3V2RA

Compcc in complex with fatty acids
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
45
structure length
45
Chain Sequence
MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title COMPcc in complex with fatty acids
rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Cartilage Oligomerization matrix protein (coiled-coil domain
total genus 18
structure length 45
sequence length 45
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3v2rA00
1MZ9A 1FBMA 1DEBA 3V2QA 3V2PA 3V2RA 3V2NA 1VDFA
chains in the Genus database with same CATH superfamily
5EFWB 1IC2A 1NKNA 2R5DA 3V4QA 5CJ0A 2E5TA 2HG5D 2KSEA 1QVGO 1L2PA 3CWBE 2KS1A 4H44B 3B5NA 4HYTB 2CK3H 4XFJA 3WUTA 2H89C 1IFPA 1RE3A 1NU1K 1T3UA 5AVUB 1E79H 1Y8AA 1IFMA 5TISH 1ZW0A 3A2AA 4PV1C 1KV4A 4JQ0D 4PD4D 2ZVOB 1OVRA 1FZCC 2A06G 2C0WA 1HGZA 2KNCB 1PP9D 2WPSA 2N1TB 1W2BO 2P7JA 2H8PD 1HTLC 3RK3B 3L71D 2E75B 3CCEP 2OTLP 5TISE 3CX5E 3FX0A 1RF1B 1T3JA 4DJGA 5AW3B 3OAKA 2E76C 1KB9D 3CI9A 1L0NK 4WY4C 5KKZC 1PV3A 4HB1A 3Q1MA 3AEEC 3ABVC 3FWNA 1FJKA 1WMKA 4TT3H 4BWNA 4ZKUA 2J59M 1JCCA 1JY2O 3HE5A 4DCKA 3G4SP 1S9KD 1KN7A 3B5ND 1PGQA 1SQQJ 1K9MQ 4QMAA 3M9QA 1ZLLA 1EZVD 5B5EE 1LT9B 2BCCJ 3L73E 1BGYE 3G6EP 1ZR2A 3M9BA 1HBWA 1BDDA 4N78D 3SWKA 2W90A 1BSNA 4YXWH 3RK3E 1NGMB 2RN0A 3PH0A 1HWTC 1GW4A 1LTSC 3HD7D 3MTUE 2WSEJ 5KAFE 4OWFA 1VQ8P 2B89A 1L0LJ 2E5YA 2GUVA 4U3FE 3RL0B 5K5GB 3CC7P 3TK1A 3CCVP 1CI6B 2RH0A 3CD6P 2WT7B 1DH3A 1BGYG 2CPSA 3CLQA 1GMJA 1SQXK 1U7JA 1KILA 1KQFB 5B66E 1P84I 2Z4EA 1KTMA 1L0LE 1NH4A 1G2CB 1S5LE 2D2CB 4U3FJ 1NTME 4HH2A 3BCCJ 4WY4B 2B87B 2PFXA 3B4SA 3H1LD 1DIPA 1DX7A 1SFCA 1EDLA 4K3AA 1N7SB 2XKMA 1PZQA 3L75D 3TDKA 1FDMA 1M90Q 4K35A 5KLVK 3AE6C 3CX5I 3JCUH 1KD1Q 2K9JB 3V2PA 3TGUG 1BCCD 3RL0g 3L71J 3L72E 1L4AB 1GL2C 1L0LG 5CCGD 1DEBA 1URQA 2IYOA 2WSFJ 3BASA 5AW7B 3AE8C 2OYHA 1SQVE 2KUBA 5BU5A 3UIAA 5KJ7A 1FZFA 1QVFO 2O1JA 3B71A 2XU6A 3AEAC 5DJUB 1NTZJ 3KDPB 2HPCB 4LGDE 4LLHA 4H0LD 4XE5B 3CCLP 2QE7H 1AVOA 1NOHA 1WT6A 1J2JB 1NU1G 5KJ7C 1GL2A 1M56D 1SP4A 5CHXA 3WU2E 1PGOA 4JYBA 2QVAA 2E43A 1VQ9P 2M5AA 3CCMP 4BXLA 3H6PA 2FYUG 4PD4I 2WPVB 3HTKA 5KAIE 3L36A 1N73B 3H1ID 4RKUJ 4RO0A 3CCQP 1AFOA 2KZIA 2XDJA 1GK6A 3GHGA 3RK2C 1D7MA 1KILC 3SSUA 3H1LJ 1AQ5A 4TLFA 4IFFA 3CWBJ 2E75C 1IFDA 5AVVB 4D6TD 1EDJA 1USDA 1N7LA 1LWUB 3K5BA 4Y99C 1NTKE 1YJWP 2GM4A 1L0ND 2E74D 1BCCJ 1SQXE 1HUCA 2L91A 2WSCH 2ZXEB 3SWFA 2NPSB 3FGAD 3KHUA 3II6A 4W7ZA 3S4RA 2FY8A 2YIUC 5KLVE 4U3FG 1IFIA 1M1JA 1PGJA 2VRSA 1NTKG 3C9IA 5AVTB 3TNUB 3USSA 1ZR4A 3MUDC 3CMAP 2J5UA 2WPRA 2YO3A 3BCCD 2AEFA 3H1IG 4IL6H 3H32A 2QM7A 1HH0A 3U1CA 1NTMG 1R5LA 1P84E 1SQBJ 3EQ2A 1FZEA 5APVA 1KZUB 1JMBA 3M9HA 5APWA 3TGUJ 1KQSO 1JM0A 2ZT9B 3LW5J 1MZ9A 3M91A 1XTCC 3V2QA 3BATA 2IBZE 3VMZA 1J1DB 1EQ7A 1URQD 1AV1A 2NZ2A 1UIIA 2V4HA 2UWJE 1M8OB 2W27A 1NKZB 1S5LX 1SQBD 3HUSB 5APQA 5AVRB 4JYCA 1FDOA 1KORA 1RHZB 1X0TA 1BE3J 4L76A 5AVYB 1LTJC 2IBZG 2PP6A 2YXRB 4UB6H 1RF1C 3B5NB 2WQYC 1FE6A 2KOGA 4KT0J 3VTPC 1EXIA 2C9NY 2YIUB 3KZIH 2E74B 1JEKA 5BVZA 1T6AA 2A06E 2E76B 4XA4A 1QEXA 1SQPG 3HE4A 3W68A 1FZCA 3O6QB 2OYIB 3WUVA 1FJPA 1NU1D 1PP9J 3FXEA 4UB8E 3CCJP 3QH9A 1MFTA 1S5LH 4AYCA 1S4XA 3Q5SA 3CC4P 4D6TG 3D6YA 2MKVA 1LP1A 5AW9B 1GU4A 1PPJD 4EI2A 5CJ4A 4OVNF 1LTAC 2KXPB 3CXHD 3O8ZA 3BVHA 1CSBA 4RESB 4JF7A 2R3SA 5GTHH 5KLIC 2K9YA 3VN0A 3AE9C 1Q7YQ 2FKWB 3MHVA 1Y47A 2WSCJ 1BE3D 3HE5B 2FFDB 2M3BA 3MUDA 2WVRA 3L73G 2FBWC 2N1TD 1Q90D 1LT9A 1JTHA 1RE3C 2I1KA 2IZ0A 3H1KD 4WVZA 1SQVJ 1YIJP 1L4AD 1LTBC 3L72G 4I6MC 5KJ7D 2GUSA 3T97A 2YKQA 5APUA 3VYIA 5B5EH 1OXZA 1UIXA 4BRYB 1MKMA 5E79E 2WPQA 3L70E 3CXHH 4GKGA 2A45I 3VP8A 2D2CC 2IPPA 1J1EB 1N7SD 3H1JE 3R2PA 2P67A 1NU1J 2P1JA 3B8EB 3P8CE 5C39A 1S3JA 4OGQD 1OW8A 1N7SC 1SQBG 3L70J 2IDBA 2WT7A 3I56P 4ZMDA 1JNMA 3VMXA 3KQGA 1FU1A 3HD7B 4OGQC 3JSVC 4EOTA 3Q5RA 2ZFCA 4CPGA 5CBOA 1VQOP 1FC2C 1GW3A 1SQVK 1YI2P 1KYOE 1SFCB 2HYNA 1IK9A 2OARA 1SFCD 1OMIA 3AECC 1NO4A 1VF5D 5AVXB 3PJSK 3WU2H 1BE3G 4C7NB 1JO5A 5AW1B 3H1KG 2K9JA 3H25A 1JMMA 1SQQK 2LXCB 3GG2A 2Q6QA 3B5NC 1SQQG 1L4AA 1OW7A 1X22A 2FYZA 4IFMA 5CCHC 1KILD 1URQB 1PPJG 5H2FH 4WB4A 2B9BA 3RGUA 3CCUP 1NVOA 2V7QJ 1BCCG 2D2CD 1LJ2A 2HODB 3TSIA 3OA7A 3D6ZA 2R3CA 3Q3DA 1R8EA 1JCDA 2M3EA 2IFNA 4R4MA 2E75D 3G71P 2OTJP 2FYNB 3L75G 5AW8B 1ZV8A 2ZT9C 4PD4E 1TU3F 1Q2NA 1GD2E 1VQ7P 2ZYAA 4H13B 3MP7B 1SQBK 2HFED 4H13D 2XZRA 3RK2B 4OH8B 2H43A 3AE7C 1GDTA 5DJTB 3A0BH 3CMEP 2FYUE 2JO1A 2SPZA 3L71E 5AW5B 3SFDC 3D70A 2FXMA 2YMYA 1SQPK 2IYPA 1LT1A 2Y0EA 1SQQD 3CX5D 2M5AB 3H1HE 3L37A 4N3YB 1A02F 1NTKK 3RK3C 1NHLA 1JUNA 4HKZH 1ZRTE 3NMDA 1KFMA 2BCCE 3L73J 1X9VA 1QL1A 1OX3A 3L74E 5APTA 1L0NJ 1LTIC 3PRJA 4LC1A 4PJ0E 4YPCA 1NTZE 1N73A 3AE5C 2XNXA 3BRTB 1NTMK 3NFQA 4YXDC 2OYHC 1IO4A 1KB9I 1YJNP 1GL2D 1RH5B 1SLQA 2ITAA 1EZVE 2YKPA 3L73D 3RL0D 1M1KQ 1KYOH 3TF5A 2A45H 4D6TJ 1KQLA 2W6JH 1OVUA 1QLED 3IF4A 5AVWB 3AEFC 4GIFA 1PP9G 2LR2A 1NTKJ 2Q3EA 1YJ9P 1YHQP 1ZP0C 2KYVA 3AE3C 1FDIA 2DW3A 2V7QH 3AE1C 1FAVA 4U3FD 3ZDMA 5KLVJ 1FOSE 1AVYA 1HJ0A 2J58A 2AXCA 1T2KD 2I8DA 5AVQB 4GOEA 1J1DC 1SFCC 3IAOA 4W80A 1VQ5P 1L0LD 1FS0E 1NTMD 2POHA 4H44D 2QJYB 2KS1B 1SQPD 4H0LC 4I7ZB 3H1LG 3S9OA 2ZJSE 2WITA 3CX5H 3BCCG 5AW0B 3L75E 2I1JA 2R5BA 2JWAA 1J1EC 3GF7A 3M0DC 1S1CX 2Q9IA 3M0AA 4GOFA 3RBXA 2Q3IA 5CBNA 2N1TA 1H8AA 4ZNCA 3H1HJ 3L75J 2QA4P 1N8RQ 3I55P 2G8YA 2Z5HA 3PP5A 1EDIA 1PGPA 4H44C 4ASVA 1KILB 5GTIE 3Q2YA 1KMIZ 1RF1A 1AJYA 4H13C 2KLVA 3GMAA 2C9LY 1WRGA 4IL6X 2FYUK 3CWBD 1GTWA 5KLIB 1W5CE 5AW4B 1EZVG 4WBAA 2WSFH 3HE4B 2FFDC 1H88A 3F89A 1JOCA 1IJDB 4N6JA 2AEJA 2QJPC 3H1IJ 3LIEA 3KPEA 4GODA 4KHXA 2AXTE 2Y9YA 1LTGC 3MIWA 1PP9E 1LP1B 1VDFA 2RKLA 3WMM0 1K8AQ 1OWAA 2B88A 4ASWA 2W6BA 1E5WA 2OYHB 1DD3A 4O9BA 1JY3P 2G3AA 1Q82Q 3AE4C 3L35A 3V6IA 1AQTA 3A7OA 1VF5C 2QM8A 3TYYA 4DZOA 5BU8B 1KB9E 5AW2B 1CZQA 2KIKA 2P58A 1KC8Q 1SQVG 4EIJA 1BSHA 3HRNA 1CI6A 1KFNA 2JDIH 3EFFK 2FYUJ 5GTIH 2MJZA 2KLUA 3HD7C 1R5SA 3GW6A 1LTJA 2O3JA 1S9KE 4WY4A 5CCHD 1G2CA 1NAYA 3HUSC 1P84H 1NTKD 1MV8A 4BRYA 1LNQA 1OZHA 2B87A 1BGYD 2P10A 1KB9H 2IBZI 2QIWA 3M0DA 4IL6E 1T2KC 4NPDA 1K73Q 1ZXGA 1N7SA 3P32A 4N78E 1BDCA 1OW6A 1NWQA 3RK3D 1L0NG 3RL0C 3U1AA 1SS1A 2OTKE 3H1JJ 2WZ7A 5KAFH 1YBKA 2ZT9D 3A0BE 5CCGA 4IFDK 2WMMA 4B86A 2LKMA 3AEGC 1X8YA 1FZAA 2Q5UA 3GHGB 3A0HE 3V2RA 4C7RA 2YO2A 1PFIA 2W6AA 1G1JA 1P84D 5KLVD 4I1LA 1ZMEC 2IX7C 2PGDA 3H1HG 1EXJA 1NYHA 4L75A 3A5TA 2XNDH 5CMZA 2IBZD 1S72P 1VQKP 1K04A 3H1LE 2HR3A 2W8ZA 1FOSF 1H0TA 1M57D 2RMZA 4W7YA 5H2FE 2FXOA 1VQ4P 3CXHI 1LT9C 1M1JB 2Y9ZA 2YKOA 2ZYDA 1BCCE 2M0BA 1JY3N 3M06A 2HODA 2L5GB 1OVVA 2FXPA 3L72D 1VQPP 1QGKB 2QJYC 5L8RJ 5GTHE 1SQVD 3W67A 1EZVI 1YTZT 5AW6B 3HTKB 4U7JA 3Q5PA 2A06D 1GZLA 5APYA 5KTBA 1N2DC 1NTZK 2N9BA 2WTYA 3WUUA 2QG4A 2IZ1A 2PRRA 1VQMP 3EFGA 3P7KA 1Q81Q 1YITP 2H7HA 2ZYGA 1SQXJ 2KNCA 1MFZA 4R4LA 3V2NA 1IFNA 3VOPA 1LWUA 1VQNP 2KZJA 1M7LA 2KB7P 3L74G 4OGQB 4PV1B 3V5BA 3OW2O 2NPSA 2Y0CA 1VQLP 1YQ3C 1EDKA 1EC5A 1BE3E 3CL3D 3TNUA 1L4AC 3ITKA 5CCHA 1A02J 3TGUE 3H1IE 2OYOA 3N7NA 1FZCB 2N9YB 3R4YA 3H32B 4ZKPA 1LTTC 2WSEH 1LWUC 4H0LB 2JJLA 4I7ZC 2E42A 3L70D 1IZNB 1FZGA 3FWLA 4D6TE 2OQQA 1VL2A 4PJ0H 1AA0A 1FZBA 2NPSC 4GDOA 1HF9A 4Y28J 1RY3A 2GA1A 4JBZA 3VP9A 1L0NE 2QEXP 1SQXD 1PIXA 3LW5H 5APSA 3A3YB 4C46A 1JY2N 3PLNA 1Z56A 2BEZF 3OJAB 3E7KA 2QRXA 3GF3A 3P8MC 4IOIH 1LGHB 1S2EA 4JPZB 3F5HA 1GK4A 4RJTA 3BCCE 3G3ZA 5APXA 3MZWB 1KYOD 4HJGH 2AXTH 3C8VA 1RF0C 4NPEA 3T97B 4EDFA 4PV1D 3LIDA 1N73C 2IFMA 1DEEG 2Q7CA 1K05A 3O6QA 4DT0A 2OYIA 3H1JG 1Y9BA 1KILE 2JKVA 2LXBA 4AUWA 1VPCA 1RF0A 2E74C 4A7PA 3G9RA 1SQBE 2KSJA 3GHGC 3FXDA 3I5CA 3MGNA 1QL2A 4Y99B 3RK2D 1N86A 1URQC 2NPSD 2QJPB 2C0XA 3PTZA 3U59A 1PL5A 1HVVA 1X79B 2K3RA 3NTNA 3CWBG 3IFMA 4I2LC 3V4WA 1CW5A 3D71A 3VMYA 3E1IA 2BCCG 3IR9A 5KKZB 2ZAEB 2FFDA 1FBMA 4L73A 1JY2P 1HJBA 2HPCA 3RBZA 1VF5B 2BASA 2FYUD 2JR8A 3GLMA 3L74J 2YXQB 1JTHB 1KQGB 2W83C 1NTZG 2FYNC 2YMKA 4WY4D 3MD0A 3CCRP 2H88C 1SQQE 1IK7A 1HGVA 1NU1E 1GL2B 1RQVA 3BRVB 2O01J 1YQ4C 3H1HD 4UB8H 3AE2C 2OGUA 1ZRTD 2K88A 3EWKA 2BCCD 5KLVG 3SWYA 2JWDA 3L74D 1NTMJ 2N1TC 1NTZD 1PPJE 2Q1KA 3A0HH 3CXHE 5E79H 2AEMA 3C1LA 3H1KJ 2R44A 4MN4C 3CCSP 4YTPC 1LTJB 2PAJA 3HD7A 4UB6E 1H89A 1YYCA 2YNYA 1NAFA 3JCUE 2QJKB 4Z1MH 3KYQA 2Z5IA 5M1BA 1ZOYC 1MUUA 3L72J 4WWIA 5KAIH 3H1KE 2BEQD 3TGUD 1XTGB 2CPBA 1RE4C 1U7MA 2K37A 2O01N 1IFJA 5CCGC 2Y0DA 1U57A 2ZVNB 4AQRD 4C7NA 2P2UA 3L71G 4EYYQ 3CC2P 2OYIC 2A45G 3KXDA 2QSIA 3VMAA 3AEDC 3IN6A 3JC22 1SQXG 3H1JD 1OIPA 5B66H 2O1KA 2ZXXA 2KI7B 1M1JC 2K1AA 1RQUA 3P8CD 1USEA 2JEEA 3PHLA 1G1IA 5TJHA 1KYOI 1GU5A 1JY3O 1SQPE 2M8RA 3L70G 3NXSA 3QWOC 1NJIQ 1VQ6P 4GT1A 4KJMA 5AVSB 1DD4A 3AEBC 1YTZI 4M3LA 1RE4A 2XV5A 1JB0J 2WWWA 3SFEC 3CPWO 4L74A 1BGYJ 2KP8A 1ZN5A 1SQPJ 3N4XA 1OFCX 1H0TB 3KZIE 3L4FA 1L0LK 2KK7A 4DOJA 2E76D 2JP3A 2QJKC 4PD4H 3S1KA 1Q86Q 2NRGA 3E1RA 2HLOA 1T8ZA 2O01H 1QX8A 4NPFX 2R32A 1W2EA 3HUSA 2WSSH 1SVFA 5AVZB
chains in the Genus database with same CATH topology
1IC2A 1NKNA 2R5DA 3V4QA 5CJ0A 2HG5D 3B5NA 4HYTB 1RE3A 1T3UA 1NU1K 5AVUB 1IFMA 3A2AA 1FZCC 2C0WA 1HGZA 2WPSA 2N1TB 2P7JA 2H8PD 1HTLC 3RK3B 1RF1B 1T3JA 5AW3B 3OAKA 3CI9A 1L0NK 4WY4C 1FJKA 4ZKUA 2J59M 1JCCA 1JY2O 3HE5A 1S9KD 3B5ND 3M9QA 1ZLLA 1LT9B 3M9BA 1HBWA 4N78D 1HWTC 1GW4A 1LTSC 3HD7D 3MTUE 2GUVA 3RL0B 3TK1A 1CI6B 2WT7B 1DH3A 2CPSA 3CLQA 1KILA 1SQXK 2Z4EA 1NH4A 4WY4B 1G2CB 4HH2A 1DX7A 1SFCA 1N7SB 2XKMA 1FDMA 5KLVK 3V2PA 5CCGD 1L4AB 1GL2C 1DEBA 1URQA 3BASA 5AW7B 2OYHA 5BU5A 3UIAA 5KJ7A 2O1JA 2XU6A 3KDPB 2HPCB 4LGDE 4LLHA 4XE5B 1NOHA 1WT6A 1J2JB 5KJ7C 1GL2A 1SP4A 5CHXA 4JYBA 3H6PA 3HTKA 3L36A 1N73B 1AFOA 2XDJA 1GK6A 3GHGA 3RK2C 1KILC 1AQ5A 4IFFA 5AVVB 1IFDA 1N7LA 1LWUB 2GM4A 4Y99C 1HUCA 2WSCH 2ZXEB 3SWFA 2NPSB 3II6A 4W7ZA 1IFIA 1M1JA 2VRSA 3C9IA 5AVTB 3TNUB 1ZR4A 2WPRA 2YO3A 3H32A 2QM7A 1HH0A 3U1CA 3EQ2A 1FZEA 5APVA 1KZUB 3M9HA 5APWA 3M91A 1MZ9A 1XTCC 3V2QA 3BATA 3VMZA 1J1DB 1EQ7A 1URQD 2W27A 5APQA 1NKZB 3HUSB 5AVRB 4JYCA 5AVYB 1LTJC 1RF1C 2PP6A 3B5NB 3VTPC 2KOGA 2C9NY 5BVZA 4XA4A 1FZCA 3HE4A 2OYIB 1FJPA 4AYCA 5AW9B 1GU4A 5CJ4A 1LTAC 3BVHA 3O8ZA 1CSBA 4RESB 4JF7A 3VN0A 2FKWB 2FFDB 3HE5B 2M3BA 3MUDA 2N1TD 1LT9A 1JTHA 1RE3C 2I1KA 1L4AD 1LTBC 4I6MC 5KJ7D 3T97A 2GUSA 3VYIA 2YKQA 5APUA 1OXZA 2WPQA 4GKGA 2A45I 3VP8A 2IPPA 1J1EB 1N7SD 3R2PA 2P67A 2P1JA 3B8EB 3P8CE 1N7SC 2WT7A 1JNMA 3VMXA 3KQGA 1FU1A 3HD7B 4EOTA 2ZFCA 1GW3A 1SQVK 1SFCB 2HYNA 2OARA 1IK9A 1SFCD 1JO5A 1NO4A 5AVXB 4C7NB 5AW1B 1JMMA 1SQQK 3B5NC 2FYZA 1L4AA 4IFMA 5CCHC 1KILD 1URQB 4WB4A 2HODB 3TSIA 3OA7A 2R3CA 1JCDA 2IFNA 5AW8B 1ZV8A 1GD2E 1SQBK 2HFED 2XZRA 3RK2B 4OH8B 2H43A 1GDTA 5AW5B 2FXMA 2YMYA 1SQPK 3L37A 4N3YB 1A02F 1NTKK 3RK3C 1NHLA 1JUNA 3NMDA 1KFMA 5APTA 1QL1A 1X9VA 1LTIC 4LC1A 1N73A 2XNXA 3BRTB 1NTMK 3NFQA 2OYHC 1IO4A 1GL2D 1SLQA 2YKPA 3RL0D 2A45H 1KQLA 5AVWB 4GIFA 2KYVA 1FAVA 1FOSE 2J58A 1T2KD 5AVQB 1J1DC 1SFCC 4W80A 2POHA 2WITA 5AW0B 2I1JA 2R5BA 3M0DC 1J1EC 2Q9IA 3M0AA 2Q3IA 2N1TA 1H8AA 2Z5HA 3PP5A 1RF1A 1KILB 2KLVA 2C9LY 1WRGA 2FYUK 1GTWA 5AW4B 4WBAA 2WSFH 3HE4B 2FFDC 1H88A 1JOCA 1IJDB 4N6JA 3LIEA 3KPEA 4KHXA 3MIWA 1LTGC 1VDFA 3WMM0 1OWAA 2W6BA 1E5WA 2OYHB 4O9BA 1JY3P 3L35A 3TYYA 3A7OA 5BU8B 2QM8A 4DZOA 5AW2B 1CZQA 4EIJA 3HRNA 1CI6A 1KFNA 2MJZA 3HD7C 1S9KE 1LTJA 4WY4A 5CCHD 1G2CA 3HUSC 1MV8A 3M0DA 1T2KC 4N78E 1N7SA 3P32A 1NWQA 3RK3D 3RL0C 3U1AA 2WZ7A 5CCGA 4IFDK 4B86A 2LKMA 1X8YA 1FZAA 3GHGB 2Q5UA 4C7RA 1PFIA 2YO2A 2W6AA 1G1JA 4I1LA 2IX7C 3A5TA 5CMZA 1FOSF 4W7YA 1LT9C 1M1JB 2YKOA 1JY3N 3M06A 2HODA 2L5GB 1YTZT 5AW6B 3HTKB 5APYA 1GZLA 5KTBA 1N2DC 1NTZK 2N9BA 2WTYA 3EFGA 3P7KA 2H7HA 1MFZA 3V2NA 1IFNA 3VOPA 1LWUA 1M7LA 2KB7P 3V5BA 2NPSA 3CL3D 3TNUA 1L4AC 5CCHA 1A02J 3N7NA 1FZCB 3H32B 4ZKPA 1LTTC 2WSEH 1LWUC 2JJLA 2E42A 1FZGA 1FZBA 2NPSC 1RY3A 3VP9A 3LW5H 5APSA 3A3YB 4C46A 1JY2N 1Z56A 3OJAB 3P8MC 1LGHB 1GK4A 3G3ZA 5APXA 1RF0C 3LIDA 1N73C 2IFMA 2Q7CA 2OYIA 4AUWA 1VPCA 1RF0A 3GHGC 2KSJA 3V2RA 3RK2D 3MGNA 3I5CA 1QL2A 4Y99B 1FZFA 1N86A 1URQC 2NPSD 2C0XA 3U59A 4I2LC 1HVVA 1X79B 3NTNA 3V4WA 3IFMA 1CW5A 3VMYA 3E1IA 3IR9A 2FFDA 1FBMA 1JY2P 1HJBA 2HPCA 2BASA 1ZR2A 1JTHB 2E43A 4WY4D 3MD0A 3BRVB 1HGVA 1GL2B 3SWYA 2N1TC 1LTJB 2PAJA 3HD7A 1H89A 1YYCA 2YNYA 1NAFA 3KYQA 2Z5IA 1MUUA 1XTGB 2CPBA 1RE4C 1IFJA 5CCGC 4AQRD 4C7NA 2P2UA 2OYIC 2A45G 2O1KA 1M1JC 3P8CD 2JEEA 1G1IA 1GU5A 3NXSA 1JY3O 2M8RA 4GT1A 5AVSB 4M3LA 1YTZI 1RE4A 2XV5A 2WWWA 2KP8A 1ZN5A 3N4XA 3L4FA 1L0LK 4DOJA 2HLOA 1T8ZA 2O01H 2R32A 1W2EA 3HUSA 1SVFA 5AVZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MZ9 A;  1FBM A;  1DEB A;  3V2Q A;  3V2P A;  3V2R A;  3V2N A;  1VDF A; 
#chains in the Genus database with same CATH topology
 5EFW B;  1IC2 A;  1NKN A;  2R5D A;  3V4Q A;  5CJ0 A;  2E5T A;  2HG5 D;  2KSE A;  1QVG O;  1L2P A;  3CWB E;  2KS1 A;  4H44 B;  3B5N A;  4HYT B;  2CK3 H;  4XFJ A;  3WUT A;  2H89 C;  1IFP A;  1RE3 A;  1NU1 K;  1T3U A;  5AVU B;  1E79 H;  1Y8A A;  1IFM A;  5TIS H;  1ZW0 A;  3A2A A;  4PV1 C;  1KV4 A;  4JQ0 D;  4PD4 D;  2ZVO B;  1OVR A;  1FZC C;  2A06 G;  2C0W A;  1HGZ A;  2KNC B;  1PP9 D;  2WPS A;  2N1T B;  1W2B O;  2P7J A;  2H8P D;  1HTL C;  3RK3 B;  3L71 D;  2E75 B;  3CCE P;  2OTL P;  5TIS E;  3CX5 E;  3FX0 A;  1RF1 B;  1T3J A;  4DJG A;  5AW3 B;  3OAK A;  2E76 C;  1KB9 D;  3CI9 A;  1L0N K;  4WY4 C;  5KKZ C;  1PV3 A;  4HB1 A;  3Q1M A;  3AEE C;  3ABV C;  3FWN A;  1FJK A;  1WMK A;  4TT3 H;  4BWN A;  4ZKU A;  2J59 M;  1JCC A;  1JY2 O;  3HE5 A;  4DCK A;  3G4S P;  1S9K D;  1KN7 A;  3B5N D;  1PGQ A;  1SQQ J;  1K9M Q;  4QMA A;  3M9Q A;  1ZLL A;  1EZV D;  5B5E E;  1LT9 B;  2BCC J;  3L73 E;  1BGY E;  3G6E P;  1ZR2 A;  3M9B A;  1HBW A;  1BDD A;  4N78 D;  3SWK A;  2W90 A;  1BSN A;  4YXW H;  3RK3 E;  1NGM B;  2RN0 A;  3PH0 A;  1HWT C;  1GW4 A;  1LTS C;  3HD7 D;  3MTU E;  2WSE J;  5KAF E;  4OWF A;  1VQ8 P;  2B89 A;  1L0L J;  2E5Y A;  2GUV A;  4U3F E;  3RL0 B;  5K5G B;  3CC7 P;  3TK1 A;  3CCV P;  1CI6 B;  2RH0 A;  3CD6 P;  2WT7 B;  1DH3 A;  1BGY G;  2CPS A;  3CLQ A;  1GMJ A;  1SQX K;  1U7J A;  1KIL A;  1KQF B;  5B66 E;  1P84 I;  2Z4E A;  1KTM A;  1L0L E;  1NH4 A;  1G2C B;  1S5L E;  2D2C B;  4U3F J;  1NTM E;  4HH2 A;  3BCC J;  4WY4 B;  2B87 B;  2PFX A;  3B4S A;  3H1L D;  1DIP A;  1DX7 A;  1SFC A;  1EDL A;  4K3A A;  1N7S B;  2XKM A;  1PZQ A;  3L75 D;  3TDK A;  1FDM A;  1M90 Q;  4K35 A;  5KLV K;  3AE6 C;  3CX5 I;  3JCU H;  1KD1 Q;  2K9J B;  3V2P A;  3TGU G;  1BCC D;  3RL0 g;  3L71 J;  3L72 E;  1L4A B;  1GL2 C;  1L0L G;  5CCG D;  1DEB A;  1URQ A;  2IYO A;  2WSF J;  3BAS A;  5AW7 B;  3AE8 C;  2OYH A;  1SQV E;  2KUB A;  5BU5 A;  3UIA A;  5KJ7 A;  1FZF A;  1QVF O;  2O1J A;  3B71 A;  2XU6 A;  3AEA C;  5DJU B;  1NTZ J;  3KDP B;  2HPC B;  4LGD E;  4LLH A;  4H0L D;  4XE5 B;  3CCL P;  2QE7 H;  1AVO A;  1NOH A;  1WT6 A;  1J2J B;  1NU1 G;  5KJ7 C;  1GL2 A;  1M56 D;  1SP4 A;  5CHX A;  3WU2 E;  1PGO A;  4JYB A;  2QVA A;  2E43 A;  1VQ9 P;  2M5A A;  3CCM P;  4BXL A;  3H6P A;  2FYU G;  4PD4 I;  2WPV B;  3HTK A;  5KAI E;  3L36 A;  1N73 B;  3H1I D;  4RKU J;  4RO0 A;  3CCQ P;  1AFO A;  2KZI A;  2XDJ A;  1GK6 A;  3GHG A;  3RK2 C;  1D7M A;  1KIL C;  3SSU A;  3H1L J;  1AQ5 A;  4TLF A;  4IFF A;  3CWB J;  2E75 C;  1IFD A;  5AVV B;  4D6T D;  1EDJ A;  1USD A;  1N7L A;  1LWU B;  3K5B A;  4Y99 C;  1NTK E;  1YJW P;  2GM4 A;  1L0N D;  2E74 D;  1BCC J;  1SQX E;  1HUC A;  2L91 A;  2WSC H;  2ZXE B;  3SWF A;  2NPS B;  3FGA D;  3KHU A;  3II6 A;  4W7Z A;  3S4R A;  2FY8 A;  2YIU C;  5KLV E;  4U3F G;  1IFI A;  1M1J A;  1PGJ A;  2VRS A;  1NTK G;  3C9I A;  5AVT B;  3TNU B;  3USS A;  1ZR4 A;  3MUD C;  3CMA P;  2J5U A;  2WPR A;  2YO3 A;  3BCC D;  2AEF A;  3H1I G;  4IL6 H;  3H32 A;  2QM7 A;  1HH0 A;  3U1C A;  1NTM G;  1R5L A;  1P84 E;  1SQB J;  3EQ2 A;  1FZE A;  5APV A;  1KZU B;  1JMB A;  3M9H A;  5APW A;  3TGU J;  1KQS O;  1JM0 A;  2ZT9 B;  3LW5 J;  1MZ9 A;  3M91 A;  1XTC C;  3V2Q A;  3BAT A;  2IBZ E;  3VMZ A;  1J1D B;  1EQ7 A;  1URQ D;  1AV1 A;  2NZ2 A;  1UII A;  2V4H A;  2UWJ E;  1M8O B;  2W27 A;  1NKZ B;  1S5L X;  1SQB D;  3HUS B;  5APQ A;  5AVR B;  4JYC A;  1FDO A;  1KOR A;  1RHZ B;  1X0T A;  1BE3 J;  4L76 A;  5AVY B;  1LTJ C;  2IBZ G;  2PP6 A;  2YXR B;  4UB6 H;  1RF1 C;  3B5N B;  2WQY C;  1FE6 A;  2KOG A;  4KT0 J;  3VTP C;  1EXI A;  2C9N Y;  2YIU B;  3KZI H;  2E74 B;  1JEK A;  5BVZ A;  1T6A A;  2A06 E;  2E76 B;  4XA4 A;  1QEX A;  1SQP G;  3HE4 A;  3W68 A;  1FZC A;  3O6Q B;  2OYI B;  3WUV A;  1FJP A;  1NU1 D;  1PP9 J;  3FXE A;  4UB8 E;  3CCJ P;  3QH9 A;  1MFT A;  1S5L H;  4AYC A;  1S4X A;  3Q5S A;  3CC4 P;  4D6T G;  3D6Y A;  2MKV A;  1LP1 A;  5AW9 B;  1GU4 A;  1PPJ D;  4EI2 A;  5CJ4 A;  4OVN F;  1LTA C;  2KXP B;  3CXH D;  3O8Z A;  3BVH A;  1CSB A;  4RES B;  4JF7 A;  2R3S A;  5GTH H;  5KLI C;  2K9Y A;  3VN0 A;  3AE9 C;  1Q7Y Q;  2FKW B;  3MHV A;  1Y47 A;  2WSC J;  1BE3 D;  3HE5 B;  2FFD B;  2M3B A;  3MUD A;  2WVR A;  3L73 G;  2FBW C;  2N1T D;  1Q90 D;  1LT9 A;  1JTH A;  1RE3 C;  2I1K A;  2IZ0 A;  3H1K D;  4WVZ A;  1SQV J;  1YIJ P;  1L4A D;  1LTB C;  3L72 G;  4I6M C;  5KJ7 D;  2GUS A;  3T97 A;  2YKQ A;  5APU A;  3VYI A;  5B5E H;  1OXZ A;  1UIX A;  4BRY B;  1MKM A;  5E79 E;  2WPQ A;  3L70 E;  3CXH H;  4GKG A;  2A45 I;  3VP8 A;  2D2C C;  2IPP A;  1J1E B;  1N7S D;  3H1J E;  3R2P A;  2P67 A;  1NU1 J;  2P1J A;  3B8E B;  3P8C E;  5C39 A;  1S3J A;  4OGQ D;  1OW8 A;  1N7S C;  1SQB G;  3L70 J;  2IDB A;  2WT7 A;  3I56 P;  4ZMD A;  1JNM A;  3VMX A;  3KQG A;  1FU1 A;  3HD7 B;  4OGQ C;  3JSV C;  4EOT A;  3Q5R A;  2ZFC A;  4CPG A;  5CBO A;  1VQO P;  1FC2 C;  1GW3 A;  1SQV K;  1YI2 P;  1KYO E;  1SFC B;  2HYN A;  1IK9 A;  2OAR A;  1SFC D;  1OMI A;  3AEC C;  1NO4 A;  1VF5 D;  5AVX B;  3PJS K;  3WU2 H;  1BE3 G;  4C7N B;  1JO5 A;  5AW1 B;  3H1K G;  2K9J A;  3H25 A;  1JMM A;  1SQQ K;  2LXC B;  3GG2 A;  2Q6Q A;  3B5N C;  1SQQ G;  1L4A A;  1OW7 A;  1X22 A;  2FYZ A;  4IFM A;  5CCH C;  1KIL D;  1URQ B;  1PPJ G;  5H2F H;  4WB4 A;  2B9B A;  3RGU A;  3CCU P;  1NVO A;  2V7Q J;  1BCC G;  2D2C D;  1LJ2 A;  2HOD B;  3TSI A;  3OA7 A;  3D6Z A;  2R3C A;  3Q3D A;  1R8E A;  1JCD A;  2M3E A;  2IFN A;  4R4M A;  2E75 D;  3G71 P;  2OTJ P;  2FYN B;  3L75 G;  5AW8 B;  1ZV8 A;  2ZT9 C;  4PD4 E;  1TU3 F;  1Q2N A;  1GD2 E;  1VQ7 P;  2ZYA A;  4H13 B;  3MP7 B;  1SQB K;  2HFE D;  4H13 D;  2XZR A;  3RK2 B;  4OH8 B;  2H43 A;  3AE7 C;  1GDT A;  5DJT B;  3A0B H;  3CME P;  2FYU E;  2JO1 A;  2SPZ A;  3L71 E;  5AW5 B;  3SFD C;  3D70 A;  2FXM A;  2YMY A;  1SQP K;  2IYP A;  1LT1 A;  2Y0E A;  1SQQ D;  3CX5 D;  2M5A B;  3H1H E;  3L37 A;  4N3Y B;  1A02 F;  1NTK K;  3RK3 C;  1NHL A;  1JUN A;  4HKZ H;  1ZRT E;  3NMD A;  1KFM A;  2BCC E;  3L73 J;  1X9V A;  1QL1 A;  1OX3 A;  3L74 E;  5APT A;  1L0N J;  1LTI C;  3PRJ A;  4LC1 A;  4PJ0 E;  4YPC A;  1NTZ E;  1N73 A;  3AE5 C;  2XNX A;  3BRT B;  1NTM K;  3NFQ A;  4YXD C;  2OYH C;  1IO4 A;  1KB9 I;  1YJN P;  1GL2 D;  1RH5 B;  1SLQ A;  2ITA A;  1EZV E;  2YKP A;  3L73 D;  3RL0 D;  1M1K Q;  1KYO H;  3TF5 A;  2A45 H;  4D6T J;  1KQL A;  2W6J H;  1OVU A;  1QLE D;  3IF4 A;  5AVW B;  3AEF C;  4GIF A;  1PP9 G;  2LR2 A;  1NTK J;  2Q3E A;  1YJ9 P;  1YHQ P;  1ZP0 C;  2KYV A;  3AE3 C;  1FDI A;  2DW3 A;  2V7Q H;  3AE1 C;  1FAV A;  4U3F D;  3ZDM A;  5KLV J;  1FOS E;  1AVY A;  1HJ0 A;  2J58 A;  2AXC A;  1T2K D;  2I8D A;  5AVQ B;  4GOE A;  1J1D C;  1SFC C;  3IAO A;  4W80 A;  1VQ5 P;  1L0L D;  1FS0 E;  1NTM D;  2POH A;  4H44 D;  2QJY B;  2KS1 B;  1SQP D;  4H0L C;  4I7Z B;  3H1L G;  3S9O A;  2ZJS E;  2WIT A;  3CX5 H;  3BCC G;  5AW0 B;  3L75 E;  2I1J A;  2R5B A;  2JWA A;  1J1E C;  3GF7 A;  3M0D C;  1S1C X;  2Q9I A;  3M0A A;  4GOF A;  3RBX A;  2Q3I A;  5CBN A;  2N1T A;  1H8A A;  4ZNC A;  3H1H J;  3L75 J;  2QA4 P;  1N8R Q;  3I55 P;  2G8Y A;  2Z5H A;  3PP5 A;  1EDI A;  1PGP A;  4H44 C;  4ASV A;  1KIL B;  5GTI E;  3Q2Y A;  1KMI Z;  1RF1 A;  1AJY A;  4H13 C;  2KLV A;  3GMA A;  2C9L Y;  1WRG A;  4IL6 X;  2FYU K;  3CWB D;  1GTW A;  5KLI B;  1W5C E;  5AW4 B;  1EZV G;  4WBA A;  2WSF H;  3HE4 B;  2FFD C;  1H88 A;  3F89 A;  1JOC A;  1IJD B;  4N6J A;  2AEJ A;  2QJP C;  3H1I J;  3LIE A;  3KPE A;  4GOD A;  4KHX A;  2AXT E;  2Y9Y A;  1LTG C;  3MIW A;  1PP9 E;  1LP1 B;  1VDF A;  2RKL A;  3WMM 0;  1K8A Q;  1OWA A;  2B88 A;  4ASW A;  2W6B A;  1E5W A;  2OYH B;  1DD3 A;  4O9B A;  1JY3 P;  2G3A A;  1Q82 Q;  3AE4 C;  3L35 A;  3V6I A;  1AQT A;  3A7O A;  1VF5 C;  2QM8 A;  3TYY A;  4DZO A;  5BU8 B;  1KB9 E;  5AW2 B;  1CZQ A;  2KIK A;  2P58 A;  1KC8 Q;  1SQV G;  4EIJ A;  1BSH A;  3HRN A;  1CI6 A;  1KFN A;  2JDI H;  3EFF K;  2FYU J;  5GTI H;  2MJZ A;  2KLU A;  3HD7 C;  1R5S A;  3GW6 A;  1LTJ A;  2O3J A;  1S9K E;  4WY4 A;  5CCH D;  1G2C A;  1NAY A;  3HUS C;  1P84 H;  1NTK D;  1MV8 A;  4BRY A;  1LNQ A;  1OZH A;  2B87 A;  1BGY D;  2P10 A;  1KB9 H;  2IBZ I;  2QIW A;  3M0D A;  4IL6 E;  1T2K C;  4NPD A;  1K73 Q;  1ZXG A;  1N7S A;  3P32 A;  4N78 E;  1BDC A;  1OW6 A;  1NWQ A;  3RK3 D;  1L0N G;  3RL0 C;  3U1A A;  1SS1 A;  2OTK E;  3H1J J;  2WZ7 A;  5KAF H;  1YBK A;  2ZT9 D;  3A0B E;  5CCG A;  4IFD K;  2WMM A;  4B86 A;  2LKM A;  3AEG C;  1X8Y A;  1FZA A;  2Q5U A;  3GHG B;  3A0H E;  3V2R A;  4C7R A;  2YO2 A;  1PFI A;  2W6A A;  1G1J A;  1P84 D;  5KLV D;  4I1L A;  1ZME C;  2IX7 C;  2PGD A;  3H1H G;  1EXJ A;  1NYH A;  4L75 A;  3A5T A;  2XND H;  5CMZ A;  2IBZ D;  1S72 P;  1VQK P;  1K04 A;  3H1L E;  2HR3 A;  2W8Z A;  1FOS F;  1H0T A;  1M57 D;  2RMZ A;  4W7Y A;  5H2F E;  2FXO A;  1VQ4 P;  3CXH I;  1LT9 C;  1M1J B;  2Y9Z A;  2YKO A;  2ZYD A;  1BCC E;  2M0B A;  1JY3 N;  3M06 A;  2HOD A;  2L5G B;  1OVV A;  2FXP A;  3L72 D;  1VQP P;  1QGK B;  2QJY C;  5L8R J;  5GTH E;  1SQV D;  3W67 A;  1EZV I;  1YTZ T;  5AW6 B;  3HTK B;  4U7J A;  3Q5P A;  2A06 D;  1GZL A;  5APY A;  5KTB A;  1N2D C;  1NTZ K;  2N9B A;  2WTY A;  3WUU A;  2QG4 A;  2IZ1 A;  2PRR A;  1VQM P;  3EFG A;  3P7K A;  1Q81 Q;  1YIT P;  2H7H A;  2ZYG A;  1SQX J;  2KNC A;  1MFZ A;  4R4L A;  3V2N A;  1IFN A;  3VOP A;  1LWU A;  1VQN P;  2KZJ A;  1M7L A;  2KB7 P;  3L74 G;  4OGQ B;  4PV1 B;  3V5B A;  3OW2 O;  2NPS A;  2Y0C A;  1VQL P;  1YQ3 C;  1EDK A;  1EC5 A;  1BE3 E;  3CL3 D;  3TNU A;  1L4A C;  3ITK A;  5CCH A;  1A02 J;  3TGU E;  3H1I E;  2OYO A;  3N7N A;  1FZC B;  2N9Y B;  3R4Y A;  3H32 B;  4ZKP A;  1LTT C;  2WSE H;  1LWU C;  4H0L B;  2JJL A;  4I7Z C;  2E42 A;  3L70 D;  1IZN B;  1FZG A;  3FWL A;  4D6T E;  2OQQ A;  1VL2 A;  4PJ0 H;  1AA0 A;  1FZB A;  2NPS C;  4GDO A;  1HF9 A;  4Y28 J;  1RY3 A;  2GA1 A;  4JBZ A;  3VP9 A;  1L0N E;  2QEX P;  1SQX D;  1PIX A;  3LW5 H;  5APS A;  3A3Y B;  4C46 A;  1JY2 N;  3PLN A;  1Z56 A;  2BEZ F;  3OJA B;  3E7K A;  2QRX A;  3GF3 A;  3P8M C;  4IOI H;  1LGH B;  1S2E A;  4JPZ B;  3F5H A;  1GK4 A;  4RJT A;  3BCC E;  3G3Z A;  5APX A;  3MZW B;  1KYO D;  4HJG H;  2AXT H;  3C8V A;  1RF0 C;  4NPE A;  3T97 B;  4EDF A;  4PV1 D;  3LID A;  1N73 C;  2IFM A;  1DEE G;  2Q7C A;  1K05 A;  3O6Q A;  4DT0 A;  2OYI A;  3H1J G;  1Y9B A;  1KIL E;  2JKV A;  2LXB A;  4AUW A;  1VPC A;  1RF0 A;  2E74 C;  4A7P A;  3G9R A;  1SQB E;  2KSJ A;  3GHG C;  3FXD A;  3I5C A;  3MGN A;  1QL2 A;  4Y99 B;  3RK2 D;  1N86 A;  1URQ C;  2NPS D;  2QJP B;  2C0X A;  3PTZ A;  3U59 A;  1PL5 A;  1HVV A;  1X79 B;  2K3R A;  3NTN A;  3CWB G;  3IFM A;  4I2L C;  3V4W A;  1CW5 A;  3D71 A;  3VMY A;  3E1I A;  2BCC G;  3IR9 A;  5KKZ B;  2ZAE B;  2FFD A;  1FBM A;  4L73 A;  1JY2 P;  1HJB A;  2HPC A;  3RBZ A;  1VF5 B;  2BAS A;  2FYU D;  2JR8 A;  3GLM A;  3L74 J;  2YXQ B;  1JTH B;  1KQG B;  2W83 C;  1NTZ G;  2FYN C;  2YMK A;  4WY4 D;  3MD0 A;  3CCR P;  2H88 C;  1SQQ E;  1IK7 A;  1HGV A;  1NU1 E;  1GL2 B;  1RQV A;  3BRV B;  2O01 J;  1YQ4 C;  3H1H D;  4UB8 H;  3AE2 C;  2OGU A;  1ZRT D;  2K88 A;  3EWK A;  2BCC D;  5KLV G;  3SWY A;  2JWD A;  3L74 D;  1NTM J;  2N1T C;  1NTZ D;  1PPJ E;  2Q1K A;  3A0H H;  3CXH E;  5E79 H;  2AEM A;  3C1L A;  3H1K J;  2R44 A;  4MN4 C;  3CCS P;  4YTP C;  1LTJ B;  2PAJ A;  3HD7 A;  4UB6 E;  1H89 A;  1YYC A;  2YNY A;  1NAF A;  3JCU E;  2QJK B;  4Z1M H;  3KYQ A;  2Z5I A;  5M1B A;  1ZOY C;  1MUU A;  3L72 J;  4WWI A;  5KAI H;  3H1K E;  2BEQ D;  3TGU D;  1XTG B;  2CPB A;  1RE4 C;  1U7M A;  2K37 A;  2O01 N;  1IFJ A;  5CCG C;  2Y0D A;  1U57 A;  2ZVN B;  4AQR D;  4C7N A;  2P2U A;  3L71 G;  4EYY Q;  3CC2 P;  2OYI C;  2A45 G;  3KXD A;  2QSI A;  3VMA A;  3AED C;  3IN6 A;  3JC2 2;  1SQX G;  3H1J D;  1OIP A;  5B66 H;  2O1K A;  2ZXX A;  2KI7 B;  1M1J C;  2K1A A;  1RQU A;  3P8C D;  1USE A;  2JEE A;  3PHL A;  1G1I A;  5TJH A;  1KYO I;  1GU5 A;  1JY3 O;  1SQP E;  2M8R A;  3L70 G;  3NXS A;  3QWO C;  1NJI Q;  1VQ6 P;  4GT1 A;  4KJM A;  5AVS B;  1DD4 A;  3AEB C;  1YTZ I;  4M3L A;  1RE4 A;  2XV5 A;  1JB0 J;  2WWW A;  3SFE C;  3CPW O;  4L74 A;  1BGY J;  2KP8 A;  1ZN5 A;  1SQP J;  3N4X A;  1OFC X;  1H0T B;  3KZI E;  3L4F A;  1L0L K;  2KK7 A;  4DOJ A;  2E76 D;  2JP3 A;  2QJK C;  4PD4 H;  3S1K A;  1Q86 Q;  2NRG A;  3E1R A;  2HLO A;  1T8Z A;  2O01 H;  1QX8 A;  4NPF X;  2R32 A;  1W2E A;  3HUS A;  2WSS H;  1SVF A;  5AVZ B; 
#chains in the Genus database with same CATH homology
 1IC2 A;  1NKN A;  2R5D A;  3V4Q A;  5CJ0 A;  2HG5 D;  3B5N A;  4HYT B;  1RE3 A;  1T3U A;  1NU1 K;  5AVU B;  1IFM A;  3A2A A;  1FZC C;  2C0W A;  1HGZ A;  2WPS A;  2N1T B;  2P7J A;  2H8P D;  1HTL C;  3RK3 B;  1RF1 B;  1T3J A;  5AW3 B;  3OAK A;  3CI9 A;  1L0N K;  4WY4 C;  1FJK A;  4ZKU A;  2J59 M;  1JCC A;  1JY2 O;  3HE5 A;  1S9K D;  3B5N D;  3M9Q A;  1ZLL A;  1LT9 B;  3M9B A;  1HBW A;  4N78 D;  1HWT C;  1GW4 A;  1LTS C;  3HD7 D;  3MTU E;  2GUV A;  3RL0 B;  3TK1 A;  1CI6 B;  2WT7 B;  1DH3 A;  2CPS A;  3CLQ A;  1KIL A;  1SQX K;  2Z4E A;  1NH4 A;  4WY4 B;  1G2C B;  4HH2 A;  1DX7 A;  1SFC A;  1N7S B;  2XKM A;  1FDM A;  5KLV K;  3V2P A;  5CCG D;  1L4A B;  1GL2 C;  1DEB A;  1URQ A;  3BAS A;  5AW7 B;  2OYH A;  5BU5 A;  3UIA A;  5KJ7 A;  2O1J A;  2XU6 A;  3KDP B;  2HPC B;  4LGD E;  4LLH A;  4XE5 B;  1NOH A;  1WT6 A;  1J2J B;  5KJ7 C;  1GL2 A;  1SP4 A;  5CHX A;  4JYB A;  3H6P A;  3HTK A;  3L36 A;  1N73 B;  1AFO A;  2XDJ A;  1GK6 A;  3GHG A;  3RK2 C;  1KIL C;  1AQ5 A;  4IFF A;  5AVV B;  1IFD A;  1N7L A;  1LWU B;  2GM4 A;  4Y99 C;  1HUC A;  2WSC H;  2ZXE B;  3SWF A;  2NPS B;  3II6 A;  4W7Z A;  1IFI A;  1M1J A;  2VRS A;  3C9I A;  5AVT B;  3TNU B;  1ZR4 A;  2WPR A;  2YO3 A;  3H32 A;  2QM7 A;  1HH0 A;  3U1C A;  3EQ2 A;  1FZE A;  5APV A;  1KZU B;  3M9H A;  5APW A;  3M91 A;  1MZ9 A;  1XTC C;  3V2Q A;  3BAT A;  3VMZ A;  1J1D B;  1EQ7 A;  1URQ D;  2W27 A;  5APQ A;  1NKZ B;  3HUS B;  5AVR B;  4JYC A;  5AVY B;  1LTJ C;  1RF1 C;  2PP6 A;  3B5N B;  3VTP C;  2KOG A;  2C9N Y;  5BVZ A;  4XA4 A;  1FZC A;  3HE4 A;  2OYI B;  1FJP A;  4AYC A;  5AW9 B;  1GU4 A;  5CJ4 A;  1LTA C;  3BVH A;  3O8Z A;  1CSB A;  4RES B;  4JF7 A;  3VN0 A;  2FKW B;  2FFD B;  3HE5 B;  2M3B A;  3MUD A;  2N1T D;  1LT9 A;  1JTH A;  1RE3 C;  2I1K A;  1L4A D;  1LTB C;  4I6M C;  5KJ7 D;  3T97 A;  2GUS A;  3VYI A;  2YKQ A;  5APU A;  1OXZ A;  2WPQ A;  4GKG A;  2A45 I;  3VP8 A;  2IPP A;  1J1E B;  1N7S D;  3R2P A;  2P67 A;  2P1J A;  3B8E B;  3P8C E;  1N7S C;  2WT7 A;  1JNM A;  3VMX A;  3KQG A;  1FU1 A;  3HD7 B;  4EOT A;  2ZFC A;  1GW3 A;  1SQV K;  1SFC B;  2HYN A;  2OAR A;  1IK9 A;  1SFC D;  1JO5 A;  1NO4 A;  5AVX B;  4C7N B;  5AW1 B;  1JMM A;  1SQQ K;  3B5N C;  2FYZ A;  1L4A A;  4IFM A;  5CCH C;  1KIL D;  1URQ B;  4WB4 A;  2HOD B;  3TSI A;  3OA7 A;  2R3C A;  1JCD A;  2IFN A;  5AW8 B;  1ZV8 A;  1GD2 E;  1SQB K;  2HFE D;  2XZR A;  3RK2 B;  4OH8 B;  2H43 A;  1GDT A;  5AW5 B;  2FXM A;  2YMY A;  1SQP K;  3L37 A;  4N3Y B;  1A02 F;  1NTK K;  3RK3 C;  1NHL A;  1JUN A;  3NMD A;  1KFM A;  5APT A;  1QL1 A;  1X9V A;  1LTI C;  4LC1 A;  1N73 A;  2XNX A;  3BRT B;  1NTM K;  3NFQ A;  2OYH C;  1IO4 A;  1GL2 D;  1SLQ A;  2YKP A;  3RL0 D;  2A45 H;  1KQL A;  5AVW B;  4GIF A;  2KYV A;  1FAV A;  1FOS E;  2J58 A;  1T2K D;  5AVQ B;  1J1D C;  1SFC C;  4W80 A;  2POH A;  2WIT A;  5AW0 B;  2I1J A;  2R5B A;  3M0D C;  1J1E C;  2Q9I A;  3M0A A;  2Q3I A;  2N1T A;  1H8A A;  2Z5H A;  3PP5 A;  1RF1 A;  1KIL B;  2KLV A;  2C9L Y;  1WRG A;  2FYU K;  1GTW A;  5AW4 B;  4WBA A;  2WSF H;  3HE4 B;  2FFD C;  1H88 A;  1JOC A;  1IJD B;  4N6J A;  3LIE A;  3KPE A;  4KHX A;  3MIW A;  1LTG C;  1VDF A;  3WMM 0;  1OWA A;  2W6B A;  1E5W A;  2OYH B;  4O9B A;  1JY3 P;  3L35 A;  3TYY A;  3A7O A;  5BU8 B;  2QM8 A;  4DZO A;  5AW2 B;  1CZQ A;  4EIJ A;  3HRN A;  1CI6 A;  1KFN A;  2MJZ A;  3HD7 C;  1S9K E;  1LTJ A;  4WY4 A;  5CCH D;  1G2C A;  3HUS C;  1MV8 A;  3M0D A;  1T2K C;  4N78 E;  1N7S A;  3P32 A;  1NWQ A;  3RK3 D;  3RL0 C;  3U1A A;  2WZ7 A;  5CCG A;  4IFD K;  4B86 A;  2LKM A;  1X8Y A;  1FZA A;  3GHG B;  2Q5U A;  4C7R A;  1PFI A;  2YO2 A;  2W6A A;  1G1J A;  4I1L A;  2IX7 C;  3A5T A;  5CMZ A;  1FOS F;  4W7Y A;  1LT9 C;  1M1J B;  2YKO A;  1JY3 N;  3M06 A;  2HOD A;  2L5G B;  1YTZ T;  5AW6 B;  3HTK B;  5APY A;  1GZL A;  5KTB A;  1N2D C;  1NTZ K;  2N9B A;  2WTY A;  3EFG A;  3P7K A;  2H7H A;  1MFZ A;  3V2N A;  1IFN A;  3VOP A;  1LWU A;  1M7L A;  2KB7 P;  3V5B A;  2NPS A;  3CL3 D;  3TNU A;  1L4A C;  5CCH A;  1A02 J;  3N7N A;  1FZC B;  3H32 B;  4ZKP A;  1LTT C;  2WSE H;  1LWU C;  2JJL A;  2E42 A;  1FZG A;  1FZB A;  2NPS C;  1RY3 A;  3VP9 A;  3LW5 H;  5APS A;  3A3Y B;  4C46 A;  1JY2 N;  1Z56 A;  3OJA B;  3P8M C;  1LGH B;  1GK4 A;  3G3Z A;  5APX A;  1RF0 C;  3LID A;  1N73 C;  2IFM A;  2Q7C A;  2OYI A;  4AUW A;  1VPC A;  1RF0 A;  3GHG C;  2KSJ A;  3V2R A;  3RK2 D;  3MGN A;  3I5C A;  1QL2 A;  4Y99 B;  1FZF A;  1N86 A;  1URQ C;  2NPS D;  2C0X A;  3U59 A;  4I2L C;  1HVV A;  1X79 B;  3NTN A;  3V4W A;  3IFM A;  1CW5 A;  3VMY A;  3E1I A;  3IR9 A;  2FFD A;  1FBM A;  1JY2 P;  1HJB A;  2HPC A;  2BAS A;  1ZR2 A;  1JTH B;  2E43 A;  4WY4 D;  3MD0 A;  3BRV B;  1HGV A;  1GL2 B;  3SWY A;  2N1T C;  1LTJ B;  2PAJ A;  3HD7 A;  1H89 A;  1YYC A;  2YNY A;  1NAF A;  3KYQ A;  2Z5I A;  1MUU A;  1XTG B;  2CPB A;  1RE4 C;  1IFJ A;  5CCG C;  4AQR D;  4C7N A;  2P2U A;  2OYI C;  2A45 G;  2O1K A;  1M1J C;  3P8C D;  2JEE A;  1G1I A;  1GU5 A;  3NXS A;  1JY3 O;  2M8R A;  4GT1 A;  5AVS B;  4M3L A;  1YTZ I;  1RE4 A;  2XV5 A;  2WWW A;  2KP8 A;  1ZN5 A;  3N4X A;  3L4F A;  1L0L K;  4DOJ A;  2HLO A;  1T8Z A;  2O01 H;  2R32 A;  1W2E A;  3HUS A;  1SVF A;  5AVZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...