3L74J

Cytochrome bc1 complex from chicken with famoxadone bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
b'ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 24
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l74J00
3CX5I 1NTMJ 4PD4I 1SQXJ 3L72J 3L75J 3L71J 1SQQJ 4D6TJ 1NTKJ 3TGUJ 1NU1J 3CWBJ 1L0NJ 1SQBJ 3CXHI 1L0LJ 3H1JJ 4U3FJ 5KLVJ 1BGYJ 1EZVI 1KB9I 3H1LJ 1BCCJ 3H1HJ 1BE3J 3BCCJ 3L74J 3L70J 1P84I 3H1IJ 3L73J 2IBZI 1NTZJ 1PP9J 2BCCJ 1SQPJ 1SQVJ 2FYUJ 3H1KJ 1KYOI
chains in the Genus database with same CATH superfamily
2KNCA 3ZDMA 3AE8C 2O01J 3L36A 1J1DB 2QVAA 3L72G 4BWNA 4L75A 3GHGC 1VDFA 3L75D 2GUVA 3CCQP 3TNUA 2R5DA 2Q5UA 2NPSD 1JY3P 1IJDB 1EDIA 3RL0g 3Q3DA 5CCGD 5AVUB 2WWWA 3H1IG 1EZVG 1BCCD 3FWLA 3CCMP 2Q7CA 3W68A 3LIEA 1R5SA 1S4XA 1J1EC 2OYIB 1S1CX 1N7SC 1SQQK 2WPSA 2WPRA 3SWYA 2XU6A 2OYHA 3BATA 1Y47A 5GTIE 3M9QA 3CCLP 3CI9A 4GOEA 1M8OB 1EXIA 3KHUA 3TK1A 1GU4A 3H1IE 1EZVE 4GOFA 2KXPB 4U3FD 2RN0A 2OTKE 4H44C 2WPVB 3HTKB 1LTSC 1DX7A 2ZXEB 3T97A 1HH0A 1BE3G 1K9MQ 4N78E 2J5UA 1NTMG 3P32A 4HH2A 4XA4A 2WSCH 3OJAB 3R2PA 1FDMA 2P67A 3USSA 1NWQA 1G1IA 2D2CB 5TISH 5CMZA 3T97B 1N8RQ 5KAIH 2MKVA 3M0DA 4N78D 1LTIC 1YYCA 3VP8A 3WU2E 3CWBG 1J1DC 1BE3E 3H1JG 3L74E 1N86A 3L37A 1HGZA 2RH0A 3GW6A 1JEKA 4AQRD 1IFMA 1FZFA 1PPJG 1KORA 1LTTC 2RKLA 2V4HA 1NTZD 2ZYAA 1WT6A 1RE4C 3LW5J 2Q9IA 3OAKA 2K9JA 2K37A 2QM8A 5AVXB 1HUCA 2V7QH 3L74D 4GT1A 2OYIC 3MD0A 1JCCA 3H1JE 4JBZA 3A0HE 1T8ZA 1W2EA 3EWKA 3A0BH 3L73J 1GU5A 1PPJE 4U7JA 1NU1E 2CK3H 3H1HD 2E5YA 1KILA 1K8AQ 5AVRB 1LWUC 1QL1A 1RF1B 1SFCB 4GKGA 5E79H 1PP9J 2ZT9B 3AEFC 2B89A 1FS0E 4UB6H 3H1JD 1KFNA 4D6TJ 2XDJA 2Y0EA 3W67A 1U7JA 2KK7A 2FKWB 1L0LJ 1NU1D 1LT9A 1IK7A 2OARA 5APYA 2H43A 1VF5B 1IFNA 1RF0A 3HD7B 2I1KA 2G8YA 1VQPP 1GMJA 2HFED 4OGQB 1LT1A 1ZMEC 4PJ0E 3IF4A 3TGUJ 3NMDA 2D2CC 2AXTH 5H2FE 3H1KE 2QG4A 1NTKJ 1URQA 4NPDA 2N1TD 4XE5B 3AEDC 2HPCA 4HB1A 3H1LE 4EIJA 2YMKA 3M9BA 3AE7C 3PHLA 1SVFA 5KKZB 2YNYA 3L75J 2K88A 1FJKA 5DJTB 1YTZT 4HYTB 4ZKUA 3CXHH 3H1KD 1PL5A 1DD3A 1L4AD 2A06G 2P10A 3G9RA 1BCCJ 1USDA 1CSBA 4GIFA 2KOGA 2M5AA 3VP9A 2GUSA 2Q3IA 2BCCE 2KP8A 1GZLA 3CC4P 4IFDK 3H1LD 1RQVA 2M3EA 2IZ0A 5CJ0A 1MFTA 2WSEH 2K1AA 1W5CE 1OW8A 1FOSE 1RHZB 3KZIH 1M57D 2Q3EA 2KZIA 2PP6A 1SQPE 1RF1C 1SFCC 1X0TA 1DD4A 1ZV8A 2ZT9C 1YJ9P 2HLOA 3H6PA 2BCCD 4DT0A 4U3FJ 1VQ9P 3FX0A 1LP1A 1G2CA 2YMYA 3HUSA 4WBAA 1L0ND 1IK9A 1HGVA 5AVWB 1H0TB 1VF5C 3HD7C 2P1JA 1HBWA 2E74D 4OGQC 1SQPD 3IN6A 4D6TG 4C7NB 4IFMA 3H1IJ 2R32A 1M1JA 1HJ0A 3QWOC 3B5NB 2E5TA 3V2QA 3SSUA 3JCUH 3EFFK 3U1AA 3BCCD 1FZAA 3BASA 2WT7A 1FZGA 3PJSK 3TGUG 4WY4A 2K3RA 3HE4B 4KJMA 2ZYGA 1P84H 3AECC 3SWFA 3CX5I 2I1JA 3L71E 1QGKB 1VQ6P 5KKZC 3MUDC 2B9BA 2JDIH 5APWA 1FC2C 2R44A 3BRVB 3SFDC 1NTKG 1AQTA 1WMKA 2JP3A 1SQBG 1FE6A 1NTZJ 5AVVB 4WY4B 5BU5A 2KSEA 1PZQA 4L73A 3L75G 5KLVK 1N7SD 3M9HA 1VPCA 2W8ZA 5CCHC 2MJZA 1OZHA 3L71D 1BE3J 3VMAA 3L74J 1Z56A 4OH8B 3R4YA 3VTPC 2M8RA 1BCCG 2Y0DA 3A0BE 1PIXA 1L0LK 1ZP0C 1KQGB 1TU3F 4I6MC 2B87B 1SQBE 1OWAA 3V2NA 1S5LE 1HWTC 2QIWA 1BDCA 1SQVE 1KYOI 2O3JA 2IYPA 3JSVC 5E79E 2AEMA 4UB6E 2NPSA 3IR9A 3PH0A 2KB7P 3H1JJ 2KUBA 5CCGA 1JTHB 1EC5A 3CCVP 5CBNA 1BCCE 4H13B 2H88C 1FZEA 4U3FG 2O1JA 3VMYA 1NU1J 3MZWB 3KXDA 1KYOH 2JKVA 3V4WA 3Q5SA 3C8VA 4LGDE 3S1KA 1JCDA 3AE1C 3B5NC 1SQVD 2L5GB 2WZ7A 3GG2A 1KQFB 1NKNA 2I8DA 5AVZB 5TJHA 5AW5B 1AV1A 4W7YA 3GF3A 1OW6A 2CPSA 1SQQE 1N73A 2Y9ZA 1Y9BA 1RE3C 2KI7B 3WUVA 2KNCB 2XNXA 4IL6X 4U3FE 1HTLC 2A45I 3SFEC 4WWIA 1JB0J 2FFDA 3TNUB 2JR8A 1CZQA 1NVOA 1LWUA 2R3CA 1SLQA 1LTBC 5AW6B 2P2UA 4OWFA 1NYHA 3PP5A 1SQQD 1U57A 3CXHE 2FYUK 1AA0A 2A45H 3H1KJ 3VOPA 3CCEP 3VMZA 1ZRTE 1NTZG 3G3ZA 1GDTA 1EQ7A 4RKUJ 3H1LJ 1K05A 2Y0CA 5KAFH 3L70E 3KZIE 1GK4A 1GL2A 2OYHB 1FU1A 3L74G 2E76B 4UB8E 3CXHD 1ZN5A 3GMAA 3EQ2A 5CBOA 1ZRTD 3RK3B 4JQ0D 2BCCJ 3H1HG 1NTZE 1ZR4A 1T6AA 1YHQP 3S9OA 2W27A 5AW7B 4H13C 2Z4EA 4QMAA 4EYYQ 1LTJA 3L70D 5KJ7A 5B66E 3FGAD 1HJBA 4W7ZA 1RH5B 1LNQA 3G6EP 1KTMA 2WSFH 1T3UA 1SQPJ 2YIUB 3RK2B 3D6ZA 2D2CD 2POHA 3F5HA 3H32A 1NU1G 1LGHB 1Q2NA 1G1JA 1JY3O 3H1HE 1DH3A 5EFWB 1ZW0A 3RK2D 1YIJP 1BSNA 4I7ZB 1P84E 4K35A 1SS1A 2NRGA 2M0BA 2UWJE 1KB9I 2H8PD 2AXCA 1OVUA 1QLED 4O9BA 2IBZI 1NTMK 1EDJA 4Y99B 4PD4I 2WSCJ 3AE3C 2HODA 1FZCA 2K9JB 5AW3B 1VQNP 2YO2A 2R3SA 2VRSA 1P84D 3PRJA 2H7HA 4BRYA 1QEXA 1VQ5P 2KS1A 2KLVA 3N4XA 3L71J 3HE5A 1W2BO 3H1KG 3JC22 2OYHC 3F89A 5AVQB 1SFCD 2E76C 1NH4A 1KILB 2J58A 2ZT9D 3H1LG 1OVRA 2N1TA 1NJIQ 2PFXA 3AEAC 2C0XA 3RK3C 1Q82Q 1YJWP 2NZ2A 3RL0B 1MFZA 3Q2YA 1VF5D 3HD7D 2YKQA 2KIKA 1EDKA 5APSA 4LC1A 1UIIA 3WUUA 3VMXA 2N9YB 1OW7A 4OGQD 1PFIA 1FOSF 1HVVA 4IL6H 5CJ4A 1LT9B 3NXSA 4YPCA 5K5GB 1RY3A 4W80A 1BDDA 1L4AA 2BCCG 1AFOA 3AE5C 2P7JA 1SQBJ 2YIUC 3RK2C 2WTYA 5L8RJ 2E75B 3GF7A 2IDBA 1YTZI 1L0NG 2KLUA 4RO0A 1XTCC 4WB4A 1NKZB 2FYNB 1JY3N 1SQVJ 2YXRB 5AW2B 3MP7B 1KD1Q 2QJPB 1NO4A 2JO1A 1SQPG 3Q5RA 1NGMB 3VYIA 3P8CD 3M0DC 4I7ZC 1EZVI 2QA4P 3GLMA 2HR3A 1URQB 2SPZA 1AVOA 1FBMA 3VN0A 3BCCG 1X79B 2HPCB 5AW8B 3Q1MA 4ZMDA 2ZXXA 3OW2O 1L0NE 4PV1B 4Y99C 4GDOA 2FXPA 1S72P 4OVNF 1OX3A 1KN7A 5CCHD 1VQ4P 2LXBA 1SQQJ 4PV1D 2M5AB 2AEFA 3D6YA 1KQSO 4WVZA 4BXLA 1H8AA 3CCRP 3CC2P 1DEBA 1GW3A 3BCCE 2IPPA 3O6QA 2IFNA 1KFMA 1K04A 3CD6P 5KAFE 4DJGA 1KILC 2ZVNB 1CW5A 2FXOA 1VQMP 3C9IA 3L71G 3MHVA 2R5BA 3GHGA 3L4FA 1VQKP 4M3LA 1SP4A 3TDKA 1Q86Q 2JJLA 2E42A 5GTHH 1LP1B 1G2CB 3MIWA 3KDPB 2PGDA 4TLFA 3HUSB 4N3YB 5AVYB 1FAVA 1LJ2A 1ZLLA 3TYYA 1LT9C 3G71P 3B8EB 2ZFCA 5TISE 1RF0C 2QJKB 1T2KD 4ZNCA 3L70J 5KAIE 3WUTA 3B5ND 1MKMA 2OTLP 4JF7A 2M3BA 1N7SA 2E75C 1SQXE 2QEXP 4H0LB 3CMAP 1PV3A 2L91A 2WITA 1M1JB 1KC8Q 5KLVE 2QJPC 3O8ZA 3BRTB 2WT7B 2C0WA 3CX5H 1URQC 5AW9B 1IO4A 1OFCX 3KYQA 1SQVG 2H89C 1JY2O 5KTBA 1SQXD 3FXDA 1R5LA 4NPEA 1MUUA 2O01H 3AE4C 3CCJP 4PV1C 4WY4D 5APUA 5KLVD 1T3JA 1NAYA 4MN4C 5APQA 1PP9D 2ZVOB 1FJPA 3II6A 4JYBA 1BGYE 2LXCB 1A02J 3H1HJ 3B71A 3M06A 3TF5A 1S2EA 1YQ4C 4C46A 3PLNA 1L0LD 3M0AA 3E1IA 1AQ5A 1ZXGA 1X22A 1PGQA 3A3YB 1DIPA 2YXQB 1SQQG 3I5CA 3S4RA 2XV5A 1L2PA 4I2LC 3H25A 1Q81Q 1M1KQ 4JYCA 3G4SP 3CPWO 3K5BA 2E43A 1LTGC 1NTKK 1BGYD 1GTWA 1IZNB 3CMEP 1SQBK 1IFJA 1T2KC 1M7LA 1JO5A 1K73Q 3NTNA 1RE4A 2IBZD 4H13D 4L74A 3HUSC 2HG5D 2NPSB 3I56P 2ITAA 2OTJP 1XTGB 2AXTE 2QJKC 1ZR2A 4IL6E 2P58A 4R4LA 1D7MA 2OYIA 1UIXA 4H0LC 4LLHA 3M91A 1R8EA 1FDIA 1M1JC 5BU8B 4AYCA 3A7OA 2IFMA 2FYUE 1GW4A 1X9VA 3L70G 1AJYA 1VQ7P 1NHLA 4WY4C 4A7PA 1N73B 1JY2N 2Z5IA 3TSIA 3D70A 4Y28J 1JNMA 1IFIA 1QL2A 3L72E 2JEEA 3HTKA 3AE9C 3FXEA 4RESB 1DEEG 2FYUD 1CI6A 2FFDB 1E5WA 2DW3A 2QSIA 5AW4B 1LWUB 2OGUA 2IYOA 2QRXA 2Q1KA 1A02F 3RK3E 1JM0A 2QM7A 2YO3A 3LW5H 5KLIB 4ZKPA 2LR2A 3MGNA 3L72D 4EOTA 4N6JA 1MZ9A 4EI2A 2FBWC 3RBXA 3P8MC 1CI6B 4KT0J 2E76D 2KYVA 3RBZA 3V5BA 4CPGA 1VQOP 3U59A 3H1ID 1GL2B 1EZVD 4K3AA 1L0NJ 1PGOA 2YKPA 1BSHA 3RK3D 1JMMA 1MV8A 2RMZA 1NAFA 4YTPC 1GL2D 2C9LY 2W90A 4R4MA 2NPSC 1QVGO 5GTHE 5APVA 3QH9A 5APXA 3JCUE 5CCGC 5CHXA 1NTZK 1M90Q 3BCCJ 2W83C 1LTJB 3UIAA 2W6AA 1NTME 4DZOA 3B4SA 1KV4A 1GK6A 3CL3D 3I55P 4RJTA 1QX8A 3L35A 3H32B 3LIDA 1NOHA 5KJ7D 2OYOA 4YXDC 5B5EH 2QJYB 3V2PA 1RF1A 1BE3D 3V6IA 1SFCA 1N73C 3CX5E 3CWBE 1H88A 3AEGC 1NTMD 1KB9H 2HYNA 2FFDC 1SQXJ 1KILE 4PD4H 2WSFJ 1S5LH 3HD7A 5BVZA 5KLVJ 4XFJA 5DJUB 2HODB 1FZCB 1NU1K 3KQGA 5KLIC 5M1BA 1PGPA 3CX5D 4KHXA 3CWBD 3CC7P 2BEZF 4HJGH 3AEEC 4BRYB 2Y9YA 2KS1B 3HRNA 1PPJD 3A2AA 1FDOA 3IAOA 2WQYC 2V7QJ 4IFFA 2G3AA 3N7NA 1KILD 1GD2E 3HE5B 1GL2C 1EDLA 2WVRA 3P8CE 1H89A 3RL0D 3U1CA 1KYOE 2N1TB 3MUDA 1BGYJ 1EXJA 4ASWA 1QVFO 4YXWH 3OA7A 4Z1MH 1JMBA 1LTJC 2XZRA 1YITP 1Q7YQ 5KJ7C 3CXHI 2A45G 2FXMA 3FWNA 2E75D 2ZYDA 4B86A 5CCHA 3Q5PA 1L4AB 2BASA 1KYOD 1IC2A 1HF9A 5APTA 5GTIH 4I1LA 1E79H 3V4QA 1YBKA 2B88A 1KQLA 1OMIA 2QJYC 1X8YA 1JY2P 2PRRA 1N7LA 3ITKA 1URQD 1VQ8P 2WPQA 1N2DC 2IX7C 3A5TA 2N9BA 3V2RA 2Z5HA 3KPEA 1PGJA 1Q90D 3D71A 4TT3H 2XNDH 4DCKA 1H0TA 4EDFA 4UB8H 3CCSP 3WMM0 2J59M 2FYUJ 3L73G 1S9KE 1L0NK 1FZCC 2JWAA 2ZJSE 4C7NA 4GODA 2A06E 1SQXG 2XKMA 1S3JA 2AEJA 3B5NA 1Y8AA 2E74B 3E1RA 1VL2A 1ZOYC 2CPBA 1SQPK 3RL0C 3AEBC 5KLVG 2ZAEB 3P7KA 5AW0B 4ASVA 1J2JB 3L72J 1RQUA 1IFPA 3AE6C 1PP9G 5B66H 3CCUP 1OIPA 3O6QB 3HE4A 3PTZA 3WU2H 2PAJA 1RE3A 2WMMA 1S9KD 2W6BA 5AVTB 2WSEJ 3IFMA 1FZBA 1L0LG 3EFGA 1P84I 2A06D 4DOJA 2N1TC 3L73E 2OQQA 1OVVA 4JPZB 3GHGB 1USEA 1M56D 2O1KA 1YQ3C 3BVHA 2FYNC 4C7RA 1LTAC 1KZUB 1AVYA 1BGYG 1VQLP 1KMIZ 1PP9E 4H0LD 2O01N 1L4AC 2WSSH 4D6TE 1WRGA 4HKZH 3A0HH 3L73D 3CLQA 1J1EB 2IBZG 1YJNP 1L0LE 1N7SB 4L76A 4NPFX 3E7KA 2GA1A 4IOIH 1SQXK 2C9NY 2B87A 1IFDA 5AVSB 4AUWA 2LKMA 3RGUA 3AE2C 1JUNA 2GM4A 5B5EE 2IZ1A 3TGUE 2FY8A 2Q6QA 1U7MA 4D6TD 4H44B 3NFQA 1KB9E 1NTMJ 5C39A 1JTHA 2KZJA 2IBZE 1NTKE 3SWKA 4PD4E 5AW1B 1OXZA 4H44D 2W6JH 4PJ0H 3C1LA 3TGUD 3MTUE 1S5LX 2KSJA 2E74C 3L75E 2YKOA 2FYUG 3CWBJ 1KB9D 3ABVC 2JWDA 2FYZA 2QE7H 5H2FH 2K9YA 1NTKD 1SQVK 2BEQD 1SQBD 1YI2P 4PD4D 1JOCA
chains in the Genus database with same CATH topology
3CX5I 1NTMJ 4PD4I 1SQXJ 3L72J 3L75J 3L71J 1SQQJ 4D6TJ 1NTKJ 3TGUJ 1NU1J 3CWBJ 1L0NJ 1SQBJ 3CXHI 1L0LJ 3H1JJ 4U3FJ 5KLVJ 1BGYJ 1EZVI 1KB9I 3H1LJ 1BCCJ 3H1HJ 1BE3J 3BCCJ 3L74J 3L70J 1P84I 3H1IJ 3L73J 2IBZI 1NTZJ 1PP9J 2BCCJ 1SQPJ 1SQVJ 2FYUJ 3H1KJ 1KYOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CX5 I;  1NTM J;  4PD4 I;  1SQX J;  3L72 J;  3L75 J;  3L71 J;  1SQQ J;  4D6T J;  1NTK J;  3TGU J;  1NU1 J;  3CWB J;  1L0N J;  1SQB J;  3CXH I;  1L0L J;  3H1J J;  4U3F J;  5KLV J;  1BGY J;  1EZV I;  1KB9 I;  3H1L J;  1BCC J;  3H1H J;  1BE3 J;  3BCC J;  3L74 J;  3L70 J;  1P84 I;  3H1I J;  3L73 J;  2IBZ I;  1NTZ J;  1PP9 J;  2BCC J;  1SQP J;  1SQV J;  2FYU J;  3H1K J;  1KYO I; 
#chains in the Genus database with same CATH topology
 2KNC A;  3ZDM A;  3AE8 C;  2O01 J;  3L36 A;  1J1D B;  2QVA A;  3L72 G;  4BWN A;  4L75 A;  3GHG C;  1VDF A;  3L75 D;  2GUV A;  3CCQ P;  3TNU A;  2R5D A;  2Q5U A;  2NPS D;  1JY3 P;  1IJD B;  1EDI A;  3RL0 g;  3Q3D A;  5CCG D;  5AVU B;  2WWW A;  3H1I G;  1EZV G;  1BCC D;  3FWL A;  3CCM P;  2Q7C A;  3W68 A;  3LIE A;  1R5S A;  1S4X A;  1J1E C;  2OYI B;  1S1C X;  1N7S C;  1SQQ K;  2WPS A;  2WPR A;  3SWY A;  2XU6 A;  2OYH A;  3BAT A;  1Y47 A;  5GTI E;  3M9Q A;  3CCL P;  3CI9 A;  4GOE A;  1M8O B;  1EXI A;  3KHU A;  3TK1 A;  1GU4 A;  3H1I E;  1EZV E;  4GOF A;  2KXP B;  4U3F D;  2RN0 A;  2OTK E;  4H44 C;  2WPV B;  3HTK B;  1LTS C;  1DX7 A;  2ZXE B;  3T97 A;  1HH0 A;  1BE3 G;  1K9M Q;  4N78 E;  2J5U A;  1NTM G;  3P32 A;  4HH2 A;  4XA4 A;  2WSC H;  3OJA B;  3R2P A;  1FDM A;  2P67 A;  3USS A;  1NWQ A;  1G1I A;  2D2C B;  5TIS H;  5CMZ A;  3T97 B;  1N8R Q;  5KAI H;  2MKV A;  3M0D A;  4N78 D;  1LTI C;  1YYC A;  3VP8 A;  3WU2 E;  3CWB G;  1J1D C;  1BE3 E;  3H1J G;  3L74 E;  1N86 A;  3L37 A;  1HGZ A;  2RH0 A;  3GW6 A;  1JEK A;  4AQR D;  1IFM A;  1FZF A;  1PPJ G;  1KOR A;  1LTT C;  2RKL A;  2V4H A;  1NTZ D;  2ZYA A;  1WT6 A;  1RE4 C;  3LW5 J;  2Q9I A;  3OAK A;  2K9J A;  2K37 A;  2QM8 A;  5AVX B;  1HUC A;  2V7Q H;  3L74 D;  4GT1 A;  2OYI C;  3MD0 A;  1JCC A;  3H1J E;  4JBZ A;  3A0H E;  1T8Z A;  1W2E A;  3EWK A;  3A0B H;  3L73 J;  1GU5 A;  1PPJ E;  4U7J A;  1NU1 E;  2CK3 H;  3H1H D;  2E5Y A;  1KIL A;  1K8A Q;  5AVR B;  1LWU C;  1QL1 A;  1RF1 B;  1SFC B;  4GKG A;  5E79 H;  1PP9 J;  2ZT9 B;  3AEF C;  2B89 A;  1FS0 E;  4UB6 H;  3H1J D;  1KFN A;  4D6T J;  2XDJ A;  2Y0E A;  3W67 A;  1U7J A;  2KK7 A;  2FKW B;  1L0L J;  1NU1 D;  1LT9 A;  1IK7 A;  2OAR A;  5APY A;  2H43 A;  1VF5 B;  1IFN A;  1RF0 A;  3HD7 B;  2I1K A;  2G8Y A;  1VQP P;  1GMJ A;  2HFE D;  4OGQ B;  1LT1 A;  1ZME C;  4PJ0 E;  3IF4 A;  3TGU J;  3NMD A;  2D2C C;  2AXT H;  5H2F E;  3H1K E;  2QG4 A;  1NTK J;  1URQ A;  4NPD A;  2N1T D;  4XE5 B;  3AED C;  2HPC A;  4HB1 A;  3H1L E;  4EIJ A;  2YMK A;  3M9B A;  3AE7 C;  3PHL A;  1SVF A;  5KKZ B;  2YNY A;  3L75 J;  2K88 A;  1FJK A;  5DJT B;  1YTZ T;  4HYT B;  4ZKU A;  3CXH H;  3H1K D;  1PL5 A;  1DD3 A;  1L4A D;  2A06 G;  2P10 A;  3G9R A;  1BCC J;  1USD A;  1CSB A;  4GIF A;  2KOG A;  2M5A A;  3VP9 A;  2GUS A;  2Q3I A;  2BCC E;  2KP8 A;  1GZL A;  3CC4 P;  4IFD K;  3H1L D;  1RQV A;  2M3E A;  2IZ0 A;  5CJ0 A;  1MFT A;  2WSE H;  2K1A A;  1W5C E;  1OW8 A;  1FOS E;  1RHZ B;  3KZI H;  1M57 D;  2Q3E A;  2KZI A;  2PP6 A;  1SQP E;  1RF1 C;  1SFC C;  1X0T A;  1DD4 A;  1ZV8 A;  2ZT9 C;  1YJ9 P;  2HLO A;  3H6P A;  2BCC D;  4DT0 A;  4U3F J;  1VQ9 P;  3FX0 A;  1LP1 A;  1G2C A;  2YMY A;  3HUS A;  4WBA A;  1L0N D;  1IK9 A;  1HGV A;  5AVW B;  1H0T B;  1VF5 C;  3HD7 C;  2P1J A;  1HBW A;  2E74 D;  4OGQ C;  1SQP D;  3IN6 A;  4D6T G;  4C7N B;  4IFM A;  3H1I J;  2R32 A;  1M1J A;  1HJ0 A;  3QWO C;  3B5N B;  2E5T A;  3V2Q A;  3SSU A;  3JCU H;  3EFF K;  3U1A A;  3BCC D;  1FZA A;  3BAS A;  2WT7 A;  1FZG A;  3PJS K;  3TGU G;  4WY4 A;  2K3R A;  3HE4 B;  4KJM A;  2ZYG A;  1P84 H;  3AEC C;  3SWF A;  3CX5 I;  2I1J A;  3L71 E;  1QGK B;  1VQ6 P;  5KKZ C;  3MUD C;  2B9B A;  2JDI H;  5APW A;  1FC2 C;  2R44 A;  3BRV B;  3SFD C;  1NTK G;  1AQT A;  1WMK A;  2JP3 A;  1SQB G;  1FE6 A;  1NTZ J;  5AVV B;  4WY4 B;  5BU5 A;  2KSE A;  1PZQ A;  4L73 A;  3L75 G;  5KLV K;  1N7S D;  3M9H A;  1VPC A;  2W8Z A;  5CCH C;  2MJZ A;  1OZH A;  3L71 D;  1BE3 J;  3VMA A;  3L74 J;  1Z56 A;  4OH8 B;  3R4Y A;  3VTP C;  2M8R A;  1BCC G;  2Y0D A;  3A0B E;  1PIX A;  1L0L K;  1ZP0 C;  1KQG B;  1TU3 F;  4I6M C;  2B87 B;  1SQB E;  1OWA A;  3V2N A;  1S5L E;  1HWT C;  2QIW A;  1BDC A;  1SQV E;  1KYO I;  2O3J A;  2IYP A;  3JSV C;  5E79 E;  2AEM A;  4UB6 E;  2NPS A;  3IR9 A;  3PH0 A;  2KB7 P;  3H1J J;  2KUB A;  5CCG A;  1JTH B;  1EC5 A;  3CCV P;  5CBN A;  1BCC E;  4H13 B;  2H88 C;  1FZE A;  4U3F G;  2O1J A;  3VMY A;  1NU1 J;  3MZW B;  3KXD A;  1KYO H;  2JKV A;  3V4W A;  3Q5S A;  3C8V A;  4LGD E;  3S1K A;  1JCD A;  3AE1 C;  3B5N C;  1SQV D;  2L5G B;  2WZ7 A;  3GG2 A;  1KQF B;  1NKN A;  2I8D A;  5AVZ B;  5TJH A;  5AW5 B;  1AV1 A;  4W7Y A;  3GF3 A;  1OW6 A;  2CPS A;  1SQQ E;  1N73 A;  2Y9Z A;  1Y9B A;  1RE3 C;  2KI7 B;  3WUV A;  2KNC B;  2XNX A;  4IL6 X;  4U3F E;  1HTL C;  2A45 I;  3SFE C;  4WWI A;  1JB0 J;  2FFD A;  3TNU B;  2JR8 A;  1CZQ A;  1NVO A;  1LWU A;  2R3C A;  1SLQ A;  1LTB C;  5AW6 B;  2P2U A;  4OWF A;  1NYH A;  3PP5 A;  1SQQ D;  1U57 A;  3CXH E;  2FYU K;  1AA0 A;  2A45 H;  3H1K J;  3VOP A;  3CCE P;  3VMZ A;  1ZRT E;  1NTZ G;  3G3Z A;  1GDT A;  1EQ7 A;  4RKU J;  3H1L J;  1K05 A;  2Y0C A;  5KAF H;  3L70 E;  3KZI E;  1GK4 A;  1GL2 A;  2OYH B;  1FU1 A;  3L74 G;  2E76 B;  4UB8 E;  3CXH D;  1ZN5 A;  3GMA A;  3EQ2 A;  5CBO A;  1ZRT D;  3RK3 B;  4JQ0 D;  2BCC J;  3H1H G;  1NTZ E;  1ZR4 A;  1T6A A;  1YHQ P;  3S9O A;  2W27 A;  5AW7 B;  4H13 C;  2Z4E A;  4QMA A;  4EYY Q;  1LTJ A;  3L70 D;  5KJ7 A;  5B66 E;  3FGA D;  1HJB A;  4W7Z A;  1RH5 B;  1LNQ A;  3G6E P;  1KTM A;  2WSF H;  1T3U A;  1SQP J;  2YIU B;  3RK2 B;  3D6Z A;  2D2C D;  2POH A;  3F5H A;  3H32 A;  1NU1 G;  1LGH B;  1Q2N A;  1G1J A;  1JY3 O;  3H1H E;  1DH3 A;  5EFW B;  1ZW0 A;  3RK2 D;  1YIJ P;  1BSN A;  4I7Z B;  1P84 E;  4K35 A;  1SS1 A;  2NRG A;  2M0B A;  2UWJ E;  1KB9 I;  2H8P D;  2AXC A;  1OVU A;  1QLE D;  4O9B A;  2IBZ I;  1NTM K;  1EDJ A;  4Y99 B;  4PD4 I;  2WSC J;  3AE3 C;  2HOD A;  1FZC A;  2K9J B;  5AW3 B;  1VQN P;  2YO2 A;  2R3S A;  2VRS A;  1P84 D;  3PRJ A;  2H7H A;  4BRY A;  1QEX A;  1VQ5 P;  2KS1 A;  2KLV A;  3N4X A;  3L71 J;  3HE5 A;  1W2B O;  3H1K G;  3JC2 2;  2OYH C;  3F89 A;  5AVQ B;  1SFC D;  2E76 C;  1NH4 A;  1KIL B;  2J58 A;  2ZT9 D;  3H1L G;  1OVR A;  2N1T A;  1NJI Q;  2PFX A;  3AEA C;  2C0X A;  3RK3 C;  1Q82 Q;  1YJW P;  2NZ2 A;  3RL0 B;  1MFZ A;  3Q2Y A;  1VF5 D;  3HD7 D;  2YKQ A;  2KIK A;  1EDK A;  5APS A;  4LC1 A;  1UII A;  3WUU A;  3VMX A;  2N9Y B;  1OW7 A;  4OGQ D;  1PFI A;  1FOS F;  1HVV A;  4IL6 H;  5CJ4 A;  1LT9 B;  3NXS A;  4YPC A;  5K5G B;  1RY3 A;  4W80 A;  1BDD A;  1L4A A;  2BCC G;  1AFO A;  3AE5 C;  2P7J A;  1SQB J;  2YIU C;  3RK2 C;  2WTY A;  5L8R J;  2E75 B;  3GF7 A;  2IDB A;  1YTZ I;  1L0N G;  2KLU A;  4RO0 A;  1XTC C;  4WB4 A;  1NKZ B;  2FYN B;  1JY3 N;  1SQV J;  2YXR B;  5AW2 B;  3MP7 B;  1KD1 Q;  2QJP B;  1NO4 A;  2JO1 A;  1SQP G;  3Q5R A;  1NGM B;  3VYI A;  3P8C D;  3M0D C;  4I7Z C;  1EZV I;  2QA4 P;  3GLM A;  2HR3 A;  1URQ B;  2SPZ A;  1AVO A;  1FBM A;  3VN0 A;  3BCC G;  1X79 B;  2HPC B;  5AW8 B;  3Q1M A;  4ZMD A;  2ZXX A;  3OW2 O;  1L0N E;  4PV1 B;  4Y99 C;  4GDO A;  2FXP A;  1S72 P;  4OVN F;  1OX3 A;  1KN7 A;  5CCH D;  1VQ4 P;  2LXB A;  1SQQ J;  4PV1 D;  2M5A B;  2AEF A;  3D6Y A;  1KQS O;  4WVZ A;  4BXL A;  1H8A A;  3CCR P;  3CC2 P;  1DEB A;  1GW3 A;  3BCC E;  2IPP A;  3O6Q A;  2IFN A;  1KFM A;  1K04 A;  3CD6 P;  5KAF E;  4DJG A;  1KIL C;  2ZVN B;  1CW5 A;  2FXO A;  1VQM P;  3C9I A;  3L71 G;  3MHV A;  2R5B A;  3GHG A;  3L4F A;  1VQK P;  4M3L A;  1SP4 A;  3TDK A;  1Q86 Q;  2JJL A;  2E42 A;  5GTH H;  1LP1 B;  1G2C B;  3MIW A;  3KDP B;  2PGD A;  4TLF A;  3HUS B;  4N3Y B;  5AVY B;  1FAV A;  1LJ2 A;  1ZLL A;  3TYY A;  1LT9 C;  3G71 P;  3B8E B;  2ZFC A;  5TIS E;  1RF0 C;  2QJK B;  1T2K D;  4ZNC A;  3L70 J;  5KAI E;  3WUT A;  3B5N D;  1MKM A;  2OTL P;  4JF7 A;  2M3B A;  1N7S A;  2E75 C;  1SQX E;  2QEX P;  4H0L B;  3CMA P;  1PV3 A;  2L91 A;  2WIT A;  1M1J B;  1KC8 Q;  5KLV E;  2QJP C;  3O8Z A;  3BRT B;  2WT7 B;  2C0W A;  3CX5 H;  1URQ C;  5AW9 B;  1IO4 A;  1OFC X;  3KYQ A;  1SQV G;  2H89 C;  1JY2 O;  5KTB A;  1SQX D;  3FXD A;  1R5L A;  4NPE A;  1MUU A;  2O01 H;  3AE4 C;  3CCJ P;  4PV1 C;  4WY4 D;  5APU A;  5KLV D;  1T3J A;  1NAY A;  4MN4 C;  5APQ A;  1PP9 D;  2ZVO B;  1FJP A;  3II6 A;  4JYB A;  1BGY E;  2LXC B;  1A02 J;  3H1H J;  3B71 A;  3M06 A;  3TF5 A;  1S2E A;  1YQ4 C;  4C46 A;  3PLN A;  1L0L D;  3M0A A;  3E1I A;  1AQ5 A;  1ZXG A;  1X22 A;  1PGQ A;  3A3Y B;  1DIP A;  2YXQ B;  1SQQ G;  3I5C A;  3S4R A;  2XV5 A;  1L2P A;  4I2L C;  3H25 A;  1Q81 Q;  1M1K Q;  4JYC A;  3G4S P;  3CPW O;  3K5B A;  2E43 A;  1LTG C;  1NTK K;  1BGY D;  1GTW A;  1IZN B;  3CME P;  1SQB K;  1IFJ A;  1T2K C;  1M7L A;  1JO5 A;  1K73 Q;  3NTN A;  1RE4 A;  2IBZ D;  4H13 D;  4L74 A;  3HUS C;  2HG5 D;  2NPS B;  3I56 P;  2ITA A;  2OTJ P;  1XTG B;  2AXT E;  2QJK C;  1ZR2 A;  4IL6 E;  2P58 A;  4R4L A;  1D7M A;  2OYI A;  1UIX A;  4H0L C;  4LLH A;  3M91 A;  1R8E A;  1FDI A;  1M1J C;  5BU8 B;  4AYC A;  3A7O A;  2IFM A;  2FYU E;  1GW4 A;  1X9V A;  3L70 G;  1AJY A;  1VQ7 P;  1NHL A;  4WY4 C;  4A7P A;  1N73 B;  1JY2 N;  2Z5I A;  3TSI A;  3D70 A;  4Y28 J;  1JNM A;  1IFI A;  1QL2 A;  3L72 E;  2JEE A;  3HTK A;  3AE9 C;  3FXE A;  4RES B;  1DEE G;  2FYU D;  1CI6 A;  2FFD B;  1E5W A;  2DW3 A;  2QSI A;  5AW4 B;  1LWU B;  2OGU A;  2IYO A;  2QRX A;  2Q1K A;  1A02 F;  3RK3 E;  1JM0 A;  2QM7 A;  2YO3 A;  3LW5 H;  5KLI B;  4ZKP A;  2LR2 A;  3MGN A;  3L72 D;  4EOT A;  4N6J A;  1MZ9 A;  4EI2 A;  2FBW C;  3RBX A;  3P8M C;  1CI6 B;  4KT0 J;  2E76 D;  2KYV A;  3RBZ A;  3V5B A;  4CPG A;  1VQO P;  3U59 A;  3H1I D;  1GL2 B;  1EZV D;  4K3A A;  1L0N J;  1PGO A;  2YKP A;  1BSH A;  3RK3 D;  1JMM A;  1MV8 A;  2RMZ A;  1NAF A;  4YTP C;  1GL2 D;  2C9L Y;  2W90 A;  4R4M A;  2NPS C;  1QVG O;  5GTH E;  5APV A;  3QH9 A;  5APX A;  3JCU E;  5CCG C;  5CHX A;  1NTZ K;  1M90 Q;  3BCC J;  2W83 C;  1LTJ B;  3UIA A;  2W6A A;  1NTM E;  4DZO A;  3B4S A;  1KV4 A;  1GK6 A;  3CL3 D;  3I55 P;  4RJT A;  1QX8 A;  3L35 A;  3H32 B;  3LID A;  1NOH A;  5KJ7 D;  2OYO A;  4YXD C;  5B5E H;  2QJY B;  3V2P A;  1RF1 A;  1BE3 D;  3V6I A;  1SFC A;  1N73 C;  3CX5 E;  3CWB E;  1H88 A;  3AEG C;  1NTM D;  1KB9 H;  2HYN A;  2FFD C;  1SQX J;  1KIL E;  4PD4 H;  2WSF J;  1S5L H;  3HD7 A;  5BVZ A;  5KLV J;  4XFJ A;  5DJU B;  2HOD B;  1FZC B;  1NU1 K;  3KQG A;  5KLI C;  5M1B A;  1PGP A;  3CX5 D;  4KHX A;  3CWB D;  3CC7 P;  2BEZ F;  4HJG H;  3AEE C;  4BRY B;  2Y9Y A;  2KS1 B;  3HRN A;  1PPJ D;  3A2A A;  1FDO A;  3IAO A;  2WQY C;  2V7Q J;  4IFF A;  2G3A A;  3N7N A;  1KIL D;  1GD2 E;  3HE5 B;  1GL2 C;  1EDL A;  2WVR A;  3P8C E;  1H89 A;  3RL0 D;  3U1C A;  1KYO E;  2N1T B;  3MUD A;  1BGY J;  1EXJ A;  4ASW A;  1QVF O;  4YXW H;  3OA7 A;  4Z1M H;  1JMB A;  1LTJ C;  2XZR A;  1YIT P;  1Q7Y Q;  5KJ7 C;  3CXH I;  2A45 G;  2FXM A;  3FWN A;  2E75 D;  2ZYD A;  4B86 A;  5CCH A;  3Q5P A;  1L4A B;  2BAS A;  1KYO D;  1IC2 A;  1HF9 A;  5APT A;  5GTI H;  4I1L A;  1E79 H;  3V4Q A;  1YBK A;  2B88 A;  1KQL A;  1OMI A;  2QJY C;  1X8Y A;  1JY2 P;  2PRR A;  1N7L A;  3ITK A;  1URQ D;  1VQ8 P;  2WPQ A;  1N2D C;  2IX7 C;  3A5T A;  2N9B A;  3V2R A;  2Z5H A;  3KPE A;  1PGJ A;  1Q90 D;  3D71 A;  4TT3 H;  2XND H;  4DCK A;  1H0T A;  4EDF A;  4UB8 H;  3CCS P;  3WMM 0;  2J59 M;  2FYU J;  3L73 G;  1S9K E;  1L0N K;  1FZC C;  2JWA A;  2ZJS E;  4C7N A;  4GOD A;  2A06 E;  1SQX G;  2XKM A;  1S3J A;  2AEJ A;  3B5N A;  1Y8A A;  2E74 B;  3E1R A;  1VL2 A;  1ZOY C;  2CPB A;  1SQP K;  3RL0 C;  3AEB C;  5KLV G;  2ZAE B;  3P7K A;  5AW0 B;  4ASV A;  1J2J B;  3L72 J;  1RQU A;  1IFP A;  3AE6 C;  1PP9 G;  5B66 H;  3CCU P;  1OIP A;  3O6Q B;  3HE4 A;  3PTZ A;  3WU2 H;  2PAJ A;  1RE3 A;  2WMM A;  1S9K D;  2W6B A;  5AVT B;  2WSE J;  3IFM A;  1FZB A;  1L0L G;  3EFG A;  1P84 I;  2A06 D;  4DOJ A;  2N1T C;  3L73 E;  2OQQ A;  1OVV A;  4JPZ B;  3GHG B;  1USE A;  1M56 D;  2O1K A;  1YQ3 C;  3BVH A;  2FYN C;  4C7R A;  1LTA C;  1KZU B;  1AVY A;  1BGY G;  1VQL P;  1KMI Z;  1PP9 E;  4H0L D;  2O01 N;  1L4A C;  2WSS H;  4D6T E;  1WRG A;  4HKZ H;  3A0H H;  3L73 D;  3CLQ A;  1J1E B;  2IBZ G;  1YJN P;  1L0L E;  1N7S B;  4L76 A;  4NPF X;  3E7K A;  2GA1 A;  4IOI H;  1SQX K;  2C9N Y;  2B87 A;  1IFD A;  5AVS B;  4AUW A;  2LKM A;  3RGU A;  3AE2 C;  1JUN A;  2GM4 A;  5B5E E;  2IZ1 A;  3TGU E;  2FY8 A;  2Q6Q A;  1U7M A;  4D6T D;  4H44 B;  3NFQ A;  1KB9 E;  1NTM J;  5C39 A;  1JTH A;  2KZJ A;  2IBZ E;  1NTK E;  3SWK A;  4PD4 E;  5AW1 B;  1OXZ A;  4H44 D;  2W6J H;  4PJ0 H;  3C1L A;  3TGU D;  3MTU E;  1S5L X;  2KSJ A;  2E74 C;  3L75 E;  2YKO A;  2FYU G;  3CWB J;  1KB9 D;  3ABV C;  2JWD A;  2FYZ A;  2QE7 H;  5H2F H;  2K9Y A;  1NTK D;  1SQV K;  2BEQ D;  1SQB D;  1YI2 P;  4PD4 D;  1JOC A; 
#chains in the Genus database with same CATH homology
 3CX5 I;  1NTM J;  4PD4 I;  1SQX J;  3L72 J;  3L75 J;  3L71 J;  1SQQ J;  4D6T J;  1NTK J;  3TGU J;  1NU1 J;  3CWB J;  1L0N J;  1SQB J;  3CXH I;  1L0L J;  3H1J J;  4U3F J;  5KLV J;  1BGY J;  1EZV I;  1KB9 I;  3H1L J;  1BCC J;  3H1H J;  1BE3 J;  3BCC J;  3L74 J;  3L70 J;  1P84 I;  3H1I J;  3L73 J;  2IBZ I;  1NTZ J;  1PP9 J;  2BCC J;  1SQP J;  1SQV J;  2FYU J;  3H1K J;  1KYO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...