3V2RA

Compcc in complex with fatty acids
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
45
structure length
45
Chain Sequence
MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cartilage Oligomerization matrix protein (coiled-coil domain
publication title COMPcc in complex with fatty acids
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 18
structure length 45
sequence length 45
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3v2rA00
1MZ9A 3V2NA 1VDFA 3V2RA 1DEBA 1FBMA 3V2QA 3V2PA
chains in the Genus database with same CATH superfamily
3AE3C 4LC1A 1NTZJ 2A06E 3CL3D 5CMZA 1SQBE 3TGUE 1QGKB 1RF0A 3S1KA 2JKVA 1OWAA 1R8EA 1OZHA 3AEGC 3P8CE 3BVHA 2IZ0A 4AQRD 1U7MA 4ZNCA 3F5HA 3CXHD 1SQXG 2QJPC 1GW4A 2W27A 1CW5A 1NU1G 2JR8A 2Y0DA 3PH0A 3MP7B 2XNXA 3RK3B 1FDMA 4IL6X 3GHGB 4I1LA 3CCVP 1YTZT 2A06G 1SQBG 4GODA 3TGUG 1DD3A 2JDIH 3H1ID 2IFMA 2P1JA 2WPQA 1JY2N 3CCJP 2LKMA 1VQKP 1JB0J 2N9YB 4PD4E 2KS1B 1L0LJ 3H1KE 5AVWB 1NU1J 4H0LC 1T2KC 3VN0A 1NTMD 1KORA 2W83C 3SWFA 2FBWC 2XV5A 3II6A 3S9OA 1SQBJ 1H8AA 2PFXA 3L72E 4L75A 2FYUK 3U59A 1FU1A 2Q5UA 1MUUA 4IFMA 1OVUA 5AW9B 3NXSA 1ZXGA 1AV1A 1IFDA 2Q1KA 4UB6E 1AFOA 4KHXA 3H1KG 3TF5A 4R4MA 3USSA 2HODA 2YNYA 1P84H 2E5TA 3O6QA 3HD7A 2WSSH 4OWFA 2ZYDA 4XA4A 1BCCD 1HF9A 4ASVA 3H1LE 2YXQB 4UB8H 1LTJA 2E74B 2PRRA 3H1HD 3L72G 1PGJA 1PL5A 1AVYA 4H0LD 3V6IA 1T2KD 1NAFA 1L0LK 3H1JE 2M0BA 3H1KJ 3AE4C 1ZV8A 1W2BO 1ZW0A 1JMMA 2Q3IA 2A45I 2P7JA 3L71D 2WSCH 4YTPC 3RL0g 1M8OB 5APWA 2W6AA 1NYHA 1KB9D 3OJAB 4JYBA 3RL0B 3PTZA 1BSNA 3H1LG 2GUSA 1GMJA 4OH8B 1SQPK 1PP9E 5GTIH 2L91A 2OTLP 2JWAA 1DH3A 4PV1B 2KS1A 5AVUB 3H1JG 1E79H 3H32B 3BRTB 3CXHH 2FYNC 1BDCA 3B8EB 1N2DC 1VL2A 2B87B 1SQXD 4XFJA 2CPSA 1NU1D 3H1LJ 3E7KA 2ZVOB 3VTPC 4RESB 2H89C 2A06D 2IBZE 1SQBD 2NPSC 1KD1Q 3TGUD 1PP9G 4NPDA 5E79H 1LTAC 4DJGA 3P8CD 2O01H 3L70J 1IO4A 2IYPA 2RKLA 1J1DC 2K37A 3LIDA 3P32A 1OVRA 1X0TA 2J58A 1VQOP 3KQGA 1ZN5A 1ZP0C 1L0NE 5AVVB 1HJ0A 2E5YA 2KK7A 3R4YA 3L75E 3B5NB 1LNQA 2AEJA 3M9QA 3BATA 3N4XA 2IBZG 2Q7CA 4ASWA 3N7NA 5DJUB 2Q3EA 2HG5D 4PD4D 2YMKA 4WY4B 3IAOA 1DD4A 1JY2O 5BU5A 2R3SA 1EXJA 1JCCA 1L0NG 5CBOA 2NPSD 2YIUB 4U3FE 2WTYA 3B71A 3VMYA 1EDKA 3M06A 3M9HA 3L75G 3L72D 3GF3A 1LWUC 4LLHA 5KAIH 4L74A 3H32A 2Y9ZA 3P8MC 2IBZI 1DEEG 1KQLA 5KJ7C 1PGPA 5AW7B 5H2FH 2B87A 3WU2E 2QG4A 5EFWB 1DIPA 2GUVA 1KB9H 1L0NJ 3HUSC 1KMIZ 1IFNA 3JC22 4NPFX 2GA1A 1OFCX 5BVZA 4U3FG 3L74J 2OYOA 4W7YA 4AUWA 3CX5I 2IPPA 3H1LD 1JY3P 3HE4A 4ZKUA 4JYCA 3CC2P 1D7MA 3L37A 3H1JD 2AEFA 1VF5B 1VDFA 3EFFK 2WPSA 3D71A 4WBAA 3O8ZA 1M1JC 2OARA 1HWTC 1N73C 1HGVA 2ZXEB 1N7SC 1KILE 3CMAP 2QSIA 3B5NA 5KJ7D 3AE9C 1OW6A 2WITA 1GK4A 1SQQK 1VQLP 3TYYA 3CCSP 3IFMA 2FFDC 1WRGA 1OIPA 1U57A 1VQPP 1YI2P 1G2CB 1PP9D 1Y8AA 2XU6A 2Z4EA 5KLVD 2KSEA 4WY4A 5TISE 4KJMA 3QH9A 1Q81Q 2PGDA 1Q82Q 4H13C 5CCGC 1JEKA 1NTZE 2ITAA 1PIXA 2ZT9C 1IFIA 1BE3J 1SVFA 1N86A 3CCEP 1MKMA 2FYUE 1NTKK 2YO3A 1CI6B 1L4AC 2V7QJ 1JM0A 4TT3H 2QRXA 1DX7A 2IBZD 3CLQA 3VMAA 1IK9A 4PD4H 2Q9IA 1Y47A 1OX3A 1LT1A 2OGUA 1N7SD 2Q6QA 2E43A 3PHLA 5APQA 2JWDA 3CCLP 2D2CC 1J1EC 3V2PA 1L0ND 1SP4A 5CHXA 3W67A 4I7ZB 1NTZG 2K1AA 3A0HE 2LXBA 4K3AA 2P2UA 1DEBA 2FYUG 2HR3A 4OGQB 3L75D 3OAKA 3U1AA 1L0LE 1YQ3C 1Z56A 3IN6A 3AE1C 4UB6H 1JOCA 1K9MQ 2QJKC 4H13D 5CCGD 1VQ5P 3G71P 2ZT9D 3EWKA 5CJ4A 1RQVA 1L4AD 1LJ2A 1NVOA 3CCRP 2OYIC 1ZOYC 4AYCA 1LTJB 2FYUJ 4U3FD 1J1DB 1E5WA 4Y28J 2KI7B 1CSBA 1WMKA 3W68A 1SQPE 5AVSB 3G4SP 4YXDC 1G2CA 2E75B 1L0LG 3KHUA 5BU8B 2WPVB 5AVYB 1KILC 1MV8A 3B4SA 5CBNA 4RJTA 2IZ1A 1NJIQ 2HPCB 1RE4A 2WSFH 1K73Q 2W8ZA 1GL2C 2P58A 1KYOE 2LR2A 3RBXA 1KZUB 1VQ4P 3Q5RA 1CI6A 1SFCC 1IZNB 4XE5B 4Z1MH 3KDPB 1BGYE 1SQPG 1NOHA 2AEMA 3L73J 2OTKE 2WSEJ 2Z5IA 2PAJA 1LT9C 4GOEA 1M7LA 1FZGA 2YO2A 2K9JB 2KZIA 2W90A 2N1TC 3MZWB 2H43A 1YTZI 2KOGA 1EXIA 1JUNA 5KAFE 2KYVA 3JSVC 1RF1C 1SQVD 3TNUB 2SPZA 1KILD 2E76C 5B66E 1SQPJ 5AW1B 3HUSB 1T6AA 1OW7A 2A45G 3P7KA 2IDBA 1YJNP 3FX0A 1BGYG 5APTA 1VQ6P 1Q90D 4TLFA 4K35A 2C0XA 1GL2D 3H25A 2Y0CA 3MUDA 3V2RA 4Y99C 3IF4A 1URQB 1SFCD 5APSA 2FKWB 1M1KQ 2R44A 4HB1A 1H0TB 3H6PA 1RF0C 3KZIE 3R2PA 3AEEC 1JNMA 3RK3E 1VPCA 1NTZD 1KYOI 3AECC 1RQUA 1BGYJ 2GM4A 4D6TJ 5KLIC 2FYUD 4IL6E 5KKZC 2B89A 3NTNA 5AVZB 3CCQP 2HFED 1N7SB 2N1TD 4W80A 4R4LA 4H44B 3L70E 4N6JA 2HPCA 1HVVA 5M1BA 2JJLA 1W5CE 2WT7B 1OW8A 3QWOC 1YHQP 2E76D 2CPBA 1GDTA 2QEXP 4IFFA 4EI2A 1M56D 2MJZA 1BDDA 3BCCJ 3ITKA 4GDOA 3RK2B 5GTHE 2YXRB 1JCDA 4OVNF 5AW3B 1HTLC 3A5TA 4BRYB 1KN7A 1L0LD 1XTGB 2M8RA 3S4RA 3L70G 3VYIA 5C39A 1EZVE 2K9JA 1LWUA 3PRJA 3WU2H 3CPWO 1EDJA 3LW5H 5KJ7A 1EC5A 3D6ZA 3M0DA 3CCMP 2OYHC 3PLNA 3TNUA 3CWBJ 2VRSA 3HE4B 1S4XA 3MHVA 3LIEA 3F89A 3HUSA 4O9BA 1S5LH 3C1LA 3V2QA 1QVFO 3A3YB 1OMIA 1NGMB 4C7NB 1JY2P 1SQPD 5AVTB 2ZAEB 4RO0A 3HD7C 2QA4P 3SFDC 1URQA 1T8ZA 1EZVG 1P84E 3CX5E 2MKVA 1H0TA 1S5LX 1Q86Q 3L74E 1FZCB 5CJ0A 4WB4A 1FZEA 1KYOD 1GK6A 4PJ0E 3KPEA 1ZRTE 1NTKE 2QM7A 2YMYA 1IK7A 3SFEC 1GU5A 1M90Q 1EQ7A 1N7SA 2M3EA 3L4FA 4GT1A 1BGYD 3H1KD 5CCHC 1KQFB 3RK3C 3C8VA 2P67A 5TISH 2WT7A 3GHGC 1PPJE 3E1RA 3SWYA 1LP1A 1EZVI 2AXTE 1KILB 1RE3A 2QJPB 2AXCA 1S9KE 3L74G 2H88C 3G6EP 2FXOA 1USDA 4WWIA 3AEAC 3Q1MA 1SQQJ 1NTKG 3AE2C 4BRYA 3TSIA 1MZ9A 2Y9YA 4EIJA 4B86A 1S72P 4HH2A 2BCCE 1SFCB 3CXHE 2NZ2A 2O3JA 1S1CX 2O01N 1MFTA 1PPJG 4YPCA 1K8AQ 3HTKA 4H0LB 1P84I 1T3UA 4GKGA 1YJ9P 1BE3E 4HYTB 1TU3F 1NTKJ 3A0HH 5CCHD 2WPRA 1GZLA 3GG2A 3RK3D 2WQYC 3FWNA 2IFNA 4C7NA 1H89A 3ZDMA 1LTBC 4WVZA 1RY3A 1Q7YQ 4N78E 5AW8B 5KLVK 5E79E 2WSCJ 2BCCG 2R5DA 3GMAA 2WSEH 3CC7P 3L70D 1G1IA 1AA0A 1HJBA 2JO1A 2J59M 1R5LA 1FZCA 3M0AA 1BE3G 1FZFA 4I2LC 2M3BA 1FE6A 1NAYA 4LGDE 1OVVA 1AQTA 2BCCJ 3RL0C 3I5CA 4U7JA 3CXHI 1VQ7P 1KILA 3FXDA 1QL1A 5AVQB 3RGUA 1KYOH 1ZR4A 2WVRA 4PV1C 1OXZA 1CZQA 3OW2O 1QLED 5L8RJ 1KFNA 3WMM0 2A45H 2KLUA 1GL2A 3GW6A 2DW3A 3AEBC 1VQ9P 3NMDA 1SFCA 1VQ8P 2O01J 1KTMA 1KQSO 2Z5HA 1NTMJ 3V4WA 5AW4B 1YQ4C 5KTBA 2FYNB 1LTTC 3CX5D 2KB7P 1FS0E 1JO5A 2JP3A 1LT9A 5KAFH 3L74D 1K05A 1G1JA 5B66H 1ZRTD 1MFZA 3L73E 2OYHB 2NRGA 3NFQA 2NPSB 1SLQA 1NKZB 4KT0J 3L71G 1YIJP 1BCCJ 1PPJD 3B5NC 2ZYGA 2XNDH 2FXMA 3D70A 3JCUE 2RMZA 3KZIH 4HKZH 3H1HJ 1YYCA 2XKMA 3RBZA 1S9KD 1YJWP 1RH5B 4WY4C 1U7JA 4IL6H 2D2CD 3L73G 1QEXA 3M91A 5APVA 3L71J 5DJTB 1NTMK 1FJKA 4ZMDA 2YIUC 3CI9A 4DOJA 2BCCD 2P10A 3TDKA 2YKOA 1FBMA 3AEFC 1FOSE 4C7RA 1X79B 1KB9I 2ZFCA 1SQVK 2BASA 1W2EA 5B5EE 3I56P 1BE3D 4D6TE 1KFMA 4JPZB 5GTHH 1UIXA 2QM8A 1NKNA 2R5BA 1AJYA 1S2EA 2ZJSE 2OTJP 2K3RA 3B5ND 3CC4P 1LWUB 4N78D 1SQXJ 2BEQD 2I1KA 1WT6A 2RN0A 1BSHA 3PP5A 2HYNA 3T97B 1XTCC 2QVAA 3A0BE 4WY4D 5AW0B 4RKUJ 3BCCE 1NTZK 3TGUJ 2HLOA 1YBKA 4D6TG 1VF5C 3HRNA 3C9IA 2OYHA 2FYZA 3AE5C 2NPSA 1FDOA 1Y9BA 3EQ2A 2XDJA 3CX5H 4DCKA 2N9BA 3L35A 3CWBE 1GTWA 1VQMP 3BCCG 3D6YA 1M1JB 3AE6C 2H8PD 5APYA 2CK3H 4JQ0D 1N73B 2ZYAA 4PJ0H 1EDIA 1PV3A 1NHLA 1RE4C 1FOSF 2UWJE 1Q2NA 1EDLA 3WUUA 1SQXK 1LTIC 3E1IA 5TJHA 4EYYQ 1NU1K 2FFDB 5AVXB 2WMMA 1LP1B 4PD4I 2YKPA 2G8YA 5CCHA 1VF5D 2AXTH 2Y0EA 2QIWA 3CWBG 1JY3N 1SQBK 2OQQA 3GHGA 1IFMA 3L72J 4H13B 3CCUP 3TK1A 3G9RA 1QVGO 2R3CA 3MIWA 2ZT9B 1GD2E 1H88A 2E42A 1KC8Q 2QJYC 3L73D 1L4AB 5KLVE 4EOTA 3AE8C 4I7ZC 3G3ZA 3HTKB 3UIAA 1LTGC 3T97A 1HBWA 3A2AA 4OGQC 1ZR2A 2V4HA 1FDIA 1FZBA 1NO4A 1SQQE 2D2CB 1J1EB 2V7QH 1NH4A 2KZJA 3MUDC 3H1JJ 3Q5PA 1HH0A 2R32A 4CPGA 2J5UA 3MTUE 3V2NA 5KLVG 2JEEA 3OA7A 5AVRB 2WSFJ 2KIKA 1HUCA 1S3JA 1LTJC 2QJKB 2C9NY 2FY8A 5AW6B 4N3YB 4W7ZA 2W6BA 1X22A 4UB8E 1M1JA 2IYOA 2E75C 3EFGA 1N73A 5AW2B 1NWQA 1SQQG 1T3JA 2OYIB 4D6TD 1PP9J 5KLVJ 2H7HA 4OGQD 2FFDA 2M5AB 3PJSK 3L36A 3K5BA 3Q3DA 1KV4A 1R5SA 2K9YA 4GOFA 4JBZA 4MN4C 3HD7D 3BRVB 5CCGA 4DZOA 1J2JB 3MD0A 3BCCD 1GL2B 5GTIE 2PP6A 1SS1A 2ZXXA 1FC2C 3KYQA 4C46A 2L5GB 5APXA 1L4AA 4HJGH 3CMEP 2KNCB 3VMZA 1LTSC 1RHZB 4L76A 3KXDA 1FJPA 3M0DC 2E75D 2LXCB 3BASA 2I8DA 1ZMEC 1LT9B 3H1IE 4IOIH 2N1TB 2I1JA 1L2PA 3CWBD 3L75J 3VP9A 2BEZF 3HE5B 1S5LE 1JTHB 4A7PA 2O1KA 1UIIA 1RF1B 4QMAA 1ZLLA 2C9LY 4YXWH 1URQC 2E76B 2YKQA 1GU4A 4DT0A 1NTME 4IFDK 1N7LA 2E74C 2W6JH 3FGAD 3GF7A 4M3LA 3IR9A 3CD6P 1HGZA 4Y99B 1IC2A 1JMBA 4U3FJ 1FAVA 1SQVE 4L73A 3H1IG 1PGQA 3JCUH 1FZAA 2XZRA 3AE7C 2OYIA 4H44C 4NPEA 3I55P 3SWKA 2WWWA 1USEA 5AW5B 1KQGB 3M9BA 1JY3O 1M57D 2M5AA 1K04A 5KLIB 5KKZB 2IX7C 1EZVD 1NTMG 3Q5SA 1AVOA 1RE3C 2QE7H 1BCCE 1IFJA 2KXPB 1L0NK 2G3AA 3FWLA 3LW5J 3MGNA 1IJDB 2K88A 4GIFA 1YITP 1X9VA 3RK2C 2O1JA 1IFPA 3H1IJ 3H1HE 4BXLA 1URQD 1PGOA 1SQVG 2B88A 5B5EH 5KAIE 3FXEA 1SQQD 2FXPA 4JF7A 2E74D 1X8YA 4BWNA 2KSJA 1VQNP 3L71E 1PZQA 1A02J 5H2FE 2KNCA 2WZ7A 2POHA 1N8RQ 1KB9E 2C0WA 4I6MC 2KUBA 1P84D 1BCCG 3A7OA 2KLVA 4H44D 2QJYB 1AQ5A 3Q2YA 2ZVNB 3VP8A 1SQVJ 3A0BH 2N1TA 3RL0D 3H1HG 1LGHB 1A02F 1NTKD 4ZKPA 3HE5A 2KP8A 1JTHA 1RF1A 2RH0A 3AEDC 1GW3A 4EDFA 3SSUA 1PFIA 3WUTA 3VOPA 1QX8A 5APUA 3V5BA 4PV1D 1SQXE 3RK2D 3WUVA 3V4QA 3U1CA 2HODB 3ABVC 1NU1E 1QL2A 2B9BA 1FZCC 3O6QB 3HD7B 3VMXA 5K5GB 3GLMA
chains in the Genus database with same CATH topology
1GTWA 1FZCB 4LC1A 5CJ0A 4WB4A 3CL3D 1FZEA 5CMZA 3B5NA 1GK6A 1M1JB 2H8PD 5APYA 5KJ7D 3KPEA 1N73B 1RF0A 2QM7A 2YMYA 2WITA 1GK4A 1OWAA 1SQQK 1GU5A 3TYYA 1EQ7A 3IFMA 1N7SA 2FFDC 1WRGA 3L4FA 4GT1A 3P8CE 3BVHA 1NHLA 1G2CB 1RE4C 1FOSF 5CCHC 4AQRD 2XU6A 2Z4EA 4WY4A 1SQXK 3RK3C 1LTIC 2P67A 3E1IA 2WT7A 1NU1K 2FFDB 1GW4A 3GHGC 5AVXB 2W27A 1CW5A 2YKPA 3SWYA 2XNXA 5CCHA 3RK3B 5CCGC 1FDMA 1KILB 1RE3A 3GHGB 1S9KE 1JY3N 1IFIA 1SQBK 3GHGA 4I1LA 1SVFA 1YTZT 1IFMA 1N86A 2YO3A 1NTKK 1CI6B 1L4AC 3TK1A 2IFMA 2P1JA 2R3CA 2WPQA 1JY2N 3MIWA 1GD2E 1H88A 2LKMA 1DX7A 3CLQA 3TSIA 1IK9A 1MZ9A 2E42A 4EIJA 4B86A 2Q9IA 5AVWB 1L4AB 4HH2A 4EOTA 1SFCB 1N7SD 1T2KC 3G3ZA 3HTKB 3UIAA 3VN0A 2E43A 5APQA 1LTGC 3HTKA 3T97A 3SWFA 2XV5A 1HBWA 1J1EC 3A2AA 3II6A 3V2PA 1ZR2A 1SP4A 1T3UA 5CHXA 4GKGA 1H8AA 1FZBA 4HYTB 2FYUK 2P2UA 1NO4A 5CCHD 3U59A 2WPRA 1FU1A 1GZLA 1DEBA 2Q5UA 1J1EB 3RK3D 1MUUA 4IFMA 2IFNA 4C7NA 1H89A 3OAKA 1NH4A 5AW9B 3NXSA 1LTBC 3U1AA 1RY3A 1Z56A 1IFDA 1AFOA 4N78E 1HH0A 2R32A 4KHXA 5AW8B 1JOCA 5KLVK 3MTUE 3V2NA 5CCGD 2HODA 2JEEA 3OA7A 2YNYA 2R5DA 2WSEH 5AVRB 1G1IA 1HUCA 1LTJC 5CJ4A 3HD7A 4XA4A 2C9NY 1HJBA 1L4AD 5AW6B 2J59M 4N3YB 4W7ZA 2OYIC 1FZCA 2W6BA 4AYCA 1LTJB 3M0AA 1M1JA 3EFGA 1N73A 1FZFA 1J1DB 1LTJA 1E5WA 4I2LC 5AW2B 1CSBA 1NWQA 1T3JA 2OYIB 1T2KD 5AVSB 1NAFA 2M3BA 1L0LK 4LGDE 1G2CA 1ZV8A 5BU8B 2H7HA 5AVYB 1KILC 1MV8A 1JMMA 2Q3IA 2A45I 3RL0C 2P7JA 2WSCH 2FFDA 2HPCB 5APWA 2W6AA 1RE4A 3I5CA 2WSFH 3L36A 3OJAB 4JYBA 3RL0B 1KILA 1QL1A 1GL2C 5AVQB 1ZR4A 1KZUB 3HD7D 3BRVB 1OXZA 1CZQA 1CI6A 2GUSA 1SFCC 5CCGA 4DZOA 1J2JB 3MD0A 4OH8B 4XE5B 1GL2B 1KFNA 2PP6A 1SQPK 3WMM0 3KDPB 2A45H 1GL2A 3KYQA 4C46A 1DH3A 5AVUB 1NOHA 2L5GB 3H32B 5APXA 3BRTB 1L4AA 3NMDA 2Z5IA 1SFCA 3VMZA 3B8EB 2Z5HA 2PAJA 1LTSC 1N2DC 1FJPA 1LT9C 3M0DC 3V4WA 1M7LA 5AW4B 1FZGA 2YO2A 5KTBA 3BASA 2CPSA 2N1TC 1LTTC 2H43A 1YTZI 2KOGA 1LT9B 2KB7P 1JUNA 1JO5A 1LT9A 2KYVA 1RF1C 3TNUB 3VTPC 2N1TB 4RESB 2I1JA 1KILD 5AW1B 1G1JA 3HUSB 3VP9A 2NPSC 2A45G 3HE5B 1JTHB 3P7KA 2O1KA 1MFZA 1RF1B 1ZLLA 2C9LY 2OYHB 1URQC 5APTA 2YKQA 1LTAC 1GU4A 2C0XA 3NFQA 2NPSB 3P8CD 1GL2D 2O01H 1SLQA 1NKZB 3MUDA 1IO4A 4IFDK 1N7LA 3V2RA 1J1DC 3LIDA 3P32A 2J58A 4Y99C 1URQB 3KQGA 1ZN5A 1SFCD 4M3LA 5APSA 5AVVB 3IR9A 2FKWB 3B5NC 2FXMA 1HGZA 3H6PA 1RF0C 4Y99B 1IC2A 3R2PA 1JNMA 1FAVA 1YYCA 2XKMA 1VPCA 1S9KD 3B5NB 1FZAA 2XZRA 3M9QA 2OYIA 3BATA 2GM4A 3N4XA 4WY4C 2Q7CA 3NTNA 5AVZB 2WWWA 2HFED 1N7SB 3N7NA 5AW5B 3M91A 2N1TD 5APVA 4W80A 2HG5D 3M9BA 1JY3O 1NTMK 4N6JA 2HPCA 1FJKA 2IX7C 1HVVA 4WY4B 3CI9A 2JJLA 4DOJA 2WT7B 1RE3C 2YKOA 1JY2O 1IFJA 5BU5A 1L0NK 1FBMA 1JCCA 2CPBA 1FOSE 3MGNA 1IJDB 4C7RA 1GDTA 4GIFA 2NPSD 1X9VA 3RK2C 1X79B 2O1JA 4IFFA 2WTYA 2ZFCA 1SQVK 2MJZA 2BASA 1URQD 1W2EA 3VMYA 3M06A 3M9HA 1KFMA 3RK2B 1JCDA 1LWUC 4LLHA 2QM8A 4JF7A 1NKNA 1X8YA 2R5BA 3H32A 5AW3B 1HTLC 3P8MC 2KSJA 3A5TA 1KQLA 5KJ7C 1A02J 2WZ7A 3B5ND 5AW7B 1XTGB 2POHA 1LWUB 2M8RA 4N78D 3VYIA 2C0WA 1LWUA 2I1KA 2GUVA 4I6MC 3HUSC 1WT6A 3A7OA 3PP5A 3LW5H 5KJ7A 1IFNA 2KLVA 3M0DA 2HYNA 1XTCC 1AQ5A 4WY4D 5AW0B 2OYHC 3VP8A 3TNUA 5BVZA 2N1TA 3RL0D 1LGHB 2VRSA 4W7YA 4AUWA 1NTZK 3HE4B 2IPPA 1A02F 3LIEA 3HUSA 2HLOA 1JY3P 4O9BA 4ZKPA 3HE5A 2KP8A 1JTHA 3HE4A 3V2QA 4ZKUA 3A3YB 3HRNA 4JYCA 3C9IA 1RF1A 4C7NB 1GW3A 2OYHA 2FYZA 1JY2P 1PFIA 5AVTB 3L37A 2NPSA 3VOPA 5APUA 3V5BA 3HD7C 3RK2D 1VDFA 3V4QA 3U1CA 2HODB 1URQA 2WPSA 1QL2A 1T8ZA 1FZCC 3EQ2A 4WBAA 3O8ZA 1M1JC 2XDJA 2OARA 1HWTC 3HD7B 3VMXA 1N73C 1HGVA 2ZXEB 2N9BA 3L35A 1N7SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MZ9 A;  3V2N A;  1VDF A;  3V2R A;  1DEB A;  1FBM A;  3V2Q A;  3V2P A; 
#chains in the Genus database with same CATH topology
 3AE3 C;  4LC1 A;  1NTZ J;  2A06 E;  3CL3 D;  5CMZ A;  1SQB E;  3TGU E;  1QGK B;  1RF0 A;  3S1K A;  2JKV A;  1OWA A;  1R8E A;  1OZH A;  3AEG C;  3P8C E;  3BVH A;  2IZ0 A;  4AQR D;  1U7M A;  4ZNC A;  3F5H A;  3CXH D;  1SQX G;  2QJP C;  1GW4 A;  2W27 A;  1CW5 A;  1NU1 G;  2JR8 A;  2Y0D A;  3PH0 A;  3MP7 B;  2XNX A;  3RK3 B;  1FDM A;  4IL6 X;  3GHG B;  4I1L A;  3CCV P;  1YTZ T;  2A06 G;  1SQB G;  4GOD A;  3TGU G;  1DD3 A;  2JDI H;  3H1I D;  2IFM A;  2P1J A;  2WPQ A;  1JY2 N;  3CCJ P;  2LKM A;  1VQK P;  1JB0 J;  2N9Y B;  4PD4 E;  2KS1 B;  1L0L J;  3H1K E;  5AVW B;  1NU1 J;  4H0L C;  1T2K C;  3VN0 A;  1NTM D;  1KOR A;  2W83 C;  3SWF A;  2FBW C;  2XV5 A;  3II6 A;  3S9O A;  1SQB J;  1H8A A;  2PFX A;  3L72 E;  4L75 A;  2FYU K;  3U59 A;  1FU1 A;  2Q5U A;  1MUU A;  4IFM A;  1OVU A;  5AW9 B;  3NXS A;  1ZXG A;  1AV1 A;  1IFD A;  2Q1K A;  4UB6 E;  1AFO A;  4KHX A;  3H1K G;  3TF5 A;  4R4M A;  3USS A;  2HOD A;  2YNY A;  1P84 H;  2E5T A;  3O6Q A;  3HD7 A;  2WSS H;  4OWF A;  2ZYD A;  4XA4 A;  1BCC D;  1HF9 A;  4ASV A;  3H1L E;  2YXQ B;  4UB8 H;  1LTJ A;  2E74 B;  2PRR A;  3H1H D;  3L72 G;  1PGJ A;  1PL5 A;  1AVY A;  4H0L D;  3V6I A;  1T2K D;  1NAF A;  1L0L K;  3H1J E;  2M0B A;  3H1K J;  3AE4 C;  1ZV8 A;  1W2B O;  1ZW0 A;  1JMM A;  2Q3I A;  2A45 I;  2P7J A;  3L71 D;  2WSC H;  4YTP C;  3RL0 g;  1M8O B;  5APW A;  2W6A A;  1NYH A;  1KB9 D;  3OJA B;  4JYB A;  3RL0 B;  3PTZ A;  1BSN A;  3H1L G;  2GUS A;  1GMJ A;  4OH8 B;  1SQP K;  1PP9 E;  5GTI H;  2L91 A;  2OTL P;  2JWA A;  1DH3 A;  4PV1 B;  2KS1 A;  5AVU B;  3H1J G;  1E79 H;  3H32 B;  3BRT B;  3CXH H;  2FYN C;  1BDC A;  3B8E B;  1N2D C;  1VL2 A;  2B87 B;  1SQX D;  4XFJ A;  2CPS A;  1NU1 D;  3H1L J;  3E7K A;  2ZVO B;  3VTP C;  4RES B;  2H89 C;  2A06 D;  2IBZ E;  1SQB D;  2NPS C;  1KD1 Q;  3TGU D;  1PP9 G;  4NPD A;  5E79 H;  1LTA C;  4DJG A;  3P8C D;  2O01 H;  3L70 J;  1IO4 A;  2IYP A;  2RKL A;  1J1D C;  2K37 A;  3LID A;  3P32 A;  1OVR A;  1X0T A;  2J58 A;  1VQO P;  3KQG A;  1ZN5 A;  1ZP0 C;  1L0N E;  5AVV B;  1HJ0 A;  2E5Y A;  2KK7 A;  3R4Y A;  3L75 E;  3B5N B;  1LNQ A;  2AEJ A;  3M9Q A;  3BAT A;  3N4X A;  2IBZ G;  2Q7C A;  4ASW A;  3N7N A;  5DJU B;  2Q3E A;  2HG5 D;  4PD4 D;  2YMK A;  4WY4 B;  3IAO A;  1DD4 A;  1JY2 O;  5BU5 A;  2R3S A;  1EXJ A;  1JCC A;  1L0N G;  5CBO A;  2NPS D;  2YIU B;  4U3F E;  2WTY A;  3B71 A;  3VMY A;  1EDK A;  3M06 A;  3M9H A;  3L75 G;  3L72 D;  3GF3 A;  1LWU C;  4LLH A;  5KAI H;  4L74 A;  3H32 A;  2Y9Z A;  3P8M C;  2IBZ I;  1DEE G;  1KQL A;  5KJ7 C;  1PGP A;  5AW7 B;  5H2F H;  2B87 A;  3WU2 E;  2QG4 A;  5EFW B;  1DIP A;  2GUV A;  1KB9 H;  1L0N J;  3HUS C;  1KMI Z;  1IFN A;  3JC2 2;  4NPF X;  2GA1 A;  1OFC X;  5BVZ A;  4U3F G;  3L74 J;  2OYO A;  4W7Y A;  4AUW A;  3CX5 I;  2IPP A;  3H1L D;  1JY3 P;  3HE4 A;  4ZKU A;  4JYC A;  3CC2 P;  1D7M A;  3L37 A;  3H1J D;  2AEF A;  1VF5 B;  1VDF A;  3EFF K;  2WPS A;  3D71 A;  4WBA A;  3O8Z A;  1M1J C;  2OAR A;  1HWT C;  1N73 C;  1HGV A;  2ZXE B;  1N7S C;  1KIL E;  3CMA P;  2QSI A;  3B5N A;  5KJ7 D;  3AE9 C;  1OW6 A;  2WIT A;  1GK4 A;  1SQQ K;  1VQL P;  3TYY A;  3CCS P;  3IFM A;  2FFD C;  1WRG A;  1OIP A;  1U57 A;  1VQP P;  1YI2 P;  1G2C B;  1PP9 D;  1Y8A A;  2XU6 A;  2Z4E A;  5KLV D;  2KSE A;  4WY4 A;  5TIS E;  4KJM A;  3QH9 A;  1Q81 Q;  2PGD A;  1Q82 Q;  4H13 C;  5CCG C;  1JEK A;  1NTZ E;  2ITA A;  1PIX A;  2ZT9 C;  1IFI A;  1BE3 J;  1SVF A;  1N86 A;  3CCE P;  1MKM A;  2FYU E;  1NTK K;  2YO3 A;  1CI6 B;  1L4A C;  2V7Q J;  1JM0 A;  4TT3 H;  2QRX A;  1DX7 A;  2IBZ D;  3CLQ A;  3VMA A;  1IK9 A;  4PD4 H;  2Q9I A;  1Y47 A;  1OX3 A;  1LT1 A;  2OGU A;  1N7S D;  2Q6Q A;  2E43 A;  3PHL A;  5APQ A;  2JWD A;  3CCL P;  2D2C C;  1J1E C;  3V2P A;  1L0N D;  1SP4 A;  5CHX A;  3W67 A;  4I7Z B;  1NTZ G;  2K1A A;  3A0H E;  2LXB A;  4K3A A;  2P2U A;  1DEB A;  2FYU G;  2HR3 A;  4OGQ B;  3L75 D;  3OAK A;  3U1A A;  1L0L E;  1YQ3 C;  1Z56 A;  3IN6 A;  3AE1 C;  4UB6 H;  1JOC A;  1K9M Q;  2QJK C;  4H13 D;  5CCG D;  1VQ5 P;  3G71 P;  2ZT9 D;  3EWK A;  5CJ4 A;  1RQV A;  1L4A D;  1LJ2 A;  1NVO A;  3CCR P;  2OYI C;  1ZOY C;  4AYC A;  1LTJ B;  2FYU J;  4U3F D;  1J1D B;  1E5W A;  4Y28 J;  2KI7 B;  1CSB A;  1WMK A;  3W68 A;  1SQP E;  5AVS B;  3G4S P;  4YXD C;  1G2C A;  2E75 B;  1L0L G;  3KHU A;  5BU8 B;  2WPV B;  5AVY B;  1KIL C;  1MV8 A;  3B4S A;  5CBN A;  4RJT A;  2IZ1 A;  1NJI Q;  2HPC B;  1RE4 A;  2WSF H;  1K73 Q;  2W8Z A;  1GL2 C;  2P58 A;  1KYO E;  2LR2 A;  3RBX A;  1KZU B;  1VQ4 P;  3Q5R A;  1CI6 A;  1SFC C;  1IZN B;  4XE5 B;  4Z1M H;  3KDP B;  1BGY E;  1SQP G;  1NOH A;  2AEM A;  3L73 J;  2OTK E;  2WSE J;  2Z5I A;  2PAJ A;  1LT9 C;  4GOE A;  1M7L A;  1FZG A;  2YO2 A;  2K9J B;  2KZI A;  2W90 A;  2N1T C;  3MZW B;  2H43 A;  1YTZ I;  2KOG A;  1EXI A;  1JUN A;  5KAF E;  2KYV A;  3JSV C;  1RF1 C;  1SQV D;  3TNU B;  2SPZ A;  1KIL D;  2E76 C;  5B66 E;  1SQP J;  5AW1 B;  3HUS B;  1T6A A;  1OW7 A;  2A45 G;  3P7K A;  2IDB A;  1YJN P;  3FX0 A;  1BGY G;  5APT A;  1VQ6 P;  1Q90 D;  4TLF A;  4K35 A;  2C0X A;  1GL2 D;  3H25 A;  2Y0C A;  3MUD A;  3V2R A;  4Y99 C;  3IF4 A;  1URQ B;  1SFC D;  5APS A;  2FKW B;  1M1K Q;  2R44 A;  4HB1 A;  1H0T B;  3H6P A;  1RF0 C;  3KZI E;  3R2P A;  3AEE C;  1JNM A;  3RK3 E;  1VPC A;  1NTZ D;  1KYO I;  3AEC C;  1RQU A;  1BGY J;  2GM4 A;  4D6T J;  5KLI C;  2FYU D;  4IL6 E;  5KKZ C;  2B89 A;  3NTN A;  5AVZ B;  3CCQ P;  2HFE D;  1N7S B;  2N1T D;  4W80 A;  4R4L A;  4H44 B;  3L70 E;  4N6J A;  2HPC A;  1HVV A;  5M1B A;  2JJL A;  1W5C E;  2WT7 B;  1OW8 A;  3QWO C;  1YHQ P;  2E76 D;  2CPB A;  1GDT A;  2QEX P;  4IFF A;  4EI2 A;  1M56 D;  2MJZ A;  1BDD A;  3BCC J;  3ITK A;  4GDO A;  3RK2 B;  5GTH E;  2YXR B;  1JCD A;  4OVN F;  5AW3 B;  1HTL C;  3A5T A;  4BRY B;  1KN7 A;  1L0L D;  1XTG B;  2M8R A;  3S4R A;  3L70 G;  3VYI A;  5C39 A;  1EZV E;  2K9J A;  1LWU A;  3PRJ A;  3WU2 H;  3CPW O;  1EDJ A;  3LW5 H;  5KJ7 A;  1EC5 A;  3D6Z A;  3M0D A;  3CCM P;  2OYH C;  3PLN A;  3TNU A;  3CWB J;  2VRS A;  3HE4 B;  1S4X A;  3MHV A;  3LIE A;  3F89 A;  3HUS A;  4O9B A;  1S5L H;  3C1L A;  3V2Q A;  1QVF O;  3A3Y B;  1OMI A;  1NGM B;  4C7N B;  1JY2 P;  1SQP D;  5AVT B;  2ZAE B;  4RO0 A;  3HD7 C;  2QA4 P;  3SFD C;  1URQ A;  1T8Z A;  1EZV G;  1P84 E;  3CX5 E;  2MKV A;  1H0T A;  1S5L X;  1Q86 Q;  3L74 E;  1FZC B;  5CJ0 A;  4WB4 A;  1FZE A;  1KYO D;  1GK6 A;  4PJ0 E;  3KPE A;  1ZRT E;  1NTK E;  2QM7 A;  2YMY A;  1IK7 A;  3SFE C;  1GU5 A;  1M90 Q;  1EQ7 A;  1N7S A;  2M3E A;  3L4F A;  4GT1 A;  1BGY D;  3H1K D;  5CCH C;  1KQF B;  3RK3 C;  3C8V A;  2P67 A;  5TIS H;  2WT7 A;  3GHG C;  1PPJ E;  3E1R A;  3SWY A;  1LP1 A;  1EZV I;  2AXT E;  1KIL B;  1RE3 A;  2QJP B;  2AXC A;  1S9K E;  3L74 G;  2H88 C;  3G6E P;  2FXO A;  1USD A;  4WWI A;  3AEA C;  3Q1M A;  1SQQ J;  1NTK G;  3AE2 C;  4BRY A;  3TSI A;  1MZ9 A;  2Y9Y A;  4EIJ A;  4B86 A;  1S72 P;  4HH2 A;  2BCC E;  1SFC B;  3CXH E;  2NZ2 A;  2O3J A;  1S1C X;  2O01 N;  1MFT A;  1PPJ G;  4YPC A;  1K8A Q;  3HTK A;  4H0L B;  1P84 I;  1T3U A;  4GKG A;  1YJ9 P;  1BE3 E;  4HYT B;  1TU3 F;  1NTK J;  3A0H H;  5CCH D;  2WPR A;  1GZL A;  3GG2 A;  3RK3 D;  2WQY C;  3FWN A;  2IFN A;  4C7N A;  1H89 A;  3ZDM A;  1LTB C;  4WVZ A;  1RY3 A;  1Q7Y Q;  4N78 E;  5AW8 B;  5KLV K;  5E79 E;  2WSC J;  2BCC G;  2R5D A;  3GMA A;  2WSE H;  3CC7 P;  3L70 D;  1G1I A;  1AA0 A;  1HJB A;  2JO1 A;  2J59 M;  1R5L A;  1FZC A;  3M0A A;  1BE3 G;  1FZF A;  4I2L C;  2M3B A;  1FE6 A;  1NAY A;  4LGD E;  1OVV A;  1AQT A;  2BCC J;  3RL0 C;  3I5C A;  4U7J A;  3CXH I;  1VQ7 P;  1KIL A;  3FXD A;  1QL1 A;  5AVQ B;  3RGU A;  1KYO H;  1ZR4 A;  2WVR A;  4PV1 C;  1OXZ A;  1CZQ A;  3OW2 O;  1QLE D;  5L8R J;  1KFN A;  3WMM 0;  2A45 H;  2KLU A;  1GL2 A;  3GW6 A;  2DW3 A;  3AEB C;  1VQ9 P;  3NMD A;  1SFC A;  1VQ8 P;  2O01 J;  1KTM A;  1KQS O;  2Z5H A;  1NTM J;  3V4W A;  5AW4 B;  1YQ4 C;  5KTB A;  2FYN B;  1LTT C;  3CX5 D;  2KB7 P;  1FS0 E;  1JO5 A;  2JP3 A;  1LT9 A;  5KAF H;  3L74 D;  1K05 A;  1G1J A;  5B66 H;  1ZRT D;  1MFZ A;  3L73 E;  2OYH B;  2NRG A;  3NFQ A;  2NPS B;  1SLQ A;  1NKZ B;  4KT0 J;  3L71 G;  1YIJ P;  1BCC J;  1PPJ D;  3B5N C;  2ZYG A;  2XND H;  2FXM A;  3D70 A;  3JCU E;  2RMZ A;  3KZI H;  4HKZ H;  3H1H J;  1YYC A;  2XKM A;  3RBZ A;  1S9K D;  1YJW P;  1RH5 B;  4WY4 C;  1U7J A;  4IL6 H;  2D2C D;  3L73 G;  1QEX A;  3M91 A;  5APV A;  3L71 J;  5DJT B;  1NTM K;  1FJK A;  4ZMD A;  2YIU C;  3CI9 A;  4DOJ A;  2BCC D;  2P10 A;  3TDK A;  2YKO A;  1FBM A;  3AEF C;  1FOS E;  4C7R A;  1X79 B;  1KB9 I;  2ZFC A;  1SQV K;  2BAS A;  1W2E A;  5B5E E;  3I56 P;  1BE3 D;  4D6T E;  1KFM A;  4JPZ B;  5GTH H;  1UIX A;  2QM8 A;  1NKN A;  2R5B A;  1AJY A;  1S2E A;  2ZJS E;  2OTJ P;  2K3R A;  3B5N D;  3CC4 P;  1LWU B;  4N78 D;  1SQX J;  2BEQ D;  2I1K A;  1WT6 A;  2RN0 A;  1BSH A;  3PP5 A;  2HYN A;  3T97 B;  1XTC C;  2QVA A;  3A0B E;  4WY4 D;  5AW0 B;  4RKU J;  3BCC E;  1NTZ K;  3TGU J;  2HLO A;  1YBK A;  4D6T G;  1VF5 C;  3HRN A;  3C9I A;  2OYH A;  2FYZ A;  3AE5 C;  2NPS A;  1FDO A;  1Y9B A;  3EQ2 A;  2XDJ A;  3CX5 H;  4DCK A;  2N9B A;  3L35 A;  3CWB E;  1GTW A;  1VQM P;  3BCC G;  3D6Y A;  1M1J B;  3AE6 C;  2H8P D;  5APY A;  2CK3 H;  4JQ0 D;  1N73 B;  2ZYA A;  4PJ0 H;  1EDI A;  1PV3 A;  1NHL A;  1RE4 C;  1FOS F;  2UWJ E;  1Q2N A;  1EDL A;  3WUU A;  1SQX K;  1LTI C;  3E1I A;  5TJH A;  4EYY Q;  1NU1 K;  2FFD B;  5AVX B;  2WMM A;  1LP1 B;  4PD4 I;  2YKP A;  2G8Y A;  5CCH A;  1VF5 D;  2AXT H;  2Y0E A;  2QIW A;  3CWB G;  1JY3 N;  1SQB K;  2OQQ A;  3GHG A;  1IFM A;  3L72 J;  4H13 B;  3CCU P;  3TK1 A;  3G9R A;  1QVG O;  2R3C A;  3MIW A;  2ZT9 B;  1GD2 E;  1H88 A;  2E42 A;  1KC8 Q;  2QJY C;  3L73 D;  1L4A B;  5KLV E;  4EOT A;  3AE8 C;  4I7Z C;  3G3Z A;  3HTK B;  3UIA A;  1LTG C;  3T97 A;  1HBW A;  3A2A A;  4OGQ C;  1ZR2 A;  2V4H A;  1FDI A;  1FZB A;  1NO4 A;  1SQQ E;  2D2C B;  1J1E B;  2V7Q H;  1NH4 A;  2KZJ A;  3MUD C;  3H1J J;  3Q5P A;  1HH0 A;  2R32 A;  4CPG A;  2J5U A;  3MTU E;  3V2N A;  5KLV G;  2JEE A;  3OA7 A;  5AVR B;  2WSF J;  2KIK A;  1HUC A;  1S3J A;  1LTJ C;  2QJK B;  2C9N Y;  2FY8 A;  5AW6 B;  4N3Y B;  4W7Z A;  2W6B A;  1X22 A;  4UB8 E;  1M1J A;  2IYO A;  2E75 C;  3EFG A;  1N73 A;  5AW2 B;  1NWQ A;  1SQQ G;  1T3J A;  2OYI B;  4D6T D;  1PP9 J;  5KLV J;  2H7H A;  4OGQ D;  2FFD A;  2M5A B;  3PJS K;  3L36 A;  3K5B A;  3Q3D A;  1KV4 A;  1R5S A;  2K9Y A;  4GOF A;  4JBZ A;  4MN4 C;  3HD7 D;  3BRV B;  5CCG A;  4DZO A;  1J2J B;  3MD0 A;  3BCC D;  1GL2 B;  5GTI E;  2PP6 A;  1SS1 A;  2ZXX A;  1FC2 C;  3KYQ A;  4C46 A;  2L5G B;  5APX A;  1L4A A;  4HJG H;  3CME P;  2KNC B;  3VMZ A;  1LTS C;  1RHZ B;  4L76 A;  3KXD A;  1FJP A;  3M0D C;  2E75 D;  2LXC B;  3BAS A;  2I8D A;  1ZME C;  1LT9 B;  3H1I E;  4IOI H;  2N1T B;  2I1J A;  1L2P A;  3CWB D;  3L75 J;  3VP9 A;  2BEZ F;  3HE5 B;  1S5L E;  1JTH B;  4A7P A;  2O1K A;  1UII A;  1RF1 B;  4QMA A;  1ZLL A;  2C9L Y;  4YXW H;  1URQ C;  2E76 B;  2YKQ A;  1GU4 A;  4DT0 A;  1NTM E;  4IFD K;  1N7L A;  2E74 C;  2W6J H;  3FGA D;  3GF7 A;  4M3L A;  3IR9 A;  3CD6 P;  1HGZ A;  4Y99 B;  1IC2 A;  1JMB A;  4U3F J;  1FAV A;  1SQV E;  4L73 A;  3H1I G;  1PGQ A;  3JCU H;  1FZA A;  2XZR A;  3AE7 C;  2OYI A;  4H44 C;  4NPE A;  3I55 P;  3SWK A;  2WWW A;  1USE A;  5AW5 B;  1KQG B;  3M9B A;  1JY3 O;  1M57 D;  2M5A A;  1K04 A;  5KLI B;  5KKZ B;  2IX7 C;  1EZV D;  1NTM G;  3Q5S A;  1AVO A;  1RE3 C;  2QE7 H;  1BCC E;  1IFJ A;  2KXP B;  1L0N K;  2G3A A;  3FWL A;  3LW5 J;  3MGN A;  1IJD B;  2K88 A;  4GIF A;  1YIT P;  1X9V A;  3RK2 C;  2O1J A;  1IFP A;  3H1I J;  3H1H E;  4BXL A;  1URQ D;  1PGO A;  1SQV G;  2B88 A;  5B5E H;  5KAI E;  3FXE A;  1SQQ D;  2FXP A;  4JF7 A;  2E74 D;  1X8Y A;  4BWN A;  2KSJ A;  1VQN P;  3L71 E;  1PZQ A;  1A02 J;  5H2F E;  2KNC A;  2WZ7 A;  2POH A;  1N8R Q;  1KB9 E;  2C0W A;  4I6M C;  2KUB A;  1P84 D;  1BCC G;  3A7O A;  2KLV A;  4H44 D;  2QJY B;  1AQ5 A;  3Q2Y A;  2ZVN B;  3VP8 A;  1SQV J;  3A0B H;  2N1T A;  3RL0 D;  3H1H G;  1LGH B;  1A02 F;  1NTK D;  4ZKP A;  3HE5 A;  2KP8 A;  1JTH A;  1RF1 A;  2RH0 A;  3AED C;  1GW3 A;  4EDF A;  3SSU A;  1PFI A;  3WUT A;  3VOP A;  1QX8 A;  5APU A;  3V5B A;  4PV1 D;  1SQX E;  3RK2 D;  3WUV A;  3V4Q A;  3U1C A;  2HOD B;  3ABV C;  1NU1 E;  1QL2 A;  2B9B A;  1FZC C;  3O6Q B;  3HD7 B;  3VMX A;  5K5G B;  3GLM A; 
#chains in the Genus database with same CATH homology
 1GTW A;  1FZC B;  4LC1 A;  5CJ0 A;  4WB4 A;  3CL3 D;  1FZE A;  5CMZ A;  3B5N A;  1GK6 A;  1M1J B;  2H8P D;  5APY A;  5KJ7 D;  3KPE A;  1N73 B;  1RF0 A;  2QM7 A;  2YMY A;  2WIT A;  1GK4 A;  1OWA A;  1SQQ K;  1GU5 A;  3TYY A;  1EQ7 A;  3IFM A;  1N7S A;  2FFD C;  1WRG A;  3L4F A;  4GT1 A;  3P8C E;  3BVH A;  1NHL A;  1G2C B;  1RE4 C;  1FOS F;  5CCH C;  4AQR D;  2XU6 A;  2Z4E A;  4WY4 A;  1SQX K;  3RK3 C;  1LTI C;  2P67 A;  3E1I A;  2WT7 A;  1NU1 K;  2FFD B;  1GW4 A;  3GHG C;  5AVX B;  2W27 A;  1CW5 A;  2YKP A;  3SWY A;  2XNX A;  5CCH A;  3RK3 B;  5CCG C;  1FDM A;  1KIL B;  1RE3 A;  3GHG B;  1S9K E;  1JY3 N;  1IFI A;  1SQB K;  3GHG A;  4I1L A;  1SVF A;  1YTZ T;  1IFM A;  1N86 A;  2YO3 A;  1NTK K;  1CI6 B;  1L4A C;  3TK1 A;  2IFM A;  2P1J A;  2R3C A;  2WPQ A;  1JY2 N;  3MIW A;  1GD2 E;  1H88 A;  2LKM A;  1DX7 A;  3CLQ A;  3TSI A;  1IK9 A;  1MZ9 A;  2E42 A;  4EIJ A;  4B86 A;  2Q9I A;  5AVW B;  1L4A B;  4HH2 A;  4EOT A;  1SFC B;  1N7S D;  1T2K C;  3G3Z A;  3HTK B;  3UIA A;  3VN0 A;  2E43 A;  5APQ A;  1LTG C;  3HTK A;  3T97 A;  3SWF A;  2XV5 A;  1HBW A;  1J1E C;  3A2A A;  3II6 A;  3V2P A;  1ZR2 A;  1SP4 A;  1T3U A;  5CHX A;  4GKG A;  1H8A A;  1FZB A;  4HYT B;  2FYU K;  2P2U A;  1NO4 A;  5CCH D;  3U59 A;  2WPR A;  1FU1 A;  1GZL A;  1DEB A;  2Q5U A;  1J1E B;  3RK3 D;  1MUU A;  4IFM A;  2IFN A;  4C7N A;  1H89 A;  3OAK A;  1NH4 A;  5AW9 B;  3NXS A;  1LTB C;  3U1A A;  1RY3 A;  1Z56 A;  1IFD A;  1AFO A;  4N78 E;  1HH0 A;  2R32 A;  4KHX A;  5AW8 B;  1JOC A;  5KLV K;  3MTU E;  3V2N A;  5CCG D;  2HOD A;  2JEE A;  3OA7 A;  2YNY A;  2R5D A;  2WSE H;  5AVR B;  1G1I A;  1HUC A;  1LTJ C;  5CJ4 A;  3HD7 A;  4XA4 A;  2C9N Y;  1HJB A;  1L4A D;  5AW6 B;  2J59 M;  4N3Y B;  4W7Z A;  2OYI C;  1FZC A;  2W6B A;  4AYC A;  1LTJ B;  3M0A A;  1M1J A;  3EFG A;  1N73 A;  1FZF A;  1J1D B;  1LTJ A;  1E5W A;  4I2L C;  5AW2 B;  1CSB A;  1NWQ A;  1T3J A;  2OYI B;  1T2K D;  5AVS B;  1NAF A;  2M3B A;  1L0L K;  4LGD E;  1G2C A;  1ZV8 A;  5BU8 B;  2H7H A;  5AVY B;  1KIL C;  1MV8 A;  1JMM A;  2Q3I A;  2A45 I;  3RL0 C;  2P7J A;  2WSC H;  2FFD A;  2HPC B;  5APW A;  2W6A A;  1RE4 A;  3I5C A;  2WSF H;  3L36 A;  3OJA B;  4JYB A;  3RL0 B;  1KIL A;  1QL1 A;  1GL2 C;  5AVQ B;  1ZR4 A;  1KZU B;  3HD7 D;  3BRV B;  1OXZ A;  1CZQ A;  1CI6 A;  2GUS A;  1SFC C;  5CCG A;  4DZO A;  1J2J B;  3MD0 A;  4OH8 B;  4XE5 B;  1GL2 B;  1KFN A;  2PP6 A;  1SQP K;  3WMM 0;  3KDP B;  2A45 H;  1GL2 A;  3KYQ A;  4C46 A;  1DH3 A;  5AVU B;  1NOH A;  2L5G B;  3H32 B;  5APX A;  3BRT B;  1L4A A;  3NMD A;  2Z5I A;  1SFC A;  3VMZ A;  3B8E B;  2Z5H A;  2PAJ A;  1LTS C;  1N2D C;  1FJP A;  1LT9 C;  3M0D C;  3V4W A;  1M7L A;  5AW4 B;  1FZG A;  2YO2 A;  5KTB A;  3BAS A;  2CPS A;  2N1T C;  1LTT C;  2H43 A;  1YTZ I;  2KOG A;  1LT9 B;  2KB7 P;  1JUN A;  1JO5 A;  1LT9 A;  2KYV A;  1RF1 C;  3TNU B;  3VTP C;  2N1T B;  4RES B;  2I1J A;  1KIL D;  5AW1 B;  1G1J A;  3HUS B;  3VP9 A;  2NPS C;  2A45 G;  3HE5 B;  1JTH B;  3P7K A;  2O1K A;  1MFZ A;  1RF1 B;  1ZLL A;  2C9L Y;  2OYH B;  1URQ C;  5APT A;  2YKQ A;  1LTA C;  1GU4 A;  2C0X A;  3NFQ A;  2NPS B;  3P8C D;  1GL2 D;  2O01 H;  1SLQ A;  1NKZ B;  3MUD A;  1IO4 A;  4IFD K;  1N7L A;  3V2R A;  1J1D C;  3LID A;  3P32 A;  2J58 A;  4Y99 C;  1URQ B;  3KQG A;  1ZN5 A;  1SFC D;  4M3L A;  5APS A;  5AVV B;  3IR9 A;  2FKW B;  3B5N C;  2FXM A;  1HGZ A;  3H6P A;  1RF0 C;  4Y99 B;  1IC2 A;  3R2P A;  1JNM A;  1FAV A;  1YYC A;  2XKM A;  1VPC A;  1S9K D;  3B5N B;  1FZA A;  2XZR A;  3M9Q A;  2OYI A;  3BAT A;  2GM4 A;  3N4X A;  4WY4 C;  2Q7C A;  3NTN A;  5AVZ B;  2WWW A;  2HFE D;  1N7S B;  3N7N A;  5AW5 B;  3M91 A;  2N1T D;  5APV A;  4W80 A;  2HG5 D;  3M9B A;  1JY3 O;  1NTM K;  4N6J A;  2HPC A;  1FJK A;  2IX7 C;  1HVV A;  4WY4 B;  3CI9 A;  2JJL A;  4DOJ A;  2WT7 B;  1RE3 C;  2YKO A;  1JY2 O;  1IFJ A;  5BU5 A;  1L0N K;  1FBM A;  1JCC A;  2CPB A;  1FOS E;  3MGN A;  1IJD B;  4C7R A;  1GDT A;  4GIF A;  2NPS D;  1X9V A;  3RK2 C;  1X79 B;  2O1J A;  4IFF A;  2WTY A;  2ZFC A;  1SQV K;  2MJZ A;  2BAS A;  1URQ D;  1W2E A;  3VMY A;  3M06 A;  3M9H A;  1KFM A;  3RK2 B;  1JCD A;  1LWU C;  4LLH A;  2QM8 A;  4JF7 A;  1NKN A;  1X8Y A;  2R5B A;  3H32 A;  5AW3 B;  1HTL C;  3P8M C;  2KSJ A;  3A5T A;  1KQL A;  5KJ7 C;  1A02 J;  2WZ7 A;  3B5N D;  5AW7 B;  1XTG B;  2POH A;  1LWU B;  2M8R A;  4N78 D;  3VYI A;  2C0W A;  1LWU A;  2I1K A;  2GUV A;  4I6M C;  3HUS C;  1WT6 A;  3A7O A;  3PP5 A;  3LW5 H;  5KJ7 A;  1IFN A;  2KLV A;  3M0D A;  2HYN A;  1XTC C;  1AQ5 A;  4WY4 D;  5AW0 B;  2OYH C;  3VP8 A;  3TNU A;  5BVZ A;  2N1T A;  3RL0 D;  1LGH B;  2VRS A;  4W7Y A;  4AUW A;  1NTZ K;  3HE4 B;  2IPP A;  1A02 F;  3LIE A;  3HUS A;  2HLO A;  1JY3 P;  4O9B A;  4ZKP A;  3HE5 A;  2KP8 A;  1JTH A;  3HE4 A;  3V2Q A;  4ZKU A;  3A3Y B;  3HRN A;  4JYC A;  3C9I A;  1RF1 A;  4C7N B;  1GW3 A;  2OYH A;  2FYZ A;  1JY2 P;  1PFI A;  5AVT B;  3L37 A;  2NPS A;  3VOP A;  5APU A;  3V5B A;  3HD7 C;  3RK2 D;  1VDF A;  3V4Q A;  3U1C A;  2HOD B;  1URQ A;  2WPS A;  1QL2 A;  1T8Z A;  1FZC C;  3EQ2 A;  4WBA A;  3O8Z A;  1M1J C;  2XDJ A;  2OAR A;  1HWT C;  3HD7 B;  3VMX A;  1N73 C;  1HGV A;  2ZXE B;  2N9B A;  3L35 A;  1N7S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...