4M3LA

Crystal structure of the coiled coil domain of murf1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
60
structure length
60
Chain Sequence
b'GAMDTLYAILDEKKSELLQRITQEQEEKLSFIEALIQQYQEQLDKSTKLVETAIQSLDEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase TRIM63
publication title Molecular basis for the fold organization and sarcomeric targeting of the muscle atrogin MuRF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 27
structure length 60
sequence length 60
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4m3lA00
3HE4A 1OWAA 1NAFA 5AW3B 5APSA 2WTYA 5APVA 4C46A 5CMZA 3UIAA 3L35A 1GTWA 2E42A 5AW6B 3TNUB 3V4QA 1SP4A 1GU5A 2WPRA 2XU6A 3KQGA 1HUCA 3A2AA 2R3CA 3MGNA 3M9BA 3M0DA 2WPQA 3NTNA 1JNMA 1H8AA 3M0AA 2YO2A 1CI6B 2YNYA 2Q7CA 4JYCA 3M06A 5AW7B 3HTKA 1A02F 4AYCA 5AVXB 5AW4B 5AVTB 3VMXA 2R32A 3I5CA 3P8MC 3VYIA 5AW5B 2ZXEB 2R5BA 1FOSE 1GZLA 5APWA 1HJBA 2BASA 1H89A 2R5DA 3A3YB 5AW0B 2Z5IA 5AVUB 2Q5UA 2WPSA 2P67A 3MD0A 3IR9A 3TNUA 1T2KD 1KQLA 2C9LY 3M91A 4LC1A 1GK6A 3TYYA 1YYCA 1J2JB 5AVYB 5APYA 2C9NY 1G2CB 1CI6A 4B86A 5AW1B 3VN0A 3P7KA 3LIEA 5APXA 5AW9B 5AW8B 1FOSF 1S9KE 4GKGA 3VMZA 3A7OA 2E43A 4C7NB 2XZRA 1HBWA 4XE5B 1MFZA 1JUNA 2JJLA 2VRSA 2W27A 2QM8A 3B8EB 1FAVA 3O8ZA 3P32A 2XV5A 4AQRD 1H88A 1IO4A 3L36A 1HWTC 4DZOA 3LIDA 2H7HA 3HE4B 4KHXA 3SWFA 1DH3A 4I6MC 1A02J 3KDPB 2IPPA 3HE5B 5APTA 5AVQB 5AVVB 4EOTA 2ZFCA 1MUUA 1NWQA 2P2UA 5AW2B 2WT7B 2YO3A 4M3LA 1SLQA 1CSBA 1X8YA 3HE5A 2KP8A 2W6AA 5AVWB 1T2KC 4JYBA 1MV8A 1OXZA 4I2LC 4AUWA 2Q3IA 3T97A 3VMYA 2WT7A 3V4WA 5APQA 2P7JA 5AVSB 5AVRB 3VTPC 3V5BA 1CZQA 3NFQA 2WWWA 1GD2E 4GT1A 3TK1A 1GK4A 2N9BA 1S9KD 2Z5HA 3NXSA 1GU4A 5APUA 4C7NA 3M9HA 5AVZB 4HYTB 3A5TA 2QM7A 3OAKA 3L37A 3NMDA 4RESB
chains in the Genus database with same CATH superfamily
2G3AA 3H1JG 2E75C 3A0HE 4U3FJ 2PFXA 2BEQD 5E79H 1GTWA 2KI7B 3AE6C 3KQGA 2BCCD 3L4FA 1H8AA 1KTMA 3ITKA 2D2CD 3M06A 1SQVK 1VF5D 2KZJA 1BGYE 1SQVD 2MKVA 1M56D 1SQPE 1KORA 3D6ZA 2A06D 1JCDA 2ZXEB 2R5BA 2GM4A 3IN6A 1FZAA 1N86A 1HJBA 2A45I 3QH9A 2R5DA 3MD0A 1NTKJ 4L73A 2Q9IA 3Q1MA 1D7MA 1NKZB 3S9OA 1LTJA 5CBOA 3H1IJ 5AW9B 3AEBC 5GTHE 3A7OA 2Y0EA 2O1JA 2IZ0A 4EYYQ 2IFNA 1XTCC 3P32A 1QVFO 3BRVB 2JEEA 1JY3O 2WSEH 3AEEC 2ZFCA 4M3LA 4CPGA 1IC2A 5E79E 1HF9A 5AVSB 4PV1C 1BDDA 1FZGA 3CC4P 2KLUA 4U3FD 4D6TD 2KNCA 1PGOA 2OTLP 1NTZG 1LTIC 4JF7A 3SWKA 1MZ9A 2GUVA 1W5CE 4DCKA 1HUCA 1ZRTD 2W83C 1NVOA 4PV1B 5CCGD 3BCCE 2K9YA 1VDFA 5CHXA 4OGQC 2B9BA 1KYOI 2I1KA 4WY4D 2WSSH 1S72P 5AW5B 1JOCA 3CWBG 2ZT9C 1RH5B 2K9JB 3K5BA 4PD4I 1N7LA 2QVAA 2QEXP 2P67A 1OVUA 2C9LY 3H1ID 1OIPA 1YYCA 1YJNP 1G2CB 1Q7YQ 3PRJA 1Y9BA 5AW1B 4OGQB 3IF4A 3VP9A 2ZYGA 4GKGA 1IFDA 1G2CA 2ZT9B 1PFIA 3FXDA 2JJLA 1EXJA 1AQTA 2XV5A 1L4AB 1LT9A 1HVVA 4I6MC 4W80A 3WUVA 2YKOA 2ZYDA 2NPSD 2WT7B 4BRYB 2LXBA 1T2KC 2D2CC 3RBZA 2WT7A 4BRYA 3P8CD 4H44B 2O01J 1GK4A 3L75G 3HD7A 2YMYA 1S4XA 2YIUC 1E79H 4I7ZB 2WSFH 2BCCE 2NZ2A 2D2CB 3V2NA 3JCUH 2E42A 3H25A 4Y28J 1VF5B 3MGNA 1P84I 4L74A 2YO2A 1CI6B 1SQVE 4L75A 3AEAC 2HODB 5AW4B 1SFCC 1BE3E 2YIUB 2K1AA 4GODA 2YKQA 3P8MC 1K8AQ 2HODA 3MUDC 2W6BA 5KLVG 3VP8A 1EC5A 3TGUE 2Z5IA 3RK2C 2FYUK 3RK3C 1OVRA 1JO5A 2PRRA 2FYUD 2O1KA 1SFCB 2A45G 3QWOC 1L0LG 3N7NA 1FJKA 3CCSP 2QJPC 1HJ0A 4XE5B 1LTTC 3CD6P 3L36A 3RK2B 1K04A 2IPPA 3RK3B 5H2FH 1SQBG 3RK3E 5KTBA 4H0LD 3H1LJ 1KZUB 5CCGC 4ZMDA 1HGVA 3JCUE 1PPJG 4D6TE 3V4WA 5BU8B 2Y9ZA 2OTJP 2QJPB 1SS1A 4EDFA 2WWWA 4R4MA 1X79B 2K37A 1PGJA 3FWNA 1JCCA 2FXOA 3H1HD 4W7ZA 1VQPP 4EI2A 1L0NK 4UB6H 5EFWB 2CK3H 3UIAA 2KLVA 2XU6A 1URQD 1S1CX 2R3CA 3W68A 3TF5A 1NOHA 1NU1K 1BCCJ 2BEZF 3A0BH 3H1KG 5TISH 5CJ0A 1NU1D 1HH0A 4WY4A 3I5CA 1W2EA 4Y99C 1GZLA 1RQUA 2FYNC 1YTZT 1JY2N 1VQ6P 3IR9A 5H2FE 3LW5H 4B86A 1AVYA 3VN0A 2A06G 5APXA 1M90Q 1T6AA 2ITAA 4Y99B 3FX0A 4W7YA 1BGYD 1SQPK 1OX3A 3KXDA 1FDIA 3BCCJ 3B8EB 2E75D 1SQPD 4JQ0D 3L72D 2XNDH 1DH3A 1Y8AA 2NPSA 1IZNB 1FZCC 3KPEA 3P8CE 3L73E 4UB6E 1VL2A 2LKMA 1GW4A 1MV8A 4I2LC 5CCHC 1UIXA 3R4YA 1SQXG 1AJYA 1EDKA 1NTME 1JTHB 4U7JA 2WSEJ 3GG2A 3L74E 2FFDA 3CL3D 3A0BE 3HE4A 3ZDMA 3TNUB 3V4QA 1R8EA 3L71D 4OVNF 3H1JE 4U3FG 3RL0g 4AYCA 3G71P 1YQ3C 5BU5A 1FBMA 4RKUJ 1ZP0C 5B5EH 2BCCJ 2L5GB 4PV1D 2OYIB 3P7KA 4L76A 1EXIA 4ASVA 1NHLA 3II6A 2OYIA 1NTKG 1LTBC 2XDJA 1SQVJ 4H0LB 2PP6A 4N6JA 3H1IG 3HE5B 2B88A 1N73C 3L70D 4RJTA 5DJUB 3HE5A 1RE4C 1N2DC 3TGUJ 1LWUA 3GHGB 4GOFA 1YQ4C 5APQA 4KJMA 4OGQD 3GHGA 2KXPB 2N9BA 5GTIH 2AEJA 2ZT9D 1L0NE 1M8OB 4LGDE 1ZOYC 5AW3B 1U7MA 3V2RA 3HUSC 1ZW0A 3D70A 1URQA 1NTZE 2Y0DA 3AE2C 3M0DA 2WPQA 1NU1E 3S1KA 2LXCB 2AXCA 2WSFJ 1KV4A 3SWYA 2UWJE 2W90A 4D6TJ 1FE6A 3AE3C 1XTGB 3A3YB 5AW0B 2HPCB 3CCQP 3TDKA 3U59A 2RH0A 1T2KD 1KQLA 5BVZA 1SQQK 5APYA 1YIJP 1PP9D 2E75B 2JWDA 1ZR2A 1BSNA 3L72E 1YI2P 4QMAA 2E43A 2QSIA 1BE3D 3G9RA 3B71A 4N3YB 2B89A 5GTIE 3FWLA 3TGUD 3CMAP 2IBZE 3C8VA 1LTAC 1AV1A 2FBWC 3AEGC 3V5BA 1T3JA 1SFCD 2JKVA 1E5WA 3B5NC 2ZVNB 1LP1B 1Q2NA 4GIFA 3CCJP 3BATA 3FGAD 1OW7A 1OWAA 4XFJA 3RK2D 3L71E 1T3UA 3RK3D 3KZIE 3D6YA 5KJ7C 1M1JC 3E1RA 1GW3A 2YXQB 2OARA 3B5NB 1IJDB 3L73J 2AEMA 1IFIA 1JMMA 3CCLP 1N7SC 3L74J 4TLFA 1DIPA 1AQ5A 2E5TA 4IFDK 1OVVA 3I55P 3B4SA 1J2JB 1ZV8A 2C9NY 3PJSK 3LIEA 2R3SA 2Q6QA 3E1IA 3V2PA 4C7NB 4RO0A 1N7SB 3L70E 3LIDA 4Z1MH 4KHXA 1T8ZA 2K9JA 3LW5J 4BXLA 2H43A 5AVQB 3CX5D 1Q81Q 1NO4A 2IYOA 3JSVC 2FYUJ 3AE7C 2SPZA 1EDLA 3VTPC 1SQBE 3AECC 3H1LG 2JO1A 2Z5HA 2NRGA 2E76C 3V6IA 1EZVD 3OA7A 3HRNA 1TU3F 4IFMA 1L4AA 1RY3A 5KKZC 3CCMP 1NAFA 1AFOA 4LLHA 2JWAA 4IFFA 3L73D 1KQFB 3M9BA 3M0AA 3G3ZA 2YNYA 1NTMK 1IK9A 1VPCA 1GL2C 1FJPA 1GDTA 2RKLA 1NTMD 2N9YB 2LR2A 1NGMB 3L74D 5KKZB 1FOSE 1BCCG 3H1HJ 1DX7A 3H1KE 3MTUE 2KUBA 2N1TC 2Q5UA 1PP9E 1SQQE 2JP3A 1L0NJ 3M91A 5CCHD 4TT3H 3RBXA 1CI6A 2WSCH 3H1JD 2FKWB 1NYHA 1CW5A 2KYVA 1FOSF 4GOEA 1NU1J 1KYOE 1KILC 2XZRA 1QGKB 2K3RA 1FAVA 1HWTC 3FXEA 3U1AA 1KQSO 1NWQA 1YTZI 3BCCG 2XNXA 1OW6A 3G6EP 1RQVA 5AVRB 1RF1C 1KILB 1SFCA 1KILE 3CX5H 3NXSA 2QJYC 1BGYJ 3CLQA 1SQXE 1H0TB 1SQPJ 3Q5PA 3EFGA 1IFPA 3L72J 2WTYA 1LTSC 1H0TA 1SP4A 1RF1B 4H13C 2QE7H 3RL0D 2OTKE 2QJYB 2M5AB 5KAIH 1A02F 4IL6X 1JB0J 2FXPA 4JBZA 3Q5RA 4R4LA 2KZIA 1QVGO 2M5AA 2KSJA 1L0ND 5CCGA 1M57D 4H13B 3F89A 2OYHC 1YBKA 1NTZK 1IFJA 1NTZD 3T97B 3L71J 1SVFA 1VQKP 1LGHB 2Y0CA 1FZFA 2WPVB 4IL6H 1JUNA 2BCCG 2ZXXA 5C39A 3CX5E 1BSHA 3CCRP 2FYZA 4EOTA 1NTKE 1SQVG 1WMKA 1SLQA 2MJZA 1VQ9P 2WMMA 1JY2P 5TJHA 1FS0E 2M3BA 1EZVE 2I8DA 2FYNB 3GMAA 3TGUG 5KAIE 3BVHA 1QX8A 5DJTB 1YHQP 2QJKC 3GF7A 4OWFA 2FFDC 2XKMA 1Y47A 2IBZD 4DJGA 3L70J 3A2AA 3M9QA 3NTNA 2Q7CA 3W67A 2P1JA 4JYCA 4ZKPA 1KD1Q 2M3EA 2YKPA 1JTHA 5AVTB 1RF0C 4HB1A 1FZCB 2QJKB 1X0TA 4IL6E 5APWA 1S2EA 1FZCA 3U1CA 3TNUA 3L75D 5CCHA 4D6TG 1PL5A 2QA4P 4LC1A 2P58A 1VQMP 1K05A 1Z56A 3GLMA 2H8PD 3B5ND 2Z4EA 3OW2O 2PGDA 4UB8E 1KB9D 3O6QB 5KLIC 4DZOA 3I56P 3SWFA 1ZN5A 3O6QA 2KB7P 5APTA 4WB4A 1J1DC 2B87B 5KJ7D 2P2UA 5AW2B 1JM0A 1X8YA 2W6AA 5KLVK 3RL0C 2C0XA 3WU2E 3VMYA 2H88C 3CCUP 1PP9J 1SQQJ 2YMKA 3KHUA 5KLIB 2OGUA 1IK7A 1PGQA 3CC7P 3OAKA 1LWUC 1BE3J 1N7SD 1J1DB 1QL1A 3IAOA 1L0LK 1BDCA 1S5LX 3AEFC 1G1JA 3GF3A 1NJIQ 1RE3C 3L35A 5AW6B 3RL0B 3CMEP 2K88A 5B66E 1JNMA 3CI9A 2IBZI 1Q86Q 1SQBK 1SQBD 2KS1B 1OMIA 3E7KA 1N73B 3WUUA 2R32A 4NPFX 2KS1A 2O01N 2IX7C 1VQ4P 1VQ8P 2BASA 1PPJD 1S5LH 3L73G 2ZAEB 1RE4A 3MP7B 2WPSA 2CPBA 1M7LA 1USEA 3L74G 2KSEA 1MKMA 4HH2A 2E5YA 2IFMA 3H32B 2E76D 1MFTA 3HUSB 2AEFA 4WWIA 1NKNA 3KZIH 1VQ5P 3HUSA 2OQQA 2GA1A 1LTGC 3C1LA 1JY3N 3CXHE 3KDPB 2WSCJ 3CPWO 2E74D 1PZQA 3H1KD 2P10A 2FXMA 2HPCA 5AVVB 3HD7D 3CWBE 3AE8C 1OW8A 1SQQD 5L8RJ 1KB9H 1QL2A 1OXZA 4ZNCA 5CJ4A 1GL2D 2P7JA 1FDOA 1JY3P 4N78D 4HJGH 4IOIH 1G1IA 1LTJC 2G8YA 3EWKA 2L91A 5AVZB 2WZ7A 4DT0A 1KYOD 1WRGA 2FYUG 2QIWA 2N1TD 4PD4D 5APVA 3H1LE 1LJ2A 3SSUA 5KAFH 1GU5A 1S5LE 2JDIH 1RHZB 2WVRA 3HTKB 1LTJB 2A45H 3Q3DA 3HTKA 1U7JA 2W8ZA 1KILD 1HGZA 3PP5A 1YJ9P 3VMXA 1SQXK 4EIJA 1DD3A 1LP1A 2V7QH 5CBNA 3L75E 1SQXD 4O9BA 1H89A 2J58A 1W2BO 4C7RA 2I1JA 1KMIZ 5AVUB 3PTZA 1QLED 3H1HG 1BCCE 1VQOP 4ASWA 3CC2P 1EQ7A 1KB9E 1KFNA 2C0WA 3B5NA 1KFMA 1VQLP 5AW8B 1S9KE 1L0NG 1NTMJ 3MIWA 3N4XA 2KNCB 1HBWA 2JR8A 4YXWH 2W27A 4AQRD 1M1JB 3V2QA 2CPSA 2V4HA 5KJ7A 1NU1G 1M1JA 3PH0A 1K73Q 5KLVE 4H13D 4PJ0H 1P84D 5KAFE 2HYNA 2Y9YA 3H1JJ 4C7NA 3M9HA 3A5TA 1N7SA 1L0LE 1VQ7P 4XA4A 1R5SA 5APSA 3PLNA 3PHLA 2PAJA 1NTKK 5CMZA 1LT9C 1ZXGA 1NTKD 1BGYG 1KYOH 1L4AC 1SQPG 3L72G 2WQYC 4PD4H 3OJAB 2Q1KA 4YTPC 4BWNA 1PPJE 1FC2C 3VYIA 2IBZG 1LT9B 1R5LA 2E74C 3HD7C 4H44C 3D71A 1X22A 1S3JA 2E76B 4I7ZC 5AVYB 4K3AA 2FY8A 1PV3A 4PJ0E 3AE4C 1VF5C 2E74B 2IDBA 3EFFK 3HD7B 3L71G 1H88A 2IYPA 1HTLC 3VMAA 1GL2B 3AE9C 4N78E 1GL2A 1LT1A 1NTZJ 1YITP 3NFQA 2N1TB 1NH4A 4PD4E 1EDIA 5APUA 2QM7A 3L37A 2A06E 3R2PA 1P84H 2N1TA 2Q3EA 3AEDC 2QRXA 3Q5SA 1FZBA 3CX5I 1VQNP 4A7PA 2DW3A 3WMM0 3USSA 2M8RA 3MUDA 3CWBJ 1KILA 3H6PA 5AW7B 3L70G 2WITA 3BASA 1IFMA 1EZVI 1DEEG 1Q90D 2IZ1A 1ZLLA 1FDMA 1PIXA 1L2PA 1FZEA 1N8RQ 1J1EC 2O3JA 2R44A 3S4RA 3KYQA 1RF1A 1WT6A 2QG4A 3WUTA 4U3FE 1AA0A 2ZVOB 1PGPA 2QM8A 3O8ZA 1J1EB 3MZWB 4WY4C 3CCEP 1P84E 2KK7A 4YPCA 2YO3A 1ZRTE 3L75J 2KP8A 1KQGB 3BRTB 1DEBA 3GW6A 2Q3IA 3T97A 2YXRB 2M0BA 2KIKA 1CZQA 1GD2E 4GT1A 4WY4B 2OYHB 4NPDA 1PP9G 1SQQG 2GUSA 2OYHA 3CXHD 1FU1A 1U57A 3CWBD 3H1IE 1OFCX 2WPRA 2NPSC 1BE3G 4UB8H 3JC22 3ABVC 3Q2YA 5KLVJ 2HLOA 4OH8B 1AVOA 3MHVA 1EDJA 1X9VA 1DD4A 3VOPA 3WU2H 2NPSB 1ZR4A 4HKZH 3H1LD 5K5GB 1L0LJ 2KOGA 1JEKA 2V7QJ 1JMBA 3IFMA 2FFDB 1SQBJ 2HR3A 1KC8Q 2VRSA 5B66H 1JY2O 3HE4B 5TISE 2O01H 2W6JH 2J59M 1USDA 1MUUA 4YXDC 1CSBA 4JYBA 3TSIA 1BCCD 3AE5C 1RF0A 2J5UA 4GDOA 2POHA 4MN4C 4NPEA 5M1BA 1S9KD 3F5HA 4HYTB 3NMDA 1KN7A 2OYIC 4C46A 2OYOA 1YJWP 3H1KJ 1UIIA 2B87A 4KT0J 3AE1C 2AXTH 4H0LC 2FYUE 3CXHI 5KLVD 3EQ2A 4WBAA 3SFDC 3G4SP 2RMZA 1OZHA 3CXHH 2ZJSE 5AVXB 1NAYA 3A0HH 3BCCD 3GHGC 1L0LD 3SFEC 1M1KQ 2HG5D 1QEXA 4ZKUA 4JPZB 3C9IA 2HFED 1EZVG 1GK6A 3TYYA 3RGUA 1LNQA 1URQC 1LWUB 1K9MQ 3M0DC 1Q82Q 3VMZA 4K35A 1N73A 2H89C 4WVZA 1MFZA 3H1HE 1IO4A 1RE3A 2H7HA 1SQXJ 1A02J 1NTMG 3CCVP 1URQB 1L4AD 1GMJA 5AVWB 4AUWA 5GTHH 2RN0A 1ZMEC 2AXTE 3TK1A 3H32A 4DOJA 4I1LA 1GU4A 2ZYAA 1KB9I 5B5EE 4RESB 1IFNA 4H44D
chains in the Genus database with same CATH topology
4XA4A 3HE4A 3EFGA 5APSA 2WTYA 2PAJA 1LTSC 1NTKK 5CMZA 1LT9C 1GTWA 3TNUB 3V4QA 1SP4A 3KQGA 1RF1B 1L4AC 3L4FA 1H8AA 3RL0D 3M06A 3OJAB 1SQVK 4AYCA 1A02F 2KSJA 3VYIA 1JCDA 2ZXEB 1LT9B 2R5BA 2GM4A 1FZAA 1N86A 5BU5A 1HJBA 2A45I 3HD7C 2R5DA 1FBMA 5CCGA 3MD0A 2OYHC 1NTZK 2Q9IA 1IFJA 1NKZB 2L5GB 5AVYB 1SVFA 1LTJA 2OYIB 3P7KA 1LGHB 1FZFA 5AW9B 1NHLA 3A7OA 3II6A 2OYIA 2O1JA 1LTBC 2XDJA 1JUNA 2IFNA 3HD7B 1XTCC 3P32A 2PP6A 3BRVB 1H88A 4N6JA 2JEEA 1JY3O 1HTLC 2WSEH 3HE5B 1GL2B 1N73C 2FYZA 4EOTA 2ZFCA 4M3LA 1SLQA 2MJZA 3HE5A 1RE4C 4N78E 1GL2A 1IC2A 1N2DC 1LWUA 3GHGB 1JY2P 2M3BA 5APQA 5AVSB 3NFQA 3GHGA 1FZGA 2N1TB 1NH4A 2N9BA 5APUA 2QM7A 3L37A 3BVHA 3R2PA 2N1TA 4LGDE 1LTIC 4JF7A 5AW3B 1MZ9A 1FZBA 3V2RA 2GUVA 3HUSC 2FFDC 2XKMA 1URQA 1HUCA 3A2AA 3M9QA 3M0DA 2WPQA 3NTNA 5CCGD 3WMM0 2M8RA 2Q7CA 2P1JA 3MUDA 4JYCA 4ZKPA 1KILA 3H6PA 5AW7B 2YKPA 1VDFA 5CHXA 1JTHA 3SWYA 5AVTB 1RF0C 1FZCB 2WITA 3BASA 1IFMA 2I1KA 4WY4D 1ZLLA 5AW5B 1FDMA 1JOCA 5APWA 1FZCA 1FZEA 1N7LA 3U1CA 1XTGB 3A3YB 5AW0B 1J1EC 2HPCB 2P67A 3U59A 3TNUA 5CCHA 1T2KD 3KYQA 1KQLA 5BVZA 2C9LY 4LC1A 1RF1A 1SQQK 1YYCA 1WT6A 5APYA 1G2CB 1Z56A 5AW1B 2H8PD 3VP9A 1ZR2A 3B5ND 4GKGA 1IFDA 1G2CA 2Z4EA 2E43A 1PFIA 4N3YB 2JJLA 2QM8A 3O8ZA 1J1EB 2XV5A 1L4AB 1LT9A 1HVVA 4WY4C 4DZOA 3SWFA 4I6MC 4W80A 1ZN5A 2YKOA 2KB7P 5APTA 4WB4A 1J1DC 2NPSD 5KJ7D 2P2UA 5AW2B 2WT7B 2YO3A 1LTAC 1X8YA 2KP8A 2W6AA 1T2KC 3BRTB 1DEBA 5KLVK 3RL0C 2C0XA 2Q3IA 3T97A 3VMYA 2WT7A 3P8CD 3V5BA 1CZQA 1T3JA 1GD2E 1SFCD 4GT1A 1GK4A 1E5WA 4WY4B 3B5NC 2OYHB 3OAKA 1LWUC 3HD7A 2YMYA 1N7SD 4GIFA 1J1DB 3BATA 1QL1A 2GUSA 2OYHA 1L0LK 1OWAA 2WSFH 3RK2D 1G1JA 1FU1A 3V2NA 1RE3C 3L35A 2E42A 5AW6B 3RL0B 1T3UA 3RK3D 2WPRA 2NPSC 5KJ7C 3MGNA 1JNMA 3CI9A 1M1JC 1GW3A 2YO2A 1CI6B 2OARA 1SQBK 3B5NB 1IJDB 2HODB 2HLOA 4OH8B 1N73B 5AW4B 1SFCC 2R32A 1X9VA 2YKQA 3P8MC 1IFIA 2HODA 1JMMA 2IX7C 2W6BA 3VOPA 2BASA 3VP8A 1N7SC 2NPSB 1ZR4A 1RE4A 2Z5IA 1AQ5A 2WPSA 2CPBA 4IFDK 3RK2C 1M7LA 2FYUK 3RK3C 1JO5A 1J2JB 1ZV8A 2KOGA 2O1KA 2C9NY 1SFCB 2A45G 3LIEA 4HH2A 3IFMA 3N7NA 3E1IA 2IFMA 3H32B 1FJKA 3HUSB 2FFDB 3V2PA 4C7NB 4XE5B 1N7SB 1NKNA 2VRSA 1LTTC 1JY2O 3HUSA 3L36A 3LIDA 3HE4B 4KHXA 3RK2B 1LTGC 1T8ZA 1JY3N 3KDPB 2IPPA 2O01H 3RK3B 2J59M 2FXMA 5AVQB 2H43A 5AVVB 3HD7D 2HPCA 5KTBA 1MUUA 1NO4A 1CSBA 1KZUB 5CCGC 4JYBA 1HGVA 1QL2A 1OXZA 5CJ4A 1GL2D 3TSIA 3V4WA 5BU8B 2P7JA 3VTPC 1JY3P 1RF0A 4N78D 2WWWA 2POHA 1G1IA 1LTJC 1S9KD 1X79B 2Z5HA 5AVZB 2WZ7A 4HYTB 3OA7A 3NMDA 3HRNA 1WRGA 1JCCA 4IFMA 2OYIC 1L4AA 1RY3A 2N1TD 1NAFA 4W7ZA 1AFOA 4LLHA 1L0NK 5APVA 4C46A 3UIAA 2KLVA 1GU5A 2XU6A 1URQD 2R3CA 4IFFA 3M9BA 3HTKB 3M0AA 3G3ZA 3EQ2A 2YNYA 1LTJB 1NOHA 1NTMK 4WBAA 1IK9A 1NU1K 1VPCA 2A45H 1GL2C 1FJPA 3HTKA 1GDTA 5CJ0A 1KILD 5AVXB 1HGZA 3PP5A 1HH0A 4WY4A 3VMXA 3I5CA 1SQXK 4EIJA 3GHGC 1W2EA 4Y99C 1FOSE 1GZLA 4O9BA 1DX7A 1H89A 2J58A 4C7RA 3MTUE 2HG5D 2I1JA 1YTZT 2N1TC 1JY2N 5AVUB 4ZKUA 2Q5UA 3IR9A 3C9IA 2HFED 3M91A 5CCHD 1GK6A 3TYYA 1URQC 1LWUB 3LW5H 1CI6A 2WSCH 4B86A 3VN0A 1EQ7A 2FKWB 1CW5A 1KFNA 2C0WA 2KYVA 1KFMA 3B5NA 3M0DC 5APXA 5AW8B 1FOSF 1S9KE 3VMZA 4Y99B 1N73A 3MIWA 3N4XA 4W7YA 1KILC 2XZRA 1HBWA 1SQPK 1MFZA 2W27A 3B8EB 1FAVA 4AQRD 1IO4A 1RE3A 1HWTC 1M1JB 2H7HA 3V2QA 2CPSA 1DH3A 3U1AA 1A02J 2NPSA 5KJ7A 1URQB 1M1JA 1NWQA 1FZCC 1YTZI 1L4AD 3KPEA 2XNXA 3P8CE 2LKMA 5AVWB 1GW4A 1MV8A 4I2LC 4AUWA 5CCHC 2HYNA 5AVRB 1RF1C 1KILB 1SFCA 1JTHB 3TK1A 3H32A 4DOJA 3NXSA 4I1LA 1GU4A 3CL3D 2FFDA 4C7NA 3M9HA 3A5TA 1N7SA 3CLQA 4RESB 1IFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HE4 A;  1OWA A;  1NAF A;  5AW3 B;  5APS A;  2WTY A;  5APV A;  4C46 A;  5CMZ A;  3UIA A;  3L35 A;  1GTW A;  2E42 A;  5AW6 B;  3TNU B;  3V4Q A;  1SP4 A;  1GU5 A;  2WPR A;  2XU6 A;  3KQG A;  1HUC A;  3A2A A;  2R3C A;  3MGN A;  3M9B A;  3M0D A;  2WPQ A;  3NTN A;  1JNM A;  1H8A A;  3M0A A;  2YO2 A;  1CI6 B;  2YNY A;  2Q7C A;  4JYC A;  3M06 A;  5AW7 B;  3HTK A;  1A02 F;  4AYC A;  5AVX B;  5AW4 B;  5AVT B;  3VMX A;  2R32 A;  3I5C A;  3P8M C;  3VYI A;  5AW5 B;  2ZXE B;  2R5B A;  1FOS E;  1GZL A;  5APW A;  1HJB A;  2BAS A;  1H89 A;  2R5D A;  3A3Y B;  5AW0 B;  2Z5I A;  5AVU B;  2Q5U A;  2WPS A;  2P67 A;  3MD0 A;  3IR9 A;  3TNU A;  1T2K D;  1KQL A;  2C9L Y;  3M91 A;  4LC1 A;  1GK6 A;  3TYY A;  1YYC A;  1J2J B;  5AVY B;  5APY A;  2C9N Y;  1G2C B;  1CI6 A;  4B86 A;  5AW1 B;  3VN0 A;  3P7K A;  3LIE A;  5APX A;  5AW9 B;  5AW8 B;  1FOS F;  1S9K E;  4GKG A;  3VMZ A;  3A7O A;  2E43 A;  4C7N B;  2XZR A;  1HBW A;  4XE5 B;  1MFZ A;  1JUN A;  2JJL A;  2VRS A;  2W27 A;  2QM8 A;  3B8E B;  1FAV A;  3O8Z A;  3P32 A;  2XV5 A;  4AQR D;  1H88 A;  1IO4 A;  3L36 A;  1HWT C;  4DZO A;  3LID A;  2H7H A;  3HE4 B;  4KHX A;  3SWF A;  1DH3 A;  4I6M C;  1A02 J;  3KDP B;  2IPP A;  3HE5 B;  5APT A;  5AVQ B;  5AVV B;  4EOT A;  2ZFC A;  1MUU A;  1NWQ A;  2P2U A;  5AW2 B;  2WT7 B;  2YO3 A;  4M3L A;  1SLQ A;  1CSB A;  1X8Y A;  3HE5 A;  2KP8 A;  2W6A A;  5AVW B;  1T2K C;  4JYB A;  1MV8 A;  1OXZ A;  4I2L C;  4AUW A;  2Q3I A;  3T97 A;  3VMY A;  2WT7 A;  3V4W A;  5APQ A;  2P7J A;  5AVS B;  5AVR B;  3VTP C;  3V5B A;  1CZQ A;  3NFQ A;  2WWW A;  1GD2 E;  4GT1 A;  3TK1 A;  1GK4 A;  2N9B A;  1S9K D;  2Z5H A;  3NXS A;  1GU4 A;  5APU A;  4C7N A;  3M9H A;  5AVZ B;  4HYT B;  3A5T A;  2QM7 A;  3OAK A;  3L37 A;  3NMD A;  4RES B; 
#chains in the Genus database with same CATH topology
 2G3A A;  3H1J G;  2E75 C;  3A0H E;  4U3F J;  2PFX A;  2BEQ D;  5E79 H;  1GTW A;  2KI7 B;  3AE6 C;  3KQG A;  2BCC D;  3L4F A;  1H8A A;  1KTM A;  3ITK A;  2D2C D;  3M06 A;  1SQV K;  1VF5 D;  2KZJ A;  1BGY E;  1SQV D;  2MKV A;  1M56 D;  1SQP E;  1KOR A;  3D6Z A;  2A06 D;  1JCD A;  2ZXE B;  2R5B A;  2GM4 A;  3IN6 A;  1FZA A;  1N86 A;  1HJB A;  2A45 I;  3QH9 A;  2R5D A;  3MD0 A;  1NTK J;  4L73 A;  2Q9I A;  3Q1M A;  1D7M A;  1NKZ B;  3S9O A;  1LTJ A;  5CBO A;  3H1I J;  5AW9 B;  3AEB C;  5GTH E;  3A7O A;  2Y0E A;  2O1J A;  2IZ0 A;  4EYY Q;  2IFN A;  1XTC C;  3P32 A;  1QVF O;  3BRV B;  2JEE A;  1JY3 O;  2WSE H;  3AEE C;  2ZFC A;  4M3L A;  4CPG A;  1IC2 A;  5E79 E;  1HF9 A;  5AVS B;  4PV1 C;  1BDD A;  1FZG A;  3CC4 P;  2KLU A;  4U3F D;  4D6T D;  2KNC A;  1PGO A;  2OTL P;  1NTZ G;  1LTI C;  4JF7 A;  3SWK A;  1MZ9 A;  2GUV A;  1W5C E;  4DCK A;  1HUC A;  1ZRT D;  2W83 C;  1NVO A;  4PV1 B;  5CCG D;  3BCC E;  2K9Y A;  1VDF A;  5CHX A;  4OGQ C;  2B9B A;  1KYO I;  2I1K A;  4WY4 D;  2WSS H;  1S72 P;  5AW5 B;  1JOC A;  3CWB G;  2ZT9 C;  1RH5 B;  2K9J B;  3K5B A;  4PD4 I;  1N7L A;  2QVA A;  2QEX P;  2P67 A;  1OVU A;  2C9L Y;  3H1I D;  1OIP A;  1YYC A;  1YJN P;  1G2C B;  1Q7Y Q;  3PRJ A;  1Y9B A;  5AW1 B;  4OGQ B;  3IF4 A;  3VP9 A;  2ZYG A;  4GKG A;  1IFD A;  1G2C A;  2ZT9 B;  1PFI A;  3FXD A;  2JJL A;  1EXJ A;  1AQT A;  2XV5 A;  1L4A B;  1LT9 A;  1HVV A;  4I6M C;  4W80 A;  3WUV A;  2YKO A;  2ZYD A;  2NPS D;  2WT7 B;  4BRY B;  2LXB A;  1T2K C;  2D2C C;  3RBZ A;  2WT7 A;  4BRY A;  3P8C D;  4H44 B;  2O01 J;  1GK4 A;  3L75 G;  3HD7 A;  2YMY A;  1S4X A;  2YIU C;  1E79 H;  4I7Z B;  2WSF H;  2BCC E;  2NZ2 A;  2D2C B;  3V2N A;  3JCU H;  2E42 A;  3H25 A;  4Y28 J;  1VF5 B;  3MGN A;  1P84 I;  4L74 A;  2YO2 A;  1CI6 B;  1SQV E;  4L75 A;  3AEA C;  2HOD B;  5AW4 B;  1SFC C;  1BE3 E;  2YIU B;  2K1A A;  4GOD A;  2YKQ A;  3P8M C;  1K8A Q;  2HOD A;  3MUD C;  2W6B A;  5KLV G;  3VP8 A;  1EC5 A;  3TGU E;  2Z5I A;  3RK2 C;  2FYU K;  3RK3 C;  1OVR A;  1JO5 A;  2PRR A;  2FYU D;  2O1K A;  1SFC B;  2A45 G;  3QWO C;  1L0L G;  3N7N A;  1FJK A;  3CCS P;  2QJP C;  1HJ0 A;  4XE5 B;  1LTT C;  3CD6 P;  3L36 A;  3RK2 B;  1K04 A;  2IPP A;  3RK3 B;  5H2F H;  1SQB G;  3RK3 E;  5KTB A;  4H0L D;  3H1L J;  1KZU B;  5CCG C;  4ZMD A;  1HGV A;  3JCU E;  1PPJ G;  4D6T E;  3V4W A;  5BU8 B;  2Y9Z A;  2OTJ P;  2QJP B;  1SS1 A;  4EDF A;  2WWW A;  4R4M A;  1X79 B;  2K37 A;  1PGJ A;  3FWN A;  1JCC A;  2FXO A;  3H1H D;  4W7Z A;  1VQP P;  4EI2 A;  1L0N K;  4UB6 H;  5EFW B;  2CK3 H;  3UIA A;  2KLV A;  2XU6 A;  1URQ D;  1S1C X;  2R3C A;  3W68 A;  3TF5 A;  1NOH A;  1NU1 K;  1BCC J;  2BEZ F;  3A0B H;  3H1K G;  5TIS H;  5CJ0 A;  1NU1 D;  1HH0 A;  4WY4 A;  3I5C A;  1W2E A;  4Y99 C;  1GZL A;  1RQU A;  2FYN C;  1YTZ T;  1JY2 N;  1VQ6 P;  3IR9 A;  5H2F E;  3LW5 H;  4B86 A;  1AVY A;  3VN0 A;  2A06 G;  5APX A;  1M90 Q;  1T6A A;  2ITA A;  4Y99 B;  3FX0 A;  4W7Y A;  1BGY D;  1SQP K;  1OX3 A;  3KXD A;  1FDI A;  3BCC J;  3B8E B;  2E75 D;  1SQP D;  4JQ0 D;  3L72 D;  2XND H;  1DH3 A;  1Y8A A;  2NPS A;  1IZN B;  1FZC C;  3KPE A;  3P8C E;  3L73 E;  4UB6 E;  1VL2 A;  2LKM A;  1GW4 A;  1MV8 A;  4I2L C;  5CCH C;  1UIX A;  3R4Y A;  1SQX G;  1AJY A;  1EDK A;  1NTM E;  1JTH B;  4U7J A;  2WSE J;  3GG2 A;  3L74 E;  2FFD A;  3CL3 D;  3A0B E;  3HE4 A;  3ZDM A;  3TNU B;  3V4Q A;  1R8E A;  3L71 D;  4OVN F;  3H1J E;  4U3F G;  3RL0 g;  4AYC A;  3G71 P;  1YQ3 C;  5BU5 A;  1FBM A;  4RKU J;  1ZP0 C;  5B5E H;  2BCC J;  2L5G B;  4PV1 D;  2OYI B;  3P7K A;  4L76 A;  1EXI A;  4ASV A;  1NHL A;  3II6 A;  2OYI A;  1NTK G;  1LTB C;  2XDJ A;  1SQV J;  4H0L B;  2PP6 A;  4N6J A;  3H1I G;  3HE5 B;  2B88 A;  1N73 C;  3L70 D;  4RJT A;  5DJU B;  3HE5 A;  1RE4 C;  1N2D C;  3TGU J;  1LWU A;  3GHG B;  4GOF A;  1YQ4 C;  5APQ A;  4KJM A;  4OGQ D;  3GHG A;  2KXP B;  2N9B A;  5GTI H;  2AEJ A;  2ZT9 D;  1L0N E;  1M8O B;  4LGD E;  1ZOY C;  5AW3 B;  1U7M A;  3V2R A;  3HUS C;  1ZW0 A;  3D70 A;  1URQ A;  1NTZ E;  2Y0D A;  3AE2 C;  3M0D A;  2WPQ A;  1NU1 E;  3S1K A;  2LXC B;  2AXC A;  2WSF J;  1KV4 A;  3SWY A;  2UWJ E;  2W90 A;  4D6T J;  1FE6 A;  3AE3 C;  1XTG B;  3A3Y B;  5AW0 B;  2HPC B;  3CCQ P;  3TDK A;  3U59 A;  2RH0 A;  1T2K D;  1KQL A;  5BVZ A;  1SQQ K;  5APY A;  1YIJ P;  1PP9 D;  2E75 B;  2JWD A;  1ZR2 A;  1BSN A;  3L72 E;  1YI2 P;  4QMA A;  2E43 A;  2QSI A;  1BE3 D;  3G9R A;  3B71 A;  4N3Y B;  2B89 A;  5GTI E;  3FWL A;  3TGU D;  3CMA P;  2IBZ E;  3C8V A;  1LTA C;  1AV1 A;  2FBW C;  3AEG C;  3V5B A;  1T3J A;  1SFC D;  2JKV A;  1E5W A;  3B5N C;  2ZVN B;  1LP1 B;  1Q2N A;  4GIF A;  3CCJ P;  3BAT A;  3FGA D;  1OW7 A;  1OWA A;  4XFJ A;  3RK2 D;  3L71 E;  1T3U A;  3RK3 D;  3KZI E;  3D6Y A;  5KJ7 C;  1M1J C;  3E1R A;  1GW3 A;  2YXQ B;  2OAR A;  3B5N B;  1IJD B;  3L73 J;  2AEM A;  1IFI A;  1JMM A;  3CCL P;  1N7S C;  3L74 J;  4TLF A;  1DIP A;  1AQ5 A;  2E5T A;  4IFD K;  1OVV A;  3I55 P;  3B4S A;  1J2J B;  1ZV8 A;  2C9N Y;  3PJS K;  3LIE A;  2R3S A;  2Q6Q A;  3E1I A;  3V2P A;  4C7N B;  4RO0 A;  1N7S B;  3L70 E;  3LID A;  4Z1M H;  4KHX A;  1T8Z A;  2K9J A;  3LW5 J;  4BXL A;  2H43 A;  5AVQ B;  3CX5 D;  1Q81 Q;  1NO4 A;  2IYO A;  3JSV C;  2FYU J;  3AE7 C;  2SPZ A;  1EDL A;  3VTP C;  1SQB E;  3AEC C;  3H1L G;  2JO1 A;  2Z5H A;  2NRG A;  2E76 C;  3V6I A;  1EZV D;  3OA7 A;  3HRN A;  1TU3 F;  4IFM A;  1L4A A;  1RY3 A;  5KKZ C;  3CCM P;  1NAF A;  1AFO A;  4LLH A;  2JWA A;  4IFF A;  3L73 D;  1KQF B;  3M9B A;  3M0A A;  3G3Z A;  2YNY A;  1NTM K;  1IK9 A;  1VPC A;  1GL2 C;  1FJP A;  1GDT A;  2RKL A;  1NTM D;  2N9Y B;  2LR2 A;  1NGM B;  3L74 D;  5KKZ B;  1FOS E;  1BCC G;  3H1H J;  1DX7 A;  3H1K E;  3MTU E;  2KUB A;  2N1T C;  2Q5U A;  1PP9 E;  1SQQ E;  2JP3 A;  1L0N J;  3M91 A;  5CCH D;  4TT3 H;  3RBX A;  1CI6 A;  2WSC H;  3H1J D;  2FKW B;  1NYH A;  1CW5 A;  2KYV A;  1FOS F;  4GOE A;  1NU1 J;  1KYO E;  1KIL C;  2XZR A;  1QGK B;  2K3R A;  1FAV A;  1HWT C;  3FXE A;  3U1A A;  1KQS O;  1NWQ A;  1YTZ I;  3BCC G;  2XNX A;  1OW6 A;  3G6E P;  1RQV A;  5AVR B;  1RF1 C;  1KIL B;  1SFC A;  1KIL E;  3CX5 H;  3NXS A;  2QJY C;  1BGY J;  3CLQ A;  1SQX E;  1H0T B;  1SQP J;  3Q5P A;  3EFG A;  1IFP A;  3L72 J;  2WTY A;  1LTS C;  1H0T A;  1SP4 A;  1RF1 B;  4H13 C;  2QE7 H;  3RL0 D;  2OTK E;  2QJY B;  2M5A B;  5KAI H;  1A02 F;  4IL6 X;  1JB0 J;  2FXP A;  4JBZ A;  3Q5R A;  4R4L A;  2KZI A;  1QVG O;  2M5A A;  2KSJ A;  1L0N D;  5CCG A;  1M57 D;  4H13 B;  3F89 A;  2OYH C;  1YBK A;  1NTZ K;  1IFJ A;  1NTZ D;  3T97 B;  3L71 J;  1SVF A;  1VQK P;  1LGH B;  2Y0C A;  1FZF A;  2WPV B;  4IL6 H;  1JUN A;  2BCC G;  2ZXX A;  5C39 A;  3CX5 E;  1BSH A;  3CCR P;  2FYZ A;  4EOT A;  1NTK E;  1SQV G;  1WMK A;  1SLQ A;  2MJZ A;  1VQ9 P;  2WMM A;  1JY2 P;  5TJH A;  1FS0 E;  2M3B A;  1EZV E;  2I8D A;  2FYN B;  3GMA A;  3TGU G;  5KAI E;  3BVH A;  1QX8 A;  5DJT B;  1YHQ P;  2QJK C;  3GF7 A;  4OWF A;  2FFD C;  2XKM A;  1Y47 A;  2IBZ D;  4DJG A;  3L70 J;  3A2A A;  3M9Q A;  3NTN A;  2Q7C A;  3W67 A;  2P1J A;  4JYC A;  4ZKP A;  1KD1 Q;  2M3E A;  2YKP A;  1JTH A;  5AVT B;  1RF0 C;  4HB1 A;  1FZC B;  2QJK B;  1X0T A;  4IL6 E;  5APW A;  1S2E A;  1FZC A;  3U1C A;  3TNU A;  3L75 D;  5CCH A;  4D6T G;  1PL5 A;  2QA4 P;  4LC1 A;  2P58 A;  1VQM P;  1K05 A;  1Z56 A;  3GLM A;  2H8P D;  3B5N D;  2Z4E A;  3OW2 O;  2PGD A;  4UB8 E;  1KB9 D;  3O6Q B;  5KLI C;  4DZO A;  3I56 P;  3SWF A;  1ZN5 A;  3O6Q A;  2KB7 P;  5APT A;  4WB4 A;  1J1D C;  2B87 B;  5KJ7 D;  2P2U A;  5AW2 B;  1JM0 A;  1X8Y A;  2W6A A;  5KLV K;  3RL0 C;  2C0X A;  3WU2 E;  3VMY A;  2H88 C;  3CCU P;  1PP9 J;  1SQQ J;  2YMK A;  3KHU A;  5KLI B;  2OGU A;  1IK7 A;  1PGQ A;  3CC7 P;  3OAK A;  1LWU C;  1BE3 J;  1N7S D;  1J1D B;  1QL1 A;  3IAO A;  1L0L K;  1BDC A;  1S5L X;  3AEF C;  1G1J A;  3GF3 A;  1NJI Q;  1RE3 C;  3L35 A;  5AW6 B;  3RL0 B;  3CME P;  2K88 A;  5B66 E;  1JNM A;  3CI9 A;  2IBZ I;  1Q86 Q;  1SQB K;  1SQB D;  2KS1 B;  1OMI A;  3E7K A;  1N73 B;  3WUU A;  2R32 A;  4NPF X;  2KS1 A;  2O01 N;  2IX7 C;  1VQ4 P;  1VQ8 P;  2BAS A;  1PPJ D;  1S5L H;  3L73 G;  2ZAE B;  1RE4 A;  3MP7 B;  2WPS A;  2CPB A;  1M7L A;  1USE A;  3L74 G;  2KSE A;  1MKM A;  4HH2 A;  2E5Y A;  2IFM A;  3H32 B;  2E76 D;  1MFT A;  3HUS B;  2AEF A;  4WWI A;  1NKN A;  3KZI H;  1VQ5 P;  3HUS A;  2OQQ A;  2GA1 A;  1LTG C;  3C1L A;  1JY3 N;  3CXH E;  3KDP B;  2WSC J;  3CPW O;  2E74 D;  1PZQ A;  3H1K D;  2P10 A;  2FXM A;  2HPC A;  5AVV B;  3HD7 D;  3CWB E;  3AE8 C;  1OW8 A;  1SQQ D;  5L8R J;  1KB9 H;  1QL2 A;  1OXZ A;  4ZNC A;  5CJ4 A;  1GL2 D;  2P7J A;  1FDO A;  1JY3 P;  4N78 D;  4HJG H;  4IOI H;  1G1I A;  1LTJ C;  2G8Y A;  3EWK A;  2L91 A;  5AVZ B;  2WZ7 A;  4DT0 A;  1KYO D;  1WRG A;  2FYU G;  2QIW A;  2N1T D;  4PD4 D;  5APV A;  3H1L E;  1LJ2 A;  3SSU A;  5KAF H;  1GU5 A;  1S5L E;  2JDI H;  1RHZ B;  2WVR A;  3HTK B;  1LTJ B;  2A45 H;  3Q3D A;  3HTK A;  1U7J A;  2W8Z A;  1KIL D;  1HGZ A;  3PP5 A;  1YJ9 P;  3VMX A;  1SQX K;  4EIJ A;  1DD3 A;  1LP1 A;  2V7Q H;  5CBN A;  3L75 E;  1SQX D;  4O9B A;  1H89 A;  2J58 A;  1W2B O;  4C7R A;  2I1J A;  1KMI Z;  5AVU B;  3PTZ A;  1QLE D;  3H1H G;  1BCC E;  1VQO P;  4ASW A;  3CC2 P;  1EQ7 A;  1KB9 E;  1KFN A;  2C0W A;  3B5N A;  1KFM A;  1VQL P;  5AW8 B;  1S9K E;  1L0N G;  1NTM J;  3MIW A;  3N4X A;  2KNC B;  1HBW A;  2JR8 A;  4YXW H;  2W27 A;  4AQR D;  1M1J B;  3V2Q A;  2CPS A;  2V4H A;  5KJ7 A;  1NU1 G;  1M1J A;  3PH0 A;  1K73 Q;  5KLV E;  4H13 D;  4PJ0 H;  1P84 D;  5KAF E;  2HYN A;  2Y9Y A;  3H1J J;  4C7N A;  3M9H A;  3A5T A;  1N7S A;  1L0L E;  1VQ7 P;  4XA4 A;  1R5S A;  5APS A;  3PLN A;  3PHL A;  2PAJ A;  1NTK K;  5CMZ A;  1LT9 C;  1ZXG A;  1NTK D;  1BGY G;  1KYO H;  1L4A C;  1SQP G;  3L72 G;  2WQY C;  4PD4 H;  3OJA B;  2Q1K A;  4YTP C;  4BWN A;  1PPJ E;  1FC2 C;  3VYI A;  2IBZ G;  1LT9 B;  1R5L A;  2E74 C;  3HD7 C;  4H44 C;  3D71 A;  1X22 A;  1S3J A;  2E76 B;  4I7Z C;  5AVY B;  4K3A A;  2FY8 A;  1PV3 A;  4PJ0 E;  3AE4 C;  1VF5 C;  2E74 B;  2IDB A;  3EFF K;  3HD7 B;  3L71 G;  1H88 A;  2IYP A;  1HTL C;  3VMA A;  1GL2 B;  3AE9 C;  4N78 E;  1GL2 A;  1LT1 A;  1NTZ J;  1YIT P;  3NFQ A;  2N1T B;  1NH4 A;  4PD4 E;  1EDI A;  5APU A;  2QM7 A;  3L37 A;  2A06 E;  3R2P A;  1P84 H;  2N1T A;  2Q3E A;  3AED C;  2QRX A;  3Q5S A;  1FZB A;  3CX5 I;  1VQN P;  4A7P A;  2DW3 A;  3WMM 0;  3USS A;  2M8R A;  3MUD A;  3CWB J;  1KIL A;  3H6P A;  5AW7 B;  3L70 G;  2WIT A;  3BAS A;  1IFM A;  1EZV I;  1DEE G;  1Q90 D;  2IZ1 A;  1ZLL A;  1FDM A;  1PIX A;  1L2P A;  1FZE A;  1N8R Q;  1J1E C;  2O3J A;  2R44 A;  3S4R A;  3KYQ A;  1RF1 A;  1WT6 A;  2QG4 A;  3WUT A;  4U3F E;  1AA0 A;  2ZVO B;  1PGP A;  2QM8 A;  3O8Z A;  1J1E B;  3MZW B;  4WY4 C;  3CCE P;  1P84 E;  2KK7 A;  4YPC A;  2YO3 A;  1ZRT E;  3L75 J;  2KP8 A;  1KQG B;  3BRT B;  1DEB A;  3GW6 A;  2Q3I A;  3T97 A;  2YXR B;  2M0B A;  2KIK A;  1CZQ A;  1GD2 E;  4GT1 A;  4WY4 B;  2OYH B;  4NPD A;  1PP9 G;  1SQQ G;  2GUS A;  2OYH A;  3CXH D;  1FU1 A;  1U57 A;  3CWB D;  3H1I E;  1OFC X;  2WPR A;  2NPS C;  1BE3 G;  4UB8 H;  3JC2 2;  3ABV C;  3Q2Y A;  5KLV J;  2HLO A;  4OH8 B;  1AVO A;  3MHV A;  1EDJ A;  1X9V A;  1DD4 A;  3VOP A;  3WU2 H;  2NPS B;  1ZR4 A;  4HKZ H;  3H1L D;  5K5G B;  1L0L J;  2KOG A;  1JEK A;  2V7Q J;  1JMB A;  3IFM A;  2FFD B;  1SQB J;  2HR3 A;  1KC8 Q;  2VRS A;  5B66 H;  1JY2 O;  3HE4 B;  5TIS E;  2O01 H;  2W6J H;  2J59 M;  1USD A;  1MUU A;  4YXD C;  1CSB A;  4JYB A;  3TSI A;  1BCC D;  3AE5 C;  1RF0 A;  2J5U A;  4GDO A;  2POH A;  4MN4 C;  4NPE A;  5M1B A;  1S9K D;  3F5H A;  4HYT B;  3NMD A;  1KN7 A;  2OYI C;  4C46 A;  2OYO A;  1YJW P;  3H1K J;  1UII A;  2B87 A;  4KT0 J;  3AE1 C;  2AXT H;  4H0L C;  2FYU E;  3CXH I;  5KLV D;  3EQ2 A;  4WBA A;  3SFD C;  3G4S P;  2RMZ A;  1OZH A;  3CXH H;  2ZJS E;  5AVX B;  1NAY A;  3A0H H;  3BCC D;  3GHG C;  1L0L D;  3SFE C;  1M1K Q;  2HG5 D;  1QEX A;  4ZKU A;  4JPZ B;  3C9I A;  2HFE D;  1EZV G;  1GK6 A;  3TYY A;  3RGU A;  1LNQ A;  1URQ C;  1LWU B;  1K9M Q;  3M0D C;  1Q82 Q;  3VMZ A;  4K35 A;  1N73 A;  2H89 C;  4WVZ A;  1MFZ A;  3H1H E;  1IO4 A;  1RE3 A;  2H7H A;  1SQX J;  1A02 J;  1NTM G;  3CCV P;  1URQ B;  1L4A D;  1GMJ A;  5AVW B;  4AUW A;  5GTH H;  2RN0 A;  1ZME C;  2AXT E;  3TK1 A;  3H32 A;  4DOJ A;  4I1L A;  1GU4 A;  2ZYA A;  1KB9 I;  5B5E E;  4RES B;  1IFN A;  4H44 D; 
#chains in the Genus database with same CATH homology
 4XA4 A;  3HE4 A;  3EFG A;  5APS A;  2WTY A;  2PAJ A;  1LTS C;  1NTK K;  5CMZ A;  1LT9 C;  1GTW A;  3TNU B;  3V4Q A;  1SP4 A;  3KQG A;  1RF1 B;  1L4A C;  3L4F A;  1H8A A;  3RL0 D;  3M06 A;  3OJA B;  1SQV K;  4AYC A;  1A02 F;  2KSJ A;  3VYI A;  1JCD A;  2ZXE B;  1LT9 B;  2R5B A;  2GM4 A;  1FZA A;  1N86 A;  5BU5 A;  1HJB A;  2A45 I;  3HD7 C;  2R5D A;  1FBM A;  5CCG A;  3MD0 A;  2OYH C;  1NTZ K;  2Q9I A;  1IFJ A;  1NKZ B;  2L5G B;  5AVY B;  1SVF A;  1LTJ A;  2OYI B;  3P7K A;  1LGH B;  1FZF A;  5AW9 B;  1NHL A;  3A7O A;  3II6 A;  2OYI A;  2O1J A;  1LTB C;  2XDJ A;  1JUN A;  2IFN A;  3HD7 B;  1XTC C;  3P32 A;  2PP6 A;  3BRV B;  1H88 A;  4N6J A;  2JEE A;  1JY3 O;  1HTL C;  2WSE H;  3HE5 B;  1GL2 B;  1N73 C;  2FYZ A;  4EOT A;  2ZFC A;  4M3L A;  1SLQ A;  2MJZ A;  3HE5 A;  1RE4 C;  4N78 E;  1GL2 A;  1IC2 A;  1N2D C;  1LWU A;  3GHG B;  1JY2 P;  2M3B A;  5APQ A;  5AVS B;  3NFQ A;  3GHG A;  1FZG A;  2N1T B;  1NH4 A;  2N9B A;  5APU A;  2QM7 A;  3L37 A;  3BVH A;  3R2P A;  2N1T A;  4LGD E;  1LTI C;  4JF7 A;  5AW3 B;  1MZ9 A;  1FZB A;  3V2R A;  2GUV A;  3HUS C;  2FFD C;  2XKM A;  1URQ A;  1HUC A;  3A2A A;  3M9Q A;  3M0D A;  2WPQ A;  3NTN A;  5CCG D;  3WMM 0;  2M8R A;  2Q7C A;  2P1J A;  3MUD A;  4JYC A;  4ZKP A;  1KIL A;  3H6P A;  5AW7 B;  2YKP A;  1VDF A;  5CHX A;  1JTH A;  3SWY A;  5AVT B;  1RF0 C;  1FZC B;  2WIT A;  3BAS A;  1IFM A;  2I1K A;  4WY4 D;  1ZLL A;  5AW5 B;  1FDM A;  1JOC A;  5APW A;  1FZC A;  1FZE A;  1N7L A;  3U1C A;  1XTG B;  3A3Y B;  5AW0 B;  1J1E C;  2HPC B;  2P67 A;  3U59 A;  3TNU A;  5CCH A;  1T2K D;  3KYQ A;  1KQL A;  5BVZ A;  2C9L Y;  4LC1 A;  1RF1 A;  1SQQ K;  1YYC A;  1WT6 A;  5APY A;  1G2C B;  1Z56 A;  5AW1 B;  2H8P D;  3VP9 A;  1ZR2 A;  3B5N D;  4GKG A;  1IFD A;  1G2C A;  2Z4E A;  2E43 A;  1PFI A;  4N3Y B;  2JJL A;  2QM8 A;  3O8Z A;  1J1E B;  2XV5 A;  1L4A B;  1LT9 A;  1HVV A;  4WY4 C;  4DZO A;  3SWF A;  4I6M C;  4W80 A;  1ZN5 A;  2YKO A;  2KB7 P;  5APT A;  4WB4 A;  1J1D C;  2NPS D;  5KJ7 D;  2P2U A;  5AW2 B;  2WT7 B;  2YO3 A;  1LTA C;  1X8Y A;  2KP8 A;  2W6A A;  1T2K C;  3BRT B;  1DEB A;  5KLV K;  3RL0 C;  2C0X A;  2Q3I A;  3T97 A;  3VMY A;  2WT7 A;  3P8C D;  3V5B A;  1CZQ A;  1T3J A;  1GD2 E;  1SFC D;  4GT1 A;  1GK4 A;  1E5W A;  4WY4 B;  3B5N C;  2OYH B;  3OAK A;  1LWU C;  3HD7 A;  2YMY A;  1N7S D;  4GIF A;  1J1D B;  3BAT A;  1QL1 A;  2GUS A;  2OYH A;  1L0L K;  1OWA A;  2WSF H;  3RK2 D;  1G1J A;  1FU1 A;  3V2N A;  1RE3 C;  3L35 A;  2E42 A;  5AW6 B;  3RL0 B;  1T3U A;  3RK3 D;  2WPR A;  2NPS C;  5KJ7 C;  3MGN A;  1JNM A;  3CI9 A;  1M1J C;  1GW3 A;  2YO2 A;  1CI6 B;  2OAR A;  1SQB K;  3B5N B;  1IJD B;  2HOD B;  2HLO A;  4OH8 B;  1N73 B;  5AW4 B;  1SFC C;  2R32 A;  1X9V A;  2YKQ A;  3P8M C;  1IFI A;  2HOD A;  1JMM A;  2IX7 C;  2W6B A;  3VOP A;  2BAS A;  3VP8 A;  1N7S C;  2NPS B;  1ZR4 A;  1RE4 A;  2Z5I A;  1AQ5 A;  2WPS A;  2CPB A;  4IFD K;  3RK2 C;  1M7L A;  2FYU K;  3RK3 C;  1JO5 A;  1J2J B;  1ZV8 A;  2KOG A;  2O1K A;  2C9N Y;  1SFC B;  2A45 G;  3LIE A;  4HH2 A;  3IFM A;  3N7N A;  3E1I A;  2IFM A;  3H32 B;  1FJK A;  3HUS B;  2FFD B;  3V2P A;  4C7N B;  4XE5 B;  1N7S B;  1NKN A;  2VRS A;  1LTT C;  1JY2 O;  3HUS A;  3L36 A;  3LID A;  3HE4 B;  4KHX A;  3RK2 B;  1LTG C;  1T8Z A;  1JY3 N;  3KDP B;  2IPP A;  2O01 H;  3RK3 B;  2J59 M;  2FXM A;  5AVQ B;  2H43 A;  5AVV B;  3HD7 D;  2HPC A;  5KTB A;  1MUU A;  1NO4 A;  1CSB A;  1KZU B;  5CCG C;  4JYB A;  1HGV A;  1QL2 A;  1OXZ A;  5CJ4 A;  1GL2 D;  3TSI A;  3V4W A;  5BU8 B;  2P7J A;  3VTP C;  1JY3 P;  1RF0 A;  4N78 D;  2WWW A;  2POH A;  1G1I A;  1LTJ C;  1S9K D;  1X79 B;  2Z5H A;  5AVZ B;  2WZ7 A;  4HYT B;  3OA7 A;  3NMD A;  3HRN A;  1WRG A;  1JCC A;  4IFM A;  2OYI C;  1L4A A;  1RY3 A;  2N1T D;  1NAF A;  4W7Z A;  1AFO A;  4LLH A;  1L0N K;  5APV A;  4C46 A;  3UIA A;  2KLV A;  1GU5 A;  2XU6 A;  1URQ D;  2R3C A;  4IFF A;  3M9B A;  3HTK B;  3M0A A;  3G3Z A;  3EQ2 A;  2YNY A;  1LTJ B;  1NOH A;  1NTM K;  4WBA A;  1IK9 A;  1NU1 K;  1VPC A;  2A45 H;  1GL2 C;  1FJP A;  3HTK A;  1GDT A;  5CJ0 A;  1KIL D;  5AVX B;  1HGZ A;  3PP5 A;  1HH0 A;  4WY4 A;  3VMX A;  3I5C A;  1SQX K;  4EIJ A;  3GHG C;  1W2E A;  4Y99 C;  1FOS E;  1GZL A;  4O9B A;  1DX7 A;  1H89 A;  2J58 A;  4C7R A;  3MTU E;  2HG5 D;  2I1J A;  1YTZ T;  2N1T C;  1JY2 N;  5AVU B;  4ZKU A;  2Q5U A;  3IR9 A;  3C9I A;  2HFE D;  3M91 A;  5CCH D;  1GK6 A;  3TYY A;  1URQ C;  1LWU B;  3LW5 H;  1CI6 A;  2WSC H;  4B86 A;  3VN0 A;  1EQ7 A;  2FKW B;  1CW5 A;  1KFN A;  2C0W A;  2KYV A;  1KFM A;  3B5N A;  3M0D C;  5APX A;  5AW8 B;  1FOS F;  1S9K E;  3VMZ A;  4Y99 B;  1N73 A;  3MIW A;  3N4X A;  4W7Y A;  1KIL C;  2XZR A;  1HBW A;  1SQP K;  1MFZ A;  2W27 A;  3B8E B;  1FAV A;  4AQR D;  1IO4 A;  1RE3 A;  1HWT C;  1M1J B;  2H7H A;  3V2Q A;  2CPS A;  1DH3 A;  3U1A A;  1A02 J;  2NPS A;  5KJ7 A;  1URQ B;  1M1J A;  1NWQ A;  1FZC C;  1YTZ I;  1L4A D;  3KPE A;  2XNX A;  3P8C E;  2LKM A;  5AVW B;  1GW4 A;  1MV8 A;  4I2L C;  4AUW A;  5CCH C;  2HYN A;  5AVR B;  1RF1 C;  1KIL B;  1SFC A;  1JTH B;  3TK1 A;  3H32 A;  4DOJ A;  3NXS A;  4I1L A;  1GU4 A;  3CL3 D;  2FFD A;  4C7N A;  3M9H A;  3A5T A;  1N7S A;  3CLQ A;  4RES B;  1IFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...