4M3LA

Crystal structure of the coiled coil domain of murf1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
60
structure length
60
Chain Sequence
GAMDTLYAILDEKKSELLQRITQEQEEKLSFIEALIQQYQEQLDKSTKLVETAIQSLDEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase TRIM63
publication title Molecular basis for the fold organization and sarcomeric targeting of the muscle atrogin MuRF1.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 60
sequence length 60
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4m3lA00
3M9BA 5AVXB 1CSBA 3A3YB 2ZFCA 2Z5IA 4C7NA 4LC1A 5APVA 1GD2E 4GT1A 2R3CA 3M06A 5AW8B 2YO3A 1MV8A 3NXSA 2E43A 3VN0A 2IPPA 3M91A 5AW2B 5AVWB 3O8ZA 3P7KA 2YO2A 1A02J 3V4WA 1GZLA 5AW1B 1GK6A 3P32A 2XV5A 3OAKA 2Z5HA 5AVRB 4AQRD 1FOSE 3IR9A 4XE5B 1HJBA 2C9NY 3A5TA 2WPQA 3L35A 1OXZA 1H89A 1GU4A 1S9KE 2N9BA 4HYTB 2VRSA 2WPRA 1T2KD 3V4QA 1CI6B 1FAVA 1A02F 4GKGA 3L36A 4B86A 5APXA 1T2KC 2XZRA 1HBWA 3KQGA 3M0DA 1YYCA 4RESB 3A2AA 4KHXA 1HUCA 1CI6A 4I6MC 2WPSA 1GTWA 5AW6B 1KQLA 1NAFA 3HTKA 3M0AA 4DZOA 1G2CB 2WTYA 5AVZB 1X8YA 3LIEA 1JNMA 2P7JA 3B8EB 5AW5B 2QM7A 5AVSB 5AVVB 5CMZA 3T97A 3TNUB 3VMYA 4AYCA 4C46A 3V5BA 3KDPB 2E42A 3VTPC 2Q5UA 2R32A 1FOSF 3VMXA 1GU5A 5AVUB 3TNUA 1JUNA 2P2UA 5AW0B 5APWA 2JJLA 5APQA 3HE4A 5APYA 5AW3B 3MGNA 4AUWA 4M3LA 3VYIA 3VMZA 1H8AA 1MFZA 2BASA 3TYYA 1HWTC 2KP8A 3NFQA 4I2LC 2W6AA 1NWQA 2C9LY 5AVTB 2WT7A 3NMDA 1DH3A 5AVYB 4JYCA 1J2JB 1SP4A 2WWWA 2Q3IA 1H88A 5APUA 1OWAA 2QM8A 2P67A 3A7OA 3LIDA 2XU6A 2Q7CA 5AVQB 5AW4B 2R5BA 2YNYA 4EOTA 3HE4B 5AW9B 1IO4A 3SWFA 3MD0A 3M9HA 1SLQA 3HE5B 5AW7B 5APTA 2W27A 3I5CA 2WT7B 1GK4A 1MUUA 2R5DA 1S9KD 4JYBA 3UIAA 2ZXEB 3P8MC 4C7NB 3TK1A 3L37A 3NTNA 3HE5A 5APSA 1CZQA 2H7HA
chains in the Genus database with same CATH superfamily
5AVXB 3C8VA 1NTKG 3S1KA 1PFIA 1FOSE 3IR9A 4I7ZC 3D6YA 5CJ0A 2K88A 1Y47A 2N9BA 3C1LA 3L73G 3LW5H 4HYTB 1L0LE 5CCGA 4L75A 1RF0C 2O3JA 1URQA 1SQVG 4N6JA 1VPCA 3L71D 1USEA 1EDJA 3SSUA 3BCCD 4O9BA 1JY3N 2OTKE 3B8EB 3OJAB 2QM7A 1FZEA 5CMZA 1QL2A 4C46A 4OH8B 4U3FE 2HR3A 1FZAA 4JF7A 2W6JH 1GU5A 1JUNA 1N2DC 2WVRA 5AW3B 1WT6A 5KKZC 1PIXA 1EXJA 1Q90D 1GW3A 1LT9A 2G3AA 1H88A 1YJWP 1NTKK 1RHZB 2YMKA 1N73B 1OVUA 1SLQA 4ZMDA 1QEXA 5APTA 2W27A 1NTKJ 1KQGB 3H1IG 2JO1A 1IFDA 1HGZA 3VMAA 1K9MQ 2KNCA 3CI9A 1W2EA 1FDOA 3L73J 1SQVK 2Y9ZA 3GW6A 1ZR2A 5BU5A 2W83C 3EQ2A 1HVVA 3O8ZA 1SQPD 3U1CA 5AW1B 4HB1A 3Q1MA 3CLQA 3H6PA 2ZT9B 4AQRD 1SQVJ 1DEBA 1PL5A 2WPQA 1NTZE 2FY8A 5KJ7A 2MJZA 2M5AA 1VQMP 2E5TA 3KQGA 1KYOE 1VQ7P 1KFNA 1KC8Q 4N78E 1CI6A 2C0WA 1GTWA 2NPSB 1KQLA 4A7PA 1VQ9P 3ABVC 4W7ZA 3AE8C 2HLOA 4ZNCA 1ZRTE 3D6ZA 2IFNA 5E79E 2A06E 4TT3H 2Q5UA 4WY4A 1SQBE 3EFGA 4YXWH 1PP9E 3L72E 4M3LA 2IBZG 1SVFA 3PHLA 1YHQP 1FDMA 2KOGA 1JY3O 2W6AA 1NOHA 3H1IJ 2HFED 1OWAA 2XKMA 1J1DC 3CCUP 2QJKB 1X22A 2QA4P 1SQQG 4JYBA 2ZXEB 1NU1E 5APSA 4OGQB 4HKZH 5KAIH 2ZFCA 2YO3A 1QLED 1FZGA 1JTHB 2IPPA 2V7QJ 3H1JG 3M91A 5AVWB 3V4WA 3H1HD 3RL0g 4UB8H 2C9NY 4PJ0E 1Z56A 3V4QA 5L8RJ 2V4HA 2BCCE 4Y28J 1L4AB 2YKOA 4EYYQ 3KHUA 1TU3F 1ZOYC 5AW6B 4H44B 3M0AA 1N8RQ 2P7JA 1VQ5P 1BCCE 4YPCA 2WPVB 2B9BA 3MUDC 1SQQK 3E7KA 5DJTB 1RE3C 3KYQA 5APWA 3HE4A 1NTZD 2O1JA 2E74D 2YXRB 3JCUE 3AE4C 5TISE 2AXTE 1SQQJ 1G1JA 5AVTB 2WT7A 3Q3DA 2WSCH 2PAJA 2IZ0A 1Y8AA 4N78D 2FFDA 5K5GB 1L0NG 3I5CA 4MN4C 1FZCA 3P8CE 5CHXA 1ZRTD 1OVVA 3H1JJ 2AEFA 5B66H 2QVAA 2A06D 3AE5C 1FJPA 1ZN5A 1SQBD 5APVA 2DW3A 5H2FE 2KXPB 1PP9D 4BRYB 1WMKA 4H13D 3L72D 5AW2B 3GF7A 1ZMEC 4H13C 3V2QA 1FZFA 4N3YB 1MKMA 5KTBA 2E74B 3CCQP 1URQB 1Q82Q 1YBKA 3RL0D 3QWOC 1AV1A 4GOEA 3RL0C 1USDA 4RESB 4R4MA 4KHXA 1NU1D 1P84I 1JY3P 2QRXA 1JNMA 1LTTC 4OWFA 5AVSB 1EXIA 1M1JC 1HF9A 1L0NK 1NTKE 1LT9B 1L0NJ 2K37A 3MTUE 3TYYA 1AVOA 1R5SA 3JC22 2WSFH 3CC7P 2BCCD 2WWWA 2D2CD 3FX0A 3LIDA 1LTIC 2WZ7A 3V2PA 2D2CC 2YNYA 5KAFE 2WMMA 3VOPA 3L74G 3M9HA 1LWUB 2WSEH 3HUSC 2NZ2A 1IFJA 1VL2A 1GK4A 1SQVE 3B4SA 2KNCB 3GMAA 1NGMB 1N86A 2B89A 1BCCD 4HJGH 2KS1A 2R3CA 1MV8A 1P84D 1M8OB 1GK6A 5AVRB 4KJMA 2M5AB 1OX3A 3H1KG 1EZVI 3HD7B 3L70G 3AEAC 2WPRA 1NTMG 2Q1KA 1CI6B 3SFDC 1LTJB 1K8AQ 5E79H 3VP8A 1K05A 2FYUG 1HUCA 2B87B 5CCHD 2OARA 3HTKA 1YQ4C 3G71P 4YXDC 4IFFA 5CCHC 4H0LD 1KORA 3CXHE 3H1IE 1M57D 4H0LC 4WY4B 1NH4A 2E76B 2XDJA 2PRRA 3TF5A 1U7JA 2ZJSE 1M56D 2P2UA 5KLVG 3L74J 1VQKP 1SFCD 3A0HH 1JOCA 3H1LG 4U7JA 2N1TA 3NMDA 1IFPA 3A7OA 4EOTA 2QIWA 5AW7B 4HH2A 2UWJE 1YJNP 2ZVOB 1KQSO 3HE5A 1NTMK 5DJUB 3TSIA 3AEFC 1YTZT 3H1KJ 1NKZB 3Q2YA 2O01H 3O6QA 2FYUK 3L70J 2JKVA 3E1RA 1NTMJ 2E43A 1KV4A 4YTPC 2QE7H 2YO2A 1ZXGA 1AQ5A 2FYUJ 3FGAD 3V6IA 2XV5A 1HJ0A 1NYHA 2IBZE 1NO4A 1GU4A 3GHGA 1T6AA 1SFCB 4XA4A 2E75B 1A02F 3L36A 2QJYB 5KLVK 2QSIA 1JCDA 1BGYD 2YIUB 2LXCB 1KB9D 1EZVG 1HGVA 2WTYA 1QL1A 5KLVJ 1P84H 3LW5J 5TISH 2AXTH 2W6BA 3EFFK 1K73Q 3H1LJ 4ASVA 2PGDA 3RK3B 2IFMA 1N73C 1FZBA 3H1JE 2OQQA 1RF1A 1FU1A 3CWBG 2Z4EA 1GL2A 1PPJG 2IYOA 3RK2B 1SP4A 3A0BH 2M3EA 4UB6E 1FZCB 3K5BA 1Q81Q 5H2FH 4EIJA 3N7NA 1IC2A 2ZT9D 1H0TB 3VP9A 1Q7YQ 2ZT9C 3H1ID 1N7SA 2B88A 4RJTA 2CK3H 3H32A 4GODA 5B5EE 4EI2A 5GTIH 3R2PA 4NPFX 2NPSD 4IL6E 2YKQA 2JR8A 3L71G 2A45I 4XE5B 2GUSA 2GUVA 1DX7A 3BCCG 1L2PA 1OXZA 3AE1C 3CD6P 1FE6A 1G2CA 3PH0A 3AECC 1JEKA 3B5ND 1E5WA 1HBWA 2FXMA 3RBZA 2AXCA 2WPSA 4Y99B 1L0NE 4DZOA 2OYHA 1X8YA 3U59A 3CWBJ 3AEGC 3L75E 1U7MA 2E42A 1Y9BA 4JPZB 4PV1B 1M1JA 1T3UA 2IBZD 1AJYA 2OYOA 2PP6A 3VYIA 1BSNA 2BASA 4OGQD 3NFQA 4OGQC 1VQ4P 4ASWA 2KLUA 1KB9H 2P1JA 3RBXA 4WBAA 1BDCA 2IX7C 3B5NB 1SQPG 2N9YB 1KILA 3HUSA 3L71J 3MP7B 1L0LD 4PD4E 3BCCJ 3M9BA 1SQXG 3JSVC 4DT0A 1L4AD 3WU2H 5KLIB 3OA7A 1L4AC 4H44D 3G6EP 4L74A 1A02J 4H44C 1HJBA 1KMIZ 1R5LA 1YQ3C 1K04A 1S9KE 2W90A 4U3FD 1KTMA 3CL3D 3HTKB 1YITP 2XZRA 1KYOI 4I6MC 2CPSA 2FXOA 2FYNB 2WSSH 3L74E 1LP1B 2OYIA 1NAFA 3ZDMA 5GTHE 3CC4P 5AVZB 3GF3A 5CCHA 3T97A 3AEBC 5CBOA 1SQPK 3SWKA 3R4YA 3TNUA 2N1TB 5CBNA 3V2RA 4ZKPA 5BVZA 3OW2O 5BU8B 1SQXK 2C9LY 1SQPJ 3H1KE 3KPEA 1J2JB 1RH5B 4LGDE 2JDIH 1DD3A 1NTME 2KB7P 1SQXJ 3SWFA 1L0ND 3FXEA 1CW5A 3HE5B 2FYUE 5CCGD 1DIPA 2R5DA 3H1HG 3P8MC 3AE3C 3O6QB 3NTNA 1URQD 3L75D 2E74C 2WSCJ 2W8ZA 3KZIE 2H7HA 1LGHB 1KYOD 2KI7B 3MIWA 3IN6A 2YMYA 3GHGB 2A45H 1JB0J 2J59M 1EQ7A 1ZV8A 3H1LE 3W68A 2KZJA 4GKGA 1NKNA 1YI2P 2HPCA 1W5CE 1LT9C 3PP5A 4PD4D 2K9YA 2ZYDA 2QG4A 2KIKA 4WVZA 2Y0CA 1OMIA 3GLMA 3CX5E 2KLVA 2LKMA 3CCLP 1S1CX 1RF1B 2R3SA 1LWUC 1EDIA 1IJDB 1GL2B 3S9OA 2IYPA 4AUWA 1M7LA 1RF0A 2I1JA 2KP8A 3H1HJ 2FXPA 2RH0A 5APUA 2A06G 5B5EH 3L74D 3PLNA 1N7SB 3FWNA 3RK3E 1JY2P 3L72G 2H43A 5KJ7D 5KJ7C 1W2BO 3HD7D 1G1IA 2WSFJ 3CCSP 1EZVE 3HD7C 2KSEA 2K3RA 1CSBA 1LTJC 3L73E 2WSEJ 3NXSA 3AEEC 3CMEP 4BXLA 3WUVA 3P32A 1NU1G 3H1KD 2YKPA 4RO0A 4WY4D 3L35A 3CWBE 1D7MA 4WY4C 1R8EA 1PPJE 2E76D 2E76C 3E1IA 3HRNA 2FYUD 4GIFA 2OYHB 2ZAEB 1HTLC 2QEXP 1QVGO 4NPEA 1KYOH 3W67A 1S4XA 2J5UA 1QGKB 2P10A 4IFDK 5AVVB 2G8YA 4AYCA 1VF5D 3V5BA 1QX8A 3KDPB 2KYVA 4IL6X 3P8CD 3BASA 2XNDH 5APYA 3L72J 1IFNA 1J1EB 1M1KQ 1MZ9A 1ZP0C 3BCCE 1RQVA 2M8RA 2OTLP 4PD4H 1UIXA 1BE3G 1S5LX 2K9JA 1KILB 2IZ1A 1NU1K 1X9VA 3V2NA 2Y9YA 4WWIA 3AE9C 2ZXXA 1JTHA 3CX5D 2QJPB 1NU1J 2H8PD 1S3JA 1IK7A 1KB9I 2E75D 1AA0A 1SFCC 2E75C 2CPBA 5AW8B 2QJYC 1VF5B 2ITAA 1E79H 2YIUC 4EDFA 4D6TG 1MFTA 1IFIA 1H89A 1Q86Q 4PJ0H 2O01J 1T2KD 3RK3D 2ZYAA 3Q5RA 1NTKD 2OYIB 1T2KC 3RK3C 2KSJA 3USSA 1FS0E 1PZQA 2Q6QA 3A2AA 1DEEG 1SQPE 3RK2D 1JCCA 1IK9A 3CXHI 3IF4A 3GG2A 3II6A 1OZHA 3RK2C 3L73D 3IAOA 3TNUB 1FZCC 1SQXE 1BE3J 1SQVD 3VMXA 2JJLA 1KFMA 3CWBD 2M3BA 2PFXA 1MFZA 3AE2C 1SQQE 2C0XA 3JCUH 2QM8A 3KZIH 1EDLA 2Q7CA 3N4XA 3SWYA 3HE4B 3MD0A 1GW4A 5B66E 2WT7B 4XFJA 2HG5D 1MUUA 4BRYA 2FBWC 2JWDA 3MUDA 4D6TJ 3PRJA 2FFDB 1RE3A 3F5HA 1CZQA 4NPDA 3TGUG 3A3YB 2ZYGA 1GD2E 4GT1A 2FKWB 1LT1A 5EFWB 3U1AA 2GM4A 1VQ8P 3P7KA 1JY2N 1YTZI 4Y99C 1BGYG 1N7LA 2LR2A 3I56P 1RE4C 3CXHD 1FC2C 2IBZI 3M0DC 2HYNA 4LLHA 4R4LA 4GOFA 2HPCB 3CX5H 4PV1D 2IDBA 2FYZA 4PV1C 1WRGA 2NPSC 4I7ZB 4L76A 2OGUA 3FWLA 3H1HE 1UIIA 4DJGA 2KUBA 2Q9IA 3VMYA 3AE7C 1ZR4A 2JWAA 1FOSF 3B5NC 1S5LE 5AW0B 5M1BA 2P58A 2RKLA 3MHVA 1H8AA 3AEDC 1LWUA 4GDOA 1GMJA 2HODA 3MZWB 5AVYB 1ZLLA 4JYCA 4ZKUA 1BDDA 2Y0DA 2Q3IA 2L91A 1LNQA 5KLIC 1X79B 3TGUJ 4Z1MH 2QJKC 2E5YA 2KK7A 5KAFH 5KKZB 2AEMA 1BGYJ 3L37A 1SQXD 1AQTA 2XNXA 1IFMA 1NAYA 3HD7A 3QH9A 1VQLP 4W80A 2FYNC 1LTJA 1SQQD 1GZLA 2WITA 2H89C 1KZUB 1FJKA 3FXDA 1BSHA 2B87A 2KS1B 2O1KA 1X0TA 1ZW0A 3WUTA 5APXA 3G4SP 3H1JD 2N1TD 4IOIH 1JY2O 1YYCA 4JBZA 2N1TC 1OW6A 1EC5A 1VQ6P 1OW8A 4OVNF 3LIEA 2POHA 3CXHH 4K35A 1KQFB 3VTPC 3IFMA 2NRGA 3B71A 2A45G 1OFCX 3AE6C 2JEEA 3A0HE 3TDKA 2WQYC 1HWTC 2K9JB 1L0LG 1DH3A 2I1KA 2ZVNB 2P67A 3SFEC 2R5BA 5AW9B 2GA1A 3S4RA 3GHGC 2V7QH 3CCEP 2JP3A 1VQPP 3CMAP 4PD4I 1HH0A 3G9RA 1NVOA 4U3FG 4C7NA 1JMBA 1IZNB 3L70E 1J1DB 4KT0J 1SFCA 2I8DA 1KILE 4I1LA 3OAKA 4TLFA 1YJ9P 3CCMP 5CCGC 2RMZA 2SPZA 1URQC 1FAVA 4B86A 1RF1C 1BE3E 1PGJA 1GL2D 1GDTA 4C7RA 3BATA 1GL2C 1P84E 3D71A 1L0LK 5KLVE 2H88C 1L0LJ 1N7SD 1N7SC 3PJSK 5AVUB 1XTCC 5APQA 3D70A 3VMZA 4D6TE 4RKUJ 1NTZG 1NHLA 4I2LC 1H0TA 3A0BE 1OW7A 2Y0EA 3L75G 3H25A 2XU6A 4U3FJ 5CJ4A 1IO4A 4UB6H 1S9KD 3UIAA 1PGQA 1N73A 1SS1A 2KZIA 5GTIE 2Z5IA 1VDFA 2O01N 3WUUA 3I55P 3M06A 1SQBG 2K1AA 1S72P 1PV3A 2OYHC 3VN0A 1PP9G 4L73A 3H32B 3C9IA 1KN7A 4IL6H 3A5TA 1FDIA 1FBMA 1RE4A 2R44A 2VRSA 3CCJP 3M0DA 1OIPA 3CPWO 4H13B 4QMAA 1S5LH 1NTZK 1PGPA 2AEJA 1J1EC 1G2CB 2NPSA 3CX5I 3L70D 1NTZJ 1NTMD 3PTZA 1LTGC 1KILD 3L75J 3TGUE 1KILC 2J58A 3RL0B 3EWKA 1LJ2A 3F89A 2YXQB 5TJHA 2HODB 3MGNA 1AFOA 1BGYE 3B5NA 1NJIQ 3L4FA 2QJPC 1XTGB 1NWQA 1KB9E 1BE3D 1SQBK 1M1JB 3WMM0 2BCCG 3KXDA 4JQ0D 1VF5C 1VQOP 1SQBJ 5KLVD 4K3AA 2M0BA 1PP9J 2MKVA 3BRVB 3TK1A 3L71E 1JM0A 3H1LD 1JMMA 1QVFO 1LTBC 2RN0A 1BCCG 3WU2E 4LC1A 2OYIC 2D2CB 4CPGA 1S2EA 3CCVP 4D6TD 1DD4A 1RY3A 3HUSB 2Z5HA 1M90Q 1T8ZA 1LP1A 5KAIE 3CC2P 1U57A 1YIJP 2BEQD 2BEZF 3BVHA 3RGUA 4UB8E 1VQNP 3CCRP 5C39A 2OTJP 2LXBA 1L4AA 1RQUA 5GTHH 5AW5B 4IFMA 1LTSC 1KD1Q 2R32A 2BCCJ 1AVYA 1EDKA 1EZVD 4DOJA 4W7YA 3G3ZA 3T97B 1OVRA 2FFDC 4WB4A 3ITKA 4H0LB 4BWNA 1JO5A 3M9QA 5AVQB 1LTAC 5AW4B 1T3JA 1BCCJ 3BRTB 3Q5SA 1Q2NA 2L5GB 1PGOA 4C7NB 4DCKA 1PPJD 2Q3EA 3Q5PA 3TGUD
chains in the Genus database with same CATH topology
2XNXA 5AVXB 1IFMA 1LGHB 2R3CA 3HD7A 1MV8A 3MIWA 2YMYA 4W80A 1LTJA 3GHGB 1GZLA 1PFIA 2WITA 1GK6A 5AVRB 1FOSE 3IR9A 1KZUB 1FJKA 5CJ0A 2A45H 3HD7B 2O1KA 2J59M 1EQ7A 1ZV8A 3LW5H 2N9BA 4HYTB 2WPRA 1CI6B 4GKGA 5CCGA 1LTJB 1NKNA 5APXA 1RF0C 3VP8A 2N1TD 1JY2O 1YYCA 1URQA 4N6JA 2HPCA 1VPCA 1HUCA 2N1TC 1LT9C 3PP5A 2OARA 5CCHD 3HTKA 5CCHC 3LIEA 1JY3N 2POHA 4O9BA 3B8EB 3OJAB 2QM7A 4WY4B 1NH4A 2KLVA 2LKMA 1FZEA 5CMZA 1QL2A 4C46A 4OH8B 2XDJA 1RF1B 3VTPC 1FZAA 4JF7A 1LWUC 1GU5A 3IFMA 1IJDB 1GL2B 1JUNA 2P2UA 2A45G 1N2DC 5AW3B 1WT6A 4AUWA 1M7LA 1RF0A 2JEEA 2I1JA 1HWTC 1SFCD 2KP8A 1JOCA 2N1TA 3NMDA 1GW3A 2I1KA 1DH3A 1LT9A 1H88A 5APUA 1NTKK 2P67A 3A7OA 2R5BA 4EOTA 5AW9B 1N7SB 1N73B 1JY2P 2H43A 5KJ7D 1SLQA 5AW7B 3GHGC 5APTA 2W27A 4HH2A 5KJ7C 3HD7D 1G1IA 1IFDA 3HE5A 3HD7C 1NTMK 1HGZA 1HH0A 3TSIA 1YTZT 1CSBA 3CI9A 1NKZB 1W2EA 4C7NA 1LTJC 2O01H 2FYUK 1SQVK 1J1DB 3NXSA 1SFCA 2E43A 1ZR2A 5BU5A 3EQ2A 1HVVA 3O8ZA 4I1LA 2YO2A 3U1CA 1AQ5A 5AW1B 3P32A 2XV5A 3CLQA 3H6PA 3OAKA 4AQRD 1DEBA 2YKPA 4WY4D 1NO4A 2WPQA 3L35A 5CCGC 1GU4A 3GHGA 4WY4C 5KJ7A 2MJZA 1SFCB 1URQC 4XA4A 1FAVA 1A02F 3E1IA 3HRNA 3L36A 4B86A 1RF1C 4GIFA 1GL2D 3KQGA 5KLVK 1GDTA 1KFNA 2OYHB 4C7RA 3BATA 4N78E 1JCDA 1GL2C 1HTLC 1CI6A 2C0WA 1GTWA 2NPSB 1KQLA 1L0LK 1HGVA 4W7ZA 2WTYA 1QL1A 2HLOA 4IFDK 2W6BA 2IFNA 5AVVB 4AYCA 1N7SD 3V5BA 3KDPB 2KYVA 2Q5UA 1N7SC 3RK3B 2IFMA 4WY4A 3P8CD 1N73C 3BASA 3EFGA 1FZBA 5AVUB 1XTCC 5APQA 5APYA 1RF1A 1FU1A 4M3LA 1SVFA 1FDMA 3VMZA 1IFNA 1J1EB 2KOGA 1JY3O 1NHLA 4I2LC 2W6AA 1MZ9A 1GL2A 2Z4EA 3RK2B 1NOHA 2M8RA 1SP4A 2HFED 1OWAA 2XU6A 1FZCB 2XKMA 1J1DC 5CJ4A 1IO4A 1KILB 4EIJA 1NU1K 3N7NA 1X9VA 1IC2A 3V2NA 3VP9A 1JTHA 1N7SA 4JYBA 3UIAA 2ZXEB 1S9KD 1N73A 3H32A 2H8PD 5APSA 1SFCC 2ZFCA 2Z5IA 1VDFA 2CPBA 3M06A 5AW8B 3R2PA 2YO3A 2OYHC 3VN0A 1JTHB 2IPPA 2NPSD 3M91A 1FZGA 3H32B 3C9IA 2YKQA 5AVWB 3V4WA 2A45I 4XE5B 2GUSA 2GUVA 2C9NY 1IFIA 1DX7A 3A5TA 1OXZA 1H89A 1FBMA 1RE4A 1G2CA 1Z56A 2VRSA 1T2KD 3RK3D 3V4QA 3B5ND 1E5WA 1T2KC 2OYIB 3RK3C 2KSJA 1HBWA 3M0DA 2FXMA 1L4AB 3A2AA 2YKOA 2WPSA 1NTZK 4Y99B 5AW6B 3M0AA 1J1EC 4DZOA 1G2CB 2OYHA 3RK2D 1JCCA 1X8YA 1IK9A 3II6A 2P7JA 3RK2C 3U59A 2NPSA 1LTGC 3TNUB 1FZCC 1KILD 2E42A 1KILC 1M1JA 2J58A 3VMXA 1T3UA 1SQQK 3RL0B 1RE3C 3KYQA 5APWA 2HODB 2JJLA 1KFMA 3HE4A 2PP6A 3MGNA 2M3BA 1AFOA 3VYIA 2O1JA 3B5NA 1MFZA 2BASA 3L4FA 3NFQA 2C0XA 1XTGB 1NWQA 1G1JA 5AVTB 2WT7A 2WSCH 1SQBK 2PAJA 1M1JB 3WMM0 2QM8A 4N78D 2Q7CA 2FFDA 2P1JA 3N4XA 3SWYA 3HE4B 4WBAA 2IX7C 3MD0A 3B5NB 1GW4A 3I5CA 2WT7B 3P8CE 1FZCA 5CHXA 2HG5D 1MUUA 3BRVB 1KILA 3MUDA 3TK1A 3HUSA 1JMMA 2FFDB 1RE3A 1CZQA 1LTBC 3M9BA 1FJPA 1ZN5A 3A3YB 4LC1A 5APVA 1GD2E 4GT1A 2FKWB 2OYIC 1L4AD 3OA7A 1L4AC 3U1AA 5AW2B 2GM4A 1RY3A 3HUSB 3P7KA 1JY2N 1A02J 1YTZI 4Y99C 1N7LA 3V2QA 1FZFA 1RE4C 2Z5HA 4N3YB 1HJBA 5KTBA 1T8ZA 1S9KE 3M0DC 2HYNA 4LLHA 1URQB 2HPCB 3CL3D 3RL0D 3HTKB 2XZRA 2FYZA 1WRGA 3BVHA 3RL0C 4RESB 4KHXA 4I6MC 2CPSA 2NPSC 2OYIA 1NAFA 5AVZB 1L4AA 1JY3P 1JNMA 1LTTC 5AW5B 4IFMA 5AVSB 2Q9IA 1LTSC 1M1JC 5CCHA 3T97A 3VMYA 1L0NK 2R32A 1ZR4A 1FOSF 3B5NC 1SQPK 3TNUA 5AW0B 2N1TB 1LT9B 3V2RA 4W7YA 4DOJA 3G3ZA 4ZKPA 1H8AA 3MTUE 1LWUA 3TYYA 5BVZA 5BU8B 1SQXK 2FFDC 2C9LY 4WB4A 2HODA 2WSFH 5AVYB 1ZLLA 4JYCA 4ZKUA 3KPEA 1J2JB 2WWWA 2Q3IA 3LIDA 4LGDE 1LTIC 2WZ7A 3V2PA 1JO5A 3M9QA 5AVQB 1LTAC 5AW4B 2YNYA 1T3JA 2KB7P 1X79B 3SWFA 3VOPA 3M9HA 1CW5A 1LWUB 2WSEH 3BRTB 3HUSC 3HE5B 1IFJA 1GK4A 2L5GB 5CCGD 2R5DA 3P8MC 4C7NB 3L37A 3NTNA 1N86A 1URQD 4IFFA 2H7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M9B A;  5AVX B;  1CSB A;  3A3Y B;  2ZFC A;  2Z5I A;  4C7N A;  4LC1 A;  5APV A;  1GD2 E;  4GT1 A;  2R3C A;  3M06 A;  5AW8 B;  2YO3 A;  1MV8 A;  3NXS A;  2E43 A;  3VN0 A;  2IPP A;  3M91 A;  5AW2 B;  5AVW B;  3O8Z A;  3P7K A;  2YO2 A;  1A02 J;  3V4W A;  1GZL A;  5AW1 B;  1GK6 A;  3P32 A;  2XV5 A;  3OAK A;  2Z5H A;  5AVR B;  4AQR D;  1FOS E;  3IR9 A;  4XE5 B;  1HJB A;  2C9N Y;  3A5T A;  2WPQ A;  3L35 A;  1OXZ A;  1H89 A;  1GU4 A;  1S9K E;  2N9B A;  4HYT B;  2VRS A;  2WPR A;  1T2K D;  3V4Q A;  1CI6 B;  1FAV A;  1A02 F;  4GKG A;  3L36 A;  4B86 A;  5APX A;  1T2K C;  2XZR A;  1HBW A;  3KQG A;  3M0D A;  1YYC A;  4RES B;  3A2A A;  4KHX A;  1HUC A;  1CI6 A;  4I6M C;  2WPS A;  1GTW A;  5AW6 B;  1KQL A;  1NAF A;  3HTK A;  3M0A A;  4DZO A;  1G2C B;  2WTY A;  5AVZ B;  1X8Y A;  3LIE A;  1JNM A;  2P7J A;  3B8E B;  5AW5 B;  2QM7 A;  5AVS B;  5AVV B;  5CMZ A;  3T97 A;  3TNU B;  3VMY A;  4AYC A;  4C46 A;  3V5B A;  3KDP B;  2E42 A;  3VTP C;  2Q5U A;  2R32 A;  1FOS F;  3VMX A;  1GU5 A;  5AVU B;  3TNU A;  1JUN A;  2P2U A;  5AW0 B;  5APW A;  2JJL A;  5APQ A;  3HE4 A;  5APY A;  5AW3 B;  3MGN A;  4AUW A;  4M3L A;  3VYI A;  3VMZ A;  1H8A A;  1MFZ A;  2BAS A;  3TYY A;  1HWT C;  2KP8 A;  3NFQ A;  4I2L C;  2W6A A;  1NWQ A;  2C9L Y;  5AVT B;  2WT7 A;  3NMD A;  1DH3 A;  5AVY B;  4JYC A;  1J2J B;  1SP4 A;  2WWW A;  2Q3I A;  1H88 A;  5APU A;  1OWA A;  2QM8 A;  2P67 A;  3A7O A;  3LID A;  2XU6 A;  2Q7C A;  5AVQ B;  5AW4 B;  2R5B A;  2YNY A;  4EOT A;  3HE4 B;  5AW9 B;  1IO4 A;  3SWF A;  3MD0 A;  3M9H A;  1SLQ A;  3HE5 B;  5AW7 B;  5APT A;  2W27 A;  3I5C A;  2WT7 B;  1GK4 A;  1MUU A;  2R5D A;  1S9K D;  4JYB A;  3UIA A;  2ZXE B;  3P8M C;  4C7N B;  3TK1 A;  3L37 A;  3NTN A;  3HE5 A;  5APS A;  1CZQ A;  2H7H A; 
#chains in the Genus database with same CATH topology
 5AVX B;  3C8V A;  1NTK G;  3S1K A;  1PFI A;  1FOS E;  3IR9 A;  4I7Z C;  3D6Y A;  5CJ0 A;  2K88 A;  1Y47 A;  2N9B A;  3C1L A;  3L73 G;  3LW5 H;  4HYT B;  1L0L E;  5CCG A;  4L75 A;  1RF0 C;  2O3J A;  1URQ A;  1SQV G;  4N6J A;  1VPC A;  3L71 D;  1USE A;  1EDJ A;  3SSU A;  3BCC D;  4O9B A;  1JY3 N;  2OTK E;  3B8E B;  3OJA B;  2QM7 A;  1FZE A;  5CMZ A;  1QL2 A;  4C46 A;  4OH8 B;  4U3F E;  2HR3 A;  1FZA A;  4JF7 A;  2W6J H;  1GU5 A;  1JUN A;  1N2D C;  2WVR A;  5AW3 B;  1WT6 A;  5KKZ C;  1PIX A;  1EXJ A;  1Q90 D;  1GW3 A;  1LT9 A;  2G3A A;  1H88 A;  1YJW P;  1NTK K;  1RHZ B;  2YMK A;  1N73 B;  1OVU A;  1SLQ A;  4ZMD A;  1QEX A;  5APT A;  2W27 A;  1NTK J;  1KQG B;  3H1I G;  2JO1 A;  1IFD A;  1HGZ A;  3VMA A;  1K9M Q;  2KNC A;  3CI9 A;  1W2E A;  1FDO A;  3L73 J;  1SQV K;  2Y9Z A;  3GW6 A;  1ZR2 A;  5BU5 A;  2W83 C;  3EQ2 A;  1HVV A;  3O8Z A;  1SQP D;  3U1C A;  5AW1 B;  4HB1 A;  3Q1M A;  3CLQ A;  3H6P A;  2ZT9 B;  4AQR D;  1SQV J;  1DEB A;  1PL5 A;  2WPQ A;  1NTZ E;  2FY8 A;  5KJ7 A;  2MJZ A;  2M5A A;  1VQM P;  2E5T A;  3KQG A;  1KYO E;  1VQ7 P;  1KFN A;  1KC8 Q;  4N78 E;  1CI6 A;  2C0W A;  1GTW A;  2NPS B;  1KQL A;  4A7P A;  1VQ9 P;  3ABV C;  4W7Z A;  3AE8 C;  2HLO A;  4ZNC A;  1ZRT E;  3D6Z A;  2IFN A;  5E79 E;  2A06 E;  4TT3 H;  2Q5U A;  4WY4 A;  1SQB E;  3EFG A;  4YXW H;  1PP9 E;  3L72 E;  4M3L A;  2IBZ G;  1SVF A;  3PHL A;  1YHQ P;  1FDM A;  2KOG A;  1JY3 O;  2W6A A;  1NOH A;  3H1I J;  2HFE D;  1OWA A;  2XKM A;  1J1D C;  3CCU P;  2QJK B;  1X22 A;  2QA4 P;  1SQQ G;  4JYB A;  2ZXE B;  1NU1 E;  5APS A;  4OGQ B;  4HKZ H;  5KAI H;  2ZFC A;  2YO3 A;  1QLE D;  1FZG A;  1JTH B;  2IPP A;  2V7Q J;  3H1J G;  3M91 A;  5AVW B;  3V4W A;  3H1H D;  3RL0 g;  4UB8 H;  2C9N Y;  4PJ0 E;  1Z56 A;  3V4Q A;  5L8R J;  2V4H A;  2BCC E;  4Y28 J;  1L4A B;  2YKO A;  4EYY Q;  3KHU A;  1TU3 F;  1ZOY C;  5AW6 B;  4H44 B;  3M0A A;  1N8R Q;  2P7J A;  1VQ5 P;  1BCC E;  4YPC A;  2WPV B;  2B9B A;  3MUD C;  1SQQ K;  3E7K A;  5DJT B;  1RE3 C;  3KYQ A;  5APW A;  3HE4 A;  1NTZ D;  2O1J A;  2E74 D;  2YXR B;  3JCU E;  3AE4 C;  5TIS E;  2AXT E;  1SQQ J;  1G1J A;  5AVT B;  2WT7 A;  3Q3D A;  2WSC H;  2PAJ A;  2IZ0 A;  1Y8A A;  4N78 D;  2FFD A;  5K5G B;  1L0N G;  3I5C A;  4MN4 C;  1FZC A;  3P8C E;  5CHX A;  1ZRT D;  1OVV A;  3H1J J;  2AEF A;  5B66 H;  2QVA A;  2A06 D;  3AE5 C;  1FJP A;  1ZN5 A;  1SQB D;  5APV A;  2DW3 A;  5H2F E;  2KXP B;  1PP9 D;  4BRY B;  1WMK A;  4H13 D;  3L72 D;  5AW2 B;  3GF7 A;  1ZME C;  4H13 C;  3V2Q A;  1FZF A;  4N3Y B;  1MKM A;  5KTB A;  2E74 B;  3CCQ P;  1URQ B;  1Q82 Q;  1YBK A;  3RL0 D;  3QWO C;  1AV1 A;  4GOE A;  3RL0 C;  1USD A;  4RES B;  4R4M A;  4KHX A;  1NU1 D;  1P84 I;  1JY3 P;  2QRX A;  1JNM A;  1LTT C;  4OWF A;  5AVS B;  1EXI A;  1M1J C;  1HF9 A;  1L0N K;  1NTK E;  1LT9 B;  1L0N J;  2K37 A;  3MTU E;  3TYY A;  1AVO A;  1R5S A;  3JC2 2;  2WSF H;  3CC7 P;  2BCC D;  2WWW A;  2D2C D;  3FX0 A;  3LID A;  1LTI C;  2WZ7 A;  3V2P A;  2D2C C;  2YNY A;  5KAF E;  2WMM A;  3VOP A;  3L74 G;  3M9H A;  1LWU B;  2WSE H;  3HUS C;  2NZ2 A;  1IFJ A;  1VL2 A;  1GK4 A;  1SQV E;  3B4S A;  2KNC B;  3GMA A;  1NGM B;  1N86 A;  2B89 A;  1BCC D;  4HJG H;  2KS1 A;  2R3C A;  1MV8 A;  1P84 D;  1M8O B;  1GK6 A;  5AVR B;  4KJM A;  2M5A B;  1OX3 A;  3H1K G;  1EZV I;  3HD7 B;  3L70 G;  3AEA C;  2WPR A;  1NTM G;  2Q1K A;  1CI6 B;  3SFD C;  1LTJ B;  1K8A Q;  5E79 H;  3VP8 A;  1K05 A;  2FYU G;  1HUC A;  2B87 B;  5CCH D;  2OAR A;  3HTK A;  1YQ4 C;  3G71 P;  4YXD C;  4IFF A;  5CCH C;  4H0L D;  1KOR A;  3CXH E;  3H1I E;  1M57 D;  4H0L C;  4WY4 B;  1NH4 A;  2E76 B;  2XDJ A;  2PRR A;  3TF5 A;  1U7J A;  2ZJS E;  1M56 D;  2P2U A;  5KLV G;  3L74 J;  1VQK P;  1SFC D;  3A0H H;  1JOC A;  3H1L G;  4U7J A;  2N1T A;  3NMD A;  1IFP A;  3A7O A;  4EOT A;  2QIW A;  5AW7 B;  4HH2 A;  2UWJ E;  1YJN P;  2ZVO B;  1KQS O;  3HE5 A;  1NTM K;  5DJU B;  3TSI A;  3AEF C;  1YTZ T;  3H1K J;  1NKZ B;  3Q2Y A;  2O01 H;  3O6Q A;  2FYU K;  3L70 J;  2JKV A;  3E1R A;  1NTM J;  2E43 A;  1KV4 A;  4YTP C;  2QE7 H;  2YO2 A;  1ZXG A;  1AQ5 A;  2FYU J;  3FGA D;  3V6I A;  2XV5 A;  1HJ0 A;  1NYH A;  2IBZ E;  1NO4 A;  1GU4 A;  3GHG A;  1T6A A;  1SFC B;  4XA4 A;  2E75 B;  1A02 F;  3L36 A;  2QJY B;  5KLV K;  2QSI A;  1JCD A;  1BGY D;  2YIU B;  2LXC B;  1KB9 D;  1EZV G;  1HGV A;  2WTY A;  1QL1 A;  5KLV J;  1P84 H;  3LW5 J;  5TIS H;  2AXT H;  2W6B A;  3EFF K;  1K73 Q;  3H1L J;  4ASV A;  2PGD A;  3RK3 B;  2IFM A;  1N73 C;  1FZB A;  3H1J E;  2OQQ A;  1RF1 A;  1FU1 A;  3CWB G;  2Z4E A;  1GL2 A;  1PPJ G;  2IYO A;  3RK2 B;  1SP4 A;  3A0B H;  2M3E A;  4UB6 E;  1FZC B;  3K5B A;  1Q81 Q;  5H2F H;  4EIJ A;  3N7N A;  1IC2 A;  2ZT9 D;  1H0T B;  3VP9 A;  1Q7Y Q;  2ZT9 C;  3H1I D;  1N7S A;  2B88 A;  4RJT A;  2CK3 H;  3H32 A;  4GOD A;  5B5E E;  4EI2 A;  5GTI H;  3R2P A;  4NPF X;  2NPS D;  4IL6 E;  2YKQ A;  2JR8 A;  3L71 G;  2A45 I;  4XE5 B;  2GUS A;  2GUV A;  1DX7 A;  3BCC G;  1L2P A;  1OXZ A;  3AE1 C;  3CD6 P;  1FE6 A;  1G2C A;  3PH0 A;  3AEC C;  1JEK A;  3B5N D;  1E5W A;  1HBW A;  2FXM A;  3RBZ A;  2AXC A;  2WPS A;  4Y99 B;  1L0N E;  4DZO A;  2OYH A;  1X8Y A;  3U59 A;  3CWB J;  3AEG C;  3L75 E;  1U7M A;  2E42 A;  1Y9B A;  4JPZ B;  4PV1 B;  1M1J A;  1T3U A;  2IBZ D;  1AJY A;  2OYO A;  2PP6 A;  3VYI A;  1BSN A;  2BAS A;  4OGQ D;  3NFQ A;  4OGQ C;  1VQ4 P;  4ASW A;  2KLU A;  1KB9 H;  2P1J A;  3RBX A;  4WBA A;  1BDC A;  2IX7 C;  3B5N B;  1SQP G;  2N9Y B;  1KIL A;  3HUS A;  3L71 J;  3MP7 B;  1L0L D;  4PD4 E;  3BCC J;  3M9B A;  1SQX G;  3JSV C;  4DT0 A;  1L4A D;  3WU2 H;  5KLI B;  3OA7 A;  1L4A C;  4H44 D;  3G6E P;  4L74 A;  1A02 J;  4H44 C;  1HJB A;  1KMI Z;  1R5L A;  1YQ3 C;  1K04 A;  1S9K E;  2W90 A;  4U3F D;  1KTM A;  3CL3 D;  3HTK B;  1YIT P;  2XZR A;  1KYO I;  4I6M C;  2CPS A;  2FXO A;  2FYN B;  2WSS H;  3L74 E;  1LP1 B;  2OYI A;  1NAF A;  3ZDM A;  5GTH E;  3CC4 P;  5AVZ B;  3GF3 A;  5CCH A;  3T97 A;  3AEB C;  5CBO A;  1SQP K;  3SWK A;  3R4Y A;  3TNU A;  2N1T B;  5CBN A;  3V2R A;  4ZKP A;  5BVZ A;  3OW2 O;  5BU8 B;  1SQX K;  2C9L Y;  1SQP J;  3H1K E;  3KPE A;  1J2J B;  1RH5 B;  4LGD E;  2JDI H;  1DD3 A;  1NTM E;  2KB7 P;  1SQX J;  3SWF A;  1L0N D;  3FXE A;  1CW5 A;  3HE5 B;  2FYU E;  5CCG D;  1DIP A;  2R5D A;  3H1H G;  3P8M C;  3AE3 C;  3O6Q B;  3NTN A;  1URQ D;  3L75 D;  2E74 C;  2WSC J;  2W8Z A;  3KZI E;  2H7H A;  1LGH B;  1KYO D;  2KI7 B;  3MIW A;  3IN6 A;  2YMY A;  3GHG B;  2A45 H;  1JB0 J;  2J59 M;  1EQ7 A;  1ZV8 A;  3H1L E;  3W68 A;  2KZJ A;  4GKG A;  1NKN A;  1YI2 P;  2HPC A;  1W5C E;  1LT9 C;  3PP5 A;  4PD4 D;  2K9Y A;  2ZYD A;  2QG4 A;  2KIK A;  4WVZ A;  2Y0C A;  1OMI A;  3GLM A;  3CX5 E;  2KLV A;  2LKM A;  3CCL P;  1S1C X;  1RF1 B;  2R3S A;  1LWU C;  1EDI A;  1IJD B;  1GL2 B;  3S9O A;  2IYP A;  4AUW A;  1M7L A;  1RF0 A;  2I1J A;  2KP8 A;  3H1H J;  2FXP A;  2RH0 A;  5APU A;  2A06 G;  5B5E H;  3L74 D;  3PLN A;  1N7S B;  3FWN A;  3RK3 E;  1JY2 P;  3L72 G;  2H43 A;  5KJ7 D;  5KJ7 C;  1W2B O;  3HD7 D;  1G1I A;  2WSF J;  3CCS P;  1EZV E;  3HD7 C;  2KSE A;  2K3R A;  1CSB A;  1LTJ C;  3L73 E;  2WSE J;  3NXS A;  3AEE C;  3CME P;  4BXL A;  3WUV A;  3P32 A;  1NU1 G;  3H1K D;  2YKP A;  4RO0 A;  4WY4 D;  3L35 A;  3CWB E;  1D7M A;  4WY4 C;  1R8E A;  1PPJ E;  2E76 D;  2E76 C;  3E1I A;  3HRN A;  2FYU D;  4GIF A;  2OYH B;  2ZAE B;  1HTL C;  2QEX P;  1QVG O;  4NPE A;  1KYO H;  3W67 A;  1S4X A;  2J5U A;  1QGK B;  2P10 A;  4IFD K;  5AVV B;  2G8Y A;  4AYC A;  1VF5 D;  3V5B A;  1QX8 A;  3KDP B;  2KYV A;  4IL6 X;  3P8C D;  3BAS A;  2XND H;  5APY A;  3L72 J;  1IFN A;  1J1E B;  1M1K Q;  1MZ9 A;  1ZP0 C;  3BCC E;  1RQV A;  2M8R A;  2OTL P;  4PD4 H;  1UIX A;  1BE3 G;  1S5L X;  2K9J A;  1KIL B;  2IZ1 A;  1NU1 K;  1X9V A;  3V2N A;  2Y9Y A;  4WWI A;  3AE9 C;  2ZXX A;  1JTH A;  3CX5 D;  2QJP B;  1NU1 J;  2H8P D;  1S3J A;  1IK7 A;  1KB9 I;  2E75 D;  1AA0 A;  1SFC C;  2E75 C;  2CPB A;  5AW8 B;  2QJY C;  1VF5 B;  2ITA A;  1E79 H;  2YIU C;  4EDF A;  4D6T G;  1MFT A;  1IFI A;  1H89 A;  1Q86 Q;  4PJ0 H;  2O01 J;  1T2K D;  3RK3 D;  2ZYA A;  3Q5R A;  1NTK D;  2OYI B;  1T2K C;  3RK3 C;  2KSJ A;  3USS A;  1FS0 E;  1PZQ A;  2Q6Q A;  3A2A A;  1DEE G;  1SQP E;  3RK2 D;  1JCC A;  1IK9 A;  3CXH I;  3IF4 A;  3GG2 A;  3II6 A;  1OZH A;  3RK2 C;  3L73 D;  3IAO A;  3TNU B;  1FZC C;  1SQX E;  1BE3 J;  1SQV D;  3VMX A;  2JJL A;  1KFM A;  3CWB D;  2M3B A;  2PFX A;  1MFZ A;  3AE2 C;  1SQQ E;  2C0X A;  3JCU H;  2QM8 A;  3KZI H;  1EDL A;  2Q7C A;  3N4X A;  3SWY A;  3HE4 B;  3MD0 A;  1GW4 A;  5B66 E;  2WT7 B;  4XFJ A;  2HG5 D;  1MUU A;  4BRY A;  2FBW C;  2JWD A;  3MUD A;  4D6T J;  3PRJ A;  2FFD B;  1RE3 A;  3F5H A;  1CZQ A;  4NPD A;  3TGU G;  3A3Y B;  2ZYG A;  1GD2 E;  4GT1 A;  2FKW B;  1LT1 A;  5EFW B;  3U1A A;  2GM4 A;  1VQ8 P;  3P7K A;  1JY2 N;  1YTZ I;  4Y99 C;  1BGY G;  1N7L A;  2LR2 A;  3I56 P;  1RE4 C;  3CXH D;  1FC2 C;  2IBZ I;  3M0D C;  2HYN A;  4LLH A;  4R4L A;  4GOF A;  2HPC B;  3CX5 H;  4PV1 D;  2IDB A;  2FYZ A;  4PV1 C;  1WRG A;  2NPS C;  4I7Z B;  4L76 A;  2OGU A;  3FWL A;  3H1H E;  1UII A;  4DJG A;  2KUB A;  2Q9I A;  3VMY A;  3AE7 C;  1ZR4 A;  2JWA A;  1FOS F;  3B5N C;  1S5L E;  5AW0 B;  5M1B A;  2P58 A;  2RKL A;  3MHV A;  1H8A A;  3AED C;  1LWU A;  4GDO A;  1GMJ A;  2HOD A;  3MZW B;  5AVY B;  1ZLL A;  4JYC A;  4ZKU A;  1BDD A;  2Y0D A;  2Q3I A;  2L91 A;  1LNQ A;  5KLI C;  1X79 B;  3TGU J;  4Z1M H;  2QJK C;  2E5Y A;  2KK7 A;  5KAF H;  5KKZ B;  2AEM A;  1BGY J;  3L37 A;  1SQX D;  1AQT A;  2XNX A;  1IFM A;  1NAY A;  3HD7 A;  3QH9 A;  1VQL P;  4W80 A;  2FYN C;  1LTJ A;  1SQQ D;  1GZL A;  2WIT A;  2H89 C;  1KZU B;  1FJK A;  3FXD A;  1BSH A;  2B87 A;  2KS1 B;  2O1K A;  1X0T A;  1ZW0 A;  3WUT A;  5APX A;  3G4S P;  3H1J D;  2N1T D;  4IOI H;  1JY2 O;  1YYC A;  4JBZ A;  2N1T C;  1OW6 A;  1EC5 A;  1VQ6 P;  1OW8 A;  4OVN F;  3LIE A;  2POH A;  3CXH H;  4K35 A;  1KQF B;  3VTP C;  3IFM A;  2NRG A;  3B71 A;  2A45 G;  1OFC X;  3AE6 C;  2JEE A;  3A0H E;  3TDK A;  2WQY C;  1HWT C;  2K9J B;  1L0L G;  1DH3 A;  2I1K A;  2ZVN B;  2P67 A;  3SFE C;  2R5B A;  5AW9 B;  2GA1 A;  3S4R A;  3GHG C;  2V7Q H;  3CCE P;  2JP3 A;  1VQP P;  3CMA P;  4PD4 I;  1HH0 A;  3G9R A;  1NVO A;  4U3F G;  4C7N A;  1JMB A;  1IZN B;  3L70 E;  1J1D B;  4KT0 J;  1SFC A;  2I8D A;  1KIL E;  4I1L A;  3OAK A;  4TLF A;  1YJ9 P;  3CCM P;  5CCG C;  2RMZ A;  2SPZ A;  1URQ C;  1FAV A;  4B86 A;  1RF1 C;  1BE3 E;  1PGJ A;  1GL2 D;  1GDT A;  4C7R A;  3BAT A;  1GL2 C;  1P84 E;  3D71 A;  1L0L K;  5KLV E;  2H88 C;  1L0L J;  1N7S D;  1N7S C;  3PJS K;  5AVU B;  1XTC C;  5APQ A;  3D70 A;  3VMZ A;  4D6T E;  4RKU J;  1NTZ G;  1NHL A;  4I2L C;  1H0T A;  3A0B E;  1OW7 A;  2Y0E A;  3L75 G;  3H25 A;  2XU6 A;  4U3F J;  5CJ4 A;  1IO4 A;  4UB6 H;  1S9K D;  3UIA A;  1PGQ A;  1N73 A;  1SS1 A;  2KZI A;  5GTI E;  2Z5I A;  1VDF A;  2O01 N;  3WUU A;  3I55 P;  3M06 A;  1SQB G;  2K1A A;  1S72 P;  1PV3 A;  2OYH C;  3VN0 A;  1PP9 G;  4L73 A;  3H32 B;  3C9I A;  1KN7 A;  4IL6 H;  3A5T A;  1FDI A;  1FBM A;  1RE4 A;  2R44 A;  2VRS A;  3CCJ P;  3M0D A;  1OIP A;  3CPW O;  4H13 B;  4QMA A;  1S5L H;  1NTZ K;  1PGP A;  2AEJ A;  1J1E C;  1G2C B;  2NPS A;  3CX5 I;  3L70 D;  1NTZ J;  1NTM D;  3PTZ A;  1LTG C;  1KIL D;  3L75 J;  3TGU E;  1KIL C;  2J58 A;  3RL0 B;  3EWK A;  1LJ2 A;  3F89 A;  2YXQ B;  5TJH A;  2HOD B;  3MGN A;  1AFO A;  1BGY E;  3B5N A;  1NJI Q;  3L4F A;  2QJP C;  1XTG B;  1NWQ A;  1KB9 E;  1BE3 D;  1SQB K;  1M1J B;  3WMM 0;  2BCC G;  3KXD A;  4JQ0 D;  1VF5 C;  1VQO P;  1SQB J;  5KLV D;  4K3A A;  2M0B A;  1PP9 J;  2MKV A;  3BRV B;  3TK1 A;  3L71 E;  1JM0 A;  3H1L D;  1JMM A;  1QVF O;  1LTB C;  2RN0 A;  1BCC G;  3WU2 E;  4LC1 A;  2OYI C;  2D2C B;  4CPG A;  1S2E A;  3CCV P;  4D6T D;  1DD4 A;  1RY3 A;  3HUS B;  2Z5H A;  1M90 Q;  1T8Z A;  1LP1 A;  5KAI E;  3CC2 P;  1U57 A;  1YIJ P;  2BEQ D;  2BEZ F;  3BVH A;  3RGU A;  4UB8 E;  1VQN P;  3CCR P;  5C39 A;  2OTJ P;  2LXB A;  1L4A A;  1RQU A;  5GTH H;  5AW5 B;  4IFM A;  1LTS C;  1KD1 Q;  2R32 A;  2BCC J;  1AVY A;  1EDK A;  1EZV D;  4DOJ A;  4W7Y A;  3G3Z A;  3T97 B;  1OVR A;  2FFD C;  4WB4 A;  3ITK A;  4H0L B;  4BWN A;  1JO5 A;  3M9Q A;  5AVQ B;  1LTA C;  5AW4 B;  1T3J A;  1BCC J;  3BRT B;  3Q5S A;  1Q2N A;  2L5G B;  1PGO A;  4C7N B;  4DCK A;  1PPJ D;  2Q3E A;  3Q5P A;  3TGU D; 
#chains in the Genus database with same CATH homology
 2XNX A;  5AVX B;  1IFM A;  1LGH B;  2R3C A;  3HD7 A;  1MV8 A;  3MIW A;  2YMY A;  4W80 A;  1LTJ A;  3GHG B;  1GZL A;  1PFI A;  2WIT A;  1GK6 A;  5AVR B;  1FOS E;  3IR9 A;  1KZU B;  1FJK A;  5CJ0 A;  2A45 H;  3HD7 B;  2O1K A;  2J59 M;  1EQ7 A;  1ZV8 A;  3LW5 H;  2N9B A;  4HYT B;  2WPR A;  1CI6 B;  4GKG A;  5CCG A;  1LTJ B;  1NKN A;  5APX A;  1RF0 C;  3VP8 A;  2N1T D;  1JY2 O;  1YYC A;  1URQ A;  4N6J A;  2HPC A;  1VPC A;  1HUC A;  2N1T C;  1LT9 C;  3PP5 A;  2OAR A;  5CCH D;  3HTK A;  5CCH C;  3LIE A;  1JY3 N;  2POH A;  4O9B A;  3B8E B;  3OJA B;  2QM7 A;  4WY4 B;  1NH4 A;  2KLV A;  2LKM A;  1FZE A;  5CMZ A;  1QL2 A;  4C46 A;  4OH8 B;  2XDJ A;  1RF1 B;  3VTP C;  1FZA A;  4JF7 A;  1LWU C;  1GU5 A;  3IFM A;  1IJD B;  1GL2 B;  1JUN A;  2P2U A;  2A45 G;  1N2D C;  5AW3 B;  1WT6 A;  4AUW A;  1M7L A;  1RF0 A;  2JEE A;  2I1J A;  1HWT C;  1SFC D;  2KP8 A;  1JOC A;  2N1T A;  3NMD A;  1GW3 A;  2I1K A;  1DH3 A;  1LT9 A;  1H88 A;  5APU A;  1NTK K;  2P67 A;  3A7O A;  2R5B A;  4EOT A;  5AW9 B;  1N7S B;  1N73 B;  1JY2 P;  2H43 A;  5KJ7 D;  1SLQ A;  5AW7 B;  3GHG C;  5APT A;  2W27 A;  4HH2 A;  5KJ7 C;  3HD7 D;  1G1I A;  1IFD A;  3HE5 A;  3HD7 C;  1NTM K;  1HGZ A;  1HH0 A;  3TSI A;  1YTZ T;  1CSB A;  3CI9 A;  1NKZ B;  1W2E A;  4C7N A;  1LTJ C;  2O01 H;  2FYU K;  1SQV K;  1J1D B;  3NXS A;  1SFC A;  2E43 A;  1ZR2 A;  5BU5 A;  3EQ2 A;  1HVV A;  3O8Z A;  4I1L A;  2YO2 A;  3U1C A;  1AQ5 A;  5AW1 B;  3P32 A;  2XV5 A;  3CLQ A;  3H6P A;  3OAK A;  4AQR D;  1DEB A;  2YKP A;  4WY4 D;  1NO4 A;  2WPQ A;  3L35 A;  5CCG C;  1GU4 A;  3GHG A;  4WY4 C;  5KJ7 A;  2MJZ A;  1SFC B;  1URQ C;  4XA4 A;  1FAV A;  1A02 F;  3E1I A;  3HRN A;  3L36 A;  4B86 A;  1RF1 C;  4GIF A;  1GL2 D;  3KQG A;  5KLV K;  1GDT A;  1KFN A;  2OYH B;  4C7R A;  3BAT A;  4N78 E;  1JCD A;  1GL2 C;  1HTL C;  1CI6 A;  2C0W A;  1GTW A;  2NPS B;  1KQL A;  1L0L K;  1HGV A;  4W7Z A;  2WTY A;  1QL1 A;  2HLO A;  4IFD K;  2W6B A;  2IFN A;  5AVV B;  4AYC A;  1N7S D;  3V5B A;  3KDP B;  2KYV A;  2Q5U A;  1N7S C;  3RK3 B;  2IFM A;  4WY4 A;  3P8C D;  1N73 C;  3BAS A;  3EFG A;  1FZB A;  5AVU B;  1XTC C;  5APQ A;  5APY A;  1RF1 A;  1FU1 A;  4M3L A;  1SVF A;  1FDM A;  3VMZ A;  1IFN A;  1J1E B;  2KOG A;  1JY3 O;  1NHL A;  4I2L C;  2W6A A;  1MZ9 A;  1GL2 A;  2Z4E A;  3RK2 B;  1NOH A;  2M8R A;  1SP4 A;  2HFE D;  1OWA A;  2XU6 A;  1FZC B;  2XKM A;  1J1D C;  5CJ4 A;  1IO4 A;  1KIL B;  4EIJ A;  1NU1 K;  3N7N A;  1X9V A;  1IC2 A;  3V2N A;  3VP9 A;  1JTH A;  1N7S A;  4JYB A;  3UIA A;  2ZXE B;  1S9K D;  1N73 A;  3H32 A;  2H8P D;  5APS A;  1SFC C;  2ZFC A;  2Z5I A;  1VDF A;  2CPB A;  3M06 A;  5AW8 B;  3R2P A;  2YO3 A;  2OYH C;  3VN0 A;  1JTH B;  2IPP A;  2NPS D;  3M91 A;  1FZG A;  3H32 B;  3C9I A;  2YKQ A;  5AVW B;  3V4W A;  2A45 I;  4XE5 B;  2GUS A;  2GUV A;  2C9N Y;  1IFI A;  1DX7 A;  3A5T A;  1OXZ A;  1H89 A;  1FBM A;  1RE4 A;  1G2C A;  1Z56 A;  2VRS A;  1T2K D;  3RK3 D;  3V4Q A;  3B5N D;  1E5W A;  1T2K C;  2OYI B;  3RK3 C;  2KSJ A;  1HBW A;  3M0D A;  2FXM A;  1L4A B;  3A2A A;  2YKO A;  2WPS A;  1NTZ K;  4Y99 B;  5AW6 B;  3M0A A;  1J1E C;  4DZO A;  1G2C B;  2OYH A;  3RK2 D;  1JCC A;  1X8Y A;  1IK9 A;  3II6 A;  2P7J A;  3RK2 C;  3U59 A;  2NPS A;  1LTG C;  3TNU B;  1FZC C;  1KIL D;  2E42 A;  1KIL C;  1M1J A;  2J58 A;  3VMX A;  1T3U A;  1SQQ K;  3RL0 B;  1RE3 C;  3KYQ A;  5APW A;  2HOD B;  2JJL A;  1KFM A;  3HE4 A;  2PP6 A;  3MGN A;  2M3B A;  1AFO A;  3VYI A;  2O1J A;  3B5N A;  1MFZ A;  2BAS A;  3L4F A;  3NFQ A;  2C0X A;  1XTG B;  1NWQ A;  1G1J A;  5AVT B;  2WT7 A;  2WSC H;  1SQB K;  2PAJ A;  1M1J B;  3WMM 0;  2QM8 A;  4N78 D;  2Q7C A;  2FFD A;  2P1J A;  3N4X A;  3SWY A;  3HE4 B;  4WBA A;  2IX7 C;  3MD0 A;  3B5N B;  1GW4 A;  3I5C A;  2WT7 B;  3P8C E;  1FZC A;  5CHX A;  2HG5 D;  1MUU A;  3BRV B;  1KIL A;  3MUD A;  3TK1 A;  3HUS A;  1JMM A;  2FFD B;  1RE3 A;  1CZQ A;  1LTB C;  3M9B A;  1FJP A;  1ZN5 A;  3A3Y B;  4LC1 A;  5APV A;  1GD2 E;  4GT1 A;  2FKW B;  2OYI C;  1L4A D;  3OA7 A;  1L4A C;  3U1A A;  5AW2 B;  2GM4 A;  1RY3 A;  3HUS B;  3P7K A;  1JY2 N;  1A02 J;  1YTZ I;  4Y99 C;  1N7L A;  3V2Q A;  1FZF A;  1RE4 C;  2Z5H A;  4N3Y B;  1HJB A;  5KTB A;  1T8Z A;  1S9K E;  3M0D C;  2HYN A;  4LLH A;  1URQ B;  2HPC B;  3CL3 D;  3RL0 D;  3HTK B;  2XZR A;  2FYZ A;  1WRG A;  3BVH A;  3RL0 C;  4RES B;  4KHX A;  4I6M C;  2CPS A;  2NPS C;  2OYI A;  1NAF A;  5AVZ B;  1L4A A;  1JY3 P;  1JNM A;  1LTT C;  5AW5 B;  4IFM A;  5AVS B;  2Q9I A;  1LTS C;  1M1J C;  5CCH A;  3T97 A;  3VMY A;  1L0N K;  2R32 A;  1ZR4 A;  1FOS F;  3B5N C;  1SQP K;  3TNU A;  5AW0 B;  2N1T B;  1LT9 B;  3V2R A;  4W7Y A;  4DOJ A;  3G3Z A;  4ZKP A;  1H8A A;  3MTU E;  1LWU A;  3TYY A;  5BVZ A;  5BU8 B;  1SQX K;  2FFD C;  2C9L Y;  4WB4 A;  2HOD A;  2WSF H;  5AVY B;  1ZLL A;  4JYC A;  4ZKU A;  3KPE A;  1J2J B;  2WWW A;  2Q3I A;  3LID A;  4LGD E;  1LTI C;  2WZ7 A;  3V2P A;  1JO5 A;  3M9Q A;  5AVQ B;  1LTA C;  5AW4 B;  2YNY A;  1T3J A;  2KB7 P;  1X79 B;  3SWF A;  3VOP A;  3M9H A;  1CW5 A;  1LWU B;  2WSE H;  3BRT B;  3HUS C;  3HE5 B;  1IFJ A;  1GK4 A;  2L5G B;  5CCG D;  2R5D A;  3P8M C;  4C7N B;  3L37 A;  3NTN A;  1N86 A;  1URQ D;  4IFF A;  2H7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...