3L74J

Cytochrome bc1 complex from chicken with famoxadone bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
total genus 24
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l74J00
1BE3J 1SQXJ 3CWBJ 1SQPJ 1NTKJ 3CX5I 1NTMJ 3L75J 1BGYJ 2BCCJ 3L70J 1NU1J 1SQBJ 3H1IJ 3TGUJ 1L0LJ 1PP9J 4PD4I 3H1LJ 3L71J 1SQVJ 1EZVI 3L72J 2FYUJ 4U3FJ 3L73J 1BCCJ 1P84I 4D6TJ 3CXHI 1NTZJ 1KYOI 3L74J 3H1KJ 5KLVJ 1KB9I 3H1JJ 1SQQJ 2IBZI 3H1HJ 3BCCJ 1L0NJ
chains in the Genus database with same CATH superfamily
5TJHA 1WRGA 2AXCA 2K37A 3GW6A 3RK2D 2NPSA 2KXPB 2OQQA 1FBMA 3N4XA 1JB0J 4L73A 1ZRTE 2Q3EA 3B5NB 1E79H 5KAFH 2FXPA 3TNUB 2N9YB 3PH0A 3WUVA 3ITKA 2KIKA 1EXIA 1M1JB 2JEEA 2YKQA 3GG2A 3NMDA 1RF1B 3CCVP 1SQXK 1EC5A 1RE3C 5AW0B 2W83C 4EI2A 3L73E 1FU1A 1L4AA 2QA4P 3D6YA 2N9BA 4RO0A 1MKMA 2IBZD 1SQPJ 3MIWA 3G9RA 3SWKA 1S4XA 3TDKA 1HF9A 4GIFA 3IAOA 3O6QB 2YNYA 4L74A 3D70A 1FZEA 1HH0A 4B86A 1SQQJ 1P84D 2XV5A 5CCGD 1L0NJ 1FOSE 4Y99B 2HPCA 3RK3E 2O01J 2QSIA 2D2CB 3HUSB 4TT3H 1FC2C 1N73B 2FYUG 1ZW0A 1FZAA 2E76B 3L4FA 5BU5A 2ZVOB 4PD4E 3L75D 1IFDA 2P10A 3RK2B 1ZXGA 3Q3DA 3KDPB 3OW2O 2MKVA 2LXCB 4BRYB 1VQNP 3PJSK 1DEBA 4D6TG 1NAFA 1KQGB 5CHXA 4PV1C 1KILE 3A0BH 3JC22 2JO1A 1SQBE 4I7ZC 2QJPB 3FXDA 1GU5A 2FYUK 3BCCJ 2IYPA 1M1KQ 2KOGA 3TF5A 4K3AA 2W6BA 5CJ4A 3A0HE 3LW5H 1PP9J 2WSEJ 3L71J 3V2RA 2B89A 5KLVG 1S5LX 2GA1A 4N78E 1Q82Q 2XZRA 1QLED 5KJ7C 1NTZE 1ZMEC 4I1LA 3B5NA 1G1IA 2Q5UA 2E42A 3TNUA 1ZR4A 3H1HD 1XTGB 2XKMA 1YJWP 4U3FJ 4GKGA 3VTPC 1M1JA 5APWA 1JM0A 1ZP0C 1RF1A 1P84H 1BCCE 3CXHH 3D6ZA 1NKNA 2V7QJ 4I2LC 2O3JA 4KT0J 3HE5B 2A06G 1SQVJ 1LTSC 3H1JG 3VN0A 1JY3N 2KZIA 3BRVB 3WU2H 5CCHC 1SFCD 1VL2A 5AW7B 3MZWB 4N3YB 2R3SA 2HYNA 3WUTA 4BWNA 2OTJP 5EFWB 1KN7A 2BCCJ 2IFNA 1T2KC 1LTTC 1SQPD 1USEA 3HUSA 2CPBA 2YMKA 1N73A 2E74B 3LIEA 4IL6E 1GMJA 2YXQB 4UB6E 1PV3A 3AEEC 2QE7H 3L70G 3KZIH 1JY3O 1SQQD 1IK9A 1L0ND 3VMZA 1IJDB 3CC7P 4BRYA 2IYOA 3AEBC 1KFMA 2R32A 3V5BA 1GL2D 2H88C 1OVUA 3HTKB 3CD6P 3D71A 2WVRA 5CBNA 5L8RJ 3CCSP 3PLNA 3CCJP 1NVOA 2O1KA 3SWFA 1HTLC 1PZQA 4OVNF 2AXTH 3G4SP 2B87B 1MFTA 2IBZI 1AVYA 3MUDA 1VQOP 1X79B 3UIAA 1SFCB 4H0LC 3BCCD 2OTKE 3AE8C 1YTZT 2ZAEB 2WZ7A 1X0TA 2L91A 3CCMP 1P84I 1JUNA 5CCGA 2IZ0A 1PP9D 1AV1A 3L71D 2G8YA 3I5CA 2H8PD 4H44C 2QIWA 4C7NB 3GHGB 2QJYB 3C9IA 1SQPE 3CX5H 1X8YA 4Z1MH 4ASWA 2IBZG 1LTBC 3A5TA 3HE5A 1URQD 2M8RA 1HJ0A 4U3FD 1NTKG 5C39A 1FJPA 1CZQA 4MN4C 1PPJG 3E7KA 1GL2B 1L0NE 1GK4A 1KORA 1VF5D 2FYNC 1PL5A 4UB8H 3R2PA 2ZXXA 2QJKC 2H43A 3FWLA 2K1AA 1PGOA 2M3EA 1QEXA 1SQVD 1USDA 3P8CD 2WQYC 5H2FE 3L75G 2KNCB 3RBZA 5AW5B 3M9HA 3VMYA 1L0LJ 3H1LJ 4IL6X 1NTKK 2R5BA 2C0WA 1OMIA 3CC4P 1JY2P 1KB9H 1BE3J 3VP9A 3WMM0 2M5AB 2Q3IA 1IFJA 1SQXE 3HTKA 2QM7A 1R5SA 1J1EB 2ITAA 1PP9E 2W27A 3M0DA 5DJTB 1URQB 2QM8A 2OYIC 2B87A 2E75D 1HUCA 1ZOYC 2HG5D 2IX7C 1EDKA 1NWQA 2Z4EA 1SFCA 1VF5B 3H6PA 2NPSC 3H1HG 1LWUB 1RHZB 1X9VA 2BASA 1S1CX 1NU1J 3VYIA 1DX7A 2N1TD 2MJZA 3EWKA 1QX8A 2WSFJ 4C7NA 3GHGA 1NYHA 1K8AQ 1ZRTD 3L35A 1H89A 4HJGH 1KQSO 1A02F 4TLFA 1ZN5A 1NGMB 1KQLA 3AE7C 1FZCB 1L4AC 2Z5IA 1VQ6P 2BCCE 1GL2A 3KYQA 2KSEA 5TISE 3U1CA 2YIUB 1LT1A 3JSVC 4ASVA 2JDIH 2IFMA 2IZ1A 4W80A 3H1IJ 3TSIA 2E75B 1UIIA 2CPSA 4DZOA 1SQQG 3OA7A 1Q86Q 2ZYDA 4W7YA 1VQLP 5B66H 3CCEP 3RK3D 2PFXA 2FKWB 2V4HA 4NPDA 2C0XA 2M5AA 1DD3A 4PD4D 1L0LD 3H1LD 1JOCA 2O01N 2N1TB 4LC1A 2PGDA 1KYOE 5CMZA 1S5LH 1VQ8P 1FDOA 3N7NA 1NTMJ 2KK7A 3CWBE 1IFPA 3F5HA 1SLQA 1URQA 4HB1A 1KILD 1LTAC 3BCCG 1SQBD 3H1KJ 2G3AA 3A3YB 1LGHB 2C9NY 1W5CE 3EFGA 1LWUA 3Q5SA 1PP9G 2KP8A 3L71G 3KHUA 5KTBA 3IN6A 3M91A 2BEQD 4DCKA 3B5NC 2H7HA 1KD1Q 1MFZA 3EQ2A 4AQRD 4NPFX 2HR3A 4N78D 3AEGC 1NTZD 3VP8A 1OVRA 1RF1C 1M57D 3V2NA 2XNXA 5AVTB 3AEFC 4U3FG 3K5BA 3FXEA 1H88A 4YXWH 3RK3B 1FZBA 1FZCA 1S9KE 5KJ7D 1N86A 1BCCD 4I6MC 1QVGO 1PFIA 1T3JA 1JMMA 1SQVG 2BEZF 1BGYJ 1OW8A 4WY4D 3A7OA 2E5YA 1H8AA 2JWDA 4R4LA 1OVVA 4PD4H 1L0LE 3H1LE 3L72E 5BVZA 4Y99C 1LTJC 4A7PA 3AEAC 1KILB 3L74E 3B71A 2D2CC 3HUSC 3SFDC 1HGVA 1N73C 3AE9C 2E76C 4ZKUA 5B5EE 1BE3E 3RK2C 1HBWA 2Y0DA 3R4YA 1Y9BA 3VMXA 3G6EP 3H1ID 4I7ZB 2WPQA 2J59M 3MD0A 2RKLA 4H13D 2OYHB 1SQXJ 3CPWO 2N1TA 4WWIA 3P8MC 1T2KD 2WSCJ 1LNQA 3FX0A 3SWYA 3A0HH 3A0BE 3PTZA 2YKPA 2R5DA 2QJPC 4W7ZA 5APQA 2B88A 3CMEP 2HODB 4GOEA 3RL0D 3VOPA 4KJMA 3MUDC 2QVAA 5KLIB 1BDDA 1NTMD 4WBAA 1NU1E 5AVSB 1KV4A 4WY4B 2PAJA 1SS1A 3HD7D 1FE6A 1HVVA 1BSNA 3C1LA 2WSFH 1ZV8A 3NXSA 5CCGC 1FZGA 2JR8A 3W68A 5KLVK 4EYYQ 1BDCA 3BASA 1GW3A 3NTNA 5AVRB 1J2JB 2K9JB 3JCUE 1IFIA 3HRNA 3KQGA 1YJNP 4JYCA 3USSA 2FXOA 2WMMA 1LT9B 3O6QA 5APTA 1NKZB 3IF4A 2Y9YA 1KFNA 4YTPC 1IFNA 4H13B 2JP3A 2P67A 3Q5RA 1K04A 1VPCA 3L73G 4PD4I 2FYUJ 1N8RQ 5GTIH 3H1IE 5AW4B 1JY3P 4IL6H 1GW4A 1YJ9P 1R8EA 1VQKP 1KILA 1M8OB 3ABVC 1HJBA 2E74C 1NO4A 3RL0B 2B9BA 3TGUE 4WB4A 1EZVE 2NRGA 1YQ3C 1N7LA 1Y47A 2WT7B 4XA4A 5KKZB 1K05A 4OH8B 3M0AA 4U7JA 3KZIE 3HE4B 1L0LG 4EDFA 3HD7B 3SFEC 3M9QA 2K9YA 5APXA 2PP6A 2OYHA 3L36A 3CC2P 1IK7A 1NTME 2ZT9D 1NOHA 1RF0A 2M0BA 1FDMA 3H1KE 1Q2NA 3CWBJ 3CCUP 1SQBG 3M0DC 1SQXD 2HODA 2AXTE 1RQVA 1J1DC 3CL3D 5M1BA 4IFDK 3TYYA 4WY4A 1SFCC 1VQ9P 2ZYAA 1FJKA 2POHA 2FBWC 1G1JA 3LIDA 2Y9ZA 1GZLA 3PP5A 4M3LA 1NTZG 1FZFA 2W6AA 4HKZH 3W67A 2W6JH 1SQBK 2OYOA 1FS0E 2E5TA 1FOSF 2K9JA 2WPRA 3GHGC 2QJYC 5AVVB 1EQ7A 1LT9A 1VQMP 1BCCG 1T8ZA 2O01H 1BGYE 2Q9IA 3V6IA 2Y0EA 2AEJA 1GL2C 2ZT9B 1NTZK 1S3JA 5H2FH 1LJ2A 1YIJP 4KHXA 1QL1A 4C46A 1L2PA 1IO4A 3L72J 1AQTA 1JMBA 2FFDB 1K9MQ 1GDTA 2BCCD 5AW8B 1KQFB 3L74J 1PIXA 1N7SD 1FDIA 2WT7A 1AJYA 3FGAD 2OARA 1DD4A 1QVFO 1L4AD 1U7JA 2ZJSE 3FWNA 2FXMA 4JF7A 3RGUA 3HE4A 3P7KA 1CSBA 3HD7A 2Q1KA 1E5WA 4PJ0E 4XE5B 2WSEH 5KAIE 1Z56A 2J5UA 5AVUB 2A45H 3U59A 2JWAA 1J1EC 3AE2C 2XDJA 4OGQD 1PGQA 4IFMA 3EFFK 1OXZA 1LTIC 1URQC 3QH9A 2WITA 1KYOD 3LW5J 3V2QA 1TU3F 2V7QH 1PGPA 5APVA 1VF5C 3CWBD 2NZ2A 1LWUC 2QEXP 3CCRP 1JEKA 2I1KA 1KTMA 2IPPA 4YXDC 1LTGC 3MTUE 1S2EA 1N7SB 1H0TB 1NTKJ 1S72P 4WVZA 2XNDH 1L4AB 2P7JA 1X22A 3ZDMA 2O1JA 3KPEA 5TISH 2FYUE 5E79E 3H25A 4GDOA 3I55P 1SP4A 1SQPG 2K3RA 5APUA 1FZCC 3AEDC 4ZKPA 1YITP 3B5ND 2KNCA 4XFJA 2YIUC 1L0NG 1S9KD 1A02J 4D6TE 4OGQB 2FFDA 1OW7A 1YYCA 1M56D 2KLVA 2E75C 3F89A 4K35A 3TGUJ 1NH4A 2Q7CA 1SQPK 4RJTA 1VQ4P 1PGJA 5K5GB 4RKUJ 3L72D 2A45I 3MHVA 1VQ7P 3G3ZA 1YI2P 5GTHE 3L74D 1YHQP 1SQQK 2AEFA 1FAVA 1L0NK 1Q90D 2J58A 1BE3D 2YO2A 2N1TC 1IZNB 3S9OA 3GF7A 3B4SA 1S5LE 4HH2A 1SQXG 2D2CD 3H1HJ 2E76D 3RBXA 3TK1A 3WUUA 3T97B 1DH3A 1M7LA 3QWOC 4PV1D 5AW6B 1CW5A 2A45G 1OX3A 3S4RA 3SSUA 5KAFE 2A06E 2LKMA 1D7MA 1R5LA 1M1JC 3H1JE 3AE4C 1MZ9A 1N7SA 1NAYA 1H0TA 2RH0A 4QMAA 3GLMA 4ZMDA 1NU1D 1YQ4C 2WPVB 3AE6C 4LGDE 2JJLA 4L75A 3U1AA 5CBOA 2QG4A 1M90Q 2VRSA 3RK3C 1GD2E 1EDIA 3BRTB 1QGKB 2KS1B 1NTKD 1VQ5P 3L70E 1PPJD 3IFMA 1VDFA 1GK6A 3MGNA 3CXHD 1LTJB 4EIJA 3NFQA 2BCCG 1CI6B 2ZFCA 5B5EH 2KYVA 4DJGA 1KILC 1KYOI 4PV1B 5CCHD 1SQVK 5AW3B 4ZNCA 4JQ0D 3BVHA 1RH5B 1RE4A 2KLUA 1Q7YQ 3TGUD 1EZVD 2OYHC 1U57A 1RF0C 2YMYA 2E74D 4LLHA 2XU6A 3L37A 3T97A 2W8ZA 4GT1A 2R3CA 3CI9A 1AVOA 3PRJA 1RY3A 1ZR2A 3CWBG 3CCLP 2IBZE 1RE3A 3H1KD 1HGZA 2RMZA 5KLIC 4WY4C 1NTKE 1PPJE 1NHLA 1JTHB 3JCUH 1P84E 2I1JA 2IDBA 5AVXB 3CXHE 3C8VA 3GMAA 4EOTA 2KI7B 4H0LD 2K88A 2LR2A 3S1KA 4IOIH 3L75E 4JPZB 2KZJA 3WU2E 1DIPA 4DT0A 1LT9C 2KS1A 1BSHA 3OJAB 1OWAA 3O8ZA 5AVQB 2Z5HA 4UB6H 4H13C 1GTWA 4H44D 1EDLA 3A2AA 4DOJA 1LTJA 4AYCA 1KMIZ 1MUUA 3CX5D 5GTIE 1JCCA 1CI6A 2GUVA 2Q6QA 2WWWA 4D6TJ 1WT6A 1BGYD 2SPZA 1W2BO 1RQUA 2P58A 1T6AA 3M9BA 3H1LG 1W2EA 3RL0C 1DEEG 1YTZI 3L72G 4GOFA 4Y28J 2YO3A 2WTYA 3IR9A 3B8EB 3L74G 2P1JA 2DW3A 2FY8A 3RL0g 5KKZC 5KLVJ 3V4WA 2LXBA 1BE3G 3HD7C 1U7MA 1NJIQ 2H89C 3H1HE 1HWTC 2WPSA 2Y0CA 2P2UA 1T3UA 4H0LB 5KJ7A 2HFED 3OAKA 3G71P 1EDJA 2WSSH 1L0LK 1J1DB 4R4MA 4BXLA 2I8DA 1YBKA 1KB9D 5DJUB 5BU8B 1OIPA 3CCQP 4H44B 2YKOA 3CXHI 4CPGA 3H1JJ 4RESB 2GM4A 3AECC 2ZXEB 3PHLA 3MP7B 2R44A 1JTHA 1XTCC 1NU1G 2HLOA 2FYZA 3CX5E 1WMKA 1EXJA 2CK3H 5CCHA 3L73J 2FYNB 5APYA 2NPSD 3Q5PA 3E1RA 1OFCX 2QJKB 1K73Q 2QRXA 3P32A 5AVWB 4AUWA 1SQQE 3L70J 3H32B 4UB8E 1EZVI 1NU1K 2ZT9C 1JY2N 2FYUD 2KB7P 3H1IG 3VMAA 1KZUB 1GU4A 4JYBA 2FFDC 1AA0A 2WSCH 4PJ0H 2ZVNB 5KAIH 3AE1C 4D6TD 1G2CB 1KB9E 1LP1B 3BCCE 3TGUG 1EZVG 4L76A 3II6A 1JNMA 5AW1B 2AEMA 1SQBJ 1JY2O 2OYIB 3KXDA 1OZHA 3I56P 3L71E 3Q2YA 5AVYB 1MV8A 2YXRB 1ZLLA 2NPSB 1NTMG 5KLVD 2JKVA 1JCDA 3BATA 3H1KG 1NTZJ 4U3FE 2ZYGA 1JO5A 2OGUA 3CX5I 4HYTB 4OWFA 1Y8AA 1BCCJ 1NTMK 2C9LY 1SQVE 1KC8Q 2M3BA 3M06A 3P8CE 1SVFA 5AW2B 1N7SC 5E79H 2A06D 5AW9B 4NPEA 3H1JD 2E43A 2RN0A 3L75J 2KUBA 2UWJE 3H32A 2HPCB 3V2PA 2L5GB 3AE5C 3L73D 4IFFA 1AQ5A 3CLQA 2W90A 1BGYG 1UIXA 2OTLP 2PRRA 2KSJA 5AVZB 4C7RA 3Q1MA 3L70D 4OGQC 1KB9I 5CJ0A 1Q81Q 1OW6A 4GODA 5B66E 1KYOH 1QL2A 4JBZA 5KLVE 5GTHH 4YPCA 3V4QA 1AFOA 1IFMA 1G2CA 1LP1A 5APSA 1VQPP 3CMAP 3E1IA 3GF3A 4O9BA 2GUSA 1N2DC 3AE3C 2OYIA 4N6JA 1IC2A 1RE4C
chains in the Genus database with same CATH topology
1BE3J 1SQXJ 3CWBJ 1SQPJ 1NTKJ 3CX5I 1NTMJ 3L75J 1BGYJ 2BCCJ 3L70J 1NU1J 1SQBJ 3H1IJ 3TGUJ 1L0LJ 1PP9J 4PD4I 3H1LJ 3L71J 1SQVJ 1EZVI 3L72J 2FYUJ 4U3FJ 3L73J 1BCCJ 1P84I 4D6TJ 3CXHI 1NTZJ 1KYOI 3L74J 3H1KJ 5KLVJ 1KB9I 3H1JJ 1SQQJ 2IBZI 3H1HJ 3BCCJ 1L0NJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE3 J;  1SQX J;  3CWB J;  1SQP J;  1NTK J;  3CX5 I;  1NTM J;  3L75 J;  1BGY J;  2BCC J;  3L70 J;  1NU1 J;  1SQB J;  3H1I J;  3TGU J;  1L0L J;  1PP9 J;  4PD4 I;  3H1L J;  3L71 J;  1SQV J;  1EZV I;  3L72 J;  2FYU J;  4U3F J;  3L73 J;  1BCC J;  1P84 I;  4D6T J;  3CXH I;  1NTZ J;  1KYO I;  3L74 J;  3H1K J;  5KLV J;  1KB9 I;  3H1J J;  1SQQ J;  2IBZ I;  3H1H J;  3BCC J;  1L0N J; 
#chains in the Genus database with same CATH topology
 5TJH A;  1WRG A;  2AXC A;  2K37 A;  3GW6 A;  3RK2 D;  2NPS A;  2KXP B;  2OQQ A;  1FBM A;  3N4X A;  1JB0 J;  4L73 A;  1ZRT E;  2Q3E A;  3B5N B;  1E79 H;  5KAF H;  2FXP A;  3TNU B;  2N9Y B;  3PH0 A;  3WUV A;  3ITK A;  2KIK A;  1EXI A;  1M1J B;  2JEE A;  2YKQ A;  3GG2 A;  3NMD A;  1RF1 B;  3CCV P;  1SQX K;  1EC5 A;  1RE3 C;  5AW0 B;  2W83 C;  4EI2 A;  3L73 E;  1FU1 A;  1L4A A;  2QA4 P;  3D6Y A;  2N9B A;  4RO0 A;  1MKM A;  2IBZ D;  1SQP J;  3MIW A;  3G9R A;  3SWK A;  1S4X A;  3TDK A;  1HF9 A;  4GIF A;  3IAO A;  3O6Q B;  2YNY A;  4L74 A;  3D70 A;  1FZE A;  1HH0 A;  4B86 A;  1SQQ J;  1P84 D;  2XV5 A;  5CCG D;  1L0N J;  1FOS E;  4Y99 B;  2HPC A;  3RK3 E;  2O01 J;  2QSI A;  2D2C B;  3HUS B;  4TT3 H;  1FC2 C;  1N73 B;  2FYU G;  1ZW0 A;  1FZA A;  2E76 B;  3L4F A;  5BU5 A;  2ZVO B;  4PD4 E;  3L75 D;  1IFD A;  2P10 A;  3RK2 B;  1ZXG A;  3Q3D A;  3KDP B;  3OW2 O;  2MKV A;  2LXC B;  4BRY B;  1VQN P;  3PJS K;  1DEB A;  4D6T G;  1NAF A;  1KQG B;  5CHX A;  4PV1 C;  1KIL E;  3A0B H;  3JC2 2;  2JO1 A;  1SQB E;  4I7Z C;  2QJP B;  3FXD A;  1GU5 A;  2FYU K;  3BCC J;  2IYP A;  1M1K Q;  2KOG A;  3TF5 A;  4K3A A;  2W6B A;  5CJ4 A;  3A0H E;  3LW5 H;  1PP9 J;  2WSE J;  3L71 J;  3V2R A;  2B89 A;  5KLV G;  1S5L X;  2GA1 A;  4N78 E;  1Q82 Q;  2XZR A;  1QLE D;  5KJ7 C;  1NTZ E;  1ZME C;  4I1L A;  3B5N A;  1G1I A;  2Q5U A;  2E42 A;  3TNU A;  1ZR4 A;  3H1H D;  1XTG B;  2XKM A;  1YJW P;  4U3F J;  4GKG A;  3VTP C;  1M1J A;  5APW A;  1JM0 A;  1ZP0 C;  1RF1 A;  1P84 H;  1BCC E;  3CXH H;  3D6Z A;  1NKN A;  2V7Q J;  4I2L C;  2O3J A;  4KT0 J;  3HE5 B;  2A06 G;  1SQV J;  1LTS C;  3H1J G;  3VN0 A;  1JY3 N;  2KZI A;  3BRV B;  3WU2 H;  5CCH C;  1SFC D;  1VL2 A;  5AW7 B;  3MZW B;  4N3Y B;  2R3S A;  2HYN A;  3WUT A;  4BWN A;  2OTJ P;  5EFW B;  1KN7 A;  2BCC J;  2IFN A;  1T2K C;  1LTT C;  1SQP D;  1USE A;  3HUS A;  2CPB A;  2YMK A;  1N73 A;  2E74 B;  3LIE A;  4IL6 E;  1GMJ A;  2YXQ B;  4UB6 E;  1PV3 A;  3AEE C;  2QE7 H;  3L70 G;  3KZI H;  1JY3 O;  1SQQ D;  1IK9 A;  1L0N D;  3VMZ A;  1IJD B;  3CC7 P;  4BRY A;  2IYO A;  3AEB C;  1KFM A;  2R32 A;  3V5B A;  1GL2 D;  2H88 C;  1OVU A;  3HTK B;  3CD6 P;  3D71 A;  2WVR A;  5CBN A;  5L8R J;  3CCS P;  3PLN A;  3CCJ P;  1NVO A;  2O1K A;  3SWF A;  1HTL C;  1PZQ A;  4OVN F;  2AXT H;  3G4S P;  2B87 B;  1MFT A;  2IBZ I;  1AVY A;  3MUD A;  1VQO P;  1X79 B;  3UIA A;  1SFC B;  4H0L C;  3BCC D;  2OTK E;  3AE8 C;  1YTZ T;  2ZAE B;  2WZ7 A;  1X0T A;  2L91 A;  3CCM P;  1P84 I;  1JUN A;  5CCG A;  2IZ0 A;  1PP9 D;  1AV1 A;  3L71 D;  2G8Y A;  3I5C A;  2H8P D;  4H44 C;  2QIW A;  4C7N B;  3GHG B;  2QJY B;  3C9I A;  1SQP E;  3CX5 H;  1X8Y A;  4Z1M H;  4ASW A;  2IBZ G;  1LTB C;  3A5T A;  3HE5 A;  1URQ D;  2M8R A;  1HJ0 A;  4U3F D;  1NTK G;  5C39 A;  1FJP A;  1CZQ A;  4MN4 C;  1PPJ G;  3E7K A;  1GL2 B;  1L0N E;  1GK4 A;  1KOR A;  1VF5 D;  2FYN C;  1PL5 A;  4UB8 H;  3R2P A;  2ZXX A;  2QJK C;  2H43 A;  3FWL A;  2K1A A;  1PGO A;  2M3E A;  1QEX A;  1SQV D;  1USD A;  3P8C D;  2WQY C;  5H2F E;  3L75 G;  2KNC B;  3RBZ A;  5AW5 B;  3M9H A;  3VMY A;  1L0L J;  3H1L J;  4IL6 X;  1NTK K;  2R5B A;  2C0W A;  1OMI A;  3CC4 P;  1JY2 P;  1KB9 H;  1BE3 J;  3VP9 A;  3WMM 0;  2M5A B;  2Q3I A;  1IFJ A;  1SQX E;  3HTK A;  2QM7 A;  1R5S A;  1J1E B;  2ITA A;  1PP9 E;  2W27 A;  3M0D A;  5DJT B;  1URQ B;  2QM8 A;  2OYI C;  2B87 A;  2E75 D;  1HUC A;  1ZOY C;  2HG5 D;  2IX7 C;  1EDK A;  1NWQ A;  2Z4E A;  1SFC A;  1VF5 B;  3H6P A;  2NPS C;  3H1H G;  1LWU B;  1RHZ B;  1X9V A;  2BAS A;  1S1C X;  1NU1 J;  3VYI A;  1DX7 A;  2N1T D;  2MJZ A;  3EWK A;  1QX8 A;  2WSF J;  4C7N A;  3GHG A;  1NYH A;  1K8A Q;  1ZRT D;  3L35 A;  1H89 A;  4HJG H;  1KQS O;  1A02 F;  4TLF A;  1ZN5 A;  1NGM B;  1KQL A;  3AE7 C;  1FZC B;  1L4A C;  2Z5I A;  1VQ6 P;  2BCC E;  1GL2 A;  3KYQ A;  2KSE A;  5TIS E;  3U1C A;  2YIU B;  1LT1 A;  3JSV C;  4ASV A;  2JDI H;  2IFM A;  2IZ1 A;  4W80 A;  3H1I J;  3TSI A;  2E75 B;  1UII A;  2CPS A;  4DZO A;  1SQQ G;  3OA7 A;  1Q86 Q;  2ZYD A;  4W7Y A;  1VQL P;  5B66 H;  3CCE P;  3RK3 D;  2PFX A;  2FKW B;  2V4H A;  4NPD A;  2C0X A;  2M5A A;  1DD3 A;  4PD4 D;  1L0L D;  3H1L D;  1JOC A;  2O01 N;  2N1T B;  4LC1 A;  2PGD A;  1KYO E;  5CMZ A;  1S5L H;  1VQ8 P;  1FDO A;  3N7N A;  1NTM J;  2KK7 A;  3CWB E;  1IFP A;  3F5H A;  1SLQ A;  1URQ A;  4HB1 A;  1KIL D;  1LTA C;  3BCC G;  1SQB D;  3H1K J;  2G3A A;  3A3Y B;  1LGH B;  2C9N Y;  1W5C E;  3EFG A;  1LWU A;  3Q5S A;  1PP9 G;  2KP8 A;  3L71 G;  3KHU A;  5KTB A;  3IN6 A;  3M91 A;  2BEQ D;  4DCK A;  3B5N C;  2H7H A;  1KD1 Q;  1MFZ A;  3EQ2 A;  4AQR D;  4NPF X;  2HR3 A;  4N78 D;  3AEG C;  1NTZ D;  3VP8 A;  1OVR A;  1RF1 C;  1M57 D;  3V2N A;  2XNX A;  5AVT B;  3AEF C;  4U3F G;  3K5B A;  3FXE A;  1H88 A;  4YXW H;  3RK3 B;  1FZB A;  1FZC A;  1S9K E;  5KJ7 D;  1N86 A;  1BCC D;  4I6M C;  1QVG O;  1PFI A;  1T3J A;  1JMM A;  1SQV G;  2BEZ F;  1BGY J;  1OW8 A;  4WY4 D;  3A7O A;  2E5Y A;  1H8A A;  2JWD A;  4R4L A;  1OVV A;  4PD4 H;  1L0L E;  3H1L E;  3L72 E;  5BVZ A;  4Y99 C;  1LTJ C;  4A7P A;  3AEA C;  1KIL B;  3L74 E;  3B71 A;  2D2C C;  3HUS C;  3SFD C;  1HGV A;  1N73 C;  3AE9 C;  2E76 C;  4ZKU A;  5B5E E;  1BE3 E;  3RK2 C;  1HBW A;  2Y0D A;  3R4Y A;  1Y9B A;  3VMX A;  3G6E P;  3H1I D;  4I7Z B;  2WPQ A;  2J59 M;  3MD0 A;  2RKL A;  4H13 D;  2OYH B;  1SQX J;  3CPW O;  2N1T A;  4WWI A;  3P8M C;  1T2K D;  2WSC J;  1LNQ A;  3FX0 A;  3SWY A;  3A0H H;  3A0B E;  3PTZ A;  2YKP A;  2R5D A;  2QJP C;  4W7Z A;  5APQ A;  2B88 A;  3CME P;  2HOD B;  4GOE A;  3RL0 D;  3VOP A;  4KJM A;  3MUD C;  2QVA A;  5KLI B;  1BDD A;  1NTM D;  4WBA A;  1NU1 E;  5AVS B;  1KV4 A;  4WY4 B;  2PAJ A;  1SS1 A;  3HD7 D;  1FE6 A;  1HVV A;  1BSN A;  3C1L A;  2WSF H;  1ZV8 A;  3NXS A;  5CCG C;  1FZG A;  2JR8 A;  3W68 A;  5KLV K;  4EYY Q;  1BDC A;  3BAS A;  1GW3 A;  3NTN A;  5AVR B;  1J2J B;  2K9J B;  3JCU E;  1IFI A;  3HRN A;  3KQG A;  1YJN P;  4JYC A;  3USS A;  2FXO A;  2WMM A;  1LT9 B;  3O6Q A;  5APT A;  1NKZ B;  3IF4 A;  2Y9Y A;  1KFN A;  4YTP C;  1IFN A;  4H13 B;  2JP3 A;  2P67 A;  3Q5R A;  1K04 A;  1VPC A;  3L73 G;  4PD4 I;  2FYU J;  1N8R Q;  5GTI H;  3H1I E;  5AW4 B;  1JY3 P;  4IL6 H;  1GW4 A;  1YJ9 P;  1R8E A;  1VQK P;  1KIL A;  1M8O B;  3ABV C;  1HJB A;  2E74 C;  1NO4 A;  3RL0 B;  2B9B A;  3TGU E;  4WB4 A;  1EZV E;  2NRG A;  1YQ3 C;  1N7L A;  1Y47 A;  2WT7 B;  4XA4 A;  5KKZ B;  1K05 A;  4OH8 B;  3M0A A;  4U7J A;  3KZI E;  3HE4 B;  1L0L G;  4EDF A;  3HD7 B;  3SFE C;  3M9Q A;  2K9Y A;  5APX A;  2PP6 A;  2OYH A;  3L36 A;  3CC2 P;  1IK7 A;  1NTM E;  2ZT9 D;  1NOH A;  1RF0 A;  2M0B A;  1FDM A;  3H1K E;  1Q2N A;  3CWB J;  3CCU P;  1SQB G;  3M0D C;  1SQX D;  2HOD A;  2AXT E;  1RQV A;  1J1D C;  3CL3 D;  5M1B A;  4IFD K;  3TYY A;  4WY4 A;  1SFC C;  1VQ9 P;  2ZYA A;  1FJK A;  2POH A;  2FBW C;  1G1J A;  3LID A;  2Y9Z A;  1GZL A;  3PP5 A;  4M3L A;  1NTZ G;  1FZF A;  2W6A A;  4HKZ H;  3W67 A;  2W6J H;  1SQB K;  2OYO A;  1FS0 E;  2E5T A;  1FOS F;  2K9J A;  2WPR A;  3GHG C;  2QJY C;  5AVV B;  1EQ7 A;  1LT9 A;  1VQM P;  1BCC G;  1T8Z A;  2O01 H;  1BGY E;  2Q9I A;  3V6I A;  2Y0E A;  2AEJ A;  1GL2 C;  2ZT9 B;  1NTZ K;  1S3J A;  5H2F H;  1LJ2 A;  1YIJ P;  4KHX A;  1QL1 A;  4C46 A;  1L2P A;  1IO4 A;  3L72 J;  1AQT A;  1JMB A;  2FFD B;  1K9M Q;  1GDT A;  2BCC D;  5AW8 B;  1KQF B;  3L74 J;  1PIX A;  1N7S D;  1FDI A;  2WT7 A;  1AJY A;  3FGA D;  2OAR A;  1DD4 A;  1QVF O;  1L4A D;  1U7J A;  2ZJS E;  3FWN A;  2FXM A;  4JF7 A;  3RGU A;  3HE4 A;  3P7K A;  1CSB A;  3HD7 A;  2Q1K A;  1E5W A;  4PJ0 E;  4XE5 B;  2WSE H;  5KAI E;  1Z56 A;  2J5U A;  5AVU B;  2A45 H;  3U59 A;  2JWA A;  1J1E C;  3AE2 C;  2XDJ A;  4OGQ D;  1PGQ A;  4IFM A;  3EFF K;  1OXZ A;  1LTI C;  1URQ C;  3QH9 A;  2WIT A;  1KYO D;  3LW5 J;  3V2Q A;  1TU3 F;  2V7Q H;  1PGP A;  5APV A;  1VF5 C;  3CWB D;  2NZ2 A;  1LWU C;  2QEX P;  3CCR P;  1JEK A;  2I1K A;  1KTM A;  2IPP A;  4YXD C;  1LTG C;  3MTU E;  1S2E A;  1N7S B;  1H0T B;  1NTK J;  1S72 P;  4WVZ A;  2XND H;  1L4A B;  2P7J A;  1X22 A;  3ZDM A;  2O1J A;  3KPE A;  5TIS H;  2FYU E;  5E79 E;  3H25 A;  4GDO A;  3I55 P;  1SP4 A;  1SQP G;  2K3R A;  5APU A;  1FZC C;  3AED C;  4ZKP A;  1YIT P;  3B5N D;  2KNC A;  4XFJ A;  2YIU C;  1L0N G;  1S9K D;  1A02 J;  4D6T E;  4OGQ B;  2FFD A;  1OW7 A;  1YYC A;  1M56 D;  2KLV A;  2E75 C;  3F89 A;  4K35 A;  3TGU J;  1NH4 A;  2Q7C A;  1SQP K;  4RJT A;  1VQ4 P;  1PGJ A;  5K5G B;  4RKU J;  3L72 D;  2A45 I;  3MHV A;  1VQ7 P;  3G3Z A;  1YI2 P;  5GTH E;  3L74 D;  1YHQ P;  1SQQ K;  2AEF A;  1FAV A;  1L0N K;  1Q90 D;  2J58 A;  1BE3 D;  2YO2 A;  2N1T C;  1IZN B;  3S9O A;  3GF7 A;  3B4S A;  1S5L E;  4HH2 A;  1SQX G;  2D2C D;  3H1H J;  2E76 D;  3RBX A;  3TK1 A;  3WUU A;  3T97 B;  1DH3 A;  1M7L A;  3QWO C;  4PV1 D;  5AW6 B;  1CW5 A;  2A45 G;  1OX3 A;  3S4R A;  3SSU A;  5KAF E;  2A06 E;  2LKM A;  1D7M A;  1R5L A;  1M1J C;  3H1J E;  3AE4 C;  1MZ9 A;  1N7S A;  1NAY A;  1H0T A;  2RH0 A;  4QMA A;  3GLM A;  4ZMD A;  1NU1 D;  1YQ4 C;  2WPV B;  3AE6 C;  4LGD E;  2JJL A;  4L75 A;  3U1A A;  5CBO A;  2QG4 A;  1M90 Q;  2VRS A;  3RK3 C;  1GD2 E;  1EDI A;  3BRT B;  1QGK B;  2KS1 B;  1NTK D;  1VQ5 P;  3L70 E;  1PPJ D;  3IFM A;  1VDF A;  1GK6 A;  3MGN A;  3CXH D;  1LTJ B;  4EIJ A;  3NFQ A;  2BCC G;  1CI6 B;  2ZFC A;  5B5E H;  2KYV A;  4DJG A;  1KIL C;  1KYO I;  4PV1 B;  5CCH D;  1SQV K;  5AW3 B;  4ZNC A;  4JQ0 D;  3BVH A;  1RH5 B;  1RE4 A;  2KLU A;  1Q7Y Q;  3TGU D;  1EZV D;  2OYH C;  1U57 A;  1RF0 C;  2YMY A;  2E74 D;  4LLH A;  2XU6 A;  3L37 A;  3T97 A;  2W8Z A;  4GT1 A;  2R3C A;  3CI9 A;  1AVO A;  3PRJ A;  1RY3 A;  1ZR2 A;  3CWB G;  3CCL P;  2IBZ E;  1RE3 A;  3H1K D;  1HGZ A;  2RMZ A;  5KLI C;  4WY4 C;  1NTK E;  1PPJ E;  1NHL A;  1JTH B;  3JCU H;  1P84 E;  2I1J A;  2IDB A;  5AVX B;  3CXH E;  3C8V A;  3GMA A;  4EOT A;  2KI7 B;  4H0L D;  2K88 A;  2LR2 A;  3S1K A;  4IOI H;  3L75 E;  4JPZ B;  2KZJ A;  3WU2 E;  1DIP A;  4DT0 A;  1LT9 C;  2KS1 A;  1BSH A;  3OJA B;  1OWA A;  3O8Z A;  5AVQ B;  2Z5H A;  4UB6 H;  4H13 C;  1GTW A;  4H44 D;  1EDL A;  3A2A A;  4DOJ A;  1LTJ A;  4AYC A;  1KMI Z;  1MUU A;  3CX5 D;  5GTI E;  1JCC A;  1CI6 A;  2GUV A;  2Q6Q A;  2WWW A;  4D6T J;  1WT6 A;  1BGY D;  2SPZ A;  1W2B O;  1RQU A;  2P58 A;  1T6A A;  3M9B A;  3H1L G;  1W2E A;  3RL0 C;  1DEE G;  1YTZ I;  3L72 G;  4GOF A;  4Y28 J;  2YO3 A;  2WTY A;  3IR9 A;  3B8E B;  3L74 G;  2P1J A;  2DW3 A;  2FY8 A;  3RL0 g;  5KKZ C;  5KLV J;  3V4W A;  2LXB A;  1BE3 G;  3HD7 C;  1U7M A;  1NJI Q;  2H89 C;  3H1H E;  1HWT C;  2WPS A;  2Y0C A;  2P2U A;  1T3U A;  4H0L B;  5KJ7 A;  2HFE D;  3OAK A;  3G71 P;  1EDJ A;  2WSS H;  1L0L K;  1J1D B;  4R4M A;  4BXL A;  2I8D A;  1YBK A;  1KB9 D;  5DJU B;  5BU8 B;  1OIP A;  3CCQ P;  4H44 B;  2YKO A;  3CXH I;  4CPG A;  3H1J J;  4RES B;  2GM4 A;  3AEC C;  2ZXE B;  3PHL A;  3MP7 B;  2R44 A;  1JTH A;  1XTC C;  1NU1 G;  2HLO A;  2FYZ A;  3CX5 E;  1WMK A;  1EXJ A;  2CK3 H;  5CCH A;  3L73 J;  2FYN B;  5APY A;  2NPS D;  3Q5P A;  3E1R A;  1OFC X;  2QJK B;  1K73 Q;  2QRX A;  3P32 A;  5AVW B;  4AUW A;  1SQQ E;  3L70 J;  3H32 B;  4UB8 E;  1EZV I;  1NU1 K;  2ZT9 C;  1JY2 N;  2FYU D;  2KB7 P;  3H1I G;  3VMA A;  1KZU B;  1GU4 A;  4JYB A;  2FFD C;  1AA0 A;  2WSC H;  4PJ0 H;  2ZVN B;  5KAI H;  3AE1 C;  4D6T D;  1G2C B;  1KB9 E;  1LP1 B;  3BCC E;  3TGU G;  1EZV G;  4L76 A;  3II6 A;  1JNM A;  5AW1 B;  2AEM A;  1SQB J;  1JY2 O;  2OYI B;  3KXD A;  1OZH A;  3I56 P;  3L71 E;  3Q2Y A;  5AVY B;  1MV8 A;  2YXR B;  1ZLL A;  2NPS B;  1NTM G;  5KLV D;  2JKV A;  1JCD A;  3BAT A;  3H1K G;  1NTZ J;  4U3F E;  2ZYG A;  1JO5 A;  2OGU A;  3CX5 I;  4HYT B;  4OWF A;  1Y8A A;  1BCC J;  1NTM K;  2C9L Y;  1SQV E;  1KC8 Q;  2M3B A;  3M06 A;  3P8C E;  1SVF A;  5AW2 B;  1N7S C;  5E79 H;  2A06 D;  5AW9 B;  4NPE A;  3H1J D;  2E43 A;  2RN0 A;  3L75 J;  2KUB A;  2UWJ E;  3H32 A;  2HPC B;  3V2P A;  2L5G B;  3AE5 C;  3L73 D;  4IFF A;  1AQ5 A;  3CLQ A;  2W90 A;  1BGY G;  1UIX A;  2OTL P;  2PRR A;  2KSJ A;  5AVZ B;  4C7R A;  3Q1M A;  3L70 D;  4OGQ C;  1KB9 I;  5CJ0 A;  1Q81 Q;  1OW6 A;  4GOD A;  5B66 E;  1KYO H;  1QL2 A;  4JBZ A;  5KLV E;  5GTH H;  4YPC A;  3V4Q A;  1AFO A;  1IFM A;  1G2C A;  1LP1 A;  5APS A;  1VQP P;  3CMA P;  3E1I A;  3GF3 A;  4O9B A;  2GUS A;  1N2D C;  3AE3 C;  2OYI A;  4N6J A;  1IC2 A;  1RE4 C; 
#chains in the Genus database with same CATH homology
 1BE3 J;  1SQX J;  3CWB J;  1SQP J;  1NTK J;  3CX5 I;  1NTM J;  3L75 J;  1BGY J;  2BCC J;  3L70 J;  1NU1 J;  1SQB J;  3H1I J;  3TGU J;  1L0L J;  1PP9 J;  4PD4 I;  3H1L J;  3L71 J;  1SQV J;  1EZV I;  3L72 J;  2FYU J;  4U3F J;  3L73 J;  1BCC J;  1P84 I;  4D6T J;  3CXH I;  1NTZ J;  1KYO I;  3L74 J;  3H1K J;  5KLV J;  1KB9 I;  3H1J J;  1SQQ J;  2IBZ I;  3H1H J;  3BCC J;  1L0N J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...