3L74J

Cytochrome bc1 complex from chicken with famoxadone bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 24
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l74J00
5KLVJ 3CX5I 4D6TJ 3L72J 3L74J 3H1JJ 4U3FJ 2FYUJ 1NTMJ 3H1HJ 1BGYJ 1SQBJ 1KYOI 1NTKJ 3H1KJ 3BCCJ 1NTZJ 1SQQJ 1BCCJ 3H1LJ 2BCCJ 1SQVJ 3TGUJ 4PD4I 3CXHI 3L73J 3L75J 1PP9J 3L71J 1L0NJ 3H1IJ 1EZVI 1KB9I 1BE3J 1P84I 1SQXJ 1NU1J 3L70J 2IBZI 1L0LJ 3CWBJ 1SQPJ
chains in the Genus database with same CATH superfamily
1Q7YQ 1SQQG 2KSJA 3WUUA 5KTBA 3TYYA 1PGOA 3HUSC 2AXCA 4GT1A 2ZYAA 1NTKK 3O6QA 2QJYB 2WMMA 2UWJE 4EIJA 5E79E 1NTKE 1OW8A 3V4QA 2IBZD 2KP8A 3H1ID 3A3YB 2SPZA 4AUWA 2YKQA 1AJYA 1FZGA 4KHXA 1WRGA 5APWA 3CCEP 1YITP 3SFEC 5KLVG 2FFDA 1A02J 1SQBD 1SQPJ 2K9JB 1SQXK 4GOFA 4RKUJ 1KILA 1MV8A 2FYZA 2IBZE 5AVQB 3H1IE 2K3RA 1SQBK 1SQXE 3CCMP 1FZBA 3LW5H 3OJAB 1Z56A 4U3FD 1H8AA 1EDLA 2ZVNB 4LC1A 1SQBE 4WY4C 2D2CB 4WY4D 4JYCA 1YYCA 1M1JA 3H1JJ 2QJPC 1YTZI 1FZCA 2BCCJ 1HJ0A 1PP9J 3LW5J 4WVZA 1EDJA 2RMZA 1Q82Q 4C7NB 1RE4C 3AE6C 5CCGC 2OYHC 1KQSO 3I5CA 1KILC 1EDKA 1N7SD 2Z4EA 1NH4A 2IZ0A 3OW2O 1L0LD 1JM0A 1PPJD 3AECC 3AEBC 1N7SB 2OTLP 2HPCA 3RBZA 2E5YA 1IK7A 3CX5I 3BCCE 1SQVG 3MHVA 4PV1B 2A06D 2YMKA 4N6JA 2CK3H 2BEQD 2ZYDA 3H1KJ 5KKZC 5AVUB 3II6A 3CWBD 5AW1B 2ZT9B 2M0BA 1LP1A 2W6AA 1PPJE 3B5NC 1NTMD 5KJ7A 2H88C 1YIJP 2VRSA 2A06E 3FGAD 1LTJA 1ZV8A 5CCHA 1M7LA 2IYPA 1NTMK 1QL2A 1N2DC 1JB0J 3RL0C 1SQPG 1UIIA 5B66H 1IFJA 1RF0C 2IPPA 1NTME 2IX7C 2KS1B 1LWUB 1K9MQ 2R44A 4D6TJ 3CD6P 1S3JA 4TT3H 2WSFJ 1M1KQ 4UB8E 1RE3C 1BSHA 2A45H 2FYUD 2POHA 5AVYB 3H1HG 4JYBA 1U57A 5TJHA 4KT0J 5AW4B 2BCCG 1L0NG 1BE3D 3BATA 3MTUE 2FYUK 3AEEC 1S2EA 2CPBA 3L73J 2O3JA 4PJ0E 4ZKUA 1G2CB 3VYIA 2FYUE 3USSA 3H32A 3MUDA 1EZVD 1K73Q 2WPQA 5E79H 1BE3E 5GTHE 4N78E 1FU1A 5APUA 3CCRP 3FXEA 2QG4A 4Y28J 3L74G 3HD7B 1BDDA 2E75D 1KB9D 1EZVE 1K05A 1TU3F 2ZYGA 1JO5A 1QVGO 2E75B 1PFIA 2KNCA 1RQUA 1VDFA 3L72G 4I6MC 1JTHB 1JY2O 3EWKA 2FXOA 3TGUG 3L71D 1KB9E 2QIWA 4GKGA 3E1IA 4GOEA 1AV1A 2FXMA 4L73A 1KN7A 3AE1C 3H1IJ 1SQXJ 1SQVK 3L36A 2G3AA 2XKMA 2O1KA 3IN6A 4L75A 1GW3A 2BASA 3HE5A 3L71E 1ZLLA 2IFMA 3M9HA 1OMIA 1Q90D 3G71P 2WSCJ 2OYIB 2N1TD 2WZ7A 4KJMA 3C9IA 3RGUA 1RQVA 3IF4A 1KYOE 5AVWB 2FYNC 2NPSC 1VQ4P 3MZWB 1KD1Q 3L75G 2N1TB 3VN0A 3HE4A 1YJ9P 3CXHI 1VF5D 2IYOA 4ZKPA 5AW2B 3V2NA 4C46A 1GU5A 4OVNF 1NOHA 4HB1A 1VF5B 3KHUA 2BEZF 3BCCJ 3IR9A 3L70D 2QM7A 3KQGA 2HYNA 1ZP0C 4IL6E 3G4SP 1DH3A 3CCVP 5TISH 1LT9C 3SFDC 1L0NK 1NTKG 2N9BA 3IFMA 3O8ZA 1JEKA 4OGQC 1URQA 1KZUB 4K35A 5APQA 3PLNA 2Q5UA 3RK2B 2JEEA 2QVAA 1LTGC 1RHZB 1P84D 3U59A 1ZMEC 4H0LB 1CI6A 2KZJA 2IBZG 4A7PA 3H1IG 1SQQJ 2Q1KA 3SSUA 1VQLP 4K3AA 3OAKA 1GW4A 1GMJA 3NXSA 1SQBG 2RN0A 1A02F 1BCCD 4PJ0H 5H2FE 1P84E 1NJIQ 3TNUB 3A0HH 1URQC 1HGVA 1WT6A 2W8ZA 4PD4I 1AFOA 2OTKE 2PAJA 1DEEG 2FKWB 1GDTA 3SWKA 4U3FG 2B89A 3V2RA 2I1JA 1BCCE 2KZIA 1U7MA 1LNQA 3KZIE 1NO4A 2YKOA 4I7ZB 4LGDE 1GK4A 2R32A 2OTJP 2PRRA 5AW6B 1PGPA 2WVRA 2QSIA 3FXDA 1X8YA 2WPVB 4ASVA 1HJBA 2Y0CA 5B66E 2YKPA 1FDMA 1VQ9P 3P8CD 1L0LG 3KYQA 1X9VA 2H7HA 1DX7A 1KB9H 4GIFA 1PPJG 4O9BA 3Q3DA 1FS0E 2GUVA 1BDCA 1FOSF 2A06G 4JPZB 3D6YA 3KDPB 3B8EB 5BU8B 2C9LY 1LTBC 2YNYA 1GL2D 1X22A 1SFCB 1L4AD 1HBWA 3RK3D 3P8MC 1KV4A 4H44B 1MFZA 1NTMG 5AW7B 1BGYD 3M9QA 2KI7B 1NAYA 1NTZD 1GL2B 1VQPP 1KYOH 1L4AB 3TSIA 3RK3B 2AEFA 2K9JA 3SWYA 2WWWA 2O01J 1SQVJ 4DT0A 2KIKA 3CL3D 1NTZK 3RK3E 1NWQA 1T6AA 1BGYE 3HUSB 1G1JA 1NTZE 2P67A 1KFMA 1W5CE 3JC22 1FJKA 3RL0g 1AQTA 1RF1C 1E79H 2FYUG 1M56D 4YXWH 4C7NA 4IL6H 3H1LD 3W67A 3WU2E 1BE3G 1ZW0A 1Y47A 2FBWC 3C8VA 1YJWP 4IFDK 3GHGA 5B5EE 3UIAA 2WTYA 1HTLC 1EZVG 3H1LE 1N7SA 2QE7H 4XE5B 3H1HJ 3S4RA 2PP6A 2D2CC 2R3CA 1AA0A 3CMEP 2KYVA 2C0XA 1L0NJ 4WY4B 2FFDC 2IBZI 3JSVC 1KQLA 2QJPB 3TF5A 2K37A 4U3FE 1FZEA 5CCGD 2HFED 5KLIB 1KILD 2O1JA 2ZJSE 4EOTA 1M8OB 3AEFC 4I1LA 3CC2P 5H2FH 2OYHB 1AVOA 1P84H 3GHGB 1JUNA 1H89A 5CJ4A 3PRJA 4RESB 1HF9A 2E5TA 1L0LK 1M1JC 3L74J 4C7RA 3L71G 2P10A 1FJPA 2KS1A 2WT7B 1OW6A 2QRXA 1FZCC 1LWUA 4PV1C 2DW3A 1IK9A 1L0LE 1R8EA 4BRYB 3KZIH 3M9BA 3B5ND 1JY2P 3V2QA 1EXJA 2E43A 1LTAC 1Y8AA 3L72J 2ZVOB 4YPCA 2XNDH 1SP4A 5TISE 3V5BA 3WUVA 3TGUJ 1YI2P 2YIUC 1IFDA 2B87B 2AXTE 3RL0D 3CWBE 1GZLA 1J1EC 1ZOYC 2M3BA 2KSEA 5DJTB 4JBZA 5APVA 1G2CA 3CC4P 3HRNA 2YO3A 1PIXA 2HODB 1NU1D 5AVTB 3SWFA 4Z1MH 3JCUH 1OX3A 2B9BA 1OXZA 5KJ7D 5KJ7C 2V4HA 3MP7B 2Q3EA 3D70A 1NU1K 3VMZA 3AE5C 1GTWA 3HD7A 1JY3P 1LTJC 5CCHC 5CCHD 1NU1E 3L75J 1OVRA 1N73B 2J5UA 5KLVD 4L76A 5KAFE 3A2AA 3A0HE 1IFNA 3PP5A 1J1DC 1JTHA 1QGKB 1YTZT 4M3LA 1FZAA 1FDOA 1QEXA 1JY2N 3HTKB 4ZMDA 4JQ0D 2YXRB 1R5LA 1D7MA 3ITKA 1YHQP 4YTPC 1USEA 2JJLA 4U7JA 1NTKJ 1VPCA 4RJTA 3AE4C 5BVZA 3D6ZA 1PGJA 1PL5A 4OWFA 3L4FA 2H8PD 4BWNA 2KUBA 3WU2H 2E74C 1NYHA 1YJNP 2JDIH 2OYIA 1SLQA 1BCCG 3MUDC 1OVUA 2WSEH 1XTCC 5B5EH 2N1TA 1EZVI 1JY3N 1NAFA 2GM4A 1QX8A 3CXHD 3VTPC 2WSEJ 3CCUP 2HG5D 1SQBJ 3Q1MA 3L37A 2I1KA 2E42A 4ASWA 1KB9I 3I55P 3GF7A 1NKZB 3GG2A 1GU4A 2NPSD 3L35A 3CXHE 3R4YA 2QJKC 4U3FJ 1JY3O 1X79B 2A45G 2M5AB 3VP9A 1SQPD 3NMDA 2QA4P 1QL1A 3PHLA 2KXPB 2WPRA 3R2PA 4IL6X 1KYOI 2KK7A 5AW8B 2KOGA 2NRGA 3H1JD 1L0LJ 1BGYG 1DEBA 3Q5RA 1HVVA 2KB7P 1NTZG 1YBKA 1LT1A 2AXTH 2BCCD 1HWTC 1PP9D 4OGQD 1JCCA 2ZAEB 1IC2A 1LT9B 3D71A 3L70E 3M0DA 4NPFX 3TNUA 2R5DA 2E76C 4OGQB 1R5SA 3H1JE 4PD4D 3CWBJ 4OH8B 1EC5A 3GLMA 2ZXXA 4HYTB 3A0BE 1KTMA 1NTMJ 1HUCA 2LKMA 2P1JA 4H0LC 4JF7A 4Y99C 2P2UA 3BRVB 3FWLA 2Y0EA 3H1KD 2WQYC 1Q81Q 3H1LG 3TK1A 3H25A 1E5WA 3ZDMA 4DOJA 5KAFH 3I56P 1PV3A 1URQD 2V7QH 2J58A 1IJDB 1FOSE 2Q9IA 2FXPA 3H1KE 2C9NY 2FYUJ 4W7YA 5AW9B 2IDBA 3M91A 1YQ3C 3F5HA 1BE3J 4D6TD 1SFCA 2AEMA 1EDIA 3CCSP 4UB6E 1KMIZ 1GL2A 3FWNA 5APSA 3GF3A 1L4AA 4L74A 3T97B 2IZ1A 4H13C 4H13D 3LIEA 1IZNB 4D6TE 1SVFA 1FBMA 2H43A 3L73D 2Y9YA 3JCUE 1K04A 3WMM0 1KORA 3C1LA 3HUSA 1YQ4C 3P8CE 3AE7C 3CWBG 3K5BA 1H88A 1U7JA 2ITAA 3IAOA 5CBOA 3AEDC 3P32A 1Q2NA 1RH5B 2YMYA 3CI9A 2W6BA 2HLOA 3L73E 3Q5PA 1NGMB 3CXHH 1NVOA 5AW0B 2GA1A 3L71J 3AEGC 2G8YA 1VQ6P 2I8DA 4MN4C 2A45I 2Q7CA 2QJYC 1DD4A 1S5LX 2W6JH 3S9OA 1LTIC 1JOCA 1CZQA 1L2PA 1N8RQ 2XNXA 3MIWA 1NU1G 1S5LE 2R5BA 4AYCA 1IFMA 3F89A 4WY4A 2Y0DA 3Q5SA 3VP8A 3MD0A 1OVVA 2JR8A 1PZQA 2PGDA 1RF1B 1OIPA 1SQXD 4ZNCA 1UIXA 1EXIA 2OGUA 1RE4A 4LLHA 5CCGA 2OYHA 5CHXA 3O6QB 4DCKA 2D2CD 3A0BH 3GW6A 3CX5D 1X0TA 1W2BO 1VQNP 2WT7A 2M3EA 3L70J 2H89C 2WSSH 3NFQA 3CCJP 2Z5IA 3G6EP 1FC2C 4BRYA 1SS1A 1OZHA 3N7NA 5KLIC 4PD4H 2FFDB 2JWDA 2YXQB 3CX5E 3B5NA 1KILB 2P58A 3GHGC 2B87A 3BCCD 4YXDC 3KPEA 1N7SC 2Q3IA 1KILE 1JMBA 1K8AQ 4PV1D 2W83C 1AVYA 2HODA 2C0WA 5AW3B 1FZFA 1M1JB 1RF0A 1M90Q 2ZT9D 2ZT9C 5KKZB 1FZCB 3G9RA 3V2PA 1BCCJ 3QH9A 1GD2E 2JWAA 4TLFA 3B5NB 4HH2A 3A5TA 1RE3A 4IFFA 4UB6H 1JMMA 1XTGB 1N73A 2J59M 2FY8A 3B71A 1AQ5A 1SQQD 3BRTB 2N9YB 2O01N 2YIUB 4W80A 3RL0B 4NPDA 1LWUC 3CCLP 1J1EB 2WSFH 3Q2YA 1VQKP 1VL2A 1KQFB 1SQQK 2HPCB 2CPSA 3HTKA 5APYA 3P7KA 1IO4A 1SQQE 1LP1B 3FX0A 2L5GB 3L70G 1S9KD 2Z5HA 1H0TA 3NTNA 4AQRD 2MJZA 1Y9BA 3H1JG 3U1CA 1N73C 1LTJB 3B4SA 2XV5A 1PP9G 2ZXEB 1G1IA 5KLVK 4N78D 2GUSA 1JNMA 1S9KE 5KLVE 1J1DB 2XDJA 1T2KC 1S5LH 1T2KD 4N3YB 3CMAP 5EFWB 3HD7D 3HD7C 1BGYJ 2RH0A 1NTZJ 1H0TB 3VMYA 1CW5A 1RY3A 2K88A 4HKZH 1S1CX 2E74D 5CMZA 1VQ5P 4IOIH 5KAIE 1DD3A 3H1KG 2E75C 4RO0A 5APXA 3CLQA 2QM8A 2LXBA 3G3ZA 1QVFO 2NZ2A 2ZFCA 3AEAC 5M1BA 4XFJA 2E74B 2MKVA 5C39A 1LTTC 2JO1A 2LR2A 1S72P 3AE8C 3H32B 4R4MA 2XZRA 2WITA 2M5AA 2NPSA 1FDIA 2XU6A 1SQVD 5GTIE 1MUUA 3TDKA 2HR3A 2Y9ZA 2OARA 3H1LJ 3M06A 1KYOD 2WSCH 4D6TG 3RBXA 3AE9C 2OYIC 5AVXB 3CX5H 4XA4A 3PJSK 1ZXGA 1GK6A 1SQVE 2KNCB 2OYOA 5AVRB 2N1TC 2QEXP 2FYNB 2NPSB 4IFMA 1LT9A 3CC7P 5APTA 2QJKB 4DJGA 3AE2C 2P7JA 3L73G 1KC8Q 3CPWO 2RKLA 1OWAA 1SQPK 1CSBA 3VOPA 1VF5C 1WMKA 3WUTA 2OQQA 2W27A 3M0AA 1SQPE 4I2LC 3HE5B 3H1HD 4DZOA 3S1KA 2KLUA 3V6IA 1NKNA 5AVZB 1J2JB 1L0ND 1HH0A 1Q86Q 4QMAA 1N7LA 1IFPA 1T3JA 4WWIA 2E76D 3U1AA 5CJ0A 3W68A 5AW5B 3BASA 3H1HE 3HE4B 5DJUB 2BCCE 4R4LA 2K1AA 1L0NE 1PP9E 3RK2D 3RK2C 3H6PA 1VQ7P 2E76B 1KFNA 1T8ZA 4H0LD 2IFNA 1LJ2A 1EQ7A 5L8RJ 3PH0A 3L74D 1S4XA 4UB8H 3MGNA 2LXCB 4PD4E 4NPEA 3CCQP 3ABVC 4HJGH 1USDA 4Y99B 1VQ8P 1SQXG 4W7ZA 3M0DC 1ZRTD 3AE3C 1MZ9A 1NU1J 3L72D 3N4XA 3L74E 4GDOA 3T97A 4CPGA 5BU5A 1URQB 5CBNA 3TGUD 3GMAA 1FAVA 1OW7A 1OFCX 1ZR4A 3QWOC 2V7QJ 1P84I 1BSNA 1ZRTE 1VQMP 1CI6B 2WPSA 1T3UA 5GTHH 4I7ZC 3L72E 1ZR2A 5KLVJ 2W90A 1ZN5A 3EFGA 4WBAA 3TGUE 3LIDA 3OA7A 2B88A 5KAIH 3BVHA 2K9YA 5AVVB 2M8RA 4EYYQ 2JKVA 1VQOP 3E7KA 2L91A 1N86A 3EFFK 2YO2A 1NHLA 1PGQA 1IFIA 3BCCG 1HGZA 3L75D 4GODA 1M57D 4H13B 3KXDA 3VMXA 3E1RA 3PTZA 5GTIH 3VMAA 2PFXA 1W2EA 3EQ2A 5K5GB 1KQGB 1FE6A 1SFCD 1SFCC 1MKMA 3V4WA 4H44C 4H44D 3L75E 4EI2A 2R3SA 2JP3A 1LGHB 1QLED 2Q6QA 4WB4A 1DIPA 2AEJA 1GL2C 4EDFA 2O01H 1L4AC 1MFTA 5AVSB 3RK3C 4B86A 3A7OA 1RF1A 4BXLA 2KLVA 1JCDA 1NTKD 1LTSC
chains in the Genus database with same CATH topology
5KLVJ 3CX5I 4D6TJ 3L72J 3L74J 3H1JJ 4U3FJ 2FYUJ 1NTMJ 3H1HJ 1BGYJ 1SQBJ 1KYOI 1NTKJ 3H1KJ 3BCCJ 1NTZJ 1SQQJ 1BCCJ 3H1LJ 2BCCJ 1SQVJ 3TGUJ 4PD4I 3CXHI 3L73J 3L75J 1PP9J 3L71J 1L0NJ 3H1IJ 1EZVI 1KB9I 1BE3J 1P84I 1SQXJ 1NU1J 3L70J 2IBZI 1L0LJ 3CWBJ 1SQPJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLV J;  3CX5 I;  4D6T J;  3L72 J;  3L74 J;  3H1J J;  4U3F J;  2FYU J;  1NTM J;  3H1H J;  1BGY J;  1SQB J;  1KYO I;  1NTK J;  3H1K J;  3BCC J;  1NTZ J;  1SQQ J;  1BCC J;  3H1L J;  2BCC J;  1SQV J;  3TGU J;  4PD4 I;  3CXH I;  3L73 J;  3L75 J;  1PP9 J;  3L71 J;  1L0N J;  3H1I J;  1EZV I;  1KB9 I;  1BE3 J;  1P84 I;  1SQX J;  1NU1 J;  3L70 J;  2IBZ I;  1L0L J;  3CWB J;  1SQP J; 
#chains in the Genus database with same CATH topology
 1Q7Y Q;  1SQQ G;  2KSJ A;  3WUU A;  5KTB A;  3TYY A;  1PGO A;  3HUS C;  2AXC A;  4GT1 A;  2ZYA A;  1NTK K;  3O6Q A;  2QJY B;  2WMM A;  2UWJ E;  4EIJ A;  5E79 E;  1NTK E;  1OW8 A;  3V4Q A;  2IBZ D;  2KP8 A;  3H1I D;  3A3Y B;  2SPZ A;  4AUW A;  2YKQ A;  1AJY A;  1FZG A;  4KHX A;  1WRG A;  5APW A;  3CCE P;  1YIT P;  3SFE C;  5KLV G;  2FFD A;  1A02 J;  1SQB D;  1SQP J;  2K9J B;  1SQX K;  4GOF A;  4RKU J;  1KIL A;  1MV8 A;  2FYZ A;  2IBZ E;  5AVQ B;  3H1I E;  2K3R A;  1SQB K;  1SQX E;  3CCM P;  1FZB A;  3LW5 H;  3OJA B;  1Z56 A;  4U3F D;  1H8A A;  1EDL A;  2ZVN B;  4LC1 A;  1SQB E;  4WY4 C;  2D2C B;  4WY4 D;  4JYC A;  1YYC A;  1M1J A;  3H1J J;  2QJP C;  1YTZ I;  1FZC A;  2BCC J;  1HJ0 A;  1PP9 J;  3LW5 J;  4WVZ A;  1EDJ A;  2RMZ A;  1Q82 Q;  4C7N B;  1RE4 C;  3AE6 C;  5CCG C;  2OYH C;  1KQS O;  3I5C A;  1KIL C;  1EDK A;  1N7S D;  2Z4E A;  1NH4 A;  2IZ0 A;  3OW2 O;  1L0L D;  1JM0 A;  1PPJ D;  3AEC C;  3AEB C;  1N7S B;  2OTL P;  2HPC A;  3RBZ A;  2E5Y A;  1IK7 A;  3CX5 I;  3BCC E;  1SQV G;  3MHV A;  4PV1 B;  2A06 D;  2YMK A;  4N6J A;  2CK3 H;  2BEQ D;  2ZYD A;  3H1K J;  5KKZ C;  5AVU B;  3II6 A;  3CWB D;  5AW1 B;  2ZT9 B;  2M0B A;  1LP1 A;  2W6A A;  1PPJ E;  3B5N C;  1NTM D;  5KJ7 A;  2H88 C;  1YIJ P;  2VRS A;  2A06 E;  3FGA D;  1LTJ A;  1ZV8 A;  5CCH A;  1M7L A;  2IYP A;  1NTM K;  1QL2 A;  1N2D C;  1JB0 J;  3RL0 C;  1SQP G;  1UII A;  5B66 H;  1IFJ A;  1RF0 C;  2IPP A;  1NTM E;  2IX7 C;  2KS1 B;  1LWU B;  1K9M Q;  2R44 A;  4D6T J;  3CD6 P;  1S3J A;  4TT3 H;  2WSF J;  1M1K Q;  4UB8 E;  1RE3 C;  1BSH A;  2A45 H;  2FYU D;  2POH A;  5AVY B;  3H1H G;  4JYB A;  1U57 A;  5TJH A;  4KT0 J;  5AW4 B;  2BCC G;  1L0N G;  1BE3 D;  3BAT A;  3MTU E;  2FYU K;  3AEE C;  1S2E A;  2CPB A;  3L73 J;  2O3J A;  4PJ0 E;  4ZKU A;  1G2C B;  3VYI A;  2FYU E;  3USS A;  3H32 A;  3MUD A;  1EZV D;  1K73 Q;  2WPQ A;  5E79 H;  1BE3 E;  5GTH E;  4N78 E;  1FU1 A;  5APU A;  3CCR P;  3FXE A;  2QG4 A;  4Y28 J;  3L74 G;  3HD7 B;  1BDD A;  2E75 D;  1KB9 D;  1EZV E;  1K05 A;  1TU3 F;  2ZYG A;  1JO5 A;  1QVG O;  2E75 B;  1PFI A;  2KNC A;  1RQU A;  1VDF A;  3L72 G;  4I6M C;  1JTH B;  1JY2 O;  3EWK A;  2FXO A;  3TGU G;  3L71 D;  1KB9 E;  2QIW A;  4GKG A;  3E1I A;  4GOE A;  1AV1 A;  2FXM A;  4L73 A;  1KN7 A;  3AE1 C;  3H1I J;  1SQX J;  1SQV K;  3L36 A;  2G3A A;  2XKM A;  2O1K A;  3IN6 A;  4L75 A;  1GW3 A;  2BAS A;  3HE5 A;  3L71 E;  1ZLL A;  2IFM A;  3M9H A;  1OMI A;  1Q90 D;  3G71 P;  2WSC J;  2OYI B;  2N1T D;  2WZ7 A;  4KJM A;  3C9I A;  3RGU A;  1RQV A;  3IF4 A;  1KYO E;  5AVW B;  2FYN C;  2NPS C;  1VQ4 P;  3MZW B;  1KD1 Q;  3L75 G;  2N1T B;  3VN0 A;  3HE4 A;  1YJ9 P;  3CXH I;  1VF5 D;  2IYO A;  4ZKP A;  5AW2 B;  3V2N A;  4C46 A;  1GU5 A;  4OVN F;  1NOH A;  4HB1 A;  1VF5 B;  3KHU A;  2BEZ F;  3BCC J;  3IR9 A;  3L70 D;  2QM7 A;  3KQG A;  2HYN A;  1ZP0 C;  4IL6 E;  3G4S P;  1DH3 A;  3CCV P;  5TIS H;  1LT9 C;  3SFD C;  1L0N K;  1NTK G;  2N9B A;  3IFM A;  3O8Z A;  1JEK A;  4OGQ C;  1URQ A;  1KZU B;  4K35 A;  5APQ A;  3PLN A;  2Q5U A;  3RK2 B;  2JEE A;  2QVA A;  1LTG C;  1RHZ B;  1P84 D;  3U59 A;  1ZME C;  4H0L B;  1CI6 A;  2KZJ A;  2IBZ G;  4A7P A;  3H1I G;  1SQQ J;  2Q1K A;  3SSU A;  1VQL P;  4K3A A;  3OAK A;  1GW4 A;  1GMJ A;  3NXS A;  1SQB G;  2RN0 A;  1A02 F;  1BCC D;  4PJ0 H;  5H2F E;  1P84 E;  1NJI Q;  3TNU B;  3A0H H;  1URQ C;  1HGV A;  1WT6 A;  2W8Z A;  4PD4 I;  1AFO A;  2OTK E;  2PAJ A;  1DEE G;  2FKW B;  1GDT A;  3SWK A;  4U3F G;  2B89 A;  3V2R A;  2I1J A;  1BCC E;  2KZI A;  1U7M A;  1LNQ A;  3KZI E;  1NO4 A;  2YKO A;  4I7Z B;  4LGD E;  1GK4 A;  2R32 A;  2OTJ P;  2PRR A;  5AW6 B;  1PGP A;  2WVR A;  2QSI A;  3FXD A;  1X8Y A;  2WPV B;  4ASV A;  1HJB A;  2Y0C A;  5B66 E;  2YKP A;  1FDM A;  1VQ9 P;  3P8C D;  1L0L G;  3KYQ A;  1X9V A;  2H7H A;  1DX7 A;  1KB9 H;  4GIF A;  1PPJ G;  4O9B A;  3Q3D A;  1FS0 E;  2GUV A;  1BDC A;  1FOS F;  2A06 G;  4JPZ B;  3D6Y A;  3KDP B;  3B8E B;  5BU8 B;  2C9L Y;  1LTB C;  2YNY A;  1GL2 D;  1X22 A;  1SFC B;  1L4A D;  1HBW A;  3RK3 D;  3P8M C;  1KV4 A;  4H44 B;  1MFZ A;  1NTM G;  5AW7 B;  1BGY D;  3M9Q A;  2KI7 B;  1NAY A;  1NTZ D;  1GL2 B;  1VQP P;  1KYO H;  1L4A B;  3TSI A;  3RK3 B;  2AEF A;  2K9J A;  3SWY A;  2WWW A;  2O01 J;  1SQV J;  4DT0 A;  2KIK A;  3CL3 D;  1NTZ K;  3RK3 E;  1NWQ A;  1T6A A;  1BGY E;  3HUS B;  1G1J A;  1NTZ E;  2P67 A;  1KFM A;  1W5C E;  3JC2 2;  1FJK A;  3RL0 g;  1AQT A;  1RF1 C;  1E79 H;  2FYU G;  1M56 D;  4YXW H;  4C7N A;  4IL6 H;  3H1L D;  3W67 A;  3WU2 E;  1BE3 G;  1ZW0 A;  1Y47 A;  2FBW C;  3C8V A;  1YJW P;  4IFD K;  3GHG A;  5B5E E;  3UIA A;  2WTY A;  1HTL C;  1EZV G;  3H1L E;  1N7S A;  2QE7 H;  4XE5 B;  3H1H J;  3S4R A;  2PP6 A;  2D2C C;  2R3C A;  1AA0 A;  3CME P;  2KYV A;  2C0X A;  1L0N J;  4WY4 B;  2FFD C;  2IBZ I;  3JSV C;  1KQL A;  2QJP B;  3TF5 A;  2K37 A;  4U3F E;  1FZE A;  5CCG D;  2HFE D;  5KLI B;  1KIL D;  2O1J A;  2ZJS E;  4EOT A;  1M8O B;  3AEF C;  4I1L A;  3CC2 P;  5H2F H;  2OYH B;  1AVO A;  1P84 H;  3GHG B;  1JUN A;  1H89 A;  5CJ4 A;  3PRJ A;  4RES B;  1HF9 A;  2E5T A;  1L0L K;  1M1J C;  3L74 J;  4C7R A;  3L71 G;  2P10 A;  1FJP A;  2KS1 A;  2WT7 B;  1OW6 A;  2QRX A;  1FZC C;  1LWU A;  4PV1 C;  2DW3 A;  1IK9 A;  1L0L E;  1R8E A;  4BRY B;  3KZI H;  3M9B A;  3B5N D;  1JY2 P;  3V2Q A;  1EXJ A;  2E43 A;  1LTA C;  1Y8A A;  3L72 J;  2ZVO B;  4YPC A;  2XND H;  1SP4 A;  5TIS E;  3V5B A;  3WUV A;  3TGU J;  1YI2 P;  2YIU C;  1IFD A;  2B87 B;  2AXT E;  3RL0 D;  3CWB E;  1GZL A;  1J1E C;  1ZOY C;  2M3B A;  2KSE A;  5DJT B;  4JBZ A;  5APV A;  1G2C A;  3CC4 P;  3HRN A;  2YO3 A;  1PIX A;  2HOD B;  1NU1 D;  5AVT B;  3SWF A;  4Z1M H;  3JCU H;  1OX3 A;  2B9B A;  1OXZ A;  5KJ7 D;  5KJ7 C;  2V4H A;  3MP7 B;  2Q3E A;  3D70 A;  1NU1 K;  3VMZ A;  3AE5 C;  1GTW A;  3HD7 A;  1JY3 P;  1LTJ C;  5CCH C;  5CCH D;  1NU1 E;  3L75 J;  1OVR A;  1N73 B;  2J5U A;  5KLV D;  4L76 A;  5KAF E;  3A2A A;  3A0H E;  1IFN A;  3PP5 A;  1J1D C;  1JTH A;  1QGK B;  1YTZ T;  4M3L A;  1FZA A;  1FDO A;  1QEX A;  1JY2 N;  3HTK B;  4ZMD A;  4JQ0 D;  2YXR B;  1R5L A;  1D7M A;  3ITK A;  1YHQ P;  4YTP C;  1USE A;  2JJL A;  4U7J A;  1NTK J;  1VPC A;  4RJT A;  3AE4 C;  5BVZ A;  3D6Z A;  1PGJ A;  1PL5 A;  4OWF A;  3L4F A;  2H8P D;  4BWN A;  2KUB A;  3WU2 H;  2E74 C;  1NYH A;  1YJN P;  2JDI H;  2OYI A;  1SLQ A;  1BCC G;  3MUD C;  1OVU A;  2WSE H;  1XTC C;  5B5E H;  2N1T A;  1EZV I;  1JY3 N;  1NAF A;  2GM4 A;  1QX8 A;  3CXH D;  3VTP C;  2WSE J;  3CCU P;  2HG5 D;  1SQB J;  3Q1M A;  3L37 A;  2I1K A;  2E42 A;  4ASW A;  1KB9 I;  3I55 P;  3GF7 A;  1NKZ B;  3GG2 A;  1GU4 A;  2NPS D;  3L35 A;  3CXH E;  3R4Y A;  2QJK C;  4U3F J;  1JY3 O;  1X79 B;  2A45 G;  2M5A B;  3VP9 A;  1SQP D;  3NMD A;  2QA4 P;  1QL1 A;  3PHL A;  2KXP B;  2WPR A;  3R2P A;  4IL6 X;  1KYO I;  2KK7 A;  5AW8 B;  2KOG A;  2NRG A;  3H1J D;  1L0L J;  1BGY G;  1DEB A;  3Q5R A;  1HVV A;  2KB7 P;  1NTZ G;  1YBK A;  1LT1 A;  2AXT H;  2BCC D;  1HWT C;  1PP9 D;  4OGQ D;  1JCC A;  2ZAE B;  1IC2 A;  1LT9 B;  3D71 A;  3L70 E;  3M0D A;  4NPF X;  3TNU A;  2R5D A;  2E76 C;  4OGQ B;  1R5S A;  3H1J E;  4PD4 D;  3CWB J;  4OH8 B;  1EC5 A;  3GLM A;  2ZXX A;  4HYT B;  3A0B E;  1KTM A;  1NTM J;  1HUC A;  2LKM A;  2P1J A;  4H0L C;  4JF7 A;  4Y99 C;  2P2U A;  3BRV B;  3FWL A;  2Y0E A;  3H1K D;  2WQY C;  1Q81 Q;  3H1L G;  3TK1 A;  3H25 A;  1E5W A;  3ZDM A;  4DOJ A;  5KAF H;  3I56 P;  1PV3 A;  1URQ D;  2V7Q H;  2J58 A;  1IJD B;  1FOS E;  2Q9I A;  2FXP A;  3H1K E;  2C9N Y;  2FYU J;  4W7Y A;  5AW9 B;  2IDB A;  3M91 A;  1YQ3 C;  3F5H A;  1BE3 J;  4D6T D;  1SFC A;  2AEM A;  1EDI A;  3CCS P;  4UB6 E;  1KMI Z;  1GL2 A;  3FWN A;  5APS A;  3GF3 A;  1L4A A;  4L74 A;  3T97 B;  2IZ1 A;  4H13 C;  4H13 D;  3LIE A;  1IZN B;  4D6T E;  1SVF A;  1FBM A;  2H43 A;  3L73 D;  2Y9Y A;  3JCU E;  1K04 A;  3WMM 0;  1KOR A;  3C1L A;  3HUS A;  1YQ4 C;  3P8C E;  3AE7 C;  3CWB G;  3K5B A;  1H88 A;  1U7J A;  2ITA A;  3IAO A;  5CBO A;  3AED C;  3P32 A;  1Q2N A;  1RH5 B;  2YMY A;  3CI9 A;  2W6B A;  2HLO A;  3L73 E;  3Q5P A;  1NGM B;  3CXH H;  1NVO A;  5AW0 B;  2GA1 A;  3L71 J;  3AEG C;  2G8Y A;  1VQ6 P;  2I8D A;  4MN4 C;  2A45 I;  2Q7C A;  2QJY C;  1DD4 A;  1S5L X;  2W6J H;  3S9O A;  1LTI C;  1JOC A;  1CZQ A;  1L2P A;  1N8R Q;  2XNX A;  3MIW A;  1NU1 G;  1S5L E;  2R5B A;  4AYC A;  1IFM A;  3F89 A;  4WY4 A;  2Y0D A;  3Q5S A;  3VP8 A;  3MD0 A;  1OVV A;  2JR8 A;  1PZQ A;  2PGD A;  1RF1 B;  1OIP A;  1SQX D;  4ZNC A;  1UIX A;  1EXI A;  2OGU A;  1RE4 A;  4LLH A;  5CCG A;  2OYH A;  5CHX A;  3O6Q B;  4DCK A;  2D2C D;  3A0B H;  3GW6 A;  3CX5 D;  1X0T A;  1W2B O;  1VQN P;  2WT7 A;  2M3E A;  3L70 J;  2H89 C;  2WSS H;  3NFQ A;  3CCJ P;  2Z5I A;  3G6E P;  1FC2 C;  4BRY A;  1SS1 A;  1OZH A;  3N7N A;  5KLI C;  4PD4 H;  2FFD B;  2JWD A;  2YXQ B;  3CX5 E;  3B5N A;  1KIL B;  2P58 A;  3GHG C;  2B87 A;  3BCC D;  4YXD C;  3KPE A;  1N7S C;  2Q3I A;  1KIL E;  1JMB A;  1K8A Q;  4PV1 D;  2W83 C;  1AVY A;  2HOD A;  2C0W A;  5AW3 B;  1FZF A;  1M1J B;  1RF0 A;  1M90 Q;  2ZT9 D;  2ZT9 C;  5KKZ B;  1FZC B;  3G9R A;  3V2P A;  1BCC J;  3QH9 A;  1GD2 E;  2JWA A;  4TLF A;  3B5N B;  4HH2 A;  3A5T A;  1RE3 A;  4IFF A;  4UB6 H;  1JMM A;  1XTG B;  1N73 A;  2J59 M;  2FY8 A;  3B71 A;  1AQ5 A;  1SQQ D;  3BRT B;  2N9Y B;  2O01 N;  2YIU B;  4W80 A;  3RL0 B;  4NPD A;  1LWU C;  3CCL P;  1J1E B;  2WSF H;  3Q2Y A;  1VQK P;  1VL2 A;  1KQF B;  1SQQ K;  2HPC B;  2CPS A;  3HTK A;  5APY A;  3P7K A;  1IO4 A;  1SQQ E;  1LP1 B;  3FX0 A;  2L5G B;  3L70 G;  1S9K D;  2Z5H A;  1H0T A;  3NTN A;  4AQR D;  2MJZ A;  1Y9B A;  3H1J G;  3U1C A;  1N73 C;  1LTJ B;  3B4S A;  2XV5 A;  1PP9 G;  2ZXE B;  1G1I A;  5KLV K;  4N78 D;  2GUS A;  1JNM A;  1S9K E;  5KLV E;  1J1D B;  2XDJ A;  1T2K C;  1S5L H;  1T2K D;  4N3Y B;  3CMA P;  5EFW B;  3HD7 D;  3HD7 C;  1BGY J;  2RH0 A;  1NTZ J;  1H0T B;  3VMY A;  1CW5 A;  1RY3 A;  2K88 A;  4HKZ H;  1S1C X;  2E74 D;  5CMZ A;  1VQ5 P;  4IOI H;  5KAI E;  1DD3 A;  3H1K G;  2E75 C;  4RO0 A;  5APX A;  3CLQ A;  2QM8 A;  2LXB A;  3G3Z A;  1QVF O;  2NZ2 A;  2ZFC A;  3AEA C;  5M1B A;  4XFJ A;  2E74 B;  2MKV A;  5C39 A;  1LTT C;  2JO1 A;  2LR2 A;  1S72 P;  3AE8 C;  3H32 B;  4R4M A;  2XZR A;  2WIT A;  2M5A A;  2NPS A;  1FDI A;  2XU6 A;  1SQV D;  5GTI E;  1MUU A;  3TDK A;  2HR3 A;  2Y9Z A;  2OAR A;  3H1L J;  3M06 A;  1KYO D;  2WSC H;  4D6T G;  3RBX A;  3AE9 C;  2OYI C;  5AVX B;  3CX5 H;  4XA4 A;  3PJS K;  1ZXG A;  1GK6 A;  1SQV E;  2KNC B;  2OYO A;  5AVR B;  2N1T C;  2QEX P;  2FYN B;  2NPS B;  4IFM A;  1LT9 A;  3CC7 P;  5APT A;  2QJK B;  4DJG A;  3AE2 C;  2P7J A;  3L73 G;  1KC8 Q;  3CPW O;  2RKL A;  1OWA A;  1SQP K;  1CSB A;  3VOP A;  1VF5 C;  1WMK A;  3WUT A;  2OQQ A;  2W27 A;  3M0A A;  1SQP E;  4I2L C;  3HE5 B;  3H1H D;  4DZO A;  3S1K A;  2KLU A;  3V6I A;  1NKN A;  5AVZ B;  1J2J B;  1L0N D;  1HH0 A;  1Q86 Q;  4QMA A;  1N7L A;  1IFP A;  1T3J A;  4WWI A;  2E76 D;  3U1A A;  5CJ0 A;  3W68 A;  5AW5 B;  3BAS A;  3H1H E;  3HE4 B;  5DJU B;  2BCC E;  4R4L A;  2K1A A;  1L0N E;  1PP9 E;  3RK2 D;  3RK2 C;  3H6P A;  1VQ7 P;  2E76 B;  1KFN A;  1T8Z A;  4H0L D;  2IFN A;  1LJ2 A;  1EQ7 A;  5L8R J;  3PH0 A;  3L74 D;  1S4X A;  4UB8 H;  3MGN A;  2LXC B;  4PD4 E;  4NPE A;  3CCQ P;  3ABV C;  4HJG H;  1USD A;  4Y99 B;  1VQ8 P;  1SQX G;  4W7Z A;  3M0D C;  1ZRT D;  3AE3 C;  1MZ9 A;  1NU1 J;  3L72 D;  3N4X A;  3L74 E;  4GDO A;  3T97 A;  4CPG A;  5BU5 A;  1URQ B;  5CBN A;  3TGU D;  3GMA A;  1FAV A;  1OW7 A;  1OFC X;  1ZR4 A;  3QWO C;  2V7Q J;  1P84 I;  1BSN A;  1ZRT E;  1VQM P;  1CI6 B;  2WPS A;  1T3U A;  5GTH H;  4I7Z C;  3L72 E;  1ZR2 A;  5KLV J;  2W90 A;  1ZN5 A;  3EFG A;  4WBA A;  3TGU E;  3LID A;  3OA7 A;  2B88 A;  5KAI H;  3BVH A;  2K9Y A;  5AVV B;  2M8R A;  4EYY Q;  2JKV A;  1VQO P;  3E7K A;  2L91 A;  1N86 A;  3EFF K;  2YO2 A;  1NHL A;  1PGQ A;  1IFI A;  3BCC G;  1HGZ A;  3L75 D;  4GOD A;  1M57 D;  4H13 B;  3KXD A;  3VMX A;  3E1R A;  3PTZ A;  5GTI H;  3VMA A;  2PFX A;  1W2E A;  3EQ2 A;  5K5G B;  1KQG B;  1FE6 A;  1SFC D;  1SFC C;  1MKM A;  3V4W A;  4H44 C;  4H44 D;  3L75 E;  4EI2 A;  2R3S A;  2JP3 A;  1LGH B;  1QLE D;  2Q6Q A;  4WB4 A;  1DIP A;  2AEJ A;  1GL2 C;  4EDF A;  2O01 H;  1L4A C;  1MFT A;  5AVS B;  3RK3 C;  4B86 A;  3A7O A;  1RF1 A;  4BXL A;  2KLV A;  1JCD A;  1NTK D;  1LTS C; 
#chains in the Genus database with same CATH homology
 5KLV J;  3CX5 I;  4D6T J;  3L72 J;  3L74 J;  3H1J J;  4U3F J;  2FYU J;  1NTM J;  3H1H J;  1BGY J;  1SQB J;  1KYO I;  1NTK J;  3H1K J;  3BCC J;  1NTZ J;  1SQQ J;  1BCC J;  3H1L J;  2BCC J;  1SQV J;  3TGU J;  4PD4 I;  3CXH I;  3L73 J;  3L75 J;  1PP9 J;  3L71 J;  1L0N J;  3H1I J;  1EZV I;  1KB9 I;  1BE3 J;  1P84 I;  1SQX J;  1NU1 J;  3L70 J;  2IBZ I;  1L0L J;  3CWB J;  1SQP J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...