A;  1L0N D;  1LT1 A;  3EQ2 A;  3VN0 A;  1IK7 A;  3AEA C;  1P84 D;  1OVU A;  3UIA A;  2N9Y B;  3TGU G;  4Y99 B;  2XNX A;  2KI7 B;  5KJ7 C;  3D6Z A;  2P7J A;  4WB4 A;  1KQS O;  3FWN A;  4EIJ A;  2KZJ A;  2FKW B;  1K9M Q;  1FOS E;  2WPR A;  3CCU P;  4H13 D;  3L70 J;  2O01 N;  1MFZ A;  2WSS H;  1EXJ A;  2YXQ B;  3HUS C;  1BSN A;  2QG4 A;  1M1J B;  3AEG C;  3V2Q A;  2FFD A;  1NTK K;  2E74 C;  1A02 F;  4M3L A;  2B88 A;  2Y9Y A;  2R3S A;  5GTH E;  5K5G B;  1JY2 N;  1ZOY C;  1DX7 A;  1IK9 A;  2LXC B;  2O01 H;  1JNM A;  4AUW A;  1JM0 A;  2A06 D;  2FXO A;  3MTU E;  1VDF A;  1GW4 A;  2WSC H;  3CXH H;  1NTK E;  2ZT9 C;  1PPJ D;  4I2L C;  1RY3 A;  2IBZ G;  3HD7 D;  3CCE P;  1NU1 J;  1X8Y A;  2OYH B;  3VMA A;  1RF0 A;  3M91 A;  1GK6 A;  1NVO A;  4K35 A;  1FDM A;  1H8A A;  5B66 E;  1KN7 A;  2LXB A;  2JDI H;  2OYH C;  3LIE A;  2W8Z A;  1ZLL A;  3M06 A;  3BVH A;  2L91 A;  1HF9 A;  2HYN A;  2N1T A;  2G8Y A;  4JQ0 D;  5APW A;  3TNU A;  3L74 E;  1SQQ J;  2R5D A;  1EXI A;  1SFC A;  1ZP0 C;  1K73 Q;  3AE1 C;  2IPP A;  1NTZ G;  3MZW B;  1FZA A;  2Q6Q A;  3L73 J;  4PD4 H;  1RQV A;  3OA7 A;  1BDC A;  2DW3 A;  2QJK B;  1Y47 A;  1DEE G;  3CWB J;  1FZB A;  1WMK A;  1NTM J;  5E79 E;  5H2F E;  1DIP A;  3HUS B;  2KSE A;  1Y9B A;  3H1H D;  3QWO C;  5KLV G;  4HH2 A;  3CX5 H;  2LKM A;  3H1L J;  4XA4 A;  3TGU E;  1JOC A;  1MZ9 A;  3OJA B;  5TJH A;  3GHG C;  4OH8 B;  1YIJ P;  1L4A C;  4OVN F;  3CLQ A;  4H13 C;  2IBZ D;  3CXH D;  3N7N A;  2K1A A;  1N7S A;  1GTW A;  3ITK A;  3PP5 A;  1XTC C;  2W6A A;  3H1K G;  1SQX D;  2YKO A;  3H1L G;  3HD7 A;  1SQV J;  1WRG A;  3CX5 D;  3CCS P;  1S5L H;  2P10 A;  1NOH A;  3H1K E;  2K37 A;  1HVV A;  2IBZ E;  2N1T C;  3CXH E;  3H6P A;  2POH A;  2KXP B;  2M3B A;  2P67 A;  3I55 P;  1VQK P;  2QE7 H;  1KIL B;  5AVW B;  3GF3 A;  1NTZ J;  1HWT C;  3PLN A;  2YIU B;  3AEC C;  3L71 G;  1L0L K;  1SQP K;  2E5T A;  3EWK A;  4U3F D;  2WSE J;  5KJ7 A;  4UB6 H;  3P8C D;  4H0L C;  4PD4 I;  1NH4 A;  3GW6 A;  5AVQ B;  1PFI A;  1BE3 J;  1L0L J;  1P84 H;  1KC8 Q;  1FOS F;  1DD3 A;  1SQP E;  2MJZ A;  2YMK A;  1VF5 D;  1E79 H;  4JBZ A;  3B5N A;  1AV1 A;  4JF7 A;  2K9J B;  1IC2 A;  2XV5 A;  1LTB C;  4IFM A;  5CCH C;  3F5H A;  3T97 B;  1Z56 A;  1J1D C;  2XDJ A;  4WY4 B;  5AVZ B;  3V5B A;  2WTY A;  2HPC B;  3RBX A;  1QX8 A;  2FFD B;  2FYZ A;  1LT9 A;  4GOF A;  5H2F H;  3RGU A;  1SQX K;  4WBA A;  2ZVN B;  5APU A;  4C7R A;  2YO3 A;  2A45 H;  4JYC A;  3L72 G;  2XU6 A;  3CX5 E;  3KZI H;  2QA4 P;  1LTJ C;  1ZRT D;  1M57 D;  2Q7C A;  5AW7 B;  1PP9 D;  3H1I D;  1IZN B;  2GA1 A;  1W5C E;  2M0B A;  3PTZ A;  1KB9 E;  5APQ A;  2KNC B;  1DEB A;  1N73 B;  3AE4 C;  2E5Y A;  1WT6 A;  1GDT A;  4OGQ B;  1KYO I;  2WWW A;  4RKU J;  1OW7 A;  1SQP J;  3BCC J;  1OZH A;  2A06 G;  1SQQ K;  1ZV8 A;  2PAJ A;  3FGA D;  2KNC A;  1KYO E;  1YTZ I;  3H1I E;  3NMD A;  4I6M C;  4RO0 A;  3IFM A;  1P84 I;  4DZO A;  1VQL P;  1VQN P;  1EZV E;  2W83 C;  3M9Q A;  3VYI A;  2WZ7 A;  5CBO A;  3U1A A;  2FYU J;  1N7S D;  1JY2 O;  1EZV G;  1KV4 A;  4K3A A;  3A0H H;  5AW0 B;  1RF1 A;  2C0X A;  2IBZ I;  3CXH I;  4H0L D;  5KTB A;  1TU3 F;  3L75 J;  3RK3 B;  1R5S A;  4WY4 D;  3V2N A;  5BU5 A;  3SFD C;  3A2A A;  4L74 A;  2QJY B;  1NWQ A;  4LLH A;  3B5N D;  1RE4 C;  1OIP A;  3HE4 A;  2HLO A;  5B66 H;  1W2B O;  2OTL P;  5DJT B;  1NTK D;  3KHU A;  1T3J A;  3TDK A;  1GU4 A;  5GTH H;  3RL0 B;  4BXL A;  2I1K A;  3V2R A;  1ZR2 A;  2PRR A;  2E75 D;  1NKZ B;  2KK7 A;  3AE8 C;  3SSU A;  1BGY D;  1JB0 J;  1HTL C;  1AA0 A;  1M7L A;  1SQV K;  2GUV A;  3AE5 C;  3II6 A;  2R3C A;  1QL1 A;  3C8V A;  2OGU A;  1HBW A;  1EC5 A;  1YBK A;  3CWB E;  1BCC E;  5KAF E;  5GTI E;  3NTN A;  3H1K D;  3V4W A;  3Q1M A;  3MIW A;  1Q81 Q;  1DH3 A;  2H8P D;  3I5C A;  1K05 A;  3TK1 A;  1HJB A;  1ZN5 A;  1VF5 C;  2FYU K;  1PPJ E;  2E42 A;  2QJP B; 
#chains in the Genus database with same CATH homology
 1JTH B;  1NAF A;  1CI6 B;  2Z5I A;  3LID A;  5KLV K;  1LWU B;  2KOG A;  3M9H A;  1QL2 A;  1N7S C;  1SP4 A;  3HTK B;  3WMM 0;  1L4A A;  1GK4 A;  2YKP A;  1RF1 B;  1JUN A;  1N86 A;  1MV8 A;  3A5T A;  1LTG C;  5AW9 B;  4C46 A;  1RF0 C;  1GW3 A;  5AVS B;  1RE3 A;  3V4Q A;  4LC1 A;  2N1T D;  1URQ A;  3SWY A;  1JMM A;  3VP9 A;  3V2P A;  3H32 B;  4N78 D;  2IFN A;  1H89 A;  2KLV A;  5AVX B;  3LW5 H;  1FAV A;  2OYH A;  1G1I A;  4N78 E;  4KHX A;  5APT A;  3TSI A;  3P7K A;  3NFQ A;  2CPS A;  5KJ7 D;  3VP8 A;  2WPS A;  1J2J B;  3VOP A;  1GL2 B;  3KQG A;  2NPS D;  2KB7 P;  3N4X A;  1FZC A;  2HOD A;  1HGZ A;  1T2K C;  2YMY A;  1HH0 A;  1SQB K;  1G1J A;  3RK2 C;  2HG5 D;  2R32 A;  1LTA C;  1YTZ T;  1S9K D;  2ZXE B;  1RF1 C;  4W80 A;  1G2C B;  3EFG A;  1EQ7 A;  2J59 M;  2W27 A;  3HE5 B;  3MD0 A;  3RK3 C;  3VMZ A;  3A7O A;  1LWU A;  1LT9 C;  1N7S B;  1NKN A;  3V5B A;  1SFC D;  1X9V A;  4HYT B;  4RES B;  5APX A;  3KYQ A;  3C9I A;  1LWU C;  2XZR A;  2CPB A;  1KZU B;  3BAS A;  5AVV B;  3HTK A;  4GT1 A;  5CCG D;  3B8E B;  2WIT A;  4N6J A;  1LTJ A;  4AQR D;  3TYY A;  5APS A;  1JTH A;  3VMX A;  5CJ4 A;  2QM8 A;  1MUU A;  1LTJ B;  1IFI A;  1L4A D;  2WSE H;  2OYI A;  1LTT C;  1SLQ A;  5AW4 B;  1HGV A;  4IFD K;  3RL0 C;  2J58 A;  1NHL A;  2JJL A;  4AYC A;  5AW6 B;  5CCG C;  1CZQ A;  1FU1 A;  3VTP C;  3HE5 A;  2HOD B;  4LGD E;  3L36 A;  3HE4 B;  4DOJ A;  3G3Z A;  2L5G B;  1VPC A;  5CMZ A;  1S9K E;  1OXZ A;  5AW5 B;  4I1L A;  1KIL C;  1A02 J;  2P1J A;  3VMY A;  3SWF A;  3P32 A;  1LGH B;  3RK2 B;  3H32 A;  4ZKU A;  1FBM A;  5CHX A;  4WY4 A;  2R5B A;  4JYB A;  2IX7 C;  1GZL A;  1GL2 C;  3IR9 A;  5CJ0 A;  3OAK A;  3KPE A;  2FFD C;  2PP6 A;  1IFD A;  3E1I A;  1LT9 B;  2N9B A;  1GL2 D;  1W2E A;  1JY3 P;  3A3Y B;  1CSB A;  1FJP A;  3NXS A;  1N2D C;  3HD7 B;  2YNY A;  2WPQ A;  1NTZ K;  2GUS A;  3RK2 D;  3L4F A;  1OWA A;  2YKQ A;  3M9B A;  1X79 B;  1LTS C;  1HUC A;  2C9N Y;  1JCC A;  1KIL D;  2O1J A;  2WSF H;  3MGN A;  1L0N K;  1CI6 A;  5BU8 B;  1M1J C;  5AVR B;  3BRV B;  5CCH D;  4N3Y B;  2Z4E A;  4B86 A;  2NPS C;  2XKM A;  1H88 A;  1CW5 A;  1IFN A;  1YYC A;  5CCH A;  3M0A A;  1FZC C;  3HRN A;  2P2U A;  3TNU B;  3L37 A;  1G2C A;  1NU1 K;  1N73 A;  2WT7 A;  2N1T B;  1M1J A;  2FXM A;  2IFM A;  1FZE A;  4IFF A;  2JEE A;  4GIF A;  3GHG B;  4ZKP A;  5AVY B;  4EOT A;  1GL2 A;  3T97 A;  3U1C A;  2GM4 A;  2W6B A;  2H43 A;  2Z5H A;  3RK3 D;  1URQ D;  3O8Z A;  1JY3 O;  1JY2 P;  1KQL A;  3B5N B;  3BAT A;  2Q5U A;  1FJK A;  1IO4 A;  2H7H A;  1SVF A;  3RL0 D;  5AW3 B;  2QM7 A;  3R2P A;  3P8C E;  1T2K D;  3HD7 C;  2KYV A;  1URQ C;  2BAS A;  5AW1 B;  2OAR A;  1IJD B;  4XE5 B;  2WT7 B;  1RE3 C;  2HPC A;  3GHG A;  1J1D B;  1JCD A;  4WY4 C;  1NTM K;  2KSJ A;  2Q3I A;  5AW2 B;  2M8R A;  3KDP B;  2I1J A;  1FZF A;  5AW8 B;  4O9B A;  2C9L Y;  4W7Y A;  3L35 A;  5CCG A;  1XTG B;  3CI9 A;  2VRS A;  5BVZ A;  2NPS B;  1SFC C;  1KIL A;  5APY A;  4C7N A;  3BRT B;  5AVU B;  2Q9I A;  1GU5 A;  1J1E B;  1IFJ A;  2OYI B;  1URQ B;  3HUS A;  2A45 I;  1LTI C;  2C0W A;  4Y99 C;  1KFM A;  1FZG A;  1T3U A;  3U59 A;  1N73 C;  1NO4 A;  1AFO A;  1L4A B;  1JY3 N;  1GD2 E;  4C7N B;  1J1E C;  3MUD A;  2HFE D;  2O1K A;  1T8Z A;  2E43 A;  2KP8 A;  3M0D A;  2OYI C;  1N7L A;  4W7Z A;  1RE4 A;  4GKG A;  1SFC B;  5APV A;  2A45 G;  2YO2 A;  2NPS A;  3CL3 D;  1KFN A;  3P8M C;  1IFM A;  1AQ5 A;  1ZR4 A;  5AVT B;  1E5W A;  2ZFC A;  3M0D C;  1JO5 A;  1FZC B;  3B5N C;  3EQ2 A;  3VN0 A;  3UIA A;  4Y99 B;  2XNX A;  5KJ7 C;  2P7J A;  4WB4 A;  4EIJ A;  1FOS E;  2FKW B;  2WPR A;  1MFZ A;  3HUS C;  3V2Q A;  1M1J B;  2FFD A;  1NTK K;  1A02 F;  4M3L A;  1JY2 N;  1DX7 A;  1IK9 A;  2O01 H;  1JNM A;  4AUW A;  3MTU E;  1VDF A;  1GW4 A;  2WSC H;  4I2L C;  1RY3 A;  3HD7 D;  1X8Y A;  2OYH B;  1RF0 A;  3M91 A;  1GK6 A;  1FDM A;  1H8A A;  2OYH C;  3LIE A;  1ZLL A;  3M06 A;  3BVH A;  2HYN A;  2N1T A;  5APW A;  3TNU A;  2R5D A;  1SFC A;  2IPP A;  1FZA A;  3OA7 A;  1FZB A;  3HUS B;  4HH2 A;  2LKM A;  4XA4 A;  1JOC A;  1MZ9 A;  3OJA B;  3GHG C;  4OH8 B;  1L4A C;  3CLQ A;  3N7N A;  1N7S A;  1GTW A;  3PP5 A;  1XTC C;  2W6A A;  1FOS F;  2YKO A;  3HD7 A;  1WRG A;  1NOH A;  1HVV A;  2N1T C;  3H6P A;  2POH A;  2P67 A;  2M3B A;  5AVW B;  1KIL B;  1HWT C;  1L0L K;  1SQP K;  5KJ7 A;  3P8C D;  1NH4 A;  1PFI A;  5AVQ B;  2MJZ A;  4JF7 A;  3B5N A;  1IC2 A;  2XV5 A;  1LTB C;  4IFM A;  5CCH C;  2HPC B;  1Z56 A;  1J1D C;  2XDJ A;  4WY4 B;  5AVZ B;  2WTY A;  2FFD B;  2FYZ A;  1LT9 A;  1SQX K;  4WBA A;  5APU A;  4C7R A;  2YO3 A;  2A45 H;  4JYC A;  2XU6 A;  1LTJ C;  2Q7C A;  5AW7 B;  5APQ A;  1DEB A;  1N73 B;  1GDT A;  1WT6 A;  2WWW A;  3NMD A;  1SQQ K;  1ZV8 A;  2PAJ A;  1YTZ I;  4DZO A;  4I6M C;  3IFM A;  3M9Q A;  3VYI A;  2WZ7 A;  3U1A A;  1N7S D;  5AW0 B;  1RF1 A;  2C0X A;  5KTB A;  3RK3 B;  4WY4 D;  3V2N A;  5BU5 A;  3A2A A;  1NWQ A;  4LLH A;  3B5N D;  1RE4 C;  3HE4 A;  2HLO A;  1GU4 A;  1T3J A;  3RL0 B;  2I1K A;  3V2R A;  1ZR2 A;  1NKZ B;  2GUV A;  1HTL C;  1SQV K;  1M7L A;  1HBW A;  3II6 A;  2R3C A;  1QL1 A;  3NTN A;  3V4W A;  3MIW A;  1DH3 A;  2H8P D;  3I5C A;  1HJB A;  3TK1 A;  1ZN5 A;  2FYU K;  1JY2 O;  2E42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...