3V2RA

Compcc in complex with fatty acids
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
45
structure length
45
Chain Sequence
b'MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cartilage Oligomerization matrix protein (coiled-coil domain
publication title COMPcc in complex with fatty acids
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 18
structure length 45
sequence length 45
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3v2rA00
3V2PA 1FBMA 1MZ9A 1DEBA 3V2RA 3V2QA 1VDFA 3V2NA
chains in the Genus database with same CATH superfamily
1CW5A 1URQD 2K9JA 5TJHA 4U3FE 3U59A 2BCCJ 4NPFX 1USEA 3GW6A 2ZVOB 1HBWA 1JCCA 1KTMA 2KZIA 3RBXA 5E79E 1GU5A 2JDIH 1J1EC 1OW6A 1OW7A 2SPZA 1KB9H 2AXTE 2Z5HA 1L4AD 2RMZA 3A0BE 3NXSA 1PGPA 1N7SA 4N3YB 2POHA 4N78D 2P7JA 3H1IE 3I56P 1M1JA 2JEEA 2E76D 4L75A 1CZQA 4QMAA 2WZ7A 1Q81Q 1S5LE 3H1KG 3VMXA 3VTPC 1N7SB 2Z5IA 1IFNA 2OGUA 3D71A 1M1JB 3CMAP 1HH0A 1KN7A 5APTA 1YBKA 1K04A 2WPVB 2YNYA 2RN0A 3MGNA 3L74G 1KFMA 4U3FJ 4H44C 1X0TA 1VQ6P 2QJYB 3KXDA 4I7ZB 1S9KD 1PP9G 4BXLA 3I5CA 2IZ0A 1P84I 1EZVE 3MP7B 3KQGA 3VN0A 1KILD 2E43A 3SWYA 3AE9C 3G4SP 1URQB 1KB9E 2K3RA 2WPSA 4GIFA 3GF3A 3HUSB 2IBZE 3G9RA 1GL2A 1NKZB 2WVRA 1SQVE 1JB0J 3T97B 3FX0A 1SQVK 2OYHB 5AW0B 3H1IJ 1RE3A 3V5BA 1E5WA 1DIPA 3HTKB 1VQPP 1L4AB 4UB6H 2J59M 4RKUJ 2Y9ZA 3H25A 4WY4A 3M0DA 3L73G 2PFXA 3RK3E 1L2PA 3Q5SA 4I6MC 1FZCA 2D2CC 3USSA 5KKZB 2E76B 2WSCH 3GF7A 3IFMA 1XTCC 5EFWB 3TNUA 3IN6A 2KK7A 2FY8A 1BSNA 1WMKA 5AW2B 1ZRTD 1LP1A 3RGUA 3V4QA 1RY3A 4IOIH 5B66H 2FXPA 4DJGA 3A7OA 3U1AA 3QH9A 1X8YA 3P32A 1YJNP 2H8PD 3A3YB 1PL5A 3WMM0 4KT0J 1KILB 2H43A 4OGQC 4IFDK 5K5GB 3L75D 1JTHB 2WSEH 4UB6E 5CJ4A 5CJ0A 1NTZD 1ZXGA 1VQMP 3VP8A 1KB9I 3MIWA 4PD4H 1NAFA 5AW7B 1Q82Q 2IBZI 2JP3A 2HPCA 4OH8B 3D6YA 3AEBC 5AVWB 2AEJA 2Y0EA 1RF0A 2WITA 4WVZA 1EQ7A 1IK9A 1FDMA 3MUDC 1L0ND 3Q3DA 3SFEC 5B66E 3D70A 2GA1A 2R5BA 1AA0A 3H1KE 4NPDA 3CCUP 2E74C 1IZNB 1BCCE 2FFDC 1USDA 3AE3C 1FOSE 5KJ7D 1LNQA 1VQ9P 4C7NA 1N73B 4WWIA 3B71A 1HTLC 3EFGA 3CPWO 1VQLP 1M7LA 1CI6A 5CCGA 1FDOA 4RO0A 3H1HE 3E1RA 1GMJA 4PD4E 2A45G 1BGYE 1TU3F 1LWUA 1A02F 1QL1A 1KQFB 2WSFH 3CCVP 2WT7B 3VP9A 2KYVA 3SWFA 1SQQG 3B5ND 1NTZG 3V2QA 4IL6X 3AEAC 1FZBA 3W68A 1T2KD 4ZKUA 2IPPA 2NPSD 1VL2A 3TGUJ 5AVRB 3C1LA 2ZAEB 3AE8C 1IFPA 2Y0CA 3CXHH 4YXDC 1VF5D 2QM8A 5APQA 2AXCA 1BCCJ 1W2BO 4N78E 3HE5B 2KSEA 5KLVD 1G2CB 5KJ7A 1L0NG 3Q2YA 5AW4B 1W2EA 3L72D 3JC22 3AE1C 2Q9IA 1YHQP 3G71P 4L73A 2JKVA 2HG5D 3H1HJ 2KS1A 1NAYA 1OVRA 1NWQA 2MKVA 1BE3E 2IYPA 2RH0A 1BGYJ 3H32A 2ZYAA 2KXPB 4DZOA 3A0HH 1GL2C 4KJMA 3F89A 1NGMB 2KS1B 2Q6QA 1YI2P 2V7QH 1RE3C 4GT1A 1SP4A 4H13C 2AEMA 1KILE 4PD4I 2QJKC 1LJ2A 2LXBA 1H8AA 1SS1A 4DOJA 4AUWA 4WY4C 3B5NB 3M0DC 3WUUA 3AEGC 1MUUA 3CXHE 3B8EB 3L71G 1H89A 1FZCC 1T6AA 2KIKA 2UWJE 3BVHA 1J2JB 3MD0A 2NPSB 3M0AA 1OFCX 1DX7A 1SVFA 3EWKA 1NVOA 1T8ZA 2PRRA 3CCMP 3TYYA 2XV5A 3II6A 1ZOYC 3MTUE 3RK2D 1VF5B 1SFCA 2IX7C 3FWNA 2OYIB 1GW3A 2K37A 1FU1A 3UIAA 2O1KA 1UIIA 1BE3J 2LXCB 2WSFJ 1IO4A 3L72G 4BRYA 3A0HE 4U7JA 4YPCA 2C9NY 5DJUB 2B89A 2OARA 4JQ0D 2IFNA 1GK6A 2QSIA 2B87B 3M9QA 1ZRTE 2YKPA 2GUSA 4RESB 2E75D 2QE7H 2R44A 3M91A 1R5LA 4ASWA 2L5GB 2RKLA 3CWBJ 1JY2N 4PV1C 1M8OB 3L75E 3AE2C 2WQYC 1KC8Q 2M3EA 1GDTA 4DCKA 1RF0C 2YMYA 1LTSC 1SQPG 1NTKG 1MFZA 1LT9A 4L74A 1VPCA 2W8ZA 4K35A 3L74D 2OTJP 3GG2A 1K05A 1DD4A 3Q1MA 4D6TD 1GTWA 4YTPC 3RK2B 1OVVA 2V7QJ 5CCGC 3D6ZA 1FJKA 1L0NE 1WRGA 2YIUC 2DW3A 4JBZA 1Y47A 3TK1A 5CBOA 2BEZF 2FYNB 1LWUC 1T3UA 1SQBE 1VQ7P 1SQBK 2E75B 1LTJB 2M8RA 3QWOC 2R5DA 1R8EA 3L75J 3L73D 2E5TA 2GUVA 3PHLA 5BU5A 2YKOA 1Y9BA 3H6PA 2G3AA 4H0LC 1RHZB 5AVVB 2HYNA 1JY3P 1AJYA 1CSBA 1KQLA 1IJDB 1GU4A 1NU1D 4TLFA 4LLHA 3H1JJ 2XU6A 2FYZA 2QRXA 3S1KA 3BCCD 3FWLA 3E1IA 2QJPB 1URQA 3VYIA 1NTMG 2FXOA 1KV4A 4D6TG 5APYA 3HUSA 2O01J 4C7RA 1FDIA 1SQXD 3T97A 5KAIH 4EYYQ 2OYHA 2IDBA 1OXZA 3OJAB 3FXDA 2Y9YA 4C46A 1SQBJ 1X9VA 5KLVE 1PZQA 3HTKA 5KLVK 5CCHC 3L72E 1L4AA 3KYQA 4JF7A 3OA7A 3RL0C 1PPJG 1Q86Q 3AE6C 1ZW0A 3S9OA 1L0LE 1L0LK 1K9MQ 1YIJP 4XA4A 3SWKA 5KLIC 1OWAA 2FYUD 2QVAA 1VQ4P 5B5EH 1NH4A 1NOHA 1SFCC 1NU1G 5AVYB 1UIXA 5KAIE 5APWA 2HFED 3BCCG 2ZYGA 1KILA 3HD7D 1EXIA 2W6BA 5KLVJ 3GHGA 1JTHA 2QG4A 3IAOA 3RK3C 4PJ0H 2C0XA 2BCCD 1SQVJ 1WT6A 1SQXG 4Y99C 4EI2A 3V4WA 4N6JA 2L91A 1J1DC 2N1TD 3GHGB 3AECC 1SQQD 5DJTB 2ZXEB 1S4XA 1RF1A 1L0LJ 1MZ9A 2ZT9C 2JJLA 5CBNA 3HRNA 3HE4A 3KPEA 1S72P 3R2PA 1JCDA 1M56D 4HYTB 3A2AA 2HODA 1RF1B 2AEFA 5B5EE 3HE4B 2XNDH 2HLOA 2P10A 1LT9C 2P58A 1ZV8A 2FYUG 3CCEP 1N73A 2HODB 3F5HA 3PLNA 1RE4C 1S1CX 4OVNF 3CD6P 4IL6H 4PJ0E 2NRGA 1Q7YQ 4U3FD 4A7PA 1JY2O 3HD7B 3LIEA 2WT7A 4IFFA 3L74E 1YJ9P 3JCUH 3FGAD 1QX8A 1U7MA 4D6TE 2BCCG 1K73Q 3MZWB 1PP9E 2YXRB 1RQVA 3WUVA 4H44D 3CC2P 2WSCJ 2YMKA 1Y8AA 2N1TB 4Z1MH 3H1ID 2R3SA 1N7SC 4WBAA 2H7HA 1M1JC 3L71D 2XNXA 3HE5A 1Q90D 1G2CA 2YIUB 1JMMA 2ITAA 2Q7CA 2Q3IA 3B4SA 3A5TA 4IL6E 2QJYC 3RL0D 3H1KJ 4I7ZC 3V6IA 1J1EB 3L73E 1HF9A 2IFMA 1EC5A 1LTGC 1S3JA 3ZDMA 3N7NA 3KHUA 2WSEJ 3HUSC 3MHVA 2JR8A 3L74J 3JCUE 2D2CD 1PFIA 1NU1E 4U3FG 2OTKE 1VQ8P 2OYHC 2PP6A 2Y0DA 1PP9J 3LIDA 4IFMA 3BCCE 3C9IA 3CCJP 2KUBA 5APSA 1LTTC 1L4AC 5AW8B 1OW8A 5AVSB 3B5NA 2ZFCA 3KDPB 1YQ3C 2Q1KA 1S9KE 1GK4A 5AVUB 1SQXE 2E76C 4H44B 2C9LY 1SQXK 2NPSA 3RK3D 1SLQA 3H1IG 3NTNA 3P8MC 5AVQB 1SQPD 4OGQD 1NTKD 1AV1A 1FJPA 1OVUA 2A45H 1ZN5A 3L73J 2OYIA 2QM7A 1M57D 2A06D 3VOPA 1FZAA 1JY2P 5BU8B 1DEEG 4HJGH 1OX3A 1XTGB 2KLUA 2P67A 3RL0g 3RL0B 1PGJA 1Z56A 2WWWA 3CX5D 2B87A 1KILC 2E42A 2FYUE 2QEXP 1FE6A 1YTZT 3BCCJ 1EZVG 5KLIB 2W27A 2M5AB 2D2CB 4NPEA 1NJIQ 3PRJA 4CPGA 1GD2E 3L70D 2KZJA 2XZRA 1QLED 1YTZI 5APXA 2E74D 2WPRA 1DEBA 5AW3B 1AQTA 2BCCE 2W83C 3S4RA 5H2FH 3RK3B 4GOFA 1X79B 2HR3A 1EDKA 1SQQE 2YXQB 1VQKP 1OZHA 2LKMA 3TGUD 1SQQK 1NTZE 4OGQB 3AE7C 1BDCA 2PAJA 1NTZK 5APUA 1N73C 1G1JA 1JUNA 1OIPA 2A06G 1H88A 4HB1A 2BEQD 2KOGA 1NTMD 3Q5RA 2ZVNB 1YYCA 1QEXA 4GOEA 1K8AQ 2WTYA 2W6JH 2MJZA 3PH0A 5GTIH 2KNCB 1L0NK 1LTJA 2Q3EA 3R4YA 2KI7B 5BVZA 1ZR4A 1PPJD 3L70G 1BSHA 1PV3A 3M06A 5AVXB 1FZFA 4XE5B 2E74B 5H2FE 1H0TB 2FFDB 1HGVA 1SQQJ 2K9JB 1NTZJ 5GTHH 1S5LX 1KYOD 1R5SA 2K1AA 1GL2D 3H1LD 5C39A 3CCSP 1YITP 1AVYA 2A45I 1IK7A 1NHLA 1FBMA 3V2NA 3TGUG 3VMYA 4H13D 1N7LA 5KJ7C 1LTBC 3O6QA 5AVZB 3L71E 1KFNA 4WY4D 1KORA 1BCCG 5GTIE 1M90Q 1L0NJ 3KZIH 3CC7P 4KHXA 1BE3D 4W7ZA 2CPSA 2B88A 3O6QB 1RH5B 4LC1A 2JWAA 2G8YA 3E7KA 4B86A 2OYOA 3BRTB 1ZP0C 3OW2O 1M1KQ 1DD3A 3H1HG 3TSIA 2Q5UA 3AE4C 2J58A 2WMMA 1FOSF 3B5NC 1BGYG 4HKZH 5AW1B 3W67A 4Y28J 4M3LA 5GTHE 1T2KC 3Q5PA 2XKMA 2NPSC 4ZNCA 3CXHD 3CX5H 3P7KA 1EDJA 3CWBD 3CC4P 1MFTA 3G3ZA 3CI9A 1FAVA 1JY3N 1VF5C 1PGQA 2FKWB 2OYIC 2B9BA 2ZJSE 4JPZB 3L71J 4GODA 1GL2B 3H1LG 1FS0E 2K88A 3CLQA 3SFDC 1QGKB 3KZIE 1EDLA 2PGDA 5M1BA 2W6AA 4H13B 3SSUA 3P8CD 4PV1D 1YQ4C 3JSVC 1SQPE 1GZLA 2YKQA 1NTKE 2QJKB 1SQPK 1NTKK 4WY4B 2QA4P 5AW5B 4JYCA 1JOCA 2A06E 2R3CA 1ZR2A 3BATA 1FZCB 3L72J 1BE3G 5KAFH 1KMIZ 2KB7P 4OWFA 1JNMA 3TNUB 1KD1Q 1ZMEC 3PTZA 3VMZA 1JM0A 3CX5E 1GW4A 2IYOA 1N8RQ 3VMAA 1LP1B 1VQOP 2M0BA 1PGOA 1LT1A 2C0WA 2O1JA 1NO4A 3IR9A 5CCGD 3V2PA 1JMBA 3L70E 1EZVI 3IF4A 3LW5H 5TISH 3CWBG 1MV8A 3G6EP 1W5CE 3RBZA 3RK2C 1P84D 3FXEA 5AW9B 2J5UA 2QIWA 1SQPJ 2IZ1A 2KSJA 3H1JD 1HVVA 1NTKJ 1D7MA 1AQ5A 3HD7A 2H89C 1X22A 5KAFE 2YO2A 2OTLP 2FYNC 4H0LD 3TGUE 2HPCB 4PV1B 1QVFO 1QVGO 2BASA 2KLVA 3CCQP 1KYOH 2E75C 1LTJC 2N1TA 1SQBD 1HGZA 1NTME 4EDFA 1NTMK 4LGDE 3L4FA 4W7YA 1JEKA 1FZEA 1RQUA 3L70J 1IC2A 5TISE 1JO5A 4C7NB 2I8DA 1QL2A 1HJ0A 3WUTA 3CX5I 4R4MA 1CI6B 4RJTA 3CCRP 3L75G 5CCHD 1PPJE 2QJPC 1HUCA 2FBWC 4R4LA 1NKNA 4MN4C 1LWUB 5L8RJ 1N2DC 3WU2H 4GKGA 3O8ZA 3GMAA 3K5BA 5CHXA 2P2UA 2ZXXA 1HJBA 1URQC 3H1JG 1KYOE 1EZVD 1E79H 3I55P 3H1LE 2CPBA 4TT3H 1U7JA 4HH2A 4AYCA 1KB9D 1VQNP 1BDDA 1NTMJ 3ABVC 4H0LB 1NU1K 4D6TJ 2OQQA 3AEDC 2IBZD 1IFMA 1MKMA 1SQVD 1G1IA 1SFCD 2R32A 1T3JA 3LW5J 4EIJA 4I2LC 4ASVA 4I1LA 1SQBG 2O3JA 1HWTC 3N4XA 2E5YA 4XFJA 1VDFA 2P1JA 4YXWH 1L0LD 3L36A 5KKZC 2GM4A 1KQGB 5CCHA 2O01N 4W80A 2NZ2A 2N9YB 3WU2E 2LR2A 3H32B 2W90A 1S2EA 3L37A 4BWNA 1YJWP 2ZT9D 2N9BA 2I1JA 1FZGA 1DH3A 3CWBE 1KZUB 5KTBA 3H1LJ 1VQ5P 2M5AA 3OAKA 3CCLP 1NU1J 1KQSO 2JWDA 3L35A 3GHGC 3AEFC 2FYUK 1Q2NA 1AFOA 4UB8H 2H88C 1JY3O 3NMDA 4ZKPA 1N86A 4WB4A 1KYOI 1EDIA 5KLVG 1P84H 3P8CE 2I1KA 2IBZG 2YO3A 1SQXJ 1SQVG 1U57A 1SFCB 1RF1C 4K3AA 2K9YA 5AVTB 2VRSA 3NFQA 4L76A 2CK3H 1OMIA 4GDOA 3TF5A 3BRVB 4BRYB 1L0LG 4JYBA 1ZLLA 3AEEC 4EOTA 2XDJA 2M3BA 2O01H 4O9BA 3CMEP 1NYHA 3PJSK 1LTAC 5E79H 4Y99B 1PIXA 3TDKA 1J1DB 2AXTH 3GLMA 3EQ2A 3H1KD 1FC2C 3A0BH 1N7SD 1BCCD 1IFDA 1IFIA 3HD7C 2ZT9B 4UB8E 2FYUJ 1LTIC 2ZYDA 2KNCA 3AE5C 5APVA 3ITKA 2Z4EA 3M9HA 2JO1A 3BASA 4DT0A 1IFJA 3CXHI 1S5LH 3MUDA 3PP5A 1P84E 3V2RA 4AQRD 3H1HD 5AW6B 1RE4A 2V4HA 2KP8A 2WPQA 1LGHB 1A02J 4PD4D 2N1TC 4ZMDA 3H1JE 2WSSH 1BGYD 1PP9D 3EFFK 3U1CA 1H0TA 1EXJA 1AVOA 3M9BA 5CMZA 2FFDA 1LT9B 3CL3D 2FXMA 3C8VA
chains in the Genus database with same CATH topology
3B8EB 1CW5A 4IFFA 1URQD 1GL2B 1H89A 1FZCC 3U59A 3CLQA 3BVHA 1J2JB 3MD0A 2NPSB 3M0AA 1DX7A 1SVFA 1T8ZA 1HBWA 1JCCA 2W6AA 3P8CD 3TYYA 1GZLA 2YKQA 2N1TB 2XV5A 3II6A 1GU5A 3MTUE 1SQPK 1J1EC 3RK2D 1SFCA 1NTKK 2IX7C 1N7SC 4WY4B 5AW5B 4JYCA 4WBAA 2OYIB 2Z5HA 1L4AD 1GW3A 2H7HA 1JOCA 1M1JC 1FU1A 3UIAA 2O1KA 2XNXA 2R3CA 1ZR2A 3NXSA 3BATA 1FZCB 1IO4A 1N7SA 2KB7P 4N3YB 2POHA 4N78D 2P7JA 2C9NY 3HE5A 1G2CA 1JNMA 1M1JA 2OARA 1JMMA 2Q7CA 2JEEA 3TNUB 2Q3IA 1CZQA 3VMZA 2IFNA 2WZ7A 1GK6A 3A5TA 1GW4A 3RL0D 3M9QA 2YKPA 1J1EB 3VMXA 3VTPC 1N7SB 2GUSA 4RESB 2C0WA 2Z5IA 1IFNA 2IFMA 1LTGC 2O1JA 1M1JB 3N7NA 1NO4A 1HH0A 3IR9A 5APTA 5CCGD 3V2PA 3M91A 2L5GB 2YNYA 3HUSC 3LW5H 3MGNA 1JY2N 1KFMA 1PFIA 1MV8A 2OYHC 2PP6A 1S9KD 3LIDA 4IFMA 3RK2C 3I5CA 3C9IA 5AW9B 3KQGA 5APSA 1GDTA 1LTTC 1L4AC 3VN0A 1RF0C 1KILD 5AW8B 2E43A 2KSJA 3SWYA 1URQB 1LTSC 2YMYA 1HVVA 5AVSB 2WPSA 3B5NA 1AQ5A 1MFZA 1LT9A 4GIFA 3HD7A 2ZFCA 3KDPB 1VPCA 1S9KE 1GK4A 3HUSB 1GL2A 5AVUB 1NKZB 2YO2A 2C9LY 1SQVK 2HPCB 2OYHB 1SQXK 5AW0B 2NPSA 1GTWA 3RK3D 2BASA 2KLVA 1SLQA 1RE3A 3V5BA 3RK2B 1E5WA 3NTNA 3HTKB 3P8MC 1LTJC 5AVQB 1L4AB 2OYIC 2N1TA 2J59M 1FJPA 5CCGC 2A45H 1HGZA 1ZN5A 4WY4A 1FJKA 3M0DA 2OYIA 1NTMK 1WRGA 4LGDE 2QM7A 3TK1A 3L4FA 4I6MC 4W7YA 3VOPA 1FZCA 1FZAA 1JY2P 2WSCH 5BU8B 1LWUC 1FZEA 1T3UA 1XTGB 2P67A 1IC2A 3RL0B 3IFMA 1XTCC 1JO5A 4C7NB 3TNUA 1SQBK 1Z56A 1LTJB 2M8RA 2WWWA 1QL2A 5AW2B 2R5DA 2E42A 1KILC 1CI6B 1YTZT 2GUVA 5CCHD 3V4QA 1RY3A 1HUCA 2W27A 5BU5A 2YKOA 3H6PA 1NKNA 1GD2E 1LWUB 1N2DC 5AVVB 3A7OA 3U1AA 2HYNA 1JY3P 4GKGA 3O8ZA 1CSBA 1KQLA 1X8YA 1IJDB 2XZRA 1YTZI 5APXA 1GU4A 3P32A 5CHXA 2P2UA 4LLHA 2H8PD 3A3YB 3WMM0 1HJBA 1URQC 1KILB 2H43A 2XU6A 2FYZA 2WPRA 4IFDK 1DEBA 5AW3B 1JTHB 2WSEH 2CPBA 3E1IA 5CJ4A 5CJ0A 1URQA 4HH2A 4AYCA 3VP8A 3VYIA 3MIWA 1NAFA 1NU1K 5AW7B 5APYA 3HUSA 3RK3B 4C7RA 1IFMA 1X79B 1G1IA 3T97A 1SFCD 2LKMA 2R32A 2HPCA 1SQQK 4OH8B 2OYHA 1T3JA 4EIJA 1OXZA 3OJAB 4I2LC 2PAJA 4C46A 1NTZK 1X9VA 5APUA 5AVWB 4I1LA 1N73C 1HWTC 1G1JA 3HTKA 1JUNA 3N4XA 5KLVK 5CCHC 1L4AA 1RF0A 1VDFA 2P1JA 2WITA 3L36A 1EQ7A 3KYQA 1IK9A 1H88A 2GM4A 2KOGA 4JF7A 1FDMA 3OA7A 1YYCA 3RL0C 5CCHA 4W80A 2R5BA 2WTYA 3H32B 2FFDC 2MJZA 1L0LK 1FOSE 5KJ7D 4C7NA 1N73B 3L37A 1L0NK 1LTJA 4XA4A 1HTLC 1OWAA 3EFGA 1M7LA 5BVZA 1ZR4A 2N9BA 2I1JA 1CI6A 5CCGA 1FZGA 1DH3A 1KZUB 5KTBA 3OAKA 3M06A 5AVXB 1NH4A 1FZFA 2A45G 1NOHA 1SFCC 4XE5B 1LWUA 5AVYB 1A02F 1QL1A 2FFDB 2WSFH 3L35A 2WT7B 3GHGC 5APWA 3VP9A 2FYUK 1AFOA 2KYVA 1HGVA 2HFED 3SWFA 1JY3O 3B5ND 3NMDA 4ZKPA 1KILA 3HD7D 1N86A 3V2QA 4WB4A 2W6BA 1GL2D 3GHGA 1JTHA 1FZBA 3RK3C 3P8CE 1T2KD 2I1KA 4ZKUA 2IPPA 2C0XA 2A45I 2NPSD 2YO3A 1NHLA 1WT6A 1FBMA 3V2NA 5AVRB 1SFCB 4Y99C 1RF1C 3VMYA 3V4WA 4N6JA 5AVTB 1N7LA 1J1DC 2VRSA 5KJ7C 1LTBC 3NFQA 2N1TD 5AVZB 3GHGB 1KFNA 2ZXEB 4WY4D 3BRVB 2QM8A 1RF1A 5APQA 1MZ9A 4N78E 4JYBA 1ZLLA 2JJLA 3HE5B 1G2CB 3HRNA 5KJ7A 4EOTA 2XDJA 3HE4A 3KPEA 5AW4B 4KHXA 4W7ZA 1W2EA 2M3BA 2O01H 2CPSA 3R2PA 1JCDA 4O9BA 4LC1A 2Q9IA 4HYTB 1LTAC 3A2AA 2HODA 4B86A 1RF1B 4Y99B 3BRTB 2HG5D 1J1DB 3TSIA 3HE4B 3EQ2A 2Q5UA 1NWQA 2HLOA 2J58A 1FOSF 1N7SD 3H32A 3B5NC 1IFDA 1LT9C 1IFIA 3HD7C 1LTIC 1ZV8A 5AW1B 4DZOA 1N73A 2HODB 1GL2C 5APVA 4M3LA 2Z4EA 3M9HA 1RE4C 1T2KC 3BASA 2XKMA 2NPSC 1IFJA 1RE3C 4GT1A 3MUDA 3P7KA 3PP5A 3V2RA 1SP4A 4AQRD 3G3ZA 3CI9A 5AW6B 1JY2O 1FAVA 1RE4A 2KP8A 2WPQA 1LGHB 1A02J 2N1TC 1JY3N 1H8AA 3U1CA 4AUWA 4DOJA 4WY4C 3B5NB 3M9BA 3M0DC 5CMZA 2FKWB 1LT9B 2FFDA 3CL3D 2FXMA 1MUUA 3HD7B 3LIEA 2WT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2P A;  1FBM A;  1MZ9 A;  1DEB A;  3V2R A;  3V2Q A;  1VDF A;  3V2N A; 
#chains in the Genus database with same CATH topology
 1CW5 A;  1URQ D;  2K9J A;  5TJH A;  4U3F E;  3U59 A;  2BCC J;  4NPF X;  1USE A;  3GW6 A;  2ZVO B;  1HBW A;  1JCC A;  1KTM A;  2KZI A;  3RBX A;  5E79 E;  1GU5 A;  2JDI H;  1J1E C;  1OW6 A;  1OW7 A;  2SPZ A;  1KB9 H;  2AXT E;  2Z5H A;  1L4A D;  2RMZ A;  3A0B E;  3NXS A;  1PGP A;  1N7S A;  4N3Y B;  2POH A;  4N78 D;  2P7J A;  3H1I E;  3I56 P;  1M1J A;  2JEE A;  2E76 D;  4L75 A;  1CZQ A;  4QMA A;  2WZ7 A;  1Q81 Q;  1S5L E;  3H1K G;  3VMX A;  3VTP C;  1N7S B;  2Z5I A;  1IFN A;  2OGU A;  3D71 A;  1M1J B;  3CMA P;  1HH0 A;  1KN7 A;  5APT A;  1YBK A;  1K04 A;  2WPV B;  2YNY A;  2RN0 A;  3MGN A;  3L74 G;  1KFM A;  4U3F J;  4H44 C;  1X0T A;  1VQ6 P;  2QJY B;  3KXD A;  4I7Z B;  1S9K D;  1PP9 G;  4BXL A;  3I5C A;  2IZ0 A;  1P84 I;  1EZV E;  3MP7 B;  3KQG A;  3VN0 A;  1KIL D;  2E43 A;  3SWY A;  3AE9 C;  3G4S P;  1URQ B;  1KB9 E;  2K3R A;  2WPS A;  4GIF A;  3GF3 A;  3HUS B;  2IBZ E;  3G9R A;  1GL2 A;  1NKZ B;  2WVR A;  1SQV E;  1JB0 J;  3T97 B;  3FX0 A;  1SQV K;  2OYH B;  5AW0 B;  3H1I J;  1RE3 A;  3V5B A;  1E5W A;  1DIP A;  3HTK B;  1VQP P;  1L4A B;  4UB6 H;  2J59 M;  4RKU J;  2Y9Z A;  3H25 A;  4WY4 A;  3M0D A;  3L73 G;  2PFX A;  3RK3 E;  1L2P A;  3Q5S A;  4I6M C;  1FZC A;  2D2C C;  3USS A;  5KKZ B;  2E76 B;  2WSC H;  3GF7 A;  3IFM A;  1XTC C;  5EFW B;  3TNU A;  3IN6 A;  2KK7 A;  2FY8 A;  1BSN A;  1WMK A;  5AW2 B;  1ZRT D;  1LP1 A;  3RGU A;  3V4Q A;  1RY3 A;  4IOI H;  5B66 H;  2FXP A;  4DJG A;  3A7O A;  3U1A A;  3QH9 A;  1X8Y A;  3P32 A;  1YJN P;  2H8P D;  3A3Y B;  1PL5 A;  3WMM 0;  4KT0 J;  1KIL B;  2H43 A;  4OGQ C;  4IFD K;  5K5G B;  3L75 D;  1JTH B;  2WSE H;  4UB6 E;  5CJ4 A;  5CJ0 A;  1NTZ D;  1ZXG A;  1VQM P;  3VP8 A;  1KB9 I;  3MIW A;  4PD4 H;  1NAF A;  5AW7 B;  1Q82 Q;  2IBZ I;  2JP3 A;  2HPC A;  4OH8 B;  3D6Y A;  3AEB C;  5AVW B;  2AEJ A;  2Y0E A;  1RF0 A;  2WIT A;  4WVZ A;  1EQ7 A;  1IK9 A;  1FDM A;  3MUD C;  1L0N D;  3Q3D A;  3SFE C;  5B66 E;  3D70 A;  2GA1 A;  2R5B A;  1AA0 A;  3H1K E;  4NPD A;  3CCU P;  2E74 C;  1IZN B;  1BCC E;  2FFD C;  1USD A;  3AE3 C;  1FOS E;  5KJ7 D;  1LNQ A;  1VQ9 P;  4C7N A;  1N73 B;  4WWI A;  3B71 A;  1HTL C;  3EFG A;  3CPW O;  1VQL P;  1M7L A;  1CI6 A;  5CCG A;  1FDO A;  4RO0 A;  3H1H E;  3E1R A;  1GMJ A;  4PD4 E;  2A45 G;  1BGY E;  1TU3 F;  1LWU A;  1A02 F;  1QL1 A;  1KQF B;  2WSF H;  3CCV P;  2WT7 B;  3VP9 A;  2KYV A;  3SWF A;  1SQQ G;  3B5N D;  1NTZ G;  3V2Q A;  4IL6 X;  3AEA C;  1FZB A;  3W68 A;  1T2K D;  4ZKU A;  2IPP A;  2NPS D;  1VL2 A;  3TGU J;  5AVR B;  3C1L A;  2ZAE B;  3AE8 C;  1IFP A;  2Y0C A;  3CXH H;  4YXD C;  1VF5 D;  2QM8 A;  5APQ A;  2AXC A;  1BCC J;  1W2B O;  4N78 E;  3HE5 B;  2KSE A;  5KLV D;  1G2C B;  5KJ7 A;  1L0N G;  3Q2Y A;  5AW4 B;  1W2E A;  3L72 D;  3JC2 2;  3AE1 C;  2Q9I A;  1YHQ P;  3G71 P;  4L73 A;  2JKV A;  2HG5 D;  3H1H J;  2KS1 A;  1NAY A;  1OVR A;  1NWQ A;  2MKV A;  1BE3 E;  2IYP A;  2RH0 A;  1BGY J;  3H32 A;  2ZYA A;  2KXP B;  4DZO A;  3A0H H;  1GL2 C;  4KJM A;  3F89 A;  1NGM B;  2KS1 B;  2Q6Q A;  1YI2 P;  2V7Q H;  1RE3 C;  4GT1 A;  1SP4 A;  4H13 C;  2AEM A;  1KIL E;  4PD4 I;  2QJK C;  1LJ2 A;  2LXB A;  1H8A A;  1SS1 A;  4DOJ A;  4AUW A;  4WY4 C;  3B5N B;  3M0D C;  3WUU A;  3AEG C;  1MUU A;  3CXH E;  3B8E B;  3L71 G;  1H89 A;  1FZC C;  1T6A A;  2KIK A;  2UWJ E;  3BVH A;  1J2J B;  3MD0 A;  2NPS B;  3M0A A;  1OFC X;  1DX7 A;  1SVF A;  3EWK A;  1NVO A;  1T8Z A;  2PRR A;  3CCM P;  3TYY A;  2XV5 A;  3II6 A;  1ZOY C;  3MTU E;  3RK2 D;  1VF5 B;  1SFC A;  2IX7 C;  3FWN A;  2OYI B;  1GW3 A;  2K37 A;  1FU1 A;  3UIA A;  2O1K A;  1UII A;  1BE3 J;  2LXC B;  2WSF J;  1IO4 A;  3L72 G;  4BRY A;  3A0H E;  4U7J A;  4YPC A;  2C9N Y;  5DJU B;  2B89 A;  2OAR A;  4JQ0 D;  2IFN A;  1GK6 A;  2QSI A;  2B87 B;  3M9Q A;  1ZRT E;  2YKP A;  2GUS A;  4RES B;  2E75 D;  2QE7 H;  2R44 A;  3M91 A;  1R5L A;  4ASW A;  2L5G B;  2RKL A;  3CWB J;  1JY2 N;  4PV1 C;  1M8O B;  3L75 E;  3AE2 C;  2WQY C;  1KC8 Q;  2M3E A;  1GDT A;  4DCK A;  1RF0 C;  2YMY A;  1LTS C;  1SQP G;  1NTK G;  1MFZ A;  1LT9 A;  4L74 A;  1VPC A;  2W8Z A;  4K35 A;  3L74 D;  2OTJ P;  3GG2 A;  1K05 A;  1DD4 A;  3Q1M A;  4D6T D;  1GTW A;  4YTP C;  3RK2 B;  1OVV A;  2V7Q J;  5CCG C;  3D6Z A;  1FJK A;  1L0N E;  1WRG A;  2YIU C;  2DW3 A;  4JBZ A;  1Y47 A;  3TK1 A;  5CBO A;  2BEZ F;  2FYN B;  1LWU C;  1T3U A;  1SQB E;  1VQ7 P;  1SQB K;  2E75 B;  1LTJ B;  2M8R A;  3QWO C;  2R5D A;  1R8E A;  3L75 J;  3L73 D;  2E5T A;  2GUV A;  3PHL A;  5BU5 A;  2YKO A;  1Y9B A;  3H6P A;  2G3A A;  4H0L C;  1RHZ B;  5AVV B;  2HYN A;  1JY3 P;  1AJY A;  1CSB A;  1KQL A;  1IJD B;  1GU4 A;  1NU1 D;  4TLF A;  4LLH A;  3H1J J;  2XU6 A;  2FYZ A;  2QRX A;  3S1K A;  3BCC D;  3FWL A;  3E1I A;  2QJP B;  1URQ A;  3VYI A;  1NTM G;  2FXO A;  1KV4 A;  4D6T G;  5APY A;  3HUS A;  2O01 J;  4C7R A;  1FDI A;  1SQX D;  3T97 A;  5KAI H;  4EYY Q;  2OYH A;  2IDB A;  1OXZ A;  3OJA B;  3FXD A;  2Y9Y A;  4C46 A;  1SQB J;  1X9V A;  5KLV E;  1PZQ A;  3HTK A;  5KLV K;  5CCH C;  3L72 E;  1L4A A;  3KYQ A;  4JF7 A;  3OA7 A;  3RL0 C;  1PPJ G;  1Q86 Q;  3AE6 C;  1ZW0 A;  3S9O A;  1L0L E;  1L0L K;  1K9M Q;  1YIJ P;  4XA4 A;  3SWK A;  5KLI C;  1OWA A;  2FYU D;  2QVA A;  1VQ4 P;  5B5E H;  1NH4 A;  1NOH A;  1SFC C;  1NU1 G;  5AVY B;  1UIX A;  5KAI E;  5APW A;  2HFE D;  3BCC G;  2ZYG A;  1KIL A;  3HD7 D;  1EXI A;  2W6B A;  5KLV J;  3GHG A;  1JTH A;  2QG4 A;  3IAO A;  3RK3 C;  4PJ0 H;  2C0X A;  2BCC D;  1SQV J;  1WT6 A;  1SQX G;  4Y99 C;  4EI2 A;  3V4W A;  4N6J A;  2L91 A;  1J1D C;  2N1T D;  3GHG B;  3AEC C;  1SQQ D;  5DJT B;  2ZXE B;  1S4X A;  1RF1 A;  1L0L J;  1MZ9 A;  2ZT9 C;  2JJL A;  5CBN A;  3HRN A;  3HE4 A;  3KPE A;  1S72 P;  3R2P A;  1JCD A;  1M56 D;  4HYT B;  3A2A A;  2HOD A;  1RF1 B;  2AEF A;  5B5E E;  3HE4 B;  2XND H;  2HLO A;  2P10 A;  1LT9 C;  2P58 A;  1ZV8 A;  2FYU G;  3CCE P;  1N73 A;  2HOD B;  3F5H A;  3PLN A;  1RE4 C;  1S1C X;  4OVN F;  3CD6 P;  4IL6 H;  4PJ0 E;  2NRG A;  1Q7Y Q;  4U3F D;  4A7P A;  1JY2 O;  3HD7 B;  3LIE A;  2WT7 A;  4IFF A;  3L74 E;  1YJ9 P;  3JCU H;  3FGA D;  1QX8 A;  1U7M A;  4D6T E;  2BCC G;  1K73 Q;  3MZW B;  1PP9 E;  2YXR B;  1RQV A;  3WUV A;  4H44 D;  3CC2 P;  2WSC J;  2YMK A;  1Y8A A;  2N1T B;  4Z1M H;  3H1I D;  2R3S A;  1N7S C;  4WBA A;  2H7H A;  1M1J C;  3L71 D;  2XNX A;  3HE5 A;  1Q90 D;  1G2C A;  2YIU B;  1JMM A;  2ITA A;  2Q7C A;  2Q3I A;  3B4S A;  3A5T A;  4IL6 E;  2QJY C;  3RL0 D;  3H1K J;  4I7Z C;  3V6I A;  1J1E B;  3L73 E;  1HF9 A;  2IFM A;  1EC5 A;  1LTG C;  1S3J A;  3ZDM A;  3N7N A;  3KHU A;  2WSE J;  3HUS C;  3MHV A;  2JR8 A;  3L74 J;  3JCU E;  2D2C D;  1PFI A;  1NU1 E;  4U3F G;  2OTK E;  1VQ8 P;  2OYH C;  2PP6 A;  2Y0D A;  1PP9 J;  3LID A;  4IFM A;  3BCC E;  3C9I A;  3CCJ P;  2KUB A;  5APS A;  1LTT C;  1L4A C;  5AW8 B;  1OW8 A;  5AVS B;  3B5N A;  2ZFC A;  3KDP B;  1YQ3 C;  2Q1K A;  1S9K E;  1GK4 A;  5AVU B;  1SQX E;  2E76 C;  4H44 B;  2C9L Y;  1SQX K;  2NPS A;  3RK3 D;  1SLQ A;  3H1I G;  3NTN A;  3P8M C;  5AVQ B;  1SQP D;  4OGQ D;  1NTK D;  1AV1 A;  1FJP A;  1OVU A;  2A45 H;  1ZN5 A;  3L73 J;  2OYI A;  2QM7 A;  1M57 D;  2A06 D;  3VOP A;  1FZA A;  1JY2 P;  5BU8 B;  1DEE G;  4HJG H;  1OX3 A;  1XTG B;  2KLU A;  2P67 A;  3RL0 g;  3RL0 B;  1PGJ A;  1Z56 A;  2WWW A;  3CX5 D;  2B87 A;  1KIL C;  2E42 A;  2FYU E;  2QEX P;  1FE6 A;  1YTZ T;  3BCC J;  1EZV G;  5KLI B;  2W27 A;  2M5A B;  2D2C B;  4NPE A;  1NJI Q;  3PRJ A;  4CPG A;  1GD2 E;  3L70 D;  2KZJ A;  2XZR A;  1QLE D;  1YTZ I;  5APX A;  2E74 D;  2WPR A;  1DEB A;  5AW3 B;  1AQT A;  2BCC E;  2W83 C;  3S4R A;  5H2F H;  3RK3 B;  4GOF A;  1X79 B;  2HR3 A;  1EDK A;  1SQQ E;  2YXQ B;  1VQK P;  1OZH A;  2LKM A;  3TGU D;  1SQQ K;  1NTZ E;  4OGQ B;  3AE7 C;  1BDC A;  2PAJ A;  1NTZ K;  5APU A;  1N73 C;  1G1J A;  1JUN A;  1OIP A;  2A06 G;  1H88 A;  4HB1 A;  2BEQ D;  2KOG A;  1NTM D;  3Q5R A;  2ZVN B;  1YYC A;  1QEX A;  4GOE A;  1K8A Q;  2WTY A;  2W6J H;  2MJZ A;  3PH0 A;  5GTI H;  2KNC B;  1L0N K;  1LTJ A;  2Q3E A;  3R4Y A;  2KI7 B;  5BVZ A;  1ZR4 A;  1PPJ D;  3L70 G;  1BSH A;  1PV3 A;  3M06 A;  5AVX B;  1FZF A;  4XE5 B;  2E74 B;  5H2F E;  1H0T B;  2FFD B;  1HGV A;  1SQQ J;  2K9J B;  1NTZ J;  5GTH H;  1S5L X;  1KYO D;  1R5S A;  2K1A A;  1GL2 D;  3H1L D;  5C39 A;  3CCS P;  1YIT P;  1AVY A;  2A45 I;  1IK7 A;  1NHL A;  1FBM A;  3V2N A;  3TGU G;  3VMY A;  4H13 D;  1N7L A;  5KJ7 C;  1LTB C;  3O6Q A;  5AVZ B;  3L71 E;  1KFN A;  4WY4 D;  1KOR A;  1BCC G;  5GTI E;  1M90 Q;  1L0N J;  3KZI H;  3CC7 P;  4KHX A;  1BE3 D;  4W7Z A;  2CPS A;  2B88 A;  3O6Q B;  1RH5 B;  4LC1 A;  2JWA A;  2G8Y A;  3E7K A;  4B86 A;  2OYO A;  3BRT B;  1ZP0 C;  3OW2 O;  1M1K Q;  1DD3 A;  3H1H G;  3TSI A;  2Q5U A;  3AE4 C;  2J58 A;  2WMM A;  1FOS F;  3B5N C;  1BGY G;  4HKZ H;  5AW1 B;  3W67 A;  4Y28 J;  4M3L A;  5GTH E;  1T2K C;  3Q5P A;  2XKM A;  2NPS C;  4ZNC A;  3CXH D;  3CX5 H;  3P7K A;  1EDJ A;  3CWB D;  3CC4 P;  1MFT A;  3G3Z A;  3CI9 A;  1FAV A;  1JY3 N;  1VF5 C;  1PGQ A;  2FKW B;  2OYI C;  2B9B A;  2ZJS E;  4JPZ B;  3L71 J;  4GOD A;  1GL2 B;  3H1L G;  1FS0 E;  2K88 A;  3CLQ A;  3SFD C;  1QGK B;  3KZI E;  1EDL A;  2PGD A;  5M1B A;  2W6A A;  4H13 B;  3SSU A;  3P8C D;  4PV1 D;  1YQ4 C;  3JSV C;  1SQP E;  1GZL A;  2YKQ A;  1NTK E;  2QJK B;  1SQP K;  1NTK K;  4WY4 B;  2QA4 P;  5AW5 B;  4JYC A;  1JOC A;  2A06 E;  2R3C A;  1ZR2 A;  3BAT A;  1FZC B;  3L72 J;  1BE3 G;  5KAF H;  1KMI Z;  2KB7 P;  4OWF A;  1JNM A;  3TNU B;  1KD1 Q;  1ZME C;  3PTZ A;  3VMZ A;  1JM0 A;  3CX5 E;  1GW4 A;  2IYO A;  1N8R Q;  3VMA A;  1LP1 B;  1VQO P;  2M0B A;  1PGO A;  1LT1 A;  2C0W A;  2O1J A;  1NO4 A;  3IR9 A;  5CCG D;  3V2P A;  1JMB A;  3L70 E;  1EZV I;  3IF4 A;  3LW5 H;  5TIS H;  3CWB G;  1MV8 A;  3G6E P;  1W5C E;  3RBZ A;  3RK2 C;  1P84 D;  3FXE A;  5AW9 B;  2J5U A;  2QIW A;  1SQP J;  2IZ1 A;  2KSJ A;  3H1J D;  1HVV A;  1NTK J;  1D7M A;  1AQ5 A;  3HD7 A;  2H89 C;  1X22 A;  5KAF E;  2YO2 A;  2OTL P;  2FYN C;  4H0L D;  3TGU E;  2HPC B;  4PV1 B;  1QVF O;  1QVG O;  2BAS A;  2KLV A;  3CCQ P;  1KYO H;  2E75 C;  1LTJ C;  2N1T A;  1SQB D;  1HGZ A;  1NTM E;  4EDF A;  1NTM K;  4LGD E;  3L4F A;  4W7Y A;  1JEK A;  1FZE A;  1RQU A;  3L70 J;  1IC2 A;  5TIS E;  1JO5 A;  4C7N B;  2I8D A;  1QL2 A;  1HJ0 A;  3WUT A;  3CX5 I;  4R4M A;  1CI6 B;  4RJT A;  3CCR P;  3L75 G;  5CCH D;  1PPJ E;  2QJP C;  1HUC A;  2FBW C;  4R4L A;  1NKN A;  4MN4 C;  1LWU B;  5L8R J;  1N2D C;  3WU2 H;  4GKG A;  3O8Z A;  3GMA A;  3K5B A;  5CHX A;  2P2U A;  2ZXX A;  1HJB A;  1URQ C;  3H1J G;  1KYO E;  1EZV D;  1E79 H;  3I55 P;  3H1L E;  2CPB A;  4TT3 H;  1U7J A;  4HH2 A;  4AYC A;  1KB9 D;  1VQN P;  1BDD A;  1NTM J;  3ABV C;  4H0L B;  1NU1 K;  4D6T J;  2OQQ A;  3AED C;  2IBZ D;  1IFM A;  1MKM A;  1SQV D;  1G1I A;  1SFC D;  2R32 A;  1T3J A;  3LW5 J;  4EIJ A;  4I2L C;  4ASV A;  4I1L A;  1SQB G;  2O3J A;  1HWT C;  3N4X A;  2E5Y A;  4XFJ A;  1VDF A;  2P1J A;  4YXW H;  1L0L D;  3L36 A;  5KKZ C;  2GM4 A;  1KQG B;  5CCH A;  2O01 N;  4W80 A;  2NZ2 A;  2N9Y B;  3WU2 E;  2LR2 A;  3H32 B;  2W90 A;  1S2E A;  3L37 A;  4BWN A;  1YJW P;  2ZT9 D;  2N9B A;  2I1J A;  1FZG A;  1DH3 A;  3CWB E;  1KZU B;  5KTB A;  3H1L J;  1VQ5 P;  2M5A A;  3OAK A;  3CCL P;  1NU1 J;  1KQS O;  2JWD A;  3L35 A;  3GHG C;  3AEF C;  2FYU K;  1Q2N A;  1AFO A;  4UB8 H;  2H88 C;  1JY3 O;  3NMD A;  4ZKP A;  1N86 A;  4WB4 A;  1KYO I;  1EDI A;  5KLV G;  1P84 H;  3P8C E;  2I1K A;  2IBZ G;  2YO3 A;  1SQX J;  1SQV G;  1U57 A;  1SFC B;  1RF1 C;  4K3A A;  2K9Y A;  5AVT B;  2VRS A;  3NFQ A;  4L76 A;  2CK3 H;  1OMI A;  4GDO A;  3TF5 A;  3BRV B;  4BRY B;  1L0L G;  4JYB A;  1ZLL A;  3AEE C;  4EOT A;  2XDJ A;  2M3B A;  2O01 H;  4O9B A;  3CME P;  1NYH A;  3PJS K;  1LTA C;  5E79 H;  4Y99 B;  1PIX A;  3TDK A;  1J1D B;  2AXT H;  3GLM A;  3EQ2 A;  3H1K D;  1FC2 C;  3A0B H;  1N7S D;  1BCC D;  1IFD A;  1IFI A;  3HD7 C;  2ZT9 B;  4UB8 E;  2FYU J;  1LTI C;  2ZYD A;  2KNC A;  3AE5 C;  5APV A;  3ITK A;  2Z4E A;  3M9H A;  2JO1 A;  3BAS A;  4DT0 A;  1IFJ A;  3CXH I;  1S5L H;  3MUD A;  3PP5 A;  1P84 E;  3V2R A;  4AQR D;  3H1H D;  5AW6 B;  1RE4 A;  2V4H A;  2KP8 A;  2WPQ A;  1LGH B;  1A02 J;  4PD4 D;  2N1T C;  4ZMD A;  3H1J E;  2WSS H;  1BGY D;  1PP9 D;  3EFF K;  3U1C A;  1H0T A;  1EXJ A;  1AVO A;  3M9B A;  5CMZ A;  2FFD A;  1LT9 B;  3CL3 D;  2FXM A;  3C8V A; 
#chains in the Genus database with same CATH homology
 3B8E B;  1CW5 A;  4IFF A;  1URQ D;  1GL2 B;  1H89 A;  1FZC C;  3U59 A;  3CLQ A;  3BVH A;  1J2J B;  3MD0 A;  2NPS B;  3M0A A;  1DX7 A;  1SVF A;  1T8Z A;  1HBW A;  1JCC A;  2W6A A;  3P8C D;  3TYY A;  1GZL A;  2YKQ A;  2N1T B;  2XV5 A;  3II6 A;  1GU5 A;  3MTU E;  1SQP K;  1J1E C;  3RK2 D;  1SFC A;  1NTK K;  2IX7 C;  1N7S C;  4WY4 B;  5AW5 B;  4JYC A;  4WBA A;  2OYI B;  2Z5H A;  1L4A D;  1GW3 A;  2H7H A;  1JOC A;  1M1J C;  1FU1 A;  3UIA A;  2O1K A;  2XNX A;  2R3C A;  1ZR2 A;  3NXS A;  3BAT A;  1FZC B;  1IO4 A;  1N7S A;  2KB7 P;  4N3Y B;  2POH A;  4N78 D;  2P7J A;  2C9N Y;  3HE5 A;  1G2C A;  1JNM A;  1M1J A;  2OAR A;  1JMM A;  2Q7C A;  2JEE A;  3TNU B;  2Q3I A;  1CZQ A;  3VMZ A;  2IFN A;  2WZ7 A;  1GK6 A;  3A5T A;  1GW4 A;  3RL0 D;  3M9Q A;  2YKP A;  1J1E B;  3VMX A;  3VTP C;  1N7S B;  2GUS A;  4RES B;  2C0W A;  2Z5I A;  1IFN A;  2IFM A;  1LTG C;  2O1J A;  1M1J B;  3N7N A;  1NO4 A;  1HH0 A;  3IR9 A;  5APT A;  5CCG D;  3V2P A;  3M91 A;  2L5G B;  2YNY A;  3HUS C;  3LW5 H;  3MGN A;  1JY2 N;  1KFM A;  1PFI A;  1MV8 A;  2OYH C;  2PP6 A;  1S9K D;  3LID A;  4IFM A;  3RK2 C;  3I5C A;  3C9I A;  5AW9 B;  3KQG A;  5APS A;  1GDT A;  1LTT C;  1L4A C;  3VN0 A;  1RF0 C;  1KIL D;  5AW8 B;  2E43 A;  2KSJ A;  3SWY A;  1URQ B;  1LTS C;  2YMY A;  1HVV A;  5AVS B;  2WPS A;  3B5N A;  1AQ5 A;  1MFZ A;  1LT9 A;  4GIF A;  3HD7 A;  2ZFC A;  3KDP B;  1VPC A;  1S9K E;  1GK4 A;  3HUS B;  1GL2 A;  5AVU B;  1NKZ B;  2YO2 A;  2C9L Y;  1SQV K;  2HPC B;  2OYH B;  1SQX K;  5AW0 B;  2NPS A;  1GTW A;  3RK3 D;  2BAS A;  2KLV A;  1SLQ A;  1RE3 A;  3V5B A;  3RK2 B;  1E5W A;  3NTN A;  3HTK B;  3P8M C;  1LTJ C;  5AVQ B;  1L4A B;  2OYI C;  2N1T A;  2J59 M;  1FJP A;  5CCG C;  2A45 H;  1HGZ A;  1ZN5 A;  4WY4 A;  1FJK A;  3M0D A;  2OYI A;  1NTM K;  1WRG A;  4LGD E;  2QM7 A;  3TK1 A;  3L4F A;  4I6M C;  4W7Y A;  3VOP A;  1FZC A;  1FZA A;  1JY2 P;  2WSC H;  5BU8 B;  1LWU C;  1FZE A;  1T3U A;  1XTG B;  2P67 A;  1IC2 A;  3RL0 B;  3IFM A;  1XTC C;  1JO5 A;  4C7N B;  3TNU A;  1SQB K;  1Z56 A;  1LTJ B;  2M8R A;  2WWW A;  1QL2 A;  5AW2 B;  2R5D A;  2E42 A;  1KIL C;  1CI6 B;  1YTZ T;  2GUV A;  5CCH D;  3V4Q A;  1RY3 A;  1HUC A;  2W27 A;  5BU5 A;  2YKO A;  3H6P A;  1NKN A;  1GD2 E;  1LWU B;  1N2D C;  5AVV B;  3A7O A;  3U1A A;  2HYN A;  1JY3 P;  4GKG A;  3O8Z A;  1CSB A;  1KQL A;  1X8Y A;  1IJD B;  2XZR A;  1YTZ I;  5APX A;  1GU4 A;  3P32 A;  5CHX A;  2P2U A;  4LLH A;  2H8P D;  3A3Y B;  3WMM 0;  1HJB A;  1URQ C;  1KIL B;  2H43 A;  2XU6 A;  2FYZ A;  2WPR A;  4IFD K;  1DEB A;  5AW3 B;  1JTH B;  2WSE H;  2CPB A;  3E1I A;  5CJ4 A;  5CJ0 A;  1URQ A;  4HH2 A;  4AYC A;  3VP8 A;  3VYI A;  3MIW A;  1NAF A;  1NU1 K;  5AW7 B;  5APY A;  3HUS A;  3RK3 B;  4C7R A;  1IFM A;  1X79 B;  1G1I A;  3T97 A;  1SFC D;  2LKM A;  2R32 A;  2HPC A;  1SQQ K;  4OH8 B;  2OYH A;  1T3J A;  4EIJ A;  1OXZ A;  3OJA B;  4I2L C;  2PAJ A;  4C46 A;  1NTZ K;  1X9V A;  5APU A;  5AVW B;  4I1L A;  1N73 C;  1HWT C;  1G1J A;  3HTK A;  1JUN A;  3N4X A;  5KLV K;  5CCH C;  1L4A A;  1RF0 A;  1VDF A;  2P1J A;  2WIT A;  3L36 A;  1EQ7 A;  3KYQ A;  1IK9 A;  1H88 A;  2GM4 A;  2KOG A;  4JF7 A;  1FDM A;  3OA7 A;  1YYC A;  3RL0 C;  5CCH A;  4W80 A;  2R5B A;  2WTY A;  3H32 B;  2FFD C;  2MJZ A;  1L0L K;  1FOS E;  5KJ7 D;  4C7N A;  1N73 B;  3L37 A;  1L0N K;  1LTJ A;  4XA4 A;  1HTL C;  1OWA A;  3EFG A;  1M7L A;  5BVZ A;  1ZR4 A;  2N9B A;  2I1J A;  1CI6 A;  5CCG A;  1FZG A;  1DH3 A;  1KZU B;  5KTB A;  3OAK A;  3M06 A;  5AVX B;  1NH4 A;  1FZF A;  2A45 G;  1NOH A;  1SFC C;  4XE5 B;  1LWU A;  5AVY B;  1A02 F;  1QL1 A;  2FFD B;  2WSF H;  3L35 A;  2WT7 B;  3GHG C;  5APW A;  3VP9 A;  2FYU K;  1AFO A;  2KYV A;  1HGV A;  2HFE D;  3SWF A;  1JY3 O;  3B5N D;  3NMD A;  4ZKP A;  1KIL A;  3HD7 D;  1N86 A;  3V2Q A;  4WB4 A;  2W6B A;  1GL2 D;  3GHG A;  1JTH A;  1FZB A;  3RK3 C;  3P8C E;  1T2K D;  2I1K A;  4ZKU A;  2IPP A;  2C0X A;  2A45 I;  2NPS D;  2YO3 A;  1NHL A;  1WT6 A;  1FBM A;  3V2N A;  5AVR B;  1SFC B;  4Y99 C;  1RF1 C;  3VMY A;  3V4W A;  4N6J A;  5AVT B;  1N7L A;  1J1D C;  2VRS A;  5KJ7 C;  1LTB C;  3NFQ A;  2N1T D;  5AVZ B;  3GHG B;  1KFN A;  2ZXE B;  4WY4 D;  3BRV B;  2QM8 A;  1RF1 A;  5APQ A;  1MZ9 A;  4N78 E;  4JYB A;  1ZLL A;  2JJL A;  3HE5 B;  1G2C B;  3HRN A;  5KJ7 A;  4EOT A;  2XDJ A;  3HE4 A;  3KPE A;  5AW4 B;  4KHX A;  4W7Z A;  1W2E A;  2M3B A;  2O01 H;  2CPS A;  3R2P A;  1JCD A;  4O9B A;  4LC1 A;  2Q9I A;  4HYT B;  1LTA C;  3A2A A;  2HOD A;  4B86 A;  1RF1 B;  4Y99 B;  3BRT B;  2HG5 D;  1J1D B;  3TSI A;  3HE4 B;  3EQ2 A;  2Q5U A;  1NWQ A;  2HLO A;  2J58 A;  1FOS F;  1N7S D;  3H32 A;  3B5N C;  1IFD A;  1LT9 C;  1IFI A;  3HD7 C;  1LTI C;  1ZV8 A;  5AW1 B;  4DZO A;  1N73 A;  2HOD B;  1GL2 C;  5APV A;  4M3L A;  2Z4E A;  3M9H A;  1RE4 C;  1T2K C;  3BAS A;  2XKM A;  2NPS C;  1IFJ A;  1RE3 C;  4GT1 A;  3MUD A;  3P7K A;  3PP5 A;  3V2R A;  1SP4 A;  4AQR D;  3G3Z A;  3CI9 A;  5AW6 B;  1JY2 O;  1FAV A;  1RE4 A;  2KP8 A;  2WPQ A;  1LGH B;  1A02 J;  2N1T C;  1JY3 N;  1H8A A;  3U1C A;  4AUW A;  4DOJ A;  4WY4 C;  3B5N B;  3M9B A;  3M0D C;  5CMZ A;  2FKW B;  1LT9 B;  2FFD A;  3CL3 D;  2FXM A;  1MUU A;  3HD7 B;  3LIE A;  2WT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...