1DEEG

Structure of s. aureus protein a bound to a human igm fab
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
51
structure length
51
Chain Sequence
DQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IGM RF 2A2
publication title Crystal structure of a Staphylococcus aureus protein A domain complexed with the Fab fragment of a human IgM antibody: structural basis for recognition of B-cell receptors and superantigen activity.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 17
structure length 51
sequence length 51
chains with identical sequence H
ec nomenclature
pdb deposition date 1999-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1deeG00
1OVRA 1FC2C 1U7JA 1OVUA 4HB1A 2KUBA 2ZAEB 5C39A 2UWJE 1Q2NA 3MHVA 5EFWB 3MZWB 5DJUB 1EDKA 4NPEA 1EDIA 2KZIA 1SS1A 4BXLA 4ZNCA 4GOFA 4GODA 5CBOA 2K3RA 1X0TA 5CBNA 2SPZA 5DJTB 1ZW0A 4JBZA 2JWDA 1S3JA 2QVAA 2M0BA 4WWIA 2B88A 1LT1A 2P58A 1U7MA 2WMMA 4MN4C 2B87A 2B89A 1BDCA 2Q1KA 4HKZH 1MFTA 1EDLA 4NPFX 2OTKE 5K5GB 3ZDMA 2QRXA 3FXEA 2M5AA 1NVOA 4KJMA 4K3AA 4ZMDA 1EDJA 2RKLA 3RGUA 1EC5A 2LXBA 4GOEA 1LP1A 2KS1B 1DEEG 4IOIH 2LR2A 1H0TA 4CPGA 2HR3A 1LP1B 3S1KA 2LXCB 2B87B 2R44A 4NPDA 4K35A 4EYYQ 3QWOC 4HJGH 2M5AB 1JM0A 2KIKA 3PH0A 2KZJA 1BDDA 1OVVA 4ASVA 1JMBA 3FXDA 1H0TB 4ASWA 2KI7B 1Y47A 2I8DA 1ZXGA
chains in the Genus database with same CATH superfamily
3IAOA 1OVUA 3A0BE 4WY4B 5TISE 3TF5A 1FZCA 2FKWB 4NPEA 1EDIA 2ZYGA 4RKUJ 3H1HE 4GOFA 3Q2YA 4H44B 1USEA 1X0TA 3I56P 1K04A 3H1HJ 3HE5B 3HE4A 2Q9IA 4JBZA 2JWDA 3H6PA 2E74D 4OGQC 3L36A 3M9QA 4GDOA 3PTZA 2W8ZA 4RJTA 5TJHA 1CI6B 1SQQG 4OGQD 2D2CB 1JTHB 2KLUA 2B89A 4EIJA 2GM4A 1RQUA 2MKVA 2ZT9C 3VN0A 4U3FG 5KJ7A 1FZAA 3KXDA 4NPFX 4IL6H 1JY3N 2WVRA 2ZT9D 2P1JA 2J5UA 5GTIE 2JEEA 1GMJA 1YITP 4GT1A 4I2LC 2ZYDA 5CCHC 2FYNB 3AE3C 3SFEC 3A5TA 1RF1B 1VQ8P 1EZVI 3QWOC 1DX7A 2DW3A 2L91A 2Z4EA 2KSEA 1NU1K 2A06D 1L0NE 3D71A 3FXDA 1H0TB 1M57D 1VQKP 1IFNA 2IBZI 3RL0C 1IZNB 1L0NJ 1IC2A 5BU8B 2YXRB 3HD7B 1RF0A 2CPBA 2XV5A 5AW4B 1KV4A 1KB9E 1PGPA 4Y99C 1OW6A 4ZNCA 1NTKE 3IF4A 3O8ZA 1NKZB 2KOGA 1NTKJ 3CXHD 2ZJSE 1GL2C 3MGNA 1RE4A 2Y0EA 1S4XA 3VP8A 4WY4D 1VF5C 1NHLA 2FXPA 3CL3D 2QM8A 4H44D 1VF5D 5CCGD 1EDLA 1AFOA 1FZBA 3B4SA 3V2PA 3RK2C 4N78E 2WT7A 1URQA 2YMYA 1Q81Q 2KYVA 3RK2D 2HPCA 2HR3A 4PD4D 2D2CD 1JY2P 4AUWA 3K5BA 1KFMA 2QEXP 2H8PD 3C8VA 4H13C 2PAJA 3PRJA 2WITA 3TYYA 5AW6B 1PIXA 2FFDB 1N73C 1PGOA 3A7OA 3G9RA 5B66H 3HUSC 2WPQA 4H13D 3HUSA 3KPEA 1M7LA 2ZXXA 5E79E 2V4HA 1SLQA 2H88C 2YKQA 3B5NB 5CHXA 4DOJA 2G8YA 1DD3A 2FYUE 3CD6P 2WSCH 1RF1C 3H1ID 4HB1A 2QE7H 1LWUB 1N7SB 4YXDC 5DJUB 1SFCB 1VQOP 1QL1A 3L72G 3BASA 3EFFK 1MKMA 3H1JE 2QIWA 1DH3A 4JPZB 5AVZB 1NTZE 3H1JJ 2FXMA 1NTZJ 2YXQB 1BDCA 1NU1D 2E76B 3CCEP 1AVOA 1A02J 4WB4A 1NO4A 1OZHA 3V4WA 1S5LE 2OYOA 2Y9ZA 1EZVE 1VQPP 3GW6A 3RK3C 1LP1A 3GHGA 3H1KJ 4IL6X 3AECC 3KYQA 5KAFH 1L0LE 3G3ZA 4NPDA 1ZR4A 2IDBA 1PFIA 2JDIH 5KKZC 4EI2A 3TGUD 1L0LJ 3WUUA 2WSFJ 3CX5D 2KIKA 2FYZA 1KYOH 3CLQA 1BDDA 3CXHI 1OX3A 2JP3A 1LGHB 2ZFCA 2KSJA 3V5BA 4C46A 4H0LC 1U7JA 5EFWB 2AXTE 1KN7A 4M3LA 4H0LD 4BXLA 1SP4A 5CBOA 1OXZA 4XA4A 3BRVB 2JWAA 4QMAA 4DZOA 5AW9B 3ABVC 1IFPA 3KZIH 2FYUG 4YTPC 3B5ND 3M91A 4EOTA 2GUVA 4XE5B 1FU1A 1RH5B 2XNXA 4PD4I 2B88A 1NKNA 3AEEC 2E5YA 2NPSC 1N7SD 4AQRD 4Y28J 2B87A 2O3JA 3QH9A 4D6TE 1G1JA 1SFCD 4N78D 1KQLA 3B8EB 3GF3A 4HKZH 2NPSD 1P84D 2PRRA 4D6TJ 1KILC 1QL2A 3L73E 3P32A 5K5GB 1EDJA 4K3AA 3L73J 1KQGB 4OH8B 1KILD 5APQA 3M0AA 3L71E 1JY3P 1PPJG 1Q7YQ 1BSHA 4GOEA 3L71J 1H89A 3A0HE 1VQMP 2KNCA 1HGVA 3H32B 2E76D 2IFNA 3O6QB 4Z1MH 1HH0A 2N9YB 2YIUC 2O1KA 4GIFA 1GD2E 3E1RA 3BCCE 1EXIA 1R5SA 2BEQD 3IR9A 1S9KE 1EZVG 1K73Q 3BCCJ 5KTBA 2XKMA 3TNUA 3AE1C 1ZN5A 1AV1A 2OYHC 3SWFA 1M8OB 5B5EE 2IBZG 5APSA 1L4AA 4W80A 3T97B 1FZCB 3RBZA 1K05A 3CCSP 1K8AQ 5APWA 1FDOA 3WMM0 5AVRB 2KS1A 4OGQB 2WMMA 1FOSF 1GK6A 3V6IA 2A06E 3H1KD 3A0BH 4I7ZC 1MFZA 2ZT9B 5TISH 3CX5I 3SWKA 2XU6A 2RMZA 1SQXG 2N1TA 1LTBC 2C9LY 2OYIA 1IFMA 1N7LA 3L74D 3S1KA 2LXCB 2W83C 1W2BO 1J1EC 3CXHE 3TDKA 5AVTB 1GDTA 2L5GB 3U1AA 1D7MA 3AE9C 3GF7A 1JM0A 3FGAD 2KZJA 1LTJC 4WVZA 1VQ7P 2WTYA 1IK7A 2K9JA 1Y47A 4I6MC 1T3UA 1IJDB 3RL0B 1VQ9P 1NGMB 1YI2P 2BCCG 1Q2NA 1P84I 3OJAB 4PD4E 2G3AA 3OAKA 2O1JA 2YNYA 4Y99B 4D6TD 4U7JA 1YIJP 2SPZA 4BRYB 1QVFO 3L73D 4R4MA 1FZCC 1GL2B 2IZ1A 1XTCC 3L71D 4R4LA 1W2EA 2I1JA 2Q1KA 1VF5B 5BVZA 3H1IE 3R4YA 1XTGB 1NVOA 3V2QA 3H1IJ 3P8MC 1HBWA 3BCCD 3RK2B 4UB8E 1S9KD 1W5CE 1ZMEC 4PJ0E 5CJ4A 5KJ7C 3WUVA 5KLVE 5KJ7D 1YJWP 4H13B 1M1JA 5KLVJ 1N73B 4PV1C 3VTPC 3HUSB 2QG4A 3PH0A 1NU1E 1QEXA 2QJPC 3L75J 4PV1D 4ASVA 1NU1J 5AW2B 1S2EA 2K88A 4A7PA 1RHZB 3V2RA 4ZKUA 5KLVK 3Q3DA 5CCHD 1JNMA 1RQVA 1N8RQ 1JEKA 1M56D 1T6AA 1SS1A 5KAIE 4YPCA 3WU2E 3M0DA 3HTKA 3SWYA 4LC1A 3TGUE 3M06A 1NH4A 1KMIZ 2M0BA 1JY2O 1LT1A 3RL0D 3TGUJ 2H43A 3CX5E 1RF0C 1Q82Q 2P7JA 1NTME 3MIWA 3AE7C 5AVQB 2QJYC 3AE8C 1NTMJ 2OGUA 4U3FD 2IYOA 3M9BA 1MFTA 4KHXA 2QRXA 1PP9E 2W27A 3CMEP 2M3EA 1RE4C 1PP9J 2XDJA 1GL2D 3H1HG 3RK3B 1LP1B 1YJNP 1NTMK 1LTAC 1WMKA 2YO2A 2V7QH 3H1IG 2Q3EA 3GG2A 4WY4A 1ZR2A 3F89A 2H89C 1SQBK 5KKZB 2M5AB 2CPSA 4IL6E 3IN6A 1URQC 1ZP0C 1QX8A 3HE5A 1P84E 1S5LH 1URQD 2I8DA 3Q5RA 2E43A 1SQVK 2WQYC 1KILE 3V2NA 3Q1MA 1AVYA 4H0LB 1CI6A 1PZQA 3EWKA 1ZRTD 1NU1G 2E75C 1VQNP 1DIPA 2IZ0A 2WSFH 3G4SP 2J59M 2GUSA 1YYCA 1ZW0A 3AEGC 4BWNA 3CCLP 1VQLP 2NPSB 1L0NG 3H25A 1ZOYC 3L37A 2AXTH 2A45G 3CI9A 2OTKE 2JKVA 1KILB 4C7NB 1YQ3C 2QSIA 5KLVD 3AE5C 2ZXEB 3L75D 1H0TA 4CPGA 4DJGA 1NTKG 1WT6A 3CWBD 2R44A 3SSUA 3LW5H 3GLMA 1BCCD 1NYHA 3HD7A 3L35A 2C0XA 1R8EA 2YIUB 1PV3A 2WPSA 4KT0J 4IFDK 3H1KE 3LIDA 4XFJA 2KXPB 3GHGC 3OA7A 1LTGC 3H1LD 3PHLA 3RK3D 4IFFA 2OYHB 2FBWC 4RESB 3AEDC 2W6JH 3CCRP 1IK9A 3R2PA 4DT0A 3AE4C 2UWJE 3W67A 1G2CB 3V4QA 3M9HA 5H2FH 3L74E 2KZIA 5B66E 1X79B 1NTMD 3L74J 1K9MQ 1VDFA 1JY3O 3D6YA 3L72D 3MD0A 1HJBA 3CCMP 1IO4A 1Y9BA 3L4FA 1J2JB 3AEAC 3S4RA 2OTLP 2GA1A 1SQBD 4WWIA 2P58A 1PP9D 4MN4C 3MUDA 1LJ2A 5B5EH 2IFMA 2WSCJ 4JF7A 1FDIA 1FZEA 1T3JA 2POHA 1BE3J 2FFDA 3MP7B 1SQVD 4I7ZB 3FXEA 1SQPK 4ZMDA 1VQ4P 4JYBA 3RBXA 2P2UA 1LTTC 5APVA 1OMIA 5AVYB 1OFCX 1J1EB 3H1JG 1LWUA 1N7SA 1FE6A 3B71A 1SFCA 1NTZG 2AEMA 1GW3A 3CC2P 3TSIA 1LNQA 1BGYE 3CCQP 1JCCA 2WZ7A 1BGYJ 3CC4P 3CCUP 1LTJB 3VYIA 5APTA 1YJ9P 1GU5A 1AA0A 1HTLC 2QA4P 1RY3A 3IFMA 1SQXK 2R3SA 5GTHH 5C39A 3II6A 1HVVA 2KLVA 5KAFE 1DD4A 1FBMA 2JR8A 3CXHH 3H1KG 3JSVC 2HODB 1GK4A 3P7KA 2O01H 1L0LG 2Y0CA 1VQ6P 2QVAA 2Y9YA 1L4AC 1U7MA 2KK7A 3NTNA 3VP9A 5AVXB 3L70D 3G71P 2ZYAA 1LT9C 5APYA 1LT9A 2WSEH 1X8YA 1WRGA 1L2PA 1J1DC 1S72P 2IX7C 2Q3IA 1NAFA 3I5CA 3HE4B 4OVNF 2ZVNB 3KZIE 5AW8B 4N6JA 2JJLA 3RGUA 1PPJD 3CCVP 2O01N 4IOIH 2LR2A 3P8CD 4I1LA 3N4XA 1NJIQ 2WWWA 1M1KQ 3FWLA 2N1TC 3FWNA 1OWAA 2OYIC 2CK3H 4PV1B 4D6TG 4U3FE 2QJPB 2W6AA 1BSNA 4B86A 4UB8H 4U3FJ 3L73G 1OVRA 1SQPD 2QM7A 1JO5A 4PJ0H 5BU5A 3L71G 5CJ0A 1TU3F 1FAVA 3VMYA 2W6BA 1KTMA 1OIPA 1SQQK 1IFDA 1QLED 5AVVB 1BE3D 1KFNA 3I55P 5GTIH 3KHUA 1JMMA 2Q7CA 2R5DA 2M3BA 3BCCG 3EFGA 2H7HA 4L76A 1GW4A 4OWFA 2Z5IA 2QJYB 3O6QA 2C9NY 3C1LA 2IPPA 2QJKC 4KJMA 3JCUE 2C0WA 1SQXD 1A02F 1H88A 1ZRTE 3AE2C 3WU2H 2A45H 1JUNA 2AEJA 1BGYD 1ZV8A 1NOHA 3CX5H 3PP5A 4UB6E 2K37A 4LGDE 2OARA 4K35A 2Q6QA 2RN0A 1KB9H 2YO3A 2OTJP 3T97A 1YBKA 1PGJA 1PL5A 3VMAA 2WT7B 2A06G 1URQB 1T8ZA 3U59A 2HPCB 2ZVOB 2E74C 2KI7B 1GTWA 5KLIC 1KYOD 2ZAEB 1JOCA 1CZQA 3KDPB 1M1JC 2BCCD 3MHVA 3MZWB 5CMZA 3L75E 3CMAP 4GKGA 1N86A 3S9OA 2E75B 3CWBE 1Q90D 3NMDA 1BCCE 3Q5SA 4ZKPA 3CWBJ 5DJTB 1USDA 1BCCJ 1P84H 1YTZT 2Z5HA 4L75A 1KC8Q 4C7RA 3CCJP 1EQ7A 2KP8A 3H1LE 1IFJA 1YQ4C 3RK3E 3PJSK 3NFQA 3H1LJ 3U1CA 3M0DC 3LIEA 5AW0B 5CCHA 5E79H 1AQTA 1T2KC 2Y0DA 2AEFA 1UIXA 2RKLA 1EC5A 1T2KD 5M1BA 2OQQA 2BEZF 1YHQP 1SQQD 3L72E 3L72J 2R3CA 2FY8A 2PGDA 1SQBE 2ITAA 3E1IA 1SQBJ 2FXOA 2P67A 1KORA 3G6EP 2WPVB 2I1KA 1S1CX 1SQVE 2R5BA 4BRYA 3GHGB 1KD1Q 1L0NK 1Q86Q 1ZXGA 1DEBA 1SQVJ 4WY4C 1QVGO 1GL2A 3A3YB 4N3YB 4YXWH 3D70A 1EDKA 4H44C 5CCGC 2P10A 5CCGA 4LLHA 1E5WA 1HWTC 1FOSE 1NTKK 2HLOA 5KLVG 3N7NA 3A2AA 2D2CC 3UIAA 1JTHA 2NRGA 2PP6A 2BASA 5AW5B 3L75G 1VPCA 2XNDH 3FX0A 2WPRA 3CWBG 1BCCG 4TT3H 2E75D 1NAYA 2HG5D 2KB7P 1KQFB 3ZDMA 1N73A 1LTSC 2RH0A 1HGZA 1DEEG 3H1LG 3CPWO 3H1HD 1KYOI 2B87B 2FYNC 1RF1A 1AJYA 2FYUJ 5AVWB 3TGUG 3BVHA 3VMZA 3L70E 3AEFC 5AW3B 1NTMG 3L70J 3USSA 3NXSA 1HUCA 4ASWA 2KNCB 2FYUK 3JC22 1JCDA 1SQBG 3HD7C 1PP9G 3W68A 1PPJE 2YKPA 1YTZI 5AW7B 2IYPA 3HD7D 3P8CE 1KQSO 2V7QJ 4GODA 3TK1A 3TNUB 3GMAA 2J58A 1SQVG 3EQ2A 5CBNA 1OW7A 1H8AA 1FJPA 3A0HH 4L74A 1NTZK 2K9YA 1L4AB 4O9BA 2K1AA 1JB0J 1LT9B 1L0ND 3ITKA 1GZLA 1SQPE 1CSBA 2IBZE 2M5AA 1J1DB 1SVFA 1SQPJ 1N2DC 4TLFA 2KS1B 3MUDC 1BE3E 1KB9D 4JYCA 1NTKD 2FFDC 1GU4A 1L0LK 4IFMA 4EYYQ 4HJGH 2N1TB 1HF9A 1Z56A 4WBAA 3Q5PA 3B5NC 2R32A 2OYIB 3B5NA 3MTUE 1JMBA 2NZ2A 1SQXE 1LWUC 1N7SC 2HYNA 1SFCC 1SQXJ 3L70G 2NPSA 3OW2O 2N9BA 1AQ5A 3LW5J 3PLNA 3SFDC 4RO0A 4W7ZA 1KILA 5AVUB 4C7NA 2K9JB 1HJ0A 1S3JA 1Y8AA 2AXCA 4DCKA 2MJZA 3RL0g 1S5LX 2E76C 2E42A 2VRSA 5H2FE 1FDMA 4HYTB 1KYOE 2FYUD 2YKOA 1RE3C 1RE3A 2QJKB 2BCCE 2M8RA 2LXBA 2BCCJ 1JY2N 3L74G 2W90A 1FZGA 1L4AD 2OYHA 3C9IA 3AEBC 1VL2A 3CC7P 1SQPG 5APUA 1MV8A 4PD4H 1ZLLA 2HFED 3H1JD 1G2CA 1FS0E 5APXA 1NTZD 4JQ0D 4W7YA 1M90Q 1FJKA 1BE3G 3JCUH 1MZ9A 3F5HA 2LKMA 2E74B 1VQ5P 1FC2C 2B9BA 2KUBA 5KLIB 1U57A 5AW1B 2PFXA 1R5LA 1E79H 1M1JB 4UB6H 1SQQE 4L73A 1EZVD 2N1TD 2A45I 1NWQA 2K3RA 1QGKB 1SQQJ 3VMXA 4EDFA 2Q5UA 1L0LD 5L8RJ 1PGQA 1KB9I 2IBZD 1FZFA 1BGYG 4HH2A 2WSSH 5GTHE 1IFIA 3D6ZA 4AYCA 3HTKB 2XZRA 1KZUB 3BATA 1MUUA 1EXJA 2O01J 2E5TA 2YMKA 1CW5A 1LTJA 3WUTA 3H32A 5AVSB 3HRNA 1OW8A 3AE6C 5KAIH 3VOPA 1LTIC 2JO1A 2WSEJ 2HODA 3BRTB 3E7KA 1OVVA 1G1IA 1X22A 3KQGA 1UIIA 1X9VA
chains in the Genus database with same CATH topology
1OVRA 1FC2C 1U7JA 1OVUA 4HB1A 2KUBA 2ZAEB 5C39A 2UWJE 1Q2NA 3MHVA 5EFWB 3MZWB 5DJUB 1EDKA 4NPEA 1EDIA 2KZIA 1SS1A 4BXLA 4ZNCA 4GOFA 4GODA 5CBOA 2K3RA 1X0TA 5CBNA 2SPZA 5DJTB 1ZW0A 4JBZA 2JWDA 1S3JA 2QVAA 2M0BA 4WWIA 2B88A 1LT1A 2P58A 1U7MA 2WMMA 4MN4C 2B87A 2B89A 1BDCA 2Q1KA 4HKZH 1MFTA 1EDLA 4NPFX 2OTKE 5K5GB 3ZDMA 2QRXA 3FXEA 2M5AA 1NVOA 4KJMA 4K3AA 4ZMDA 1EDJA 2RKLA 3RGUA 1EC5A 2LXBA 4GOEA 1LP1A 2KS1B 1DEEG 4IOIH 2LR2A 1H0TA 4CPGA 2HR3A 1LP1B 3S1KA 2LXCB 2B87B 2R44A 4NPDA 4K35A 4EYYQ 3QWOC 4HJGH 2M5AB 1JM0A 2KIKA 3PH0A 2KZJA 1BDDA 1OVVA 4ASVA 1JMBA 3FXDA 1H0TB 4ASWA 2KI7B 1Y47A 2I8DA 1ZXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVR A;  1FC2 C;  1U7J A;  1OVU A;  4HB1 A;  2KUB A;  2ZAE B;  5C39 A;  2UWJ E;  1Q2N A;  3MHV A;  5EFW B;  3MZW B;  5DJU B;  1EDK A;  4NPE A;  1EDI A;  2KZI A;  1SS1 A;  4BXL A;  4ZNC A;  4GOF A;  4GOD A;  5CBO A;  2K3R A;  1X0T A;  5CBN A;  2SPZ A;  5DJT B;  1ZW0 A;  4JBZ A;  2JWD A;  1S3J A;  2QVA A;  2M0B A;  4WWI A;  2B88 A;  1LT1 A;  2P58 A;  1U7M A;  2WMM A;  4MN4 C;  2B87 A;  2B89 A;  1BDC A;  2Q1K A;  4HKZ H;  1MFT A;  1EDL A;  4NPF X;  2OTK E;  5K5G B;  3ZDM A;  2QRX A;  3FXE A;  2M5A A;  1NVO A;  4KJM A;  4K3A A;  4ZMD A;  1EDJ A;  2RKL A;  3RGU A;  1EC5 A;  2LXB A;  4GOE A;  1LP1 A;  2KS1 B;  1DEE G;  4IOI H;  2LR2 A;  1H0T A;  4CPG A;  2HR3 A;  1LP1 B;  3S1K A;  2LXC B;  2B87 B;  2R44 A;  4NPD A;  4K35 A;  4EYY Q;  3QWO C;  4HJG H;  2M5A B;  1JM0 A;  2KIK A;  3PH0 A;  2KZJ A;  1BDD A;  1OVV A;  4ASV A;  1JMB A;  3FXD A;  1H0T B;  4ASW A;  2KI7 B;  1Y47 A;  2I8D A;  1ZXG A; 
#chains in the Genus database with same CATH topology
 3IAO A;  1OVU A;  3A0B E;  4WY4 B;  5TIS E;  3TF5 A;  1FZC A;  2FKW B;  4NPE A;  1EDI A;  2ZYG A;  4RKU J;  3H1H E;  4GOF A;  3Q2Y A;  4H44 B;  1USE A;  1X0T A;  3I56 P;  1K04 A;  3H1H J;  3HE5 B;  3HE4 A;  2Q9I A;  4JBZ A;  2JWD A;  3H6P A;  2E74 D;  4OGQ C;  3L36 A;  3M9Q A;  4GDO A;  3PTZ A;  2W8Z A;  4RJT A;  5TJH A;  1CI6 B;  1SQQ G;  4OGQ D;  2D2C B;  1JTH B;  2KLU A;  2B89 A;  4EIJ A;  2GM4 A;  1RQU A;  2MKV A;  2ZT9 C;  3VN0 A;  4U3F G;  5KJ7 A;  1FZA A;  3KXD A;  4NPF X;  4IL6 H;  1JY3 N;  2WVR A;  2ZT9 D;  2P1J A;  2J5U A;  5GTI E;  2JEE A;  1GMJ A;  1YIT P;  4GT1 A;  4I2L C;  2ZYD A;  5CCH C;  2FYN B;  3AE3 C;  3SFE C;  3A5T A;  1RF1 B;  1VQ8 P;  1EZV I;  3QWO C;  1DX7 A;  2DW3 A;  2L91 A;  2Z4E A;  2KSE A;  1NU1 K;  2A06 D;  1L0N E;  3D71 A;  3FXD A;  1H0T B;  1M57 D;  1VQK P;  1IFN A;  2IBZ I;  3RL0 C;  1IZN B;  1L0N J;  1IC2 A;  5BU8 B;  2YXR B;  3HD7 B;  1RF0 A;  2CPB A;  2XV5 A;  5AW4 B;  1KV4 A;  1KB9 E;  1PGP A;  4Y99 C;  1OW6 A;  4ZNC A;  1NTK E;  3IF4 A;  3O8Z A;  1NKZ B;  2KOG A;  1NTK J;  3CXH D;  2ZJS E;  1GL2 C;  3MGN A;  1RE4 A;  2Y0E A;  1S4X A;  3VP8 A;  4WY4 D;  1VF5 C;  1NHL A;  2FXP A;  3CL3 D;  2QM8 A;  4H44 D;  1VF5 D;  5CCG D;  1EDL A;  1AFO A;  1FZB A;  3B4S A;  3V2P A;  3RK2 C;  4N78 E;  2WT7 A;  1URQ A;  2YMY A;  1Q81 Q;  2KYV A;  3RK2 D;  2HPC A;  2HR3 A;  4PD4 D;  2D2C D;  1JY2 P;  4AUW A;  3K5B A;  1KFM A;  2QEX P;  2H8P D;  3C8V A;  4H13 C;  2PAJ A;  3PRJ A;  2WIT A;  3TYY A;  5AW6 B;  1PIX A;  2FFD B;  1N73 C;  1PGO A;  3A7O A;  3G9R A;  5B66 H;  3HUS C;  2WPQ A;  4H13 D;  3HUS A;  3KPE A;  1M7L A;  2ZXX A;  5E79 E;  2V4H A;  1SLQ A;  2H88 C;  2YKQ A;  3B5N B;  5CHX A;  4DOJ A;  2G8Y A;  1DD3 A;  2FYU E;  3CD6 P;  2WSC H;  1RF1 C;  3H1I D;  4HB1 A;  2QE7 H;  1LWU B;  1N7S B;  4YXD C;  5DJU B;  1SFC B;  1VQO P;  1QL1 A;  3L72 G;  3BAS A;  3EFF K;  1MKM A;  3H1J E;  2QIW A;  1DH3 A;  4JPZ B;  5AVZ B;  1NTZ E;  3H1J J;  2FXM A;  1NTZ J;  2YXQ B;  1BDC A;  1NU1 D;  2E76 B;  3CCE P;  1AVO A;  1A02 J;  4WB4 A;  1NO4 A;  1OZH A;  3V4W A;  1S5L E;  2OYO A;  2Y9Z A;  1EZV E;  1VQP P;  3GW6 A;  3RK3 C;  1LP1 A;  3GHG A;  3H1K J;  4IL6 X;  3AEC C;  3KYQ A;  5KAF H;  1L0L E;  3G3Z A;  4NPD A;  1ZR4 A;  2IDB A;  1PFI A;  2JDI H;  5KKZ C;  4EI2 A;  3TGU D;  1L0L J;  3WUU A;  2WSF J;  3CX5 D;  2KIK A;  2FYZ A;  1KYO H;  3CLQ A;  1BDD A;  3CXH I;  1OX3 A;  2JP3 A;  1LGH B;  2ZFC A;  2KSJ A;  3V5B A;  4C46 A;  4H0L C;  1U7J A;  5EFW B;  2AXT E;  1KN7 A;  4M3L A;  4H0L D;  4BXL A;  1SP4 A;  5CBO A;  1OXZ A;  4XA4 A;  3BRV B;  2JWA A;  4QMA A;  4DZO A;  5AW9 B;  3ABV C;  1IFP A;  3KZI H;  2FYU G;  4YTP C;  3B5N D;  3M91 A;  4EOT A;  2GUV A;  4XE5 B;  1FU1 A;  1RH5 B;  2XNX A;  4PD4 I;  2B88 A;  1NKN A;  3AEE C;  2E5Y A;  2NPS C;  1N7S D;  4AQR D;  4Y28 J;  2B87 A;  2O3J A;  3QH9 A;  4D6T E;  1G1J A;  1SFC D;  4N78 D;  1KQL A;  3B8E B;  3GF3 A;  4HKZ H;  2NPS D;  1P84 D;  2PRR A;  4D6T J;  1KIL C;  1QL2 A;  3L73 E;  3P32 A;  5K5G B;  1EDJ A;  4K3A A;  3L73 J;  1KQG B;  4OH8 B;  1KIL D;  5APQ A;  3M0A A;  3L71 E;  1JY3 P;  1PPJ G;  1Q7Y Q;  1BSH A;  4GOE A;  3L71 J;  1H89 A;  3A0H E;  1VQM P;  2KNC A;  1HGV A;  3H32 B;  2E76 D;  2IFN A;  3O6Q B;  4Z1M H;  1HH0 A;  2N9Y B;  2YIU C;  2O1K A;  4GIF A;  1GD2 E;  3E1R A;  3BCC E;  1EXI A;  1R5S A;  2BEQ D;  3IR9 A;  1S9K E;  1EZV G;  1K73 Q;  3BCC J;  5KTB A;  2XKM A;  3TNU A;  3AE1 C;  1ZN5 A;  1AV1 A;  2OYH C;  3SWF A;  1M8O B;  5B5E E;  2IBZ G;  5APS A;  1L4A A;  4W80 A;  3T97 B;  1FZC B;  3RBZ A;  1K05 A;  3CCS P;  1K8A Q;  5APW A;  1FDO A;  3WMM 0;  5AVR B;  2KS1 A;  4OGQ B;  2WMM A;  1FOS F;  1GK6 A;  3V6I A;  2A06 E;  3H1K D;  3A0B H;  4I7Z C;  1MFZ A;  2ZT9 B;  5TIS H;  3CX5 I;  3SWK A;  2XU6 A;  2RMZ A;  1SQX G;  2N1T A;  1LTB C;  2C9L Y;  2OYI A;  1IFM A;  1N7L A;  3L74 D;  3S1K A;  2LXC B;  2W83 C;  1W2B O;  1J1E C;  3CXH E;  3TDK A;  5AVT B;  1GDT A;  2L5G B;  3U1A A;  1D7M A;  3AE9 C;  3GF7 A;  1JM0 A;  3FGA D;  2KZJ A;  1LTJ C;  4WVZ A;  1VQ7 P;  2WTY A;  1IK7 A;  2K9J A;  1Y47 A;  4I6M C;  1T3U A;  1IJD B;  3RL0 B;  1VQ9 P;  1NGM B;  1YI2 P;  2BCC G;  1Q2N A;  1P84 I;  3OJA B;  4PD4 E;  2G3A A;  3OAK A;  2O1J A;  2YNY A;  4Y99 B;  4D6T D;  4U7J A;  1YIJ P;  2SPZ A;  4BRY B;  1QVF O;  3L73 D;  4R4M A;  1FZC C;  1GL2 B;  2IZ1 A;  1XTC C;  3L71 D;  4R4L A;  1W2E A;  2I1J A;  2Q1K A;  1VF5 B;  5BVZ A;  3H1I E;  3R4Y A;  1XTG B;  1NVO A;  3V2Q A;  3H1I J;  3P8M C;  1HBW A;  3BCC D;  3RK2 B;  4UB8 E;  1S9K D;  1W5C E;  1ZME C;  4PJ0 E;  5CJ4 A;  5KJ7 C;  3WUV A;  5KLV E;  5KJ7 D;  1YJW P;  4H13 B;  1M1J A;  5KLV J;  1N73 B;  4PV1 C;  3VTP C;  3HUS B;  2QG4 A;  3PH0 A;  1NU1 E;  1QEX A;  2QJP C;  3L75 J;  4PV1 D;  4ASV A;  1NU1 J;  5AW2 B;  1S2E A;  2K88 A;  4A7P A;  1RHZ B;  3V2R A;  4ZKU A;  5KLV K;  3Q3D A;  5CCH D;  1JNM A;  1RQV A;  1N8R Q;  1JEK A;  1M56 D;  1T6A A;  1SS1 A;  5KAI E;  4YPC A;  3WU2 E;  3M0D A;  3HTK A;  3SWY A;  4LC1 A;  3TGU E;  3M06 A;  1NH4 A;  1KMI Z;  2M0B A;  1JY2 O;  1LT1 A;  3RL0 D;  3TGU J;  2H43 A;  3CX5 E;  1RF0 C;  1Q82 Q;  2P7J A;  1NTM E;  3MIW A;  3AE7 C;  5AVQ B;  2QJY C;  3AE8 C;  1NTM J;  2OGU A;  4U3F D;  2IYO A;  3M9B A;  1MFT A;  4KHX A;  2QRX A;  1PP9 E;  2W27 A;  3CME P;  2M3E A;  1RE4 C;  1PP9 J;  2XDJ A;  1GL2 D;  3H1H G;  3RK3 B;  1LP1 B;  1YJN P;  1NTM K;  1LTA C;  1WMK A;  2YO2 A;  2V7Q H;  3H1I G;  2Q3E A;  3GG2 A;  4WY4 A;  1ZR2 A;  3F89 A;  2H89 C;  1SQB K;  5KKZ B;  2M5A B;  2CPS A;  4IL6 E;  3IN6 A;  1URQ C;  1ZP0 C;  1QX8 A;  3HE5 A;  1P84 E;  1S5L H;  1URQ D;  2I8D A;  3Q5R A;  2E43 A;  1SQV K;  2WQY C;  1KIL E;  3V2N A;  3Q1M A;  1AVY A;  4H0L B;  1CI6 A;  1PZQ A;  3EWK A;  1ZRT D;  1NU1 G;  2E75 C;  1VQN P;  1DIP A;  2IZ0 A;  2WSF H;  3G4S P;  2J59 M;  2GUS A;  1YYC A;  1ZW0 A;  3AEG C;  4BWN A;  3CCL P;  1VQL P;  2NPS B;  1L0N G;  3H25 A;  1ZOY C;  3L37 A;  2AXT H;  2A45 G;  3CI9 A;  2OTK E;  2JKV A;  1KIL B;  4C7N B;  1YQ3 C;  2QSI A;  5KLV D;  3AE5 C;  2ZXE B;  3L75 D;  1H0T A;  4CPG A;  4DJG A;  1NTK G;  1WT6 A;  3CWB D;  2R44 A;  3SSU A;  3LW5 H;  3GLM A;  1BCC D;  1NYH A;  3HD7 A;  3L35 A;  2C0X A;  1R8E A;  2YIU B;  1PV3 A;  2WPS A;  4KT0 J;  4IFD K;  3H1K E;  3LID A;  4XFJ A;  2KXP B;  3GHG C;  3OA7 A;  1LTG C;  3H1L D;  3PHL A;  3RK3 D;  4IFF A;  2OYH B;  2FBW C;  4RES B;  3AED C;  2W6J H;  3CCR P;  1IK9 A;  3R2P A;  4DT0 A;  3AE4 C;  2UWJ E;  3W67 A;  1G2C B;  3V4Q A;  3M9H A;  5H2F H;  3L74 E;  2KZI A;  5B66 E;  1X79 B;  1NTM D;  3L74 J;  1K9M Q;  1VDF A;  1JY3 O;  3D6Y A;  3L72 D;  3MD0 A;  1HJB A;  3CCM P;  1IO4 A;  1Y9B A;  3L4F A;  1J2J B;  3AEA C;  3S4R A;  2OTL P;  2GA1 A;  1SQB D;  4WWI A;  2P58 A;  1PP9 D;  4MN4 C;  3MUD A;  1LJ2 A;  5B5E H;  2IFM A;  2WSC J;  4JF7 A;  1FDI A;  1FZE A;  1T3J A;  2POH A;  1BE3 J;  2FFD A;  3MP7 B;  1SQV D;  4I7Z B;  3FXE A;  1SQP K;  4ZMD A;  1VQ4 P;  4JYB A;  3RBX A;  2P2U A;  1LTT C;  5APV A;  1OMI A;  5AVY B;  1OFC X;  1J1E B;  3H1J G;  1LWU A;  1N7S A;  1FE6 A;  3B71 A;  1SFC A;  1NTZ G;  2AEM A;  1GW3 A;  3CC2 P;  3TSI A;  1LNQ A;  1BGY E;  3CCQ P;  1JCC A;  2WZ7 A;  1BGY J;  3CC4 P;  3CCU P;  1LTJ B;  3VYI A;  5APT A;  1YJ9 P;  1GU5 A;  1AA0 A;  1HTL C;  2QA4 P;  1RY3 A;  3IFM A;  1SQX K;  2R3S A;  5GTH H;  5C39 A;  3II6 A;  1HVV A;  2KLV A;  5KAF E;  1DD4 A;  1FBM A;  2JR8 A;  3CXH H;  3H1K G;  3JSV C;  2HOD B;  1GK4 A;  3P7K A;  2O01 H;  1L0L G;  2Y0C A;  1VQ6 P;  2QVA A;  2Y9Y A;  1L4A C;  1U7M A;  2KK7 A;  3NTN A;  3VP9 A;  5AVX B;  3L70 D;  3G71 P;  2ZYA A;  1LT9 C;  5APY A;  1LT9 A;  2WSE H;  1X8Y A;  1WRG A;  1L2P A;  1J1D C;  1S72 P;  2IX7 C;  2Q3I A;  1NAF A;  3I5C A;  3HE4 B;  4OVN F;  2ZVN B;  3KZI E;  5AW8 B;  4N6J A;  2JJL A;  3RGU A;  1PPJ D;  3CCV P;  2O01 N;  4IOI H;  2LR2 A;  3P8C D;  4I1L A;  3N4X A;  1NJI Q;  2WWW A;  1M1K Q;  3FWL A;  2N1T C;  3FWN A;  1OWA A;  2OYI C;  2CK3 H;  4PV1 B;  4D6T G;  4U3F E;  2QJP B;  2W6A A;  1BSN A;  4B86 A;  4UB8 H;  4U3F J;  3L73 G;  1OVR A;  1SQP D;  2QM7 A;  1JO5 A;  4PJ0 H;  5BU5 A;  3L71 G;  5CJ0 A;  1TU3 F;  1FAV A;  3VMY A;  2W6B A;  1KTM A;  1OIP A;  1SQQ K;  1IFD A;  1QLE D;  5AVV B;  1BE3 D;  1KFN A;  3I55 P;  5GTI H;  3KHU A;  1JMM A;  2Q7C A;  2R5D A;  2M3B A;  3BCC G;  3EFG A;  2H7H A;  4L76 A;  1GW4 A;  4OWF A;  2Z5I A;  2QJY B;  3O6Q A;  2C9N Y;  3C1L A;  2IPP A;  2QJK C;  4KJM A;  3JCU E;  2C0W A;  1SQX D;  1A02 F;  1H88 A;  1ZRT E;  3AE2 C;  3WU2 H;  2A45 H;  1JUN A;  2AEJ A;  1BGY D;  1ZV8 A;  1NOH A;  3CX5 H;  3PP5 A;  4UB6 E;  2K37 A;  4LGD E;  2OAR A;  4K35 A;  2Q6Q A;  2RN0 A;  1KB9 H;  2YO3 A;  2OTJ P;  3T97 A;  1YBK A;  1PGJ A;  1PL5 A;  3VMA A;  2WT7 B;  2A06 G;  1URQ B;  1T8Z A;  3U59 A;  2HPC B;  2ZVO B;  2E74 C;  2KI7 B;  1GTW A;  5KLI C;  1KYO D;  2ZAE B;  1JOC A;  1CZQ A;  3KDP B;  1M1J C;  2BCC D;  3MHV A;  3MZW B;  5CMZ A;  3L75 E;  3CMA P;  4GKG A;  1N86 A;  3S9O A;  2E75 B;  3CWB E;  1Q90 D;  3NMD A;  1BCC E;  3Q5S A;  4ZKP A;  3CWB J;  5DJT B;  1USD A;  1BCC J;  1P84 H;  1YTZ T;  2Z5H A;  4L75 A;  1KC8 Q;  4C7R A;  3CCJ P;  1EQ7 A;  2KP8 A;  3H1L E;  1IFJ A;  1YQ4 C;  3RK3 E;  3PJS K;  3NFQ A;  3H1L J;  3U1C A;  3M0D C;  3LIE A;  5AW0 B;  5CCH A;  5E79 H;  1AQT A;  1T2K C;  2Y0D A;  2AEF A;  1UIX A;  2RKL A;  1EC5 A;  1T2K D;  5M1B A;  2OQQ A;  2BEZ F;  1YHQ P;  1SQQ D;  3L72 E;  3L72 J;  2R3C A;  2FY8 A;  2PGD A;  1SQB E;  2ITA A;  3E1I A;  1SQB J;  2FXO A;  2P67 A;  1KOR A;  3G6E P;  2WPV B;  2I1K A;  1S1C X;  1SQV E;  2R5B A;  4BRY A;  3GHG B;  1KD1 Q;  1L0N K;  1Q86 Q;  1ZXG A;  1DEB A;  1SQV J;  4WY4 C;  1QVG O;  1GL2 A;  3A3Y B;  4N3Y B;  4YXW H;  3D70 A;  1EDK A;  4H44 C;  5CCG C;  2P10 A;  5CCG A;  4LLH A;  1E5W A;  1HWT C;  1FOS E;  1NTK K;  2HLO A;  5KLV G;  3N7N A;  3A2A A;  2D2C C;  3UIA A;  1JTH A;  2NRG A;  2PP6 A;  2BAS A;  5AW5 B;  3L75 G;  1VPC A;  2XND H;  3FX0 A;  2WPR A;  3CWB G;  1BCC G;  4TT3 H;  2E75 D;  1NAY A;  2HG5 D;  2KB7 P;  1KQF B;  3ZDM A;  1N73 A;  1LTS C;  2RH0 A;  1HGZ A;  1DEE G;  3H1L G;  3CPW O;  3H1H D;  1KYO I;  2B87 B;  2FYN C;  1RF1 A;  1AJY A;  2FYU J;  5AVW B;  3TGU G;  3BVH A;  3VMZ A;  3L70 E;  3AEF C;  5AW3 B;  1NTM G;  3L70 J;  3USS A;  3NXS A;  1HUC A;  4ASW A;  2KNC B;  2FYU K;  3JC2 2;  1JCD A;  1SQB G;  3HD7 C;  1PP9 G;  3W68 A;  1PPJ E;  2YKP A;  1YTZ I;  5AW7 B;  2IYP A;  3HD7 D;  3P8C E;  1KQS O;  2V7Q J;  4GOD A;  3TK1 A;  3TNU B;  3GMA A;  2J58 A;  1SQV G;  3EQ2 A;  5CBN A;  1OW7 A;  1H8A A;  1FJP A;  3A0H H;  4L74 A;  1NTZ K;  2K9Y A;  1L4A B;  4O9B A;  2K1A A;  1JB0 J;  1LT9 B;  1L0N D;  3ITK A;  1GZL A;  1SQP E;  1CSB A;  2IBZ E;  2M5A A;  1J1D B;  1SVF A;  1SQP J;  1N2D C;  4TLF A;  2KS1 B;  3MUD C;  1BE3 E;  1KB9 D;  4JYC A;  1NTK D;  2FFD C;  1GU4 A;  1L0L K;  4IFM A;  4EYY Q;  4HJG H;  2N1T B;  1HF9 A;  1Z56 A;  4WBA A;  3Q5P A;  3B5N C;  2R32 A;  2OYI B;  3B5N A;  3MTU E;  1JMB A;  2NZ2 A;  1SQX E;  1LWU C;  1N7S C;  2HYN A;  1SFC C;  1SQX J;  3L70 G;  2NPS A;  3OW2 O;  2N9B A;  1AQ5 A;  3LW5 J;  3PLN A;  3SFD C;  4RO0 A;  4W7Z A;  1KIL A;  5AVU B;  4C7N A;  2K9J B;  1HJ0 A;  1S3J A;  1Y8A A;  2AXC A;  4DCK A;  2MJZ A;  3RL0 g;  1S5L X;  2E76 C;  2E42 A;  2VRS A;  5H2F E;  1FDM A;  4HYT B;  1KYO E;  2FYU D;  2YKO A;  1RE3 C;  1RE3 A;  2QJK B;  2BCC E;  2M8R A;  2LXB A;  2BCC J;  1JY2 N;  3L74 G;  2W90 A;  1FZG A;  1L4A D;  2OYH A;  3C9I A;  3AEB C;  1VL2 A;  3CC7 P;  1SQP G;  5APU A;  1MV8 A;  4PD4 H;  1ZLL A;  2HFE D;  3H1J D;  1G2C A;  1FS0 E;  5APX A;  1NTZ D;  4JQ0 D;  4W7Y A;  1M90 Q;  1FJK A;  1BE3 G;  3JCU H;  1MZ9 A;  3F5H A;  2LKM A;  2E74 B;  1VQ5 P;  1FC2 C;  2B9B A;  2KUB A;  5KLI B;  1U57 A;  5AW1 B;  2PFX A;  1R5L A;  1E79 H;  1M1J B;  4UB6 H;  1SQQ E;  4L73 A;  1EZV D;  2N1T D;  2A45 I;  1NWQ A;  2K3R A;  1QGK B;  1SQQ J;  3VMX A;  4EDF A;  2Q5U A;  1L0L D;  5L8R J;  1PGQ A;  1KB9 I;  2IBZ D;  1FZF A;  1BGY G;  4HH2 A;  2WSS H;  5GTH E;  1IFI A;  3D6Z A;  4AYC A;  3HTK B;  2XZR A;  1KZU B;  3BAT A;  1MUU A;  1EXJ A;  2O01 J;  2E5T A;  2YMK A;  1CW5 A;  1LTJ A;  3WUT A;  3H32 A;  5AVS B;  3HRN A;  1OW8 A;  3AE6 C;  5KAI H;  3VOP A;  1LTI C;  2JO1 A;  2WSE J;  2HOD A;  3BRT B;  3E7K A;  1OVV A;  1G1I A;  1X22 A;  3KQG A;  1UII A;  1X9V A; 
#chains in the Genus database with same CATH homology
 1OVR A;  1FC2 C;  1U7J A;  1OVU A;  4HB1 A;  2KUB A;  2ZAE B;  5C39 A;  2UWJ E;  1Q2N A;  3MHV A;  5EFW B;  3MZW B;  5DJU B;  1EDK A;  4NPE A;  1EDI A;  2KZI A;  1SS1 A;  4BXL A;  4ZNC A;  4GOF A;  4GOD A;  5CBO A;  2K3R A;  1X0T A;  5CBN A;  2SPZ A;  5DJT B;  1ZW0 A;  4JBZ A;  2JWD A;  1S3J A;  2QVA A;  2M0B A;  4WWI A;  2B88 A;  1LT1 A;  2P58 A;  1U7M A;  2WMM A;  4MN4 C;  2B87 A;  2B89 A;  1BDC A;  2Q1K A;  4HKZ H;  1MFT A;  1EDL A;  4NPF X;  2OTK E;  5K5G B;  3ZDM A;  2QRX A;  3FXE A;  2M5A A;  1NVO A;  4KJM A;  4K3A A;  4ZMD A;  1EDJ A;  2RKL A;  3RGU A;  1EC5 A;  2LXB A;  4GOE A;  1LP1 A;  2KS1 B;  1DEE G;  4IOI H;  2LR2 A;  1H0T A;  4CPG A;  2HR3 A;  1LP1 B;  3S1K A;  2LXC B;  2B87 B;  2R44 A;  4NPD A;  4K35 A;  4EYY Q;  3QWO C;  4HJG H;  2M5A B;  1JM0 A;  2KIK A;  3PH0 A;  2KZJ A;  1BDD A;  1OVV A;  4ASV A;  1JMB A;  3FXD A;  1H0T B;  4ASW A;  2KI7 B;  1Y47 A;  2I8D A;  1ZXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...