3V2RA

Compcc in complex with fatty acids
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
45
structure length
45
Chain Sequence
MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Cartilage Oligomerization matrix protein (coiled-coil domain
publication title COMPcc in complex with fatty acids
rcsb
source organism Mus musculus
total genus 18
structure length 45
sequence length 45
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3v2rA00
1VDFA 3V2RA 1DEBA 3V2PA 3V2QA 1FBMA 3V2NA 1MZ9A
chains in the Genus database with same CATH superfamily
2OYHA 2HFED 2YKQA 1BDCA 4JYCA 3H1IE 2RN0A 1QVGO 1EDIA 4I7ZB 5AVZB 1BE3E 3BATA 1QLED 1DEBA 2V7QH 1JY2O 4WY4B 2FXMA 1OFCX 2A45G 5APWA 1PP9G 3OA7A 1VQKP 5KAFE 1QL1A 1J1EC 2LKMA 2P7JA 2R32A 1IC2A 1BSNA 2QA4P 1KZUB 2PAJA 3CX5H 1HGZA 2E42A 4OGQC 2IX7C 2E43A 4U7JA 2A45H 3TYYA 4D6TJ 4I6MC 5APTA 4RJTA 2HPCB 2AEMA 4R4MA 1H0TA 1L4AA 1FOSE 2WPQA 1N73A 3MUDC 1KB9E 1LNQA 3D6YA 1N7SD 2E75D 3AE4C 1Q86Q 3L74E 2W6AA 4EOTA 1K73Q 3RL0g 3C9IA 3PHLA 4PJ0E 1NJIQ 4EYYQ 1EZVD 1VQ6P 3CXHH 1SQPE 2JKVA 1LWUC 4RESB 5M1BA 1ZRTD 2FXOA 1SQXE 2XU6A 1JY3N 4DCKA 2WVRA 1DD3A 5GTHH 2N1TD 5BU5A 3CWBJ 3HUSA 3CCQP 3BCCE 1G2CA 2E75B 3Q1MA 3CXHI 4HYTB 3G3ZA 2KSJA 2FBWC 1FZCB 4UB6H 5AW0B 1GK4A 2K37A 2BEQD 2Q3IA 3AECC 3H1KE 1OW6A 1QVFO 1FJPA 2K9YA 1IJDB 4D6TG 4AQRD 1RE3C 2Q5UA 2O01N 1CI6A 3HD7A 1FDMA 4BWNA 1BGYJ 1NKZB 1NTZJ 1ZXGA 1KQSO 3L75E 4HH2A 1SQQK 1IK9A 1EDLA 1S3JA 1ZN5A 1OIPA 5KKZB 2PFXA 1KFMA 1H0TB 1L4AB 3M91A 1WT6A 3D71A 3H1LE 1OX3A 1SQQG 1XTGB 1M8OB 2XDJA 5APXA 1FZAA 1L0NE 2CPSA 1VDFA 2K3RA 1FS0E 2Z4EA 1L0LD 3V2NA 2E74D 3VOPA 2O1JA 5AW9B 1NU1J 1K04A 1R8EA 2K88A 2R5DA 2BCCG 2WITA 1LT9A 5CCGC 1EZVI 3R4YA 3H1HJ 4JF7A 3KXDA 3CCSP 4GIFA 2ZYAA 1NTME 2NZ2A 2BEZF 3Q2YA 4K35A 3KZIE 2C9LY 4W80A 2WSEJ 2OYIA 3CL3D 2O1KA 1NTKG 3CCRP 1IFJA 4H44C 1RQVA 2C0WA 1ZR2A 2WPSA 1SQVD 4WB4A 4XA4A 3TGUD 2WSSH 1CZQA 1KILA 4OGQD 4DT0A 1L0LK 2Z5HA 1BGYG 1MV8A 2Z5IA 1LTJC 1SQBD 2CPBA 4L75A 2G8YA 3FWLA 1Q90D 2W27A 1EDKA 1SVFA 1S4XA 4PV1B 4U3FD 1T6AA 1CW5A 4YTPC 3CLQA 3GG2A 4KHXA 5AVQB 1K9MQ 2KLVA 3HD7B 3WUVA 1KORA 2KYVA 2HG5D 3HTKA 3WU2E 3P8MC 1GD2E 1XTCC 2HODA 1QX8A 4IOIH 1J1DB 1FBMA 1KQLA 3B8EB 1RF1B 1NU1G 2RH0A 2YNYA 2IZ1A 4WVZA 5KLVK 1H89A 5TISE 1LP1B 3VMAA 2XZRA 3H1ID 1LTIC 4L74A 4KJMA 5CCHC 5AVSB 1YJWP 3QH9A 1BCCE 2KZJA 3S9OA 2R44A 2NPSA 1PIXA 5KLVG 1WRGA 5AVWB 2AEJA 1LT9B 2GUVA 2IZ0A 1KYOH 4EIJA 2KSEA 3L73J 4IFMA 1J2JB 1HJ0A 5TJHA 2Q7CA 2L91A 1QGKB 2POHA 2WSEH 2AEFA 2BASA 3GHGC 2OYIB 2H89C 3L71J 2RKLA 1ZLLA 3H1JG 3EFGA 5E79H 2FYUJ 1NVOA 2K9JA 1KILB 3FXDA 2WMMA 1KB9D 4HJGH 4I1LA 3SSUA 1W2BO 1PGJA 2WSCH 1EXIA 1NOHA 2QJPB 3I56P 3U1AA 1S5LX 2OYHC 2B88A 2IBZG 1MFTA 1Y8AA 3E1IA 1Z56A 1IFPA 1VL2A 4XFJA 2K1AA 2FYNC 4Y99C 5DJUB 3A0HH 4OWFA 1SQPD 1BE3G 2JWAA 2V7QJ 4WY4A 2KS1A 4YXWH 3A0BE 5B5EE 1VQ7P 1ZV8A 1GTWA 3HTKB 3FWNA 1SQXD 2FY8A 1VQNP 2HODB 2ZVOB 3L36A 5B66E 5CCGD 2H88C 1DIPA 2QJKC 5CMZA 3V2QA 3B71A 1ZMEC 1SFCC 3KDPB 5KTBA 1GL2D 3M0AA 1SQVE 4M3LA 2HPCA 3L73G 3TGUE 1PP9J 1AJYA 1KV4A 1IZNB 1AVYA 1SQBE 3H1KD 4H44D 5KAFH 4H0LB 3L70D 3L71G 1JOCA 1RF0A 2YIUB 2ZT9C 1VQ9P 1SQPK 1JNMA 3SFDC 5GTIH 3V5BA 2FYUG 3L74G 1N2DC 3RBXA 2QJYC 2Q1KA 1SQXK 2D2CC 4ZKPA 1EQ7A 3TK1A 3D6ZA 3P7KA 1OW7A 1FC2C 4PD4E 2P10A 1GL2B 3L72J 3L75D 4L76A 2WWWA 3AEGC 1HF9A 2PP6A 1LTSC 2M3BA 4UB8E 1N7SA 1PPJE 3GMAA 1MFZA 2E76D 3H1LD 3BCCG 3KQGA 3M0DA 1FZCA 4ASVA 1MUUA 1KB9I 4IFFA 1IK7A 5APYA 1OVRA 1L0ND 3JCUE 1T2KD 3CCEP 2WPVB 1UIXA 2FFDC 4QMAA 1RHZB 5AVUB 3MZWB 4NPEA 1N7LA 4H13C 3CC2P 1JM0A 3TSIA 2KS1B 4OVNF 3B5NC 5CCHD 5CHXA 4AYCA 3BRTB 1HVVA 2IYPA 2M3EA 4OH8B 2N1TA 3RK3C 1NTMD 2A06E 3VP8A 2WSFH 2E76B 3PRJA 2YO2A 4BXLA 2ZVNB 3CC4P 3C1LA 2XV5A 3B4SA 1PL5A 2QRXA 5AW7B 5BVZA 3TDKA 1VQOP 3NMDA 1L0NK 3ZDMA 1JMMA 2H7HA 2DW3A 3L72G 1JY3O 3CPWO 3C8VA 2IFNA 1JO5A 2O01H 4B86A 5C39A 1AV1A 2H43A 2QM8A 1NTMK 1M1KQ 3SWYA 1OMIA 2LR2A 1IFIA 2GUSA 1KFNA 2W6JH 2KUBA 1SQQJ 4R4LA 3FXEA 4ZMDA 1VQ5P 3CI9A 1DD4A 3HE4B 2WPRA 3IR9A 4N6JA 1N7SB 4JPZB 1N8RQ 2BCCJ 1E79H 3AE8C 1VQMP 2MJZA 2M5AB 2M0BA 1JB0J 3CMAP 2ZXXA 1SFCD 2IDBA 2YO3A 3T97A 3D70A 3M9HA 1BCCD 1FZGA 3L70E 1HUCA 1AFOA 4EDFA 5K5GB 3KZIH 3CWBD 4O9BA 2WT7A 1NTKJ 4Y99B 3G9RA 1FZBA 1JCCA 2N1TB 3CX5E 2KNCA 1FZEA 3BVHA 2W90A 5AVXB 2ZT9D 1PP9E 1KMIZ 2IPPA 1EZVG 3PJSK 1DH3A 2D2CD 1USEA 4I2LC 3PP5A 1RQUA 1JMBA 2WTYA 5CBOA 1RF1A 2OTJP 4NPDA 3LW5J 1L0LJ 3E7KA 3GF3A 5KJ7D 4N3YB 1Q82Q 1S5LH 3HRNA 3OW2O 3MUDA 1LP1A 3MTUE 1LTBC 1NTZD 5AVYB 3FGAD 4YPCA 2P58A 1U7JA 4ZKUA 3AEEC 1M1JC 2D2CB 2NPSC 1RY3A 2JWDA 1DX7A 3V4WA 1GU4A 1R5SA 4UB6E 3A2AA 4H13D 1FDIA 3B5ND 2KP8A 5AVVB 5KLVJ 3RK3D 3GLMA 1HJBA 1BDDA 2E74B 4WWIA 3M9QA 4XE5B 2IYOA 4U3FJ 3LIEA 4IL6E 4WBAA 4MN4C 3H1HD 3T97B 5AW2B 1KD1Q 1CSBA 1W5CE 2P2UA 1FAVA 2WSCJ 2WT7B 3A3YB 1S2EA 1URQC 2YXQB 3H1JJ 5H2FH 2AXTH 2KNCB 3V2PA 1LT1A 1L0LG 4D6TE 4JBZA 1RE3A 2Y0DA 1ZP0C 1L2PA 3UIAA 1HTLC 1J1EB 1HWTC 4PD4D 2W83C 4NPFX 4ASWA 2E5TA 4OGQB 3S4RA 1U57A 3LW5H 1SQVK 1NHLA 3SFEC 1PPJD 1BE3J 1GMJA 2XNDH 1FE6A 1R5LA 1SQBK 4DOJA 2LXCB 2KOGA 1NWQA 4TLFA 4LLHA 1SQVG 3AE2C 3TGUG 1YITP 2E5YA 2OTLP 1LJ2A 5B66H 3CWBE 2I8DA 4KT0J 1MZ9A 1SQBG 3AE5C 2W8ZA 1LWUB 2B87A 3RBZA 3TNUB 5CCGA 2QG4A 4U3FG 2A06D 3O6QB 2FYZA 1GL2A 3M9BA 1BSHA 5APVA 1VQ8P 4DZOA 1W2EA 3VMXA 3SWFA 2UWJE 2JR8A 2QEXP 1X8YA 1JTHB 2YMKA 1NTKE 3E1RA 3L74J 1M57D 3S1KA 2B89A 2E75C 1K8AQ 1N86A 1SQPJ 5APSA 1BGYE 1SP4A 3BASA 1NTZE 4PD4H 1LTJA 1FZCC 1NAFA 3H1IG 5KAIE 1SQXJ 3W67A 3PLNA 1PGOA 1VQLP 2Y9ZA 1YI2P 1IFNA 3A7OA 3ITKA 2GA1A 1H88A 4UB8H 3BCCJ 3HE5A 4HB1A 4PD4I 3SWKA 3G4SP 1AVOA 2WSFJ 2I1KA 2NPSD 3H25A 1JEKA 3RK3E 1GDTA 1M90Q 1ZW0A 3H1KJ 5APQA 1NU1E 2AXCA 1JUNA 1YQ4C 3H1HE 3RGUA 1KYOE 4LGDE 3MD0A 5KKZC 5CBNA 1NYHA 1Q81Q 4Y28J 1L4AC 5CCHA 3MP7B 3Q3DA 2J58A 1N73C 1Y9BA 5AW3B 1S1CX 3AE3C 3PTZA 2O01J 2KIKA 1OWAA 2B87B 4YXDC 1FDOA 3L75J 1P84E 3CX5D 1PZQA 3K5BA 1X0TA 1QEXA 5E79E 3AEBC 1PP9D 1URQD 1X22A 1KB9H 1SQPG 3P8CE 1S9KE 3CD6P 3GHGA 3HE4A 3H32B 1SQXG 3R2PA 1YIJP 1L0NJ 2IFMA 4H44B 4JQ0D 1S72P 1YYCA 2OGUA 1KTMA 4PJ0H 3HUSC 3MIWA 3IFMA 2L5GB 2JDIH 2C0XA 4BRYA 3A0HE 4CPGA 3CXHD 3AE7C 2M5AA 3AE1C 1YJNP 1LTJB 1LTAC 2HLOA 3KHUA 2P1JA 1Y47A 1ZR4A 1NTMJ 2IBZE 3H1KG 3L70G 1U7MA 4DJGA 3HE5B 1YBKA 3QWOC 3IAOA 4PV1C 1OVVA 1KILE 3I55P 3NFQA 4JYBA 3O8ZA 2V4HA 2JJLA 4TT3H 3RL0C 3HD7C 2OARA 1SLQA 3L75G 1SFCA 1GU5A 1J1DC 1JCDA 5GTIE 3L73E 1NAYA 1GZLA 1M7LA 1T8ZA 1RF1C 3KPEA 1YTZI 1JY2N 3H1LG 1H8AA 1Q7YQ 3NXSA 3L71E 1NKNA 1L0NG 3KYQA 1NH4A 4N78D 4D6TD 1AQTA 2JP3A 3CX5I 2JO1A 2FYUE 2Q6QA 1IO4A 3IF4A 2A45I 1RH5B 3AE6C 1OXZA 3EQ2A 2QSIA 2R3SA 1RE4A 4K3AA 1LT9C 3GHGB 2FKWB 3F89A 3CCUP 5DJTB 5KJ7A 2VRSA 3WUUA 5AW5B 2RMZA 1NTMG 3P32A 1PGQA 4C46A 3V6IA 1BCCJ 4BRYB 3LIDA 1OVUA 2OYIC 3VTPC 2N9YB 3GF7A 4GODA 3M06A 2ZAEB 1SQQD 1Q2NA 3EFFK 2OYHB 1KILC 2FFDA 2FYNB 1KN7A 3I5CA 4C7NA 3U59A 3B5NA 2QJPC 1L4AD 2BCCD 4EI2A 3II6A 4A7PA 2QIWA 3V4QA 4W7ZA 1KQGB 4IL6H 2YXRB 2OTKE 2Y0CA 2QJKB 5EFWB 3CCLP 3VN0A 1SFCB 5KLIC 1NTKD 1VQ4P 4GKGA 3NTNA 3L37A 2HR3A 4GOEA 3CXHE 2KZIA 4GT1A 1BGYD 3N4XA 4HKZH 3L72E 3ABVC 1N73B 1YTZT 2ZT9B 3WU2H 1HH0A 1OZHA 2ZXEB 1FJKA 3Q5PA 5GTHE 1T3JA 3RK2C 1BCCG 5AVTB 2QJYB 4H0LC 2H8PD 3CWBG 1LWUA 2YIUC 1TU3F 3JC22 2R3CA 3TNUA 1T3UA 1A02F 2J5UA 5TISH 5AW4B 1E5WA 3O6QA 1SQVJ 3AEFC 1VF5C 3TGUJ 1IFDA 3PH0A 1ZOYC 1NTKK 5CJ0A 3AE9C 2YKOA 4PV1D 1AA0A 5AW8B 1SQBJ 1A02J 4LC1A 1NU1D 1YQ3C 1GL2C 1NGMB 2Y0EA 3WMM0 1JTHA 3HUSB 1G2CB 3RL0D 2YMYA 3HD7D 1NTZK 1KYOD 1WMKA 1EXJA 4AUWA 2QE7H 2FFDB 1LGHB 2W6BA 2Q9IA 3VMZA 4H13B 1G1IA 4C7NB 5KLVD 4C7RA 1P84D 3B5NB 4N78E 1NTZG 5AVRB 1YJ9P 1KQFB 2ITAA 4I7ZC 1PV3A 1GK6A 3RK3B 3CCJP 2J59M 5BU8B 3F5HA 1USDA 3P8CD 4WY4C 1S9KD 1CI6B 1S5LE 1EZVE 3RL0B 1NU1K 3H1IJ 3FX0A 1IFMA 3Q5SA 3H1JD 3G71P 1ZRTE 5L8RJ 2I1JA 5KAIH 1DEEG 2E76C 2GM4A 3CMEP 2KXPB 1EDJA 2M8RA 1PGPA 3MGNA 4GOFA 5B5EH 3A0BH 1T2KC 1SQQE 4IFDK 2PGDA 5CJ4A 1X9VA 1KC8Q 2PRRA 1GW4A 2G3AA 3H1HG 3G6EP 1M56D 2KB7P 2IBZD 1FOSF 1X79B 3EWKA 5AW6B 1RF0C 5AW1B 2BCCE 1VPCA 3AEAC 1BE3D 1M1JA 2SPZA 4Z1MH 1KILD 3VMYA 3L35A 3L4FA 1EC5A 5APUA 2O3JA 2ZJSE 1NO4A 1UIIA 4IL6X 3H32A 3OAKA 4L73A 1OW8A 3V2RA 5H2FE 2AXTE 1P84H 2QM7A 3USSA 3U1CA 3L73D 1PPJG 1N7SC 3GW6A 2B9BA 3W68A 1KYOI 3IN6A 3M0DC 3CC7P 1AQ5A 1LTGC 3L71D 1JY2P 1URQA 1D7MA 1P84I 2FYUD 3L74D 1L0LE 1LTTC 2OQQA 1HBWA 2QVAA 3VYIA 2Y9YA 1FZFA 2R5BA 2N1TC 3RK2D 1VQPP 2JEEA 3JCUH 2KLUA 3VP9A 2A06G 4H0LD 2P67A 5KLIB 1G1JA 3CCVP 2YKPA 3L70J 1VF5D 2WZ7A 2XNXA 3BCCD 1JY3P 1FU1A 2KI7B 3N7NA 4RO0A 1YHQP 3OJAB 4GDOA 1K05A 3JSVC 1QL2A 3WUTA 3Q5RA 2ZFCA 2FYUK 2WQYC 5KLVE 1PFIA 3RK2B 3A5TA 2IBZI 2KK7A 1M1JB 2NPSB 3AEDC 3MHVA 2ZYDA 4U3FE 2NRGA 4RKUJ 2C9NY 2HYNA 3BRVB 3H1LJ 1VF5B 2MKVA 4ZNCA 1HGVA 2N9BA 3H6PA 1RE4C 2ZYGA 2LXBA 3H1JE 2XKMA 2FXPA 3CCMP 4WY4D 5KJ7C 1SS1A 3TF5A 1GW3A 4W7YA 2K9JB 2CK3H 3L72D 1MKMA 2E74C 2OYOA 2Q3EA 1URQB
chains in the Genus database with same CATH topology
2OYHA 2HFED 2YKQA 2WSCH 1KILC 2FFDA 1FAVA 4JYCA 1NOHA 2WT7B 3A3YB 1URQC 3U1AA 3I5CA 2OYHC 4C7NA 3U59A 5AVZB 3V2PA 3B5NA 3BATA 1L4AD 3E1IA 3II6A 1Z56A 4Y99C 1RE3A 3V4QA 1DEBA 4W7ZA 1JY2O 3UIAA 4WY4B 4WY4A 1HTLC 2FXMA 1J1EB 1HWTC 1ZV8A 2A45G 1GTWA 3HTKB 5APWA 3OA7A 2HODB 1QL1A 1J1EC 2LKMA 2P7JA 3L36A 3VN0A 1SFCB 2R32A 1IC2A 3LW5H 5CCGD 1SQVK 1KZUB 1NHLA 5CMZA 2PAJA 3V2QA 1HGZA 2E42A 4GKGA 3NTNA 1SFCC 3L37A 2IX7C 3KDPB 2E43A 2A45H 1GL2D 3M0AA 3TYYA 4I6MC 5APTA 5KTBA 1SQBK 4DOJA 4M3LA 2HPCA 2HPCB 4GT1A 2KOGA 1L4AA 1NWQA 1FOSE 2WPQA 3N4XA 1N73B 1N73A 4LLHA 1YTZT 1HH0A 1N7SD 2ZXEB 1FJKA 1JOCA 1RF0A 1T3JA 3RK2C 5AVTB 2W6AA 1MZ9A 1SQPK 4EOTA 1JNMA 2H8PD 1LWUB 1LWUA 3V5BA 1N2DC 3C9IA 2R3CA 3TNUB 3TNUA 5CCGA 1SQXK 4ZKPA 1T3UA 1A02F 1EQ7A 5AW4B 3TK1A 1E5WA 1LWUC 3P7KA 4RESB 1IFDA 2FYZA 1NTKK 1GL2B 1GL2A 5CJ0A 3M9BA 5APVA 2XU6A 4DZOA 1W2EA 3VMXA 1JY3N 2YKOA 3SWFA 2WWWA 5AW8B 1A02J 4LC1A 2PP6A 1LTSC 2M3BA 1GL2C 1X8YA 2N1TD 3WMM0 5BU5A 1JTHB 1JTHA 3HUSB 3HUSA 1G2CB 1G2CA 1N7SA 3RL0D 2YMYA 3HD7D 1NTZK 1MFZA 3G3ZA 4HYTB 2KSJA 3KQGA 3M0DA 1FZCA 1FZCB 4AUWA 2FFDB 1LGHB 1MUUA 2W6BA 4IFFA 5AW0B 1N86A 5APSA 5APYA 2Q9IA 1GK4A 1SP4A 3VMZA 3BASA 1T2KD 2Q3IA 1LTJA 1FZCC 1G1IA 1NAFA 4C7NB 2FFDC 4C7RA 3B5NB 4N78E 5AVUB 5AVRB 1N7LA 1IFNA 1FJPA 1GK6A 3RK3B 3TSIA 3A7OA 2J59M 3B5NC 1H88A 1IJDB 5CCHD 5BU8B 5CHXA 4AYCA 3BRTB 4AQRD 1HVVA 1RE3C 2Q5UA 4OH8B 2N1TA 3HE5A 3P8CD 3RK3C 4WY4C 1S9KD 1CI6B 1CI6A 3RL0B 3VP8A 2WSFH 3HD7A 1NU1K 2I1KA 1FDMA 1IFMA 2YO2A 1NKZB 2NPSD 4HH2A 1SQQK 2I1JA 2XV5A 1IK9A 1GDTA 2GM4A 5APQA 1ZN5A 2M8RA 1KFMA 3MGNA 1L4AB 5AW7B 3M91A 5BVZA 1WT6A 3NMDA 1L0NK 1JUNA 1T2KC 4IFDK 5CJ4A 4LGDE 3MD0A 1JMMA 2H7HA 1X9VA 1L4AC 5CCHA 1JY3O 1GW4A 1XTGB 2J58A 2KB7P 1N73C 2XDJA 5APXA 2IFNA 1JO5A 5AW3B 1FZAA 2O01H 2CPSA 1VDFA 4B86A 1FOSF 1X79B 1OWAA 2Z4EA 5AW6B 3V2NA 1RF0C 5AW1B 2H43A 1VPCA 2QM8A 3VOPA 2O1JA 1M1JA 5AW9B 1KILD 1NTMK 2R5DA 3VMYA 3SWYA 2WITA 1LT9A 1IFIA 5CCGC 1URQD 2GUSA 1KFNA 3L35A 3L4FA 4JF7A 3P8CE 5APUA 4GIFA 1S9KE 3GHGA 3CI9A 1NO4A 3HE4B 2WPRA 3HE4A 3IR9A 3H32B 3H32A 3OAKA 4N6JA 3R2PA 1URQB 2C9LY 4W80A 2IFMA 1N7SB 3V2RA 1YYCA 2OYIA 3CL3D 2O1KA 2QM7A 3HUSC 3U1CA 3MIWA 3IFMA 2L5GB 1IFJA 1N7SC 2C0XA 2C0WA 1ZR2A 2WPSA 2MJZA 4WB4A 4XA4A 1LTJB 3M0DC 1LTAC 1CZQA 1KILA 1AQ5A 1SFCD 1LTGC 2YO3A 3T97A 1L0LK 1JY2P 2Z5HA 2HLOA 1MV8A 3M9HA 2P1JA 1FZGA 2Z5IA 1URQA 1ZR4A 1HUCA 1LTJC 2CPBA 1AFOA 2W27A 1SVFA 4O9BA 2WT7A 4Y99B 1FZBA 1LTTC 1JCCA 1CW5A 2N1TB 3HE5B 3CLQA 1HBWA 1FZEA 3BVHA 4KHXA 5AVQB 3NFQA 2KLVA 3HD7B 4JYBA 5AVXB 3VYIA 1FZFA 3O8ZA 2R5BA 2N1TC 3RK2D 2JEEA 2IPPA 2KYVA 3VP9A 2JJLA 2HG5D 3RL0C 2P67A 3HD7C 3HTKA 2OARA 1DH3A 1G1JA 1SLQA 3P8MC 1GD2E 1XTCC 2HODA 2YKPA 1J1DB 4I2LC 3PP5A 1FBMA 1KQLA 3B8EB 1SFCA 2WTYA 2WZ7A 2XNXA 1RF1B 1GU5A 1RF1A 1JY3P 1FU1A 3N7NA 1J1DC 1JCDA 2YNYA 5KJ7D 5KLVK 4N3YB 3OJAB 1H89A 1GZLA 1M7LA 1T8ZA 1RF1C 3HRNA 1QL2A 3KPEA 1YTZI 1JY2N 3MUDA 2XZRA 1H8AA 1LTIC 2ZFCA 3MTUE 5CCHC 3NXSA 1LTBC 2FYUK 5AVSB 1PFIA 5AVYB 1NKNA 3KYQA 3RK2B 3A5TA 1M1JB 1NH4A 2NPSB 2NPSA 4N78D 1WRGA 5AVWB 4ZKUA 1LT9B 1IO4A 2GUVA 1M1JC 2NPSC 2C9NY 1RY3A 2A45I 2HYNA 1OXZA 3EQ2A 3BRVB 4EIJA 1RE4A 1DX7A 1LT9C 3GHGB 3V4WA 1GU4A 1HGVA 1J2JB 2FKWB 4IFMA 3A2AA 2Q7CA 2N9BA 5KJ7A 2VRSA 3B5ND 5AW5B 2POHA 3H6PA 1RE4C 2WSEH 2BASA 3GHGC 2OYIB 2KP8A 2XKMA 5AVVB 3P32A 3RK3D 4C46A 4WY4D 5KJ7C 1ZLLA 1HJBA 3LIDA 2OYIC 3EFGA 3VTPC 3M9QA 1GW3A 4W7YA 4XE5B 1KILB 3M06A 3LIEA 4WBAA 5AW2B 1CSBA 4I1LA 2P2UA 2OYHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VDF A;  3V2R A;  1DEB A;  3V2P A;  3V2Q A;  1FBM A;  3V2N A;  1MZ9 A; 
#chains in the Genus database with same CATH topology
 2OYH A;  2HFE D;  2YKQ A;  1BDC A;  4JYC A;  3H1I E;  2RN0 A;  1QVG O;  1EDI A;  4I7Z B;  5AVZ B;  1BE3 E;  3BAT A;  1QLE D;  1DEB A;  2V7Q H;  1JY2 O;  4WY4 B;  2FXM A;  1OFC X;  2A45 G;  5APW A;  1PP9 G;  3OA7 A;  1VQK P;  5KAF E;  1QL1 A;  1J1E C;  2LKM A;  2P7J A;  2R32 A;  1IC2 A;  1BSN A;  2QA4 P;  1KZU B;  2PAJ A;  3CX5 H;  1HGZ A;  2E42 A;  4OGQ C;  2IX7 C;  2E43 A;  4U7J A;  2A45 H;  3TYY A;  4D6T J;  4I6M C;  5APT A;  4RJT A;  2HPC B;  2AEM A;  4R4M A;  1H0T A;  1L4A A;  1FOS E;  2WPQ A;  1N73 A;  3MUD C;  1KB9 E;  1LNQ A;  3D6Y A;  1N7S D;  2E75 D;  3AE4 C;  1Q86 Q;  3L74 E;  2W6A A;  4EOT A;  1K73 Q;  3RL0 g;  3C9I A;  3PHL A;  4PJ0 E;  1NJI Q;  4EYY Q;  1EZV D;  1VQ6 P;  3CXH H;  1SQP E;  2JKV A;  1LWU C;  4RES B;  5M1B A;  1ZRT D;  2FXO A;  1SQX E;  2XU6 A;  1JY3 N;  4DCK A;  2WVR A;  1DD3 A;  5GTH H;  2N1T D;  5BU5 A;  3CWB J;  3HUS A;  3CCQ P;  3BCC E;  1G2C A;  2E75 B;  3Q1M A;  3CXH I;  4HYT B;  3G3Z A;  2KSJ A;  2FBW C;  1FZC B;  4UB6 H;  5AW0 B;  1GK4 A;  2K37 A;  2BEQ D;  2Q3I A;  3AEC C;  3H1K E;  1OW6 A;  1QVF O;  1FJP A;  2K9Y A;  1IJD B;  4D6T G;  4AQR D;  1RE3 C;  2Q5U A;  2O01 N;  1CI6 A;  3HD7 A;  1FDM A;  4BWN A;  1BGY J;  1NKZ B;  1NTZ J;  1ZXG A;  1KQS O;  3L75 E;  4HH2 A;  1SQQ K;  1IK9 A;  1EDL A;  1S3J A;  1ZN5 A;  1OIP A;  5KKZ B;  2PFX A;  1KFM A;  1H0T B;  1L4A B;  3M91 A;  1WT6 A;  3D71 A;  3H1L E;  1OX3 A;  1SQQ G;  1XTG B;  1M8O B;  2XDJ A;  5APX A;  1FZA A;  1L0N E;  2CPS A;  1VDF A;  2K3R A;  1FS0 E;  2Z4E A;  1L0L D;  3V2N A;  2E74 D;  3VOP A;  2O1J A;  5AW9 B;  1NU1 J;  1K04 A;  1R8E A;  2K88 A;  2R5D A;  2BCC G;  2WIT A;  1LT9 A;  5CCG C;  1EZV I;  3R4Y A;  3H1H J;  4JF7 A;  3KXD A;  3CCS P;  4GIF A;  2ZYA A;  1NTM E;  2NZ2 A;  2BEZ F;  3Q2Y A;  4K35 A;  3KZI E;  2C9L Y;  4W80 A;  2WSE J;  2OYI A;  3CL3 D;  2O1K A;  1NTK G;  3CCR P;  1IFJ A;  4H44 C;  1RQV A;  2C0W A;  1ZR2 A;  2WPS A;  1SQV D;  4WB4 A;  4XA4 A;  3TGU D;  2WSS H;  1CZQ A;  1KIL A;  4OGQ D;  4DT0 A;  1L0L K;  2Z5H A;  1BGY G;  1MV8 A;  2Z5I A;  1LTJ C;  1SQB D;  2CPB A;  4L75 A;  2G8Y A;  3FWL A;  1Q90 D;  2W27 A;  1EDK A;  1SVF A;  1S4X A;  4PV1 B;  4U3F D;  1T6A A;  1CW5 A;  4YTP C;  3CLQ A;  3GG2 A;  4KHX A;  5AVQ B;  1K9M Q;  2KLV A;  3HD7 B;  3WUV A;  1KOR A;  2KYV A;  2HG5 D;  3HTK A;  3WU2 E;  3P8M C;  1GD2 E;  1XTC C;  2HOD A;  1QX8 A;  4IOI H;  1J1D B;  1FBM A;  1KQL A;  3B8E B;  1RF1 B;  1NU1 G;  2RH0 A;  2YNY A;  2IZ1 A;  4WVZ A;  5KLV K;  1H89 A;  5TIS E;  1LP1 B;  3VMA A;  2XZR A;  3H1I D;  1LTI C;  4L74 A;  4KJM A;  5CCH C;  5AVS B;  1YJW P;  3QH9 A;  1BCC E;  2KZJ A;  3S9O A;  2R44 A;  2NPS A;  1PIX A;  5KLV G;  1WRG A;  5AVW B;  2AEJ A;  1LT9 B;  2GUV A;  2IZ0 A;  1KYO H;  4EIJ A;  2KSE A;  3L73 J;  4IFM A;  1J2J B;  1HJ0 A;  5TJH A;  2Q7C A;  2L91 A;  1QGK B;  2POH A;  2WSE H;  2AEF A;  2BAS A;  3GHG C;  2OYI B;  2H89 C;  3L71 J;  2RKL A;  1ZLL A;  3H1J G;  3EFG A;  5E79 H;  2FYU J;  1NVO A;  2K9J A;  1KIL B;  3FXD A;  2WMM A;  1KB9 D;  4HJG H;  4I1L A;  3SSU A;  1W2B O;  1PGJ A;  2WSC H;  1EXI A;  1NOH A;  2QJP B;  3I56 P;  3U1A A;  1S5L X;  2OYH C;  2B88 A;  2IBZ G;  1MFT A;  1Y8A A;  3E1I A;  1Z56 A;  1IFP A;  1VL2 A;  4XFJ A;  2K1A A;  2FYN C;  4Y99 C;  5DJU B;  3A0H H;  4OWF A;  1SQP D;  1BE3 G;  2JWA A;  2V7Q J;  4WY4 A;  2KS1 A;  4YXW H;  3A0B E;  5B5E E;  1VQ7 P;  1ZV8 A;  1GTW A;  3HTK B;  3FWN A;  1SQX D;  2FY8 A;  1VQN P;  2HOD B;  2ZVO B;  3L36 A;  5B66 E;  5CCG D;  2H88 C;  1DIP A;  2QJK C;  5CMZ A;  3V2Q A;  3B71 A;  1ZME C;  1SFC C;  3KDP B;  5KTB A;  1GL2 D;  3M0A A;  1SQV E;  4M3L A;  2HPC A;  3L73 G;  3TGU E;  1PP9 J;  1AJY A;  1KV4 A;  1IZN B;  1AVY A;  1SQB E;  3H1K D;  4H44 D;  5KAF H;  4H0L B;  3L70 D;  3L71 G;  1JOC A;  1RF0 A;  2YIU B;  2ZT9 C;  1VQ9 P;  1SQP K;  1JNM A;  3SFD C;  5GTI H;  3V5B A;  2FYU G;  3L74 G;  1N2D C;  3RBX A;  2QJY C;  2Q1K A;  1SQX K;  2D2C C;  4ZKP A;  1EQ7 A;  3TK1 A;  3D6Z A;  3P7K A;  1OW7 A;  1FC2 C;  4PD4 E;  2P10 A;  1GL2 B;  3L72 J;  3L75 D;  4L76 A;  2WWW A;  3AEG C;  1HF9 A;  2PP6 A;  1LTS C;  2M3B A;  4UB8 E;  1N7S A;  1PPJ E;  3GMA A;  1MFZ A;  2E76 D;  3H1L D;  3BCC G;  3KQG A;  3M0D A;  1FZC A;  4ASV A;  1MUU A;  1KB9 I;  4IFF A;  1IK7 A;  5APY A;  1OVR A;  1L0N D;  3JCU E;  1T2K D;  3CCE P;  2WPV B;  1UIX A;  2FFD C;  4QMA A;  1RHZ B;  5AVU B;  3MZW B;  4NPE A;  1N7L A;  4H13 C;  3CC2 P;  1JM0 A;  3TSI A;  2KS1 B;  4OVN F;  3B5N C;  5CCH D;  5CHX A;  4AYC A;  3BRT B;  1HVV A;  2IYP A;  2M3E A;  4OH8 B;  2N1T A;  3RK3 C;  1NTM D;  2A06 E;  3VP8 A;  2WSF H;  2E76 B;  3PRJ A;  2YO2 A;  4BXL A;  2ZVN B;  3CC4 P;  3C1L A;  2XV5 A;  3B4S A;  1PL5 A;  2QRX A;  5AW7 B;  5BVZ A;  3TDK A;  1VQO P;  3NMD A;  1L0N K;  3ZDM A;  1JMM A;  2H7H A;  2DW3 A;  3L72 G;  1JY3 O;  3CPW O;  3C8V A;  2IFN A;  1JO5 A;  2O01 H;  4B86 A;  5C39 A;  1AV1 A;  2H43 A;  2QM8 A;  1NTM K;  1M1K Q;  3SWY A;  1OMI A;  2LR2 A;  1IFI A;  2GUS A;  1KFN A;  2W6J H;  2KUB A;  1SQQ J;  4R4L A;  3FXE A;  4ZMD A;  1VQ5 P;  3CI9 A;  1DD4 A;  3HE4 B;  2WPR A;  3IR9 A;  4N6J A;  1N7S B;  4JPZ B;  1N8R Q;  2BCC J;  1E79 H;  3AE8 C;  1VQM P;  2MJZ A;  2M5A B;  2M0B A;  1JB0 J;  3CMA P;  2ZXX A;  1SFC D;  2IDB A;  2YO3 A;  3T97 A;  3D70 A;  3M9H A;  1BCC D;  1FZG A;  3L70 E;  1HUC A;  1AFO A;  4EDF A;  5K5G B;  3KZI H;  3CWB D;  4O9B A;  2WT7 A;  1NTK J;  4Y99 B;  3G9R A;  1FZB A;  1JCC A;  2N1T B;  3CX5 E;  2KNC A;  1FZE A;  3BVH A;  2W90 A;  5AVX B;  2ZT9 D;  1PP9 E;  1KMI Z;  2IPP A;  1EZV G;  3PJS K;  1DH3 A;  2D2C D;  1USE A;  4I2L C;  3PP5 A;  1RQU A;  1JMB A;  2WTY A;  5CBO A;  1RF1 A;  2OTJ P;  4NPD A;  3LW5 J;  1L0L J;  3E7K A;  3GF3 A;  5KJ7 D;  4N3Y B;  1Q82 Q;  1S5L H;  3HRN A;  3OW2 O;  3MUD A;  1LP1 A;  3MTU E;  1LTB C;  1NTZ D;  5AVY B;  3FGA D;  4YPC A;  2P58 A;  1U7J A;  4ZKU A;  3AEE C;  1M1J C;  2D2C B;  2NPS C;  1RY3 A;  2JWD A;  1DX7 A;  3V4W A;  1GU4 A;  1R5S A;  4UB6 E;  3A2A A;  4H13 D;  1FDI A;  3B5N D;  2KP8 A;  5AVV B;  5KLV J;  3RK3 D;  3GLM A;  1HJB A;  1BDD A;  2E74 B;  4WWI A;  3M9Q A;  4XE5 B;  2IYO A;  4U3F J;  3LIE A;  4IL6 E;  4WBA A;  4MN4 C;  3H1H D;  3T97 B;  5AW2 B;  1KD1 Q;  1CSB A;  1W5C E;  2P2U A;  1FAV A;  2WSC J;  2WT7 B;  3A3Y B;  1S2E A;  1URQ C;  2YXQ B;  3H1J J;  5H2F H;  2AXT H;  2KNC B;  3V2P A;  1LT1 A;  1L0L G;  4D6T E;  4JBZ A;  1RE3 A;  2Y0D A;  1ZP0 C;  1L2P A;  3UIA A;  1HTL C;  1J1E B;  1HWT C;  4PD4 D;  2W83 C;  4NPF X;  4ASW A;  2E5T A;  4OGQ B;  3S4R A;  1U57 A;  3LW5 H;  1SQV K;  1NHL A;  3SFE C;  1PPJ D;  1BE3 J;  1GMJ A;  2XND H;  1FE6 A;  1R5L A;  1SQB K;  4DOJ A;  2LXC B;  2KOG A;  1NWQ A;  4TLF A;  4LLH A;  1SQV G;  3AE2 C;  3TGU G;  1YIT P;  2E5Y A;  2OTL P;  1LJ2 A;  5B66 H;  3CWB E;  2I8D A;  4KT0 J;  1MZ9 A;  1SQB G;  3AE5 C;  2W8Z A;  1LWU B;  2B87 A;  3RBZ A;  3TNU B;  5CCG A;  2QG4 A;  4U3F G;  2A06 D;  3O6Q B;  2FYZ A;  1GL2 A;  3M9B A;  1BSH A;  5APV A;  1VQ8 P;  4DZO A;  1W2E A;  3VMX A;  3SWF A;  2UWJ E;  2JR8 A;  2QEX P;  1X8Y A;  1JTH B;  2YMK A;  1NTK E;  3E1R A;  3L74 J;  1M57 D;  3S1K A;  2B89 A;  2E75 C;  1K8A Q;  1N86 A;  1SQP J;  5APS A;  1BGY E;  1SP4 A;  3BAS A;  1NTZ E;  4PD4 H;  1LTJ A;  1FZC C;  1NAF A;  3H1I G;  5KAI E;  1SQX J;  3W67 A;  3PLN A;  1PGO A;  1VQL P;  2Y9Z A;  1YI2 P;  1IFN A;  3A7O A;  3ITK A;  2GA1 A;  1H88 A;  4UB8 H;  3BCC J;  3HE5 A;  4HB1 A;  4PD4 I;  3SWK A;  3G4S P;  1AVO A;  2WSF J;  2I1K A;  2NPS D;  3H25 A;  1JEK A;  3RK3 E;  1GDT A;  1M90 Q;  1ZW0 A;  3H1K J;  5APQ A;  1NU1 E;  2AXC A;  1JUN A;  1YQ4 C;  3H1H E;  3RGU A;  1KYO E;  4LGD E;  3MD0 A;  5KKZ C;  5CBN A;  1NYH A;  1Q81 Q;  4Y28 J;  1L4A C;  5CCH A;  3MP7 B;  3Q3D A;  2J58 A;  1N73 C;  1Y9B A;  5AW3 B;  1S1C X;  3AE3 C;  3PTZ A;  2O01 J;  2KIK A;  1OWA A;  2B87 B;  4YXD C;  1FDO A;  3L75 J;  1P84 E;  3CX5 D;  1PZQ A;  3K5B A;  1X0T A;  1QEX A;  5E79 E;  3AEB C;  1PP9 D;  1URQ D;  1X22 A;  1KB9 H;  1SQP G;  3P8C E;  1S9K E;  3CD6 P;  3GHG A;  3HE4 A;  3H32 B;  1SQX G;  3R2P A;  1YIJ P;  1L0N J;  2IFM A;  4H44 B;  4JQ0 D;  1S72 P;  1YYC A;  2OGU A;  1KTM A;  4PJ0 H;  3HUS C;  3MIW A;  3IFM A;  2L5G B;  2JDI H;  2C0X A;  4BRY A;  3A0H E;  4CPG A;  3CXH D;  3AE7 C;  2M5A A;  3AE1 C;  1YJN P;  1LTJ B;  1LTA C;  2HLO A;  3KHU A;  2P1J A;  1Y47 A;  1ZR4 A;  1NTM J;  2IBZ E;  3H1K G;  3L70 G;  1U7M A;  4DJG A;  3HE5 B;  1YBK A;  3QWO C;  3IAO A;  4PV1 C;  1OVV A;  1KIL E;  3I55 P;  3NFQ A;  4JYB A;  3O8Z A;  2V4H A;  2JJL A;  4TT3 H;  3RL0 C;  3HD7 C;  2OAR A;  1SLQ A;  3L75 G;  1SFC A;  1GU5 A;  1J1D C;  1JCD A;  5GTI E;  3L73 E;  1NAY A;  1GZL A;  1M7L A;  1T8Z A;  1RF1 C;  3KPE A;  1YTZ I;  1JY2 N;  3H1L G;  1H8A A;  1Q7Y Q;  3NXS A;  3L71 E;  1NKN A;  1L0N G;  3KYQ A;  1NH4 A;  4N78 D;  4D6T D;  1AQT A;  2JP3 A;  3CX5 I;  2JO1 A;  2FYU E;  2Q6Q A;  1IO4 A;  3IF4 A;  2A45 I;  1RH5 B;  3AE6 C;  1OXZ A;  3EQ2 A;  2QSI A;  2R3S A;  1RE4 A;  4K3A A;  1LT9 C;  3GHG B;  2FKW B;  3F89 A;  3CCU P;  5DJT B;  5KJ7 A;  2VRS A;  3WUU A;  5AW5 B;  2RMZ A;  1NTM G;  3P32 A;  1PGQ A;  4C46 A;  3V6I A;  1BCC J;  4BRY B;  3LID A;  1OVU A;  2OYI C;  3VTP C;  2N9Y B;  3GF7 A;  4GOD A;  3M06 A;  2ZAE B;  1SQQ D;  1Q2N A;  3EFF K;  2OYH B;  1KIL C;  2FFD A;  2FYN B;  1KN7 A;  3I5C A;  4C7N A;  3U59 A;  3B5N A;  2QJP C;  1L4A D;  2BCC D;  4EI2 A;  3II6 A;  4A7P A;  2QIW A;  3V4Q A;  4W7Z A;  1KQG B;  4IL6 H;  2YXR B;  2OTK E;  2Y0C A;  2QJK B;  5EFW B;  3CCL P;  3VN0 A;  1SFC B;  5KLI C;  1NTK D;  1VQ4 P;  4GKG A;  3NTN A;  3L37 A;  2HR3 A;  4GOE A;  3CXH E;  2KZI A;  4GT1 A;  1BGY D;  3N4X A;  4HKZ H;  3L72 E;  3ABV C;  1N73 B;  1YTZ T;  2ZT9 B;  3WU2 H;  1HH0 A;  1OZH A;  2ZXE B;  1FJK A;  3Q5P A;  5GTH E;  1T3J A;  3RK2 C;  1BCC G;  5AVT B;  2QJY B;  4H0L C;  2H8P D;  3CWB G;  1LWU A;  2YIU C;  1TU3 F;  3JC2 2;  2R3C A;  3TNU A;  1T3U A;  1A02 F;  2J5U A;  5TIS H;  5AW4 B;  1E5W A;  3O6Q A;  1SQV J;  3AEF C;  1VF5 C;  3TGU J;  1IFD A;  3PH0 A;  1ZOY C;  1NTK K;  5CJ0 A;  3AE9 C;  2YKO A;  4PV1 D;  1AA0 A;  5AW8 B;  1SQB J;  1A02 J;  4LC1 A;  1NU1 D;  1YQ3 C;  1GL2 C;  1NGM B;  2Y0E A;  3WMM 0;  1JTH A;  3HUS B;  1G2C B;  3RL0 D;  2YMY A;  3HD7 D;  1NTZ K;  1KYO D;  1WMK A;  1EXJ A;  4AUW A;  2QE7 H;  2FFD B;  1LGH B;  2W6B A;  2Q9I A;  3VMZ A;  4H13 B;  1G1I A;  4C7N B;  5KLV D;  4C7R A;  1P84 D;  3B5N B;  4N78 E;  1NTZ G;  5AVR B;  1YJ9 P;  1KQF B;  2ITA A;  4I7Z C;  1PV3 A;  1GK6 A;  3RK3 B;  3CCJ P;  2J59 M;  5BU8 B;  3F5H A;  1USD A;  3P8C D;  4WY4 C;  1S9K D;  1CI6 B;  1S5L E;  1EZV E;  3RL0 B;  1NU1 K;  3H1I J;  3FX0 A;  1IFM A;  3Q5S A;  3H1J D;  3G71 P;  1ZRT E;  5L8R J;  2I1J A;  5KAI H;  1DEE G;  2E76 C;  2GM4 A;  3CME P;  2KXP B;  1EDJ A;  2M8R A;  1PGP A;  3MGN A;  4GOF A;  5B5E H;  3A0B H;  1T2K C;  1SQQ E;  4IFD K;  2PGD A;  5CJ4 A;  1X9V A;  1KC8 Q;  2PRR A;  1GW4 A;  2G3A A;  3H1H G;  3G6E P;  1M56 D;  2KB7 P;  2IBZ D;  1FOS F;  1X79 B;  3EWK A;  5AW6 B;  1RF0 C;  5AW1 B;  2BCC E;  1VPC A;  3AEA C;  1BE3 D;  1M1J A;  2SPZ A;  4Z1M H;  1KIL D;  3VMY A;  3L35 A;  3L4F A;  1EC5 A;  5APU A;  2O3J A;  2ZJS E;  1NO4 A;  1UII A;  4IL6 X;  3H32 A;  3OAK A;  4L73 A;  1OW8 A;  3V2R A;  5H2F E;  2AXT E;  1P84 H;  2QM7 A;  3USS A;  3U1C A;  3L73 D;  1PPJ G;  1N7S C;  3GW6 A;  2B9B A;  3W68 A;  1KYO I;  3IN6 A;  3M0D C;  3CC7 P;  1AQ5 A;  1LTG C;  3L71 D;  1JY2 P;  1URQ A;  1D7M A;  1P84 I;  2FYU D;  3L74 D;  1L0L E;  1LTT C;  2OQQ A;  1HBW A;  2QVA A;  3VYI A;  2Y9Y A;  1FZF A;  2R5B A;  2N1T C;  3RK2 D;  1VQP P;  2JEE A;  3JCU H;  2KLU A;  3VP9 A;  2A06 G;  4H0L D;  2P67 A;  5KLI B;  1G1J A;  3CCV P;  2YKP A;  3L70 J;  1VF5 D;  2WZ7 A;  2XNX A;  3BCC D;  1JY3 P;  1FU1 A;  2KI7 B;  3N7N A;  4RO0 A;  1YHQ P;  3OJA B;  4GDO A;  1K05 A;  3JSV C;  1QL2 A;  3WUT A;  3Q5R A;  2ZFC A;  2FYU K;  2WQY C;  5KLV E;  1PFI A;  3RK2 B;  3A5T A;  2IBZ I;  2KK7 A;  1M1J B;  2NPS B;  3AED C;  3MHV A;  2ZYD A;  4U3F E;  2NRG A;  4RKU J;  2C9N Y;  2HYN A;  3BRV B;  3H1L J;  1VF5 B;  2MKV A;  4ZNC A;  1HGV A;  2N9B A;  3H6P A;  1RE4 C;  2ZYG A;  2LXB A;  3H1J E;  2XKM A;  2FXP A;  3CCM P;  4WY4 D;  5KJ7 C;  1SS1 A;  3TF5 A;  1GW3 A;  4W7Y A;  2K9J B;  2CK3 H;  3L72 D;  1MKM A;  2E74 C;  2OYO A;  2Q3E A;  1URQ B; 
#chains in the Genus database with same CATH homology
 2OYH A;  2HFE D;  2YKQ A;  2WSC H;  1KIL C;  2FFD A;  1FAV A;  4JYC A;  1NOH A;  2WT7 B;  3A3Y B;  1URQ C;  3U1A A;  3I5C A;  2OYH C;  4C7N A;  3U59 A;  5AVZ B;  3V2P A;  3B5N A;  3BAT A;  1L4A D;  3E1I A;  3II6 A;  1Z56 A;  4Y99 C;  1RE3 A;  3V4Q A;  1DEB A;  4W7Z A;  1JY2 O;  3UIA A;  4WY4 B;  4WY4 A;  1HTL C;  2FXM A;  1J1E B;  1HWT C;  1ZV8 A;  2A45 G;  1GTW A;  3HTK B;  5APW A;  3OA7 A;  2HOD B;  1QL1 A;  1J1E C;  2LKM A;  2P7J A;  3L36 A;  3VN0 A;  1SFC B;  2R32 A;  1IC2 A;  3LW5 H;  5CCG D;  1SQV K;  1KZU B;  1NHL A;  5CMZ A;  2PAJ A;  3V2Q A;  1HGZ A;  2E42 A;  4GKG A;  3NTN A;  1SFC C;  3L37 A;  2IX7 C;  3KDP B;  2E43 A;  2A45 H;  1GL2 D;  3M0A A;  3TYY A;  4I6M C;  5APT A;  5KTB A;  1SQB K;  4DOJ A;  4M3L A;  2HPC A;  2HPC B;  4GT1 A;  2KOG A;  1L4A A;  1NWQ A;  1FOS E;  2WPQ A;  3N4X A;  1N73 B;  1N73 A;  4LLH A;  1YTZ T;  1HH0 A;  1N7S D;  2ZXE B;  1FJK A;  1JOC A;  1RF0 A;  1T3J A;  3RK2 C;  5AVT B;  2W6A A;  1MZ9 A;  1SQP K;  4EOT A;  1JNM A;  2H8P D;  1LWU B;  1LWU A;  3V5B A;  1N2D C;  3C9I A;  2R3C A;  3TNU B;  3TNU A;  5CCG A;  1SQX K;  4ZKP A;  1T3U A;  1A02 F;  1EQ7 A;  5AW4 B;  3TK1 A;  1E5W A;  1LWU C;  3P7K A;  4RES B;  1IFD A;  2FYZ A;  1NTK K;  1GL2 B;  1GL2 A;  5CJ0 A;  3M9B A;  5APV A;  2XU6 A;  4DZO A;  1W2E A;  3VMX A;  1JY3 N;  2YKO A;  3SWF A;  2WWW A;  5AW8 B;  1A02 J;  4LC1 A;  2PP6 A;  1LTS C;  2M3B A;  1GL2 C;  1X8Y A;  2N1T D;  3WMM 0;  5BU5 A;  1JTH B;  1JTH A;  3HUS B;  3HUS A;  1G2C B;  1G2C A;  1N7S A;  3RL0 D;  2YMY A;  3HD7 D;  1NTZ K;  1MFZ A;  3G3Z A;  4HYT B;  2KSJ A;  3KQG A;  3M0D A;  1FZC A;  1FZC B;  4AUW A;  2FFD B;  1LGH B;  1MUU A;  2W6B A;  4IFF A;  5AW0 B;  1N86 A;  5APS A;  5APY A;  2Q9I A;  1GK4 A;  1SP4 A;  3VMZ A;  3BAS A;  1T2K D;  2Q3I A;  1LTJ A;  1FZC C;  1G1I A;  1NAF A;  4C7N B;  2FFD C;  4C7R A;  3B5N B;  4N78 E;  5AVU B;  5AVR B;  1N7L A;  1IFN A;  1FJP A;  1GK6 A;  3RK3 B;  3TSI A;  3A7O A;  2J59 M;  3B5N C;  1H88 A;  1IJD B;  5CCH D;  5BU8 B;  5CHX A;  4AYC A;  3BRT B;  4AQR D;  1HVV A;  1RE3 C;  2Q5U A;  4OH8 B;  2N1T A;  3HE5 A;  3P8C D;  3RK3 C;  4WY4 C;  1S9K D;  1CI6 B;  1CI6 A;  3RL0 B;  3VP8 A;  2WSF H;  3HD7 A;  1NU1 K;  2I1K A;  1FDM A;  1IFM A;  2YO2 A;  1NKZ B;  2NPS D;  4HH2 A;  1SQQ K;  2I1J A;  2XV5 A;  1IK9 A;  1GDT A;  2GM4 A;  5APQ A;  1ZN5 A;  2M8R A;  1KFM A;  3MGN A;  1L4A B;  5AW7 B;  3M91 A;  5BVZ A;  1WT6 A;  3NMD A;  1L0N K;  1JUN A;  1T2K C;  4IFD K;  5CJ4 A;  4LGD E;  3MD0 A;  1JMM A;  2H7H A;  1X9V A;  1L4A C;  5CCH A;  1JY3 O;  1GW4 A;  1XTG B;  2J58 A;  2KB7 P;  1N73 C;  2XDJ A;  5APX A;  2IFN A;  1JO5 A;  5AW3 B;  1FZA A;  2O01 H;  2CPS A;  1VDF A;  4B86 A;  1FOS F;  1X79 B;  1OWA A;  2Z4E A;  5AW6 B;  3V2N A;  1RF0 C;  5AW1 B;  2H43 A;  1VPC A;  2QM8 A;  3VOP A;  2O1J A;  1M1J A;  5AW9 B;  1KIL D;  1NTM K;  2R5D A;  3VMY A;  3SWY A;  2WIT A;  1LT9 A;  1IFI A;  5CCG C;  1URQ D;  2GUS A;  1KFN A;  3L35 A;  3L4F A;  4JF7 A;  3P8C E;  5APU A;  4GIF A;  1S9K E;  3GHG A;  3CI9 A;  1NO4 A;  3HE4 B;  2WPR A;  3HE4 A;  3IR9 A;  3H32 B;  3H32 A;  3OAK A;  4N6J A;  3R2P A;  1URQ B;  2C9L Y;  4W80 A;  2IFM A;  1N7S B;  3V2R A;  1YYC A;  2OYI A;  3CL3 D;  2O1K A;  2QM7 A;  3HUS C;  3U1C A;  3MIW A;  3IFM A;  2L5G B;  1IFJ A;  1N7S C;  2C0X A;  2C0W A;  1ZR2 A;  2WPS A;  2MJZ A;  4WB4 A;  4XA4 A;  1LTJ B;  3M0D C;  1LTA C;  1CZQ A;  1KIL A;  1AQ5 A;  1SFC D;  1LTG C;  2YO3 A;  3T97 A;  1L0L K;  1JY2 P;  2Z5H A;  2HLO A;  1MV8 A;  3M9H A;  2P1J A;  1FZG A;  2Z5I A;  1URQ A;  1ZR4 A;  1HUC A;  1LTJ C;  2CPB A;  1AFO A;  2W27 A;  1SVF A;  4O9B A;  2WT7 A;  4Y99 B;  1FZB A;  1LTT C;  1JCC A;  1CW5 A;  2N1T B;  3HE5 B;  3CLQ A;  1HBW A;  1FZE A;  3BVH A;  4KHX A;  5AVQ B;  3NFQ A;  2KLV A;  3HD7 B;  4JYB A;  5AVX B;  3VYI A;  1FZF A;  3O8Z A;  2R5B A;  2N1T C;  3RK2 D;  2JEE A;  2IPP A;  2KYV A;  3VP9 A;  2JJL A;  2HG5 D;  3RL0 C;  2P67 A;  3HD7 C;  3HTK A;  2OAR A;  1DH3 A;  1G1J A;  1SLQ A;  3P8M C;  1GD2 E;  1XTC C;  2HOD A;  2YKP A;  1J1D B;  4I2L C;  3PP5 A;  1FBM A;  1KQL A;  3B8E B;  1SFC A;  2WTY A;  2WZ7 A;  2XNX A;  1RF1 B;  1GU5 A;  1RF1 A;  1JY3 P;  1FU1 A;  3N7N A;  1J1D C;  1JCD A;  2YNY A;  5KJ7 D;  5KLV K;  4N3Y B;  3OJA B;  1H89 A;  1GZL A;  1M7L A;  1T8Z A;  1RF1 C;  3HRN A;  1QL2 A;  3KPE A;  1YTZ I;  1JY2 N;  3MUD A;  2XZR A;  1H8A A;  1LTI C;  2ZFC A;  3MTU E;  5CCH C;  3NXS A;  1LTB C;  2FYU K;  5AVS B;  1PFI A;  5AVY B;  1NKN A;  3KYQ A;  3RK2 B;  3A5T A;  1M1J B;  1NH4 A;  2NPS B;  2NPS A;  4N78 D;  1WRG A;  5AVW B;  4ZKU A;  1LT9 B;  1IO4 A;  2GUV A;  1M1J C;  2NPS C;  2C9N Y;  1RY3 A;  2A45 I;  2HYN A;  1OXZ A;  3EQ2 A;  3BRV B;  4EIJ A;  1RE4 A;  1DX7 A;  1LT9 C;  3GHG B;  3V4W A;  1GU4 A;  1HGV A;  1J2J B;  2FKW B;  4IFM A;  3A2A A;  2Q7C A;  2N9B A;  5KJ7 A;  2VRS A;  3B5N D;  5AW5 B;  2POH A;  3H6P A;  1RE4 C;  2WSE H;  2BAS A;  3GHG C;  2OYI B;  2KP8 A;  2XKM A;  5AVV B;  3P32 A;  3RK3 D;  4C46 A;  4WY4 D;  5KJ7 C;  1ZLL A;  1HJB A;  3LID A;  2OYI C;  3EFG A;  3VTP C;  3M9Q A;  1GW3 A;  4W7Y A;  4XE5 B;  1KIL B;  3M06 A;  3LIE A;  4WBA A;  5AW2 B;  1CSB A;  4I1L A;  2P2U A;  2OYH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...