1KILB

Three-dimensional structure of the complexin/snare complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
59
structure length
59
Chain Sequence
LSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Synaptobrevin SNARE motif
publication title Three-dimensional structure of the complexin/SNARE complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 27
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2001-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1kilB00
4W80A 3RL0B 1URQA 2HFED 4WY4B 2NPSD 3VOPA 1GL2D 2N1TA 3PP5A 2KOGA 3RL0C 4W7ZA 3RK3C 1L4AA 4WY4C 1GL2A 1URQD 3RK2C 2H8PD 3KYQA 1N7SB 5CCHC 3RK3D 3HTKB 3M0DC 3HD7B 1L4AD 1SFCB 1KILB 4WY4A 3B5ND 5CCGC 3HD7C 1SFCC 4W7YA 1NHLA 3P8CE 3B5NA 1JTHA 5CCGD 1URQB 3RL0D 2N1TB 4WY4D 1HVVA 5CCGA 3RK2D 2NPSB 1N7SC 3HD7A 1GL2B 5CCHD 4N78E 2HG5D 1KILC 2NPSC 4JF7A 1N7SD 1GL2C 5CCHA 1XTGB 2PP6A 2WZ7A 1T3JA 3HD7D 3RK3B 5KJ7C 1SFCD 1N7SA 1KILD 2XDJA 1L4AB 2M8RA 1URQC 3RK2B 5KJ7D 2N1TC 1SFCA 1KILA 2NPSA 4LGDE 3B5NB 1JTHB 1L4AC 2YMYA 5KJ7A 2N1TD 3TSIA 3B5NC 4OH8B
chains in the Genus database with same CATH superfamily
2OTLP 1WT6A 1P84D 2YKQA 4WY4B 2KS1B 3IAOA 2IZ0A 1JUNA 1AVYA 2KOGA 1SQVG 1T2KD 3KZIH 1R5SA 1GL2A 2M5AA 2ZJSE 2E76C 2K37A 1L0LD 3E7KA 3CCQP 3G4SP 2V4HA 1LWUA 2IBZG 1AV1A 1N2DC 2Y0CA 2JEEA 1SFCC 3L74G 1IFMA 1SQVJ 1X9VA 1LT9C 1SVFA 2POHA 2E74B 1JNMA 1ZOYC 1QLED 1LTSC 2G8YA 3G6EP 1KC8Q 4ASWA 2P2UA 3SFDC 3L74J 1VQPP 5L8RJ 1RHZB 1NWQA 2LR2A 2FBWC 1FZBA 1J2JB 4ZNCA 1KZUB 3L36A 1L4AC 1M56D 1M1KQ 3WMM0 4EIJA 1PPJE 3JCUE 1S5LH 3TSIA 1KYOE 2KZJA 3CCUP 1YJWP 1M90Q 3WUUA 5KLVK 4DZOA 1HGVA 3L71E 1JY2P 1LT9B 4BRYA 2A45H 4IL6H 4PD4H 3CWBG 1M8OB 1BE3D 5CCHC 5M1BA 2E74D 2K1AA 3AE6C 2BEQD 2P67A 4WY4A 2QVAA 4AUWA 3H1JD 3HD7C 1SQPD 5C39A 3O8ZA 3B5NA 2CPSA 3CWBJ 5AW2B 2E76D 5CCGA 1ZR4A 1PGJA 2KXPB 1ZN5A 1DD3A 1FZGA 1AA0A 4HJGH 1SQQE 1KILC 4JF7A 1JB0J 5DJTB 1LGHB 1BE3G 1CW5A 3E1RA 2HYNA 1BDCA 1SFCD 1FOSF 1N7SA 3I55P 3AEEC 2IZ1A 3CCRP 3SSUA 2B89A 1VF5D 1KB9I 1SQPG 1IO4A 1U57A 2FFDC 1FDIA 1X8YA 1VQ5P 1BE3J 5AVWB 2OGUA 1FDMA 1YITP 4RJTA 3V2PA 1P84H 5CJ4A 1KN7A 3H32B 3K5BA 2LKMA 4GDOA 1HTLC 1SQPJ 1L4AD 1KILB 1S9KE 1OZHA 3CX5I 5BU8B 1HBWA 2KZIA 3FXDA 1PP9D 4N78D 1VQNP 4EI2A 5KAFH 3GF3A 1PGPA 5KAIE 1SQXG 5AW5B 5CCHD 1R8EA 1FS0E 2FFDB 1NTKK 5CBOA 3M06A 1QL2A 2OQQA 5AVUB 5AW9B 1S3JA 1H0TB 3HD7D 3H1KE 3H1ID 1SQVK 3HTKA 4KJMA 4EYYQ 1SQXJ 1L0NE 4I7ZC 1SQBG 1EZVE 2PAJA 1T3UA 1OVUA 1YIJP 2PRRA 5KJ7A 5AVVB 1FAVA 1ZXGA 5KKZC 4XE5B 3CCSP 1EC5A 1UIIA 3PH0A 3V6IA 1HUCA 2Y9YA 3GLMA 1FBMA 3ITKA 1ZW0A 1JMMA 1S5LX 3SWKA 2IBZI 1L0NK 1SQBJ 1AFOA 1LTTC 3MGNA 3H1IG 2AEJA 4UB6H 3Q5RA 2XV5A 3RK3E 4IL6X 4NPEA 1ZRTE 1NAYA 4DT0A 2AXCA 2ZAEB 3Q2YA 2E75B 1L0LK 4R4MA 3L70E 1VQLP 2OTJP 5KLIC 1BGYE 3VP9A 3CC2P 3H32A 4I7ZB 1IJDB 1VQOP 1RF0C 3TDKA 2RMZA 1EXJA 2H7HA 1YI2P 3H1IJ 3JSVC 1GL2C 2FYUD 3P8MC 3ZDMA 1Q90D 2JWDA 1H89A 3BASA 1FU1A 3A2AA 2ZT9B 1KB9D 1PGQA 3H1HD 4UB8H 5E79H 2N1TC 1DEEG 3AEBC 3V2RA 1X0TA 1MUUA 3TNUB 2WVRA 1T2KC 2H89C 2QSIA 2A06D 2IFMA 5TJHA 5CHXA 2QJPB 3A7OA 1M1JB 1NTZD 4YXWH 1YTZI 1CSBA 3RK2C 1SLQA 3GHGC 4H44C 2J5UA 3CX5D 3L73D 3HRNA 3CPWO 1BCCE 1OVVA 1HF9A 3L72D 2QA4P 3H1LD 1RF1A 4IFMA 3IFMA 3M0DA 4I1LA 2MJZA 5AVSB 2N1TB 2WSCH 1BSHA 4GIFA 1FZCB 4HKZH 2P58A 3A0HH 3LIDA 3V5BA 3PLNA 1SQPK 2I8DA 2NPSC 1YJNP 3CD6P 1OMIA 2R3SA 2KK7A 3AEDC 3AEFC 2XDJA 3WU2H 3RK2B 3M9HA 3GHGB 2V7QJ 3U59A 2H43A 4D6TE 2FXMA 3KHUA 3AEGC 3S1KA 3L72G 3H1LG 3M91A 5AW6B 1NU1G 3B5NC 1IFJA 2WT7B 1LTJA 3CXHE 4WWIA 3VOPA 1JY3P 3VTPC 2E42A 1GL2D 4WVZA 4NPDA 3TGUE 2ZFCA 3I56P 2IBZD 1GU4A 1EXIA 1E79H 3O6QA 3Q1MA 2OYIB 1MFZA 2QJYC 1NKZB 2Q3IA 1SQXK 2YIUB 2DW3A 1GD2E 2WWWA 1FZFA 3L72J 3H1LJ 1NU1J 1S72P 1VQ6P 1PP9E 1YBKA 2GUVA 3FWNA 4LLHA 1NAFA 2I1JA 2W6JH 2W6BA 3CL3D 5B66H 2ZVOB 3RK2D 1BDDA 4H44D 4I2LC 3HUSB 1NTMD 4ZKUA 5TISE 4GODA 2XNXA 5AVXB 1W5CE 3LW5J 1RE3A 1VF5C 2O01N 3CWBD 1KILE 5B5EE 2YMYA 5KLVE 2E5YA 3NFQA 1KB9H 3BRTB 2IDBA 4OGQC 2HFED 1EZVG 2RKLA 4CPGA 2NPSD 3UIAA 3IR9A 3KZIE 4Y99C 1JY3O 4L76A 2E76B 3T97B 3RL0C 1YYCA 1NTMG 3AECC 2V7QH 1RE4A 3GG2A 1GZLA 4IOIH 3M0AA 4IFDK 2HLOA 2R44A 2HPCB 2K9JA 3SFEC 3EFFK 2HODB 2FYNC 1SFCB 2G3AA 1E5WA 2WSFJ 3B5ND 1KFNA 3GW6A 3G71P 1Q2NA 3CCJP 2ZYAA 3CX5H 1DX7A 3PHLA 4JYBA 1VF5B 1JTHA 5K5GB 2OYIA 2O1JA 5CCGD 1HGZA 1NTMJ 3VMYA 3MZWB 2Y0DA 3HE4B 2FYUE 1M7LA 5APTA 2N9YB 3VYIA 2YXQB 2KS1A 1LP1B 5AW7B 4OGQB 2OYHC 1OWAA 1N7SD 3H1HE 1VL2A 1GU5A 2AEMA 4Y99B 2R3CA 1GMJA 3A3YB 1USDA 2P7JA 1FZAA 1QX8A 2IYOA 3CCLP 1L4AB 1DH3A 4KT0J 2CPBA 4LGDE 2Z5IA 1LTGC 4JBZA 3HUSA 2FYUK 1S5LE 2FYNB 1KYOI 2AXTH 3CCVP 2C9LY 5AVZB 3D71A 3LW5H 1NTZE 1LNQA 3C9IA 2W27A 2B88A 4IL6E 4ZKPA 3HE5B 4PD4E 2KP8A 2H88C 3G9RA 2BCCE 3P32A 3BCCG 1SQXD 1K04A 3HD7B 2OYHB 1ZMEC 2D2CC 2Y0EA 4TT3H 2E43A 2OTKE 1GK6A 4HH2A 3L75E 4OGQD 1NTZK 1N73C 3Q5SA 3E1IA 5APXA 2C9NY 3P8CE 5GTHH 1BCCG 3RL0D 2W6AA 5BU5A 2HPCA 1NTKE 4KHXA 2M3BA 1EQ7A 3BCCJ 2QE7H 3H25A 3H6PA 2NRGA 1SQBD 2WPSA 3F5HA 2RH0A 1BSNA 1LT9A 1G2CB 3CC4P 2FYZA 4Y28J 4GT1A 1SQVE 4C46A 3W67A 3MTUE 3M9QA 4RO0A 3KDPB 1BCCJ 3MUDA 1URQC 1KQGB 4RESB 4U3FE 1NOHA 5KJ7D 5BVZA 1CZQA 1PGOA 2YXRB 1RF1C 1EDLA 5AVTB 1K05A 4GKGA 1JCCA 3L74E 1N73B 4HB1A 2WSEJ 3PJSK 2OYOA 1J1EC 4U7JA 3BVHA 4K3AA 1L4AA 3MD0A 2KLVA 2Q7CA 1P84E 1Z56A 3B4SA 3FGAD 3TK1A 2B87B 1JOCA 2KYVA 5GTIH 1HJ0A 1JCDA 1SS1A 1L0LE 2ITAA 5APSA 4PJ0H 1KQFB 5KAFE 4GOEA 4YPCA 2R32A 1URQB 3BATA 4JPZB 3AE8C 1NYHA 1FJKA 2Y9ZA 1AVOA 3HD7A 5APWA 3V4WA 3AE9C 2C0XA 2HG5D 1QL1A 4MN4C 1S1CX 1Y8AA 2Q6QA 2D2CD 3EFGA 2KNCB 2GM4A 1T3JA 3CWBE 3GF7A 1MKMA 1NKNA 1VQKP 3D6YA 1GDTA 2O1KA 1KYOD 1NTMK 1TU3F 2MKVA 1KILA 1VQ4P 1EZVI 2QEXP 5KKZB 1U7JA 3TF5A 2QM8A 1PL5A 2B9BA 1FJPA 3U1CA 3AE5C 2GUSA 5KLVG 1LWUC 5AW3B 3L35A 1CI6B 2QG4A 2K3RA 2WPVB 5H2FH 2FFDA 1URQD 3Q3DA 3P7KA 4JQ0D 3V2QA 3AE1C 1RQUA 1IC2A 4UB6E 1FDOA 1VQMP 3KPEA 1H0TA 1RE3C 2BASA 2YKOA 1BE3E 1G1IA 2WSEH 1PPJG 5KLIB 5KLVJ 1VQ8P 1QVGO 4K35A 4XA4A 1NHLA 1H88A 3AEAC 3H1JE 3L71G 1SQPE 1SQQD 3CC7P 1NVOA 1ZP0C 1GL2B 5CBNA 2KI7B 2M5AB 4H13C 1YQ3C 2HR3A 2QIWA 3MHVA 1NU1D 3VMXA 1LWUB 2JDIH 1OVRA 3NMDA 4UB8E 5E79E 3CXHH 3R4YA 3CMAP 2PFXA 3L71J 3Q5PA 1DD4A 2Z5HA 2FKWB 2J58A 1QEXA 4EDFA 4ZMDA 1ZV8A 1SQQG 1IK7A 1SQXE 2IPPA 4H44B 4WY4C 5KTBA 2Z4EA 3KYQA 2KSEA 4H13B 2WTYA 3L37A 1QGKB 2XKMA 2M3EA 2R5BA 2BCCG 2YKPA 1K8AQ 1IZNB 5AVQB 5CCGC 3CCEP 3RL0g 4IFFA 1SQQJ 1CI6A 1LJ2A 2L5GB 4WBAA 2O01J 1LTAC 1ZR2A 1GW4A 4O9BA 3L75G 3TNUA 4BRYB 2I1KA 1GTWA 3A0BE 3A0HE 1W2BO 2JR8A 2KIKA 2NPSB 1N7SC 2XNDH 4N78E 1N86A 3H1KD 2BCCJ 1NTKG 5APYA 1IFDA 1KTMA 4L73A 2Q3EA 1M1JA 1EZVD 3L4FA 3WU2E 1RF0A 3B8EB 3CLQA 1SQBK 3L75J 5APQA 3B5NB 3VMZA 3H1IE 4TLFA 3W68A 3CMEP 3FX0A 1D7MA 4C7NB 4U3FG 4H13D 2AEFA 1K73Q 3JCUH 1NTKJ 1KYOH 2KSJA 3CXHI 3R2PA 2N1TA 2QJYB 1LT1A 4DCKA 1FZCA 1Q81Q 2E5TA 3H1KG 1NJIQ 2NZ2A 3SWYA 1N7SB 3RK3D 1JY2N 1ZRTD 4OWFA 2N9BA 1L0NG 2YO3A 3D6ZA 2KB7P 3G3ZA 1AJYA 4H0LD 4U3FJ 3L70D 3MUDC 4NPFX 1BGYD 3NTNA 1WMKA 1MFTA 1VPCA 4PV1D 3GHGA 1HJBA 2LXCB 1W2EA 2K9YA 4GOFA 3N4XA 2WPQA 1J1DC 3H1KJ 4WY4D 1L0LG 5B66E 1L2PA 1HH0A 2WT7A 1QVFO 4RKUJ 2QJKC 2W90A 2YMKA 1L0NJ 1IFIA 1GK4A 4BXLA 1VQ7P 2WZ7A 1T6AA 2O01H 1OXZA 5KJ7C 4I6MC 1GW3A 1X79B 1H8AA 2M8RA 1L0LJ 2NPSA 1LTIC 3L70G 1OX3A 1S4XA 1BGYG 1KB9E 2OARA 1KQSO 3BCCD 2BEZF 4OH8B 4W80A 3RL0B 3EQ2A 1JO5A 3OW2O 2RN0A 2CK3H 4QMAA 1J1DB 1S2EA 2ZXEB 5AW1B 1K9MQ 1BCCD 3VN0A 2FXOA 4M3LA 3L70J 2A06E 2QJKB 4XFJA 4DOJA 1BGYJ 2YNYA 2GA1A 3HTKB 4C7NA 5APUA 2W83C 2IFNA 2FY8A 4N6JA 4Z1MH 4YTPC 1LTBC 1EDJA 3CX5E 3AE3C 4N3YB 4JYCA 1HWTC 3RBXA 3C1LA 4W7YA 4A7PA 3L73E 2P10A 4WB4A 3IF4A 3BRVB 3JC22 3L72E 4L75A 3H1LE 1DEBA 1HVVA 5KAIH 2C0WA 3TYYA 1NU1E 3H1JG 3ABVC 3T97A 2W8ZA 4YXDC 5DJUB 1XTGB 3AE4C 1RQVA 4R4LA 3NXSA 4D6TD 1N8RQ 1SQQK 2QM7A 3MIWA 1X22A 5AW4B 1OIPA 2O3JA 2QRXA 1OW6A 5EFWB 2HODA 1JY2O 1SFCA 3CXHD 4HYTB 2WSFH 1NU1K 2AXTE 3TGUD 1NGMB 1PIXA 3H1JJ 1Y47A 3EWKA 1NO4A 4L74A 5AW8B 4B86A 1AQTA 3HE4A 5AVRB 2JP3A 2A45I 4PD4I 1XTCC 1LP1A 3S9OA 1KORA 2D2CB 2P1JA 3FWLA 2IBZE 2KUBA 3M0DC 1YHQP 4D6TG 3KQGA 4C7RA 3CI9A 2VRSA 5APVA 5GTHE 3IN6A 1R5LA 1T8ZA 1NH4A 3TGUG 3OAKA 1ZLLA 2ZVNB 1KFMA 2ZYGA 3A5TA 1FZEA 5CMZA 3CCMP 2WSSH 2E75C 2L91A 2WQYC 3USSA 4AYCA 3I5CA 4D6TJ 4ASVA 1Y9BA 5CCHA 3HE5A 1PZQA 3QWOC 1WRGA 3M9BA 2WITA 2PP6A 1PP9G 1NTME 4BWNA 1KILD 5KLVD 1LTJC 3TGUJ 1RF1B 3PRJA 2OYHA 3D70A 2ZT9C 1AQ5A 4LC1A 3RGUA 5AW0B 2WSCJ 2Q1KA 1J1EB 3SWFA 1JEKA 1FE6A 3B71A 1PP9J 1Q86Q 1VQ9P 1PPJD 3GMAA 2PGDA 1EDIA 1P84I 1VDFA 1KV4A 3N7NA 2XU6A 4AQRD 1YJ9P 2WMMA 2Q9IA 3L71D 4OVNF 1G2CA 2QJPC 1JM0A 5GTIE 1M1JC 1G1JA 1PV3A 1YQ4C 4PJ0E 1LTJB 3RBZA 1N7LA 3II6A 1OW7A 1OW8A 3O6QB 1N73A 3V4QA 1DIPA 1Q7YQ 1FZCC 2JO1A 1A02F 1JMBA 3FXEA 1KQLA 1PFIA 1OFCX 1Q82Q 4DJGA 3AE2C 3WUVA 3BCCE 3U1AA 2WPRA 2B87A 3KXDA 2K88A 5CJ0A 2E75D 2FYUG 1RE4C 1FOSE 2JKVA 2YO2A 4PD4D 1RH5B 2Q5UA 3F89A 2XZRA 1URQA 2BCCD 1MV8A 1EDKA 3PP5A 3H1HG 5H2FE 2FXPA 4W7ZA 3RK3C 3VMAA 5AVYB 1YTZT 1KD1Q 2J59M 1JY3N 1IFNA 1KMIZ 2H8PD 4H0LC 2ZT9D 3L75D 2KNCA 3C8VA 2OYIC 2FYUJ 3P8CD 4PV1C 2YIUC 1SP4A 3A0BH 1A02J 1IFPA 2A06G 3S4RA 2M0BA 3V2NA 2ZYDA 1NTKD 2SPZA 3MP7B 3H1HJ 1NTZG 1S9KD 4EOTA 2KLUA 2A45G 1M57D 2R5DA 3AE7C 1SQVD 3L73G 3QH9A 3LIEA 3PTZA 2UWJE 3OA7A 1IK9A 2K9JB 5TISH 1U7MA 3HUSC 4U3FD 2JWAA 2IYPA 1UIXA 3RK3B 1SQBE 2ZXXA 2IX7C 3VP8A 1NTZJ 2JJLA 1MZ9A 1USEA 4H0LB 1RY3A 3L74D 2E74C 1JTHB 3L73J 1FC2C 2LXBA 4PV1B 5B5EH 2N1TD 3WUTA 3OJAB 1L0ND
chains in the Genus database with same CATH topology
4W80A 1JCCA 3RL0B 1WT6A 1N73B 2YKQA 4WY4B 3EQ2A 1J1EC 1JUNA 3BVHA 1JO5A 2KOGA 2IFMA 1T2KD 1L4AA 3MD0A 1J1DB 5CHXA 1GL2A 2KLVA 3A7OA 2Q7CA 1M1JB 1Z56A 2ZXEB 5AW1B 1YTZI 3VN0A 1CSBA 3RK2C 4M3LA 1SLQA 3GHGC 3TK1A 4DOJA 2YNYA 3HTKB 1LWUA 4C7NA 5APUA 1JOCA 2KYVA 3HRNA 2IFNA 1JCDA 4N6JA 1N2DC 1LTBC 2JEEA 4N3YB 4JYCA 1HWTC 1RF1A 5APSA 1SFCC 4W7YA 4IFMA 1IFMA 1X9VA 1LT9C 3IFMA 3M0DA 4WB4A 2R32A 1URQB 4I1LA 3BATA 2MJZA 5AVSB 3BRVB 2N1TB 1SVFA 2WSCH 1FJKA 2POHA 4GIFA 1DEBA 1HVVA 1FZCB 2C0WA 1JNMA 3TYYA 3HD7A 5APWA 3V4WA 3LIDA 3V5BA 1SQPK 2C0XA 2HG5D 1QL1A 3T97A 1LTSC 2NPSC 3EFGA 1XTGB 2GM4A 2P2UA 3NXSA 1T3JA 1SQQK 2QM7A 3MIWA 1NKNA 2XDJA 5AW4B 1NWQA 1GDTA 2O1KA 3RK2B 1NTMK 3M9HA 3GHGB 2HODA 1JY2O 1FZBA 1SFCA 3U59A 2H43A 1KILA 2FXMA 1J2JB 1KZUB 4HYTB 3L36A 2WSFH 1L4AC 1NU1K 3WMM0 3M91A 4EIJA 5AW6B 3TSIA 3B5NC 1IFJA 2WT7B 1LTJA 2QM8A 5KLVK 1NO4A 4DZOA 1FJPA 5AW8B 3VOPA 1JY3P 3VTPC 3U1CA 1GL2D 2E42A 4B86A 2GUSA 2ZFCA 3HE4A 1LWUC 5AVRB 1HGVA 5AW3B 2A45I 1JY2P 1LT9B 1GU4A 3L35A 1CI6B 2A45H 1XTCC 2OYIB 1MFZA 1NKZB 2FFDA 2Q3IA 1URQD 1SQXK 2P1JA 5CCHC 3P7KA 3V2QA 1GD2E 2WWWA 1FZFA 3M0DC 1IC2A 3KQGA 3KPEA 2P67A 1RE3C 4C7RA 2BASA 2YKOA 3CI9A 4WY4A 1G1IA 2WSEH 4AUWA 3HD7C 2VRSA 5APVA 2GUVA 3O8ZA 4LLHA 4XA4A 1NHLA 3B5NA 1H88A 1T8ZA 1NAFA 1NH4A 2I1JA 2CPSA 3OAKA 1ZLLA 1KFMA 3A5TA 1FZEA 5CMZA 5AW2B 2W6BA 3CL3D 5CCGA 3RK2D 1ZR4A 1GL2B 4AYCA 3I5CA 4I2LC 3HUSB 1ZN5A 4ZKUA 1FZGA 1KILC 4JF7A 2XNXA 5CCHA 3HE5A 5AVXB 1WRGA 3M9BA 2WITA 3VMXA 1LWUB 2PP6A 1LGHB 1CW5A 2HYNA 3NMDA 1SFCD 1FOSF 1RE3A 1N7SA 1KILD 1LTJC 1RF1B 2OYHA 2Z5HA 2YMYA 1AQ5A 1IO4A 4LC1A 5AW0B 3NFQA 2FKWB 3BRTB 1J1EB 2J58A 2FFDC 3SWFA 1X8YA 2HFED 1ZV8A 2NPSD 3UIAA 3IR9A 4Y99C 1JY3O 5AVWB 3RL0C 2IPPA 4WY4C 1FDMA 1YYCA 1RE4A 1VDFA 3V2PA 5KTBA 3N7NA 2XU6A 4AQRD 1GZLA 2Z4EA 3M0AA 2Q9IA 4IFDK 2HLOA 3KYQA 5CJ4A 3H32B 2HPCB 1G2CA 2LKMA 1HTLC 1M1JC 2WTYA 1G1JA 1L4AD 2HODB 3L37A 1SFCB 2XKMA 1KILB 2R5BA 2YKPA 1E5WA 1S9KE 3B5ND 5AVQB 5CCGC 1KFNA 5BU8B 4IFFA 1CI6A 2L5GB 1HBWA 1DX7A 1LTJB 4JYBA 4WBAA 1JTHA 1LTAC 2OYIA 2O1JA 4N78D 5CCGD 1HGZA 1ZR2A 3VMYA 1N7LA 3HE4B 1GW4A 4O9BA 3TNUA 5AW5B 2I1KA 1GTWA 3II6A 1M7LA 5APTA 2NPSB 1N7SC 3VYIA 5CCHD 1N73A 4N78E 3V4QA 1N86A 2FFDB 1NTKK 5AW7B 1FZCC 3M06A 2OYHC 1OWAA 1A02F 5APYA 1N7SD 1IFDA 1QL2A 1GU5A 4Y99B 5AVUB 2R3CA 5AW9B 1KQLA 1M1JA 1PFIA 3HD7D 3A3YB 2P7JA 3L4FA 1FZAA 1RF0A 1SQVK 3B8EB 3HTKA 1L4AB 3U1AA 1DH3A 2WPRA 3CLQA 1SQBK 2CPBA 5APQA 4LGDE 3B5NB 2Z5IA 1LTGC 3VMZA 3HUSA 2FYUK 5CJ0A 2PAJA 1T3UA 5KJ7A 1RE4C 1FOSE 5AVVB 4C7NB 2C9LY 1FAVA 2YO2A 5AVZB 2Q5UA 2XZRA 2KSJA 3LW5H 4XE5B 1URQA 3R2PA 2N1TA 1MV8A 3C9IA 2W27A 3PP5A 1FZCA 4W7ZA 3RK3C 4ZKPA 3HE5B 1HUCA 5AVYB 1YTZT 1FBMA 2J59M 2KP8A 1JMMA 1JY3N 1IFNA 3P32A 3SWYA 2H8PD 1N7SB 3RK3D 1JY2N 1L0NK 2N9BA 2OYIC 1AFOA 2YO3A 1LTTC 3HD7B 2KB7P 3MGNA 2OYHB 3G3ZA 3P8CD 1SP4A 2E43A 1A02J 2XV5A 1GK6A 3V2NA 4HH2A 3NTNA 1NTZK 1N73C 3E1IA 5APXA 1VPCA 3GHGA 1HJBA 2C9NY 3P8CE 1W2EA 1L0LK 3N4XA 1S9KD 3RL0D 4EOTA 2WPQA 2W6AA 3VP9A 2A45G 1J1DC 4WY4D 5BU5A 3H32A 2HPCA 4KHXA 1HH0A 2R5DA 2WT7A 2M3BA 1EQ7A 3LIEA 1IJDB 1RF0C 3H6PA 2H7HA 2WPSA 1IFIA 3OA7A 1GK4A 1LT9A 1G2CB 1IK9A 2FYZA 1GL2C 3P8MC 4GT1A 3HUSC 4C46A 2WZ7A 1H89A 3BASA 1FU1A 3A2AA 2O01H 1OXZA 3RK3B 5KJ7C 2IX7C 3VP8A 4I6MC 3MTUE 3M9QA 1GW3A 2JJLA 3KDPB 1X79B 3MUDA 1H8AA 2M8RA 1MZ9A 1URQC 4RESB 1NOHA 5KJ7D 2N1TC 1RY3A 2NPSA 1LTIC 5BVZA 1CZQA 1JTHB 1RF1C 3V2RA 2OARA 5AVTB 1MUUA 3TNUB 2N1TD 3OJAB 4OH8B 1T2KC 4GKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W80 A;  3RL0 B;  1URQ A;  2HFE D;  4WY4 B;  2NPS D;  3VOP A;  1GL2 D;  2N1T A;  3PP5 A;  2KOG A;  3RL0 C;  4W7Z A;  3RK3 C;  1L4A A;  4WY4 C;  1GL2 A;  1URQ D;  3RK2 C;  2H8P D;  3KYQ A;  1N7S B;  5CCH C;  3RK3 D;  3HTK B;  3M0D C;  3HD7 B;  1L4A D;  1SFC B;  1KIL B;  4WY4 A;  3B5N D;  5CCG C;  3HD7 C;  1SFC C;  4W7Y A;  1NHL A;  3P8C E;  3B5N A;  1JTH A;  5CCG D;  1URQ B;  3RL0 D;  2N1T B;  4WY4 D;  1HVV A;  5CCG A;  3RK2 D;  2NPS B;  1N7S C;  3HD7 A;  1GL2 B;  5CCH D;  4N78 E;  2HG5 D;  1KIL C;  2NPS C;  4JF7 A;  1N7S D;  1GL2 C;  5CCH A;  1XTG B;  2PP6 A;  2WZ7 A;  1T3J A;  3HD7 D;  3RK3 B;  5KJ7 C;  1SFC D;  1N7S A;  1KIL D;  2XDJ A;  1L4A B;  2M8R A;  1URQ C;  3RK2 B;  5KJ7 D;  2N1T C;  1SFC A;  1KIL A;  2NPS A;  4LGD E;  3B5N B;  1JTH B;  1L4A C;  2YMY A;  5KJ7 A;  2N1T D;  3TSI A;  3B5N C;  4OH8 B; 
#chains in the Genus database with same CATH topology
 2OTL P;  1WT6 A;  1P84 D;  2YKQ A;  4WY4 B;  2KS1 B;  3IAO A;  2IZ0 A;  1JUN A;  1AVY A;  2KOG A;  1SQV G;  1T2K D;  3KZI H;  1R5S A;  1GL2 A;  2M5A A;  2ZJS E;  2E76 C;  2K37 A;  1L0L D;  3E7K A;  3CCQ P;  3G4S P;  2V4H A;  1LWU A;  2IBZ G;  1AV1 A;  1N2D C;  2Y0C A;  2JEE A;  1SFC C;  3L74 G;  1IFM A;  1SQV J;  1X9V A;  1LT9 C;  1SVF A;  2POH A;  2E74 B;  1JNM A;  1ZOY C;  1QLE D;  1LTS C;  2G8Y A;  3G6E P;  1KC8 Q;  4ASW A;  2P2U A;  3SFD C;  3L74 J;  1VQP P;  5L8R J;  1RHZ B;  1NWQ A;  2LR2 A;  2FBW C;  1FZB A;  1J2J B;  4ZNC A;  1KZU B;  3L36 A;  1L4A C;  1M56 D;  1M1K Q;  3WMM 0;  4EIJ A;  1PPJ E;  3JCU E;  1S5L H;  3TSI A;  1KYO E;  2KZJ A;  3CCU P;  1YJW P;  1M90 Q;  3WUU A;  5KLV K;  4DZO A;  1HGV A;  3L71 E;  1JY2 P;  1LT9 B;  4BRY A;  2A45 H;  4IL6 H;  4PD4 H;  3CWB G;  1M8O B;  1BE3 D;  5CCH C;  5M1B A;  2E74 D;  2K1A A;  3AE6 C;  2BEQ D;  2P67 A;  4WY4 A;  2QVA A;  4AUW A;  3H1J D;  3HD7 C;  1SQP D;  5C39 A;  3O8Z A;  3B5N A;  2CPS A;  3CWB J;  5AW2 B;  2E76 D;  5CCG A;  1ZR4 A;  1PGJ A;  2KXP B;  1ZN5 A;  1DD3 A;  1FZG A;  1AA0 A;  4HJG H;  1SQQ E;  1KIL C;  4JF7 A;  1JB0 J;  5DJT B;  1LGH B;  1BE3 G;  1CW5 A;  3E1R A;  2HYN A;  1BDC A;  1SFC D;  1FOS F;  1N7S A;  3I55 P;  3AEE C;  2IZ1 A;  3CCR P;  3SSU A;  2B89 A;  1VF5 D;  1KB9 I;  1SQP G;  1IO4 A;  1U57 A;  2FFD C;  1FDI A;  1X8Y A;  1VQ5 P;  1BE3 J;  5AVW B;  2OGU A;  1FDM A;  1YIT P;  4RJT A;  3V2P A;  1P84 H;  5CJ4 A;  1KN7 A;  3H32 B;  3K5B A;  2LKM A;  4GDO A;  1HTL C;  1SQP J;  1L4A D;  1KIL B;  1S9K E;  1OZH A;  3CX5 I;  5BU8 B;  1HBW A;  2KZI A;  3FXD A;  1PP9 D;  4N78 D;  1VQN P;  4EI2 A;  5KAF H;  3GF3 A;  1PGP A;  5KAI E;  1SQX G;  5AW5 B;  5CCH D;  1R8E A;  1FS0 E;  2FFD B;  1NTK K;  5CBO A;  3M06 A;  1QL2 A;  2OQQ A;  5AVU B;  5AW9 B;  1S3J A;  1H0T B;  3HD7 D;  3H1K E;  3H1I D;  1SQV K;  3HTK A;  4KJM A;  4EYY Q;  1SQX J;  1L0N E;  4I7Z C;  1SQB G;  1EZV E;  2PAJ A;  1T3U A;  1OVU A;  1YIJ P;  2PRR A;  5KJ7 A;  5AVV B;  1FAV A;  1ZXG A;  5KKZ C;  4XE5 B;  3CCS P;  1EC5 A;  1UII A;  3PH0 A;  3V6I A;  1HUC A;  2Y9Y A;  3GLM A;  1FBM A;  3ITK A;  1ZW0 A;  1JMM A;  1S5L X;  3SWK A;  2IBZ I;  1L0N K;  1SQB J;  1AFO A;  1LTT C;  3MGN A;  3H1I G;  2AEJ A;  4UB6 H;  3Q5R A;  2XV5 A;  3RK3 E;  4IL6 X;  4NPE A;  1ZRT E;  1NAY A;  4DT0 A;  2AXC A;  2ZAE B;  3Q2Y A;  2E75 B;  1L0L K;  4R4M A;  3L70 E;  1VQL P;  2OTJ P;  5KLI C;  1BGY E;  3VP9 A;  3CC2 P;  3H32 A;  4I7Z B;  1IJD B;  1VQO P;  1RF0 C;  3TDK A;  2RMZ A;  1EXJ A;  2H7H A;  1YI2 P;  3H1I J;  3JSV C;  1GL2 C;  2FYU D;  3P8M C;  3ZDM A;  1Q90 D;  2JWD A;  1H89 A;  3BAS A;  1FU1 A;  3A2A A;  2ZT9 B;  1KB9 D;  1PGQ A;  3H1H D;  4UB8 H;  5E79 H;  2N1T C;  1DEE G;  3AEB C;  3V2R A;  1X0T A;  1MUU A;  3TNU B;  2WVR A;  1T2K C;  2H89 C;  2QSI A;  2A06 D;  2IFM A;  5TJH A;  5CHX A;  2QJP B;  3A7O A;  1M1J B;  1NTZ D;  4YXW H;  1YTZ I;  1CSB A;  3RK2 C;  1SLQ A;  3GHG C;  4H44 C;  2J5U A;  3CX5 D;  3L73 D;  3HRN A;  3CPW O;  1BCC E;  1OVV A;  1HF9 A;  3L72 D;  2QA4 P;  3H1L D;  1RF1 A;  4IFM A;  3IFM A;  3M0D A;  4I1L A;  2MJZ A;  5AVS B;  2N1T B;  2WSC H;  1BSH A;  4GIF A;  1FZC B;  4HKZ H;  2P58 A;  3A0H H;  3LID A;  3V5B A;  3PLN A;  1SQP K;  2I8D A;  2NPS C;  1YJN P;  3CD6 P;  1OMI A;  2R3S A;  2KK7 A;  3AED C;  3AEF C;  2XDJ A;  3WU2 H;  3RK2 B;  3M9H A;  3GHG B;  2V7Q J;  3U59 A;  2H43 A;  4D6T E;  2FXM A;  3KHU A;  3AEG C;  3S1K A;  3L72 G;  3H1L G;  3M91 A;  5AW6 B;  1NU1 G;  3B5N C;  1IFJ A;  2WT7 B;  1LTJ A;  3CXH E;  4WWI A;  3VOP A;  1JY3 P;  3VTP C;  2E42 A;  1GL2 D;  4WVZ A;  4NPD A;  3TGU E;  2ZFC A;  3I56 P;  2IBZ D;  1GU4 A;  1EXI A;  1E79 H;  3O6Q A;  3Q1M A;  2OYI B;  1MFZ A;  2QJY C;  1NKZ B;  2Q3I A;  1SQX K;  2YIU B;  2DW3 A;  1GD2 E;  2WWW A;  1FZF A;  3L72 J;  3H1L J;  1NU1 J;  1S72 P;  1VQ6 P;  1PP9 E;  1YBK A;  2GUV A;  3FWN A;  4LLH A;  1NAF A;  2I1J A;  2W6J H;  2W6B A;  3CL3 D;  5B66 H;  2ZVO B;  3RK2 D;  1BDD A;  4H44 D;  4I2L C;  3HUS B;  1NTM D;  4ZKU A;  5TIS E;  4GOD A;  2XNX A;  5AVX B;  1W5C E;  3LW5 J;  1RE3 A;  1VF5 C;  2O01 N;  3CWB D;  1KIL E;  5B5E E;  2YMY A;  5KLV E;  2E5Y A;  3NFQ A;  1KB9 H;  3BRT B;  2IDB A;  4OGQ C;  2HFE D;  1EZV G;  2RKL A;  4CPG A;  2NPS D;  3UIA A;  3IR9 A;  3KZI E;  4Y99 C;  1JY3 O;  4L76 A;  2E76 B;  3T97 B;  3RL0 C;  1YYC A;  1NTM G;  3AEC C;  2V7Q H;  1RE4 A;  3GG2 A;  1GZL A;  4IOI H;  3M0A A;  4IFD K;  2HLO A;  2R44 A;  2HPC B;  2K9J A;  3SFE C;  3EFF K;  2HOD B;  2FYN C;  1SFC B;  2G3A A;  1E5W A;  2WSF J;  3B5N D;  1KFN A;  3GW6 A;  3G71 P;  1Q2N A;  3CCJ P;  2ZYA A;  3CX5 H;  1DX7 A;  3PHL A;  4JYB A;  1VF5 B;  1JTH A;  5K5G B;  2OYI A;  2O1J A;  5CCG D;  1HGZ A;  1NTM J;  3VMY A;  3MZW B;  2Y0D A;  3HE4 B;  2FYU E;  1M7L A;  5APT A;  2N9Y B;  3VYI A;  2YXQ B;  2KS1 A;  1LP1 B;  5AW7 B;  4OGQ B;  2OYH C;  1OWA A;  1N7S D;  3H1H E;  1VL2 A;  1GU5 A;  2AEM A;  4Y99 B;  2R3C A;  1GMJ A;  3A3Y B;  1USD A;  2P7J A;  1FZA A;  1QX8 A;  2IYO A;  3CCL P;  1L4A B;  1DH3 A;  4KT0 J;  2CPB A;  4LGD E;  2Z5I A;  1LTG C;  4JBZ A;  3HUS A;  2FYU K;  1S5L E;  2FYN B;  1KYO I;  2AXT H;  3CCV P;  2C9L Y;  5AVZ B;  3D71 A;  3LW5 H;  1NTZ E;  1LNQ A;  3C9I A;  2W27 A;  2B88 A;  4IL6 E;  4ZKP A;  3HE5 B;  4PD4 E;  2KP8 A;  2H88 C;  3G9R A;  2BCC E;  3P32 A;  3BCC G;  1SQX D;  1K04 A;  3HD7 B;  2OYH B;  1ZME C;  2D2C C;  2Y0E A;  4TT3 H;  2E43 A;  2OTK E;  1GK6 A;  4HH2 A;  3L75 E;  4OGQ D;  1NTZ K;  1N73 C;  3Q5S A;  3E1I A;  5APX A;  2C9N Y;  3P8C E;  5GTH H;  1BCC G;  3RL0 D;  2W6A A;  5BU5 A;  2HPC A;  1NTK E;  4KHX A;  2M3B A;  1EQ7 A;  3BCC J;  2QE7 H;  3H25 A;  3H6P A;  2NRG A;  1SQB D;  2WPS A;  3F5H A;  2RH0 A;  1BSN A;  1LT9 A;  1G2C B;  3CC4 P;  2FYZ A;  4Y28 J;  4GT1 A;  1SQV E;  4C46 A;  3W67 A;  3MTU E;  3M9Q A;  4RO0 A;  3KDP B;  1BCC J;  3MUD A;  1URQ C;  1KQG B;  4RES B;  4U3F E;  1NOH A;  5KJ7 D;  5BVZ A;  1CZQ A;  1PGO A;  2YXR B;  1RF1 C;  1EDL A;  5AVT B;  1K05 A;  4GKG A;  1JCC A;  3L74 E;  1N73 B;  4HB1 A;  2WSE J;  3PJS K;  2OYO A;  1J1E C;  4U7J A;  3BVH A;  4K3A A;  1L4A A;  3MD0 A;  2KLV A;  2Q7C A;  1P84 E;  1Z56 A;  3B4S A;  3FGA D;  3TK1 A;  2B87 B;  1JOC A;  2KYV A;  5GTI H;  1HJ0 A;  1JCD A;  1SS1 A;  1L0L E;  2ITA A;  5APS A;  4PJ0 H;  1KQF B;  5KAF E;  4GOE A;  4YPC A;  2R32 A;  1URQ B;  3BAT A;  4JPZ B;  3AE8 C;  1NYH A;  1FJK A;  2Y9Z A;  1AVO A;  3HD7 A;  5APW A;  3V4W A;  3AE9 C;  2C0X A;  2HG5 D;  1QL1 A;  4MN4 C;  1S1C X;  1Y8A A;  2Q6Q A;  2D2C D;  3EFG A;  2KNC B;  2GM4 A;  1T3J A;  3CWB E;  3GF7 A;  1MKM A;  1NKN A;  1VQK P;  3D6Y A;  1GDT A;  2O1K A;  1KYO D;  1NTM K;  1TU3 F;  2MKV A;  1KIL A;  1VQ4 P;  1EZV I;  2QEX P;  5KKZ B;  1U7J A;  3TF5 A;  2QM8 A;  1PL5 A;  2B9B A;  1FJP A;  3U1C A;  3AE5 C;  2GUS A;  5KLV G;  1LWU C;  5AW3 B;  3L35 A;  1CI6 B;  2QG4 A;  2K3R A;  2WPV B;  5H2F H;  2FFD A;  1URQ D;  3Q3D A;  3P7K A;  4JQ0 D;  3V2Q A;  3AE1 C;  1RQU A;  1IC2 A;  4UB6 E;  1FDO A;  1VQM P;  3KPE A;  1H0T A;  1RE3 C;  2BAS A;  2YKO A;  1BE3 E;  1G1I A;  2WSE H;  1PPJ G;  5KLI B;  5KLV J;  1VQ8 P;  1QVG O;  4K35 A;  4XA4 A;  1NHL A;  1H88 A;  3AEA C;  3H1J E;  3L71 G;  1SQP E;  1SQQ D;  3CC7 P;  1NVO A;  1ZP0 C;  1GL2 B;  5CBN A;  2KI7 B;  2M5A B;  4H13 C;  1YQ3 C;  2HR3 A;  2QIW A;  3MHV A;  1NU1 D;  3VMX A;  1LWU B;  2JDI H;  1OVR A;  3NMD A;  4UB8 E;  5E79 E;  3CXH H;  3R4Y A;  3CMA P;  2PFX A;  3L71 J;  3Q5P A;  1DD4 A;  2Z5H A;  2FKW B;  2J58 A;  1QEX A;  4EDF A;  4ZMD A;  1ZV8 A;  1SQQ G;  1IK7 A;  1SQX E;  2IPP A;  4H44 B;  4WY4 C;  5KTB A;  2Z4E A;  3KYQ A;  2KSE A;  4H13 B;  2WTY A;  3L37 A;  1QGK B;  2XKM A;  2M3E A;  2R5B A;  2BCC G;  2YKP A;  1K8A Q;  1IZN B;  5AVQ B;  5CCG C;  3CCE P;  3RL0 g;  4IFF A;  1SQQ J;  1CI6 A;  1LJ2 A;  2L5G B;  4WBA A;  2O01 J;  1LTA C;  1ZR2 A;  1GW4 A;  4O9B A;  3L75 G;  3TNU A;  4BRY B;  2I1K A;  1GTW A;  3A0B E;  3A0H E;  1W2B O;  2JR8 A;  2KIK A;  2NPS B;  1N7S C;  2XND H;  4N78 E;  1N86 A;  3H1K D;  2BCC J;  1NTK G;  5APY A;  1IFD A;  1KTM A;  4L73 A;  2Q3E A;  1M1J A;  1EZV D;  3L4F A;  3WU2 E;  1RF0 A;  3B8E B;  3CLQ A;  1SQB K;  3L75 J;  5APQ A;  3B5N B;  3VMZ A;  3H1I E;  4TLF A;  3W68 A;  3CME P;  3FX0 A;  1D7M A;  4C7N B;  4U3F G;  4H13 D;  2AEF A;  1K73 Q;  3JCU H;  1NTK J;  1KYO H;  2KSJ A;  3CXH I;  3R2P A;  2N1T A;  2QJY B;  1LT1 A;  4DCK A;  1FZC A;  1Q81 Q;  2E5T A;  3H1K G;  1NJI Q;  2NZ2 A;  3SWY A;  1N7S B;  3RK3 D;  1JY2 N;  1ZRT D;  4OWF A;  2N9B A;  1L0N G;  2YO3 A;  3D6Z A;  2KB7 P;  3G3Z A;  1AJY A;  4H0L D;  4U3F J;  3L70 D;  3MUD C;  4NPF X;  1BGY D;  3NTN A;  1WMK A;  1MFT A;  1VPC A;  4PV1 D;  3GHG A;  1HJB A;  2LXC B;  1W2E A;  2K9Y A;  4GOF A;  3N4X A;  2WPQ A;  1J1D C;  3H1K J;  4WY4 D;  1L0L G;  5B66 E;  1L2P A;  1HH0 A;  2WT7 A;  1QVF O;  4RKU J;  2QJK C;  2W90 A;  2YMK A;  1L0N J;  1IFI A;  1GK4 A;  4BXL A;  1VQ7 P;  2WZ7 A;  1T6A A;  2O01 H;  1OXZ A;  5KJ7 C;  4I6M C;  1GW3 A;  1X79 B;  1H8A A;  2M8R A;  1L0L J;  2NPS A;  1LTI C;  3L70 G;  1OX3 A;  1S4X A;  1BGY G;  1KB9 E;  2OAR A;  1KQS O;  3BCC D;  2BEZ F;  4OH8 B;  4W80 A;  3RL0 B;  3EQ2 A;  1JO5 A;  3OW2 O;  2RN0 A;  2CK3 H;  4QMA A;  1J1D B;  1S2E A;  2ZXE B;  5AW1 B;  1K9M Q;  1BCC D;  3VN0 A;  2FXO A;  4M3L A;  3L70 J;  2A06 E;  2QJK B;  4XFJ A;  4DOJ A;  1BGY J;  2YNY A;  2GA1 A;  3HTK B;  4C7N A;  5APU A;  2W83 C;  2IFN A;  2FY8 A;  4N6J A;  4Z1M H;  4YTP C;  1LTB C;  1EDJ A;  3CX5 E;  3AE3 C;  4N3Y B;  4JYC A;  1HWT C;  3RBX A;  3C1L A;  4W7Y A;  4A7P A;  3L73 E;  2P10 A;  4WB4 A;  3IF4 A;  3BRV B;  3JC2 2;  3L72 E;  4L75 A;  3H1L E;  1DEB A;  1HVV A;  5KAI H;  2C0W A;  3TYY A;  1NU1 E;  3H1J G;  3ABV C;  3T97 A;  2W8Z A;  4YXD C;  5DJU B;  1XTG B;  3AE4 C;  1RQV A;  4R4L A;  3NXS A;  4D6T D;  1N8R Q;  1SQQ K;  2QM7 A;  3MIW A;  1X22 A;  5AW4 B;  1OIP A;  2O3J A;  2QRX A;  1OW6 A;  5EFW B;  2HOD A;  1JY2 O;  1SFC A;  3CXH D;  4HYT B;  2WSF H;  1NU1 K;  2AXT E;  3TGU D;  1NGM B;  1PIX A;  3H1J J;  1Y47 A;  3EWK A;  1NO4 A;  4L74 A;  5AW8 B;  4B86 A;  1AQT A;  3HE4 A;  5AVR B;  2JP3 A;  2A45 I;  4PD4 I;  1XTC C;  1LP1 A;  3S9O A;  1KOR A;  2D2C B;  2P1J A;  3FWL A;  2IBZ E;  2KUB A;  3M0D C;  1YHQ P;  4D6T G;  3KQG A;  4C7R A;  3CI9 A;  2VRS A;  5APV A;  5GTH E;  3IN6 A;  1R5L A;  1T8Z A;  1NH4 A;  3TGU G;  3OAK A;  1ZLL A;  2ZVN B;  1KFM A;  2ZYG A;  3A5T A;  1FZE A;  5CMZ A;  3CCM P;  2WSS H;  2E75 C;  2L91 A;  2WQY C;  3USS A;  4AYC A;  3I5C A;  4D6T J;  4ASV A;  1Y9B A;  5CCH A;  3HE5 A;  1PZQ A;  3QWO C;  1WRG A;  3M9B A;  2WIT A;  2PP6 A;  1PP9 G;  1NTM E;  4BWN A;  1KIL D;  5KLV D;  1LTJ C;  3TGU J;  1RF1 B;  3PRJ A;  2OYH A;  3D70 A;  2ZT9 C;  1AQ5 A;  4LC1 A;  3RGU A;  5AW0 B;  2WSC J;  2Q1K A;  1J1E B;  3SWF A;  1JEK A;  1FE6 A;  3B71 A;  1PP9 J;  1Q86 Q;  1VQ9 P;  1PPJ D;  3GMA A;  2PGD A;  1EDI A;  1P84 I;  1VDF A;  1KV4 A;  3N7N A;  2XU6 A;  4AQR D;  1YJ9 P;  2WMM A;  2Q9I A;  3L71 D;  4OVN F;  1G2C A;  2QJP C;  1JM0 A;  5GTI E;  1M1J C;  1G1J A;  1PV3 A;  1YQ4 C;  4PJ0 E;  1LTJ B;  3RBZ A;  1N7L A;  3II6 A;  1OW7 A;  1OW8 A;  3O6Q B;  1N73 A;  3V4Q A;  1DIP A;  1Q7Y Q;  1FZC C;  2JO1 A;  1A02 F;  1JMB A;  3FXE A;  1KQL A;  1PFI A;  1OFC X;  1Q82 Q;  4DJG A;  3AE2 C;  3WUV A;  3BCC E;  3U1A A;  2WPR A;  2B87 A;  3KXD A;  2K88 A;  5CJ0 A;  2E75 D;  2FYU G;  1RE4 C;  1FOS E;  2JKV A;  2YO2 A;  4PD4 D;  1RH5 B;  2Q5U A;  3F89 A;  2XZR A;  1URQ A;  2BCC D;  1MV8 A;  1EDK A;  3PP5 A;  3H1H G;  5H2F E;  2FXP A;  4W7Z A;  3RK3 C;  3VMA A;  5AVY B;  1YTZ T;  1KD1 Q;  2J59 M;  1JY3 N;  1IFN A;  1KMI Z;  2H8P D;  4H0L C;  2ZT9 D;  3L75 D;  2KNC A;  3C8V A;  2OYI C;  2FYU J;  3P8C D;  4PV1 C;  2YIU C;  1SP4 A;  3A0B H;  1A02 J;  1IFP A;  2A06 G;  3S4R A;  2M0B A;  3V2N A;  2ZYD A;  1NTK D;  2SPZ A;  3MP7 B;  3H1H J;  1NTZ G;  1S9K D;  4EOT A;  2KLU A;  2A45 G;  1M57 D;  2R5D A;  3AE7 C;  1SQV D;  3L73 G;  3QH9 A;  3LIE A;  3PTZ A;  2UWJ E;  3OA7 A;  1IK9 A;  2K9J B;  5TIS H;  1U7M A;  3HUS C;  4U3F D;  2JWA A;  2IYP A;  1UIX A;  3RK3 B;  1SQB E;  2ZXX A;  2IX7 C;  3VP8 A;  1NTZ J;  2JJL A;  1MZ9 A;  1USE A;  4H0L B;  1RY3 A;  3L74 D;  2E74 C;  1JTH B;  3L73 J;  1FC2 C;  2LXB A;  4PV1 B;  5B5E H;  2N1T D;  3WUT A;  3OJA B;  1L0N D; 
#chains in the Genus database with same CATH homology
 4W80 A;  1JCC A;  3RL0 B;  1WT6 A;  1N73 B;  2YKQ A;  4WY4 B;  3EQ2 A;  1J1E C;  1JUN A;  3BVH A;  1JO5 A;  2KOG A;  2IFM A;  1T2K D;  1L4A A;  3MD0 A;  1J1D B;  5CHX A;  1GL2 A;  2KLV A;  3A7O A;  2Q7C A;  1M1J B;  1Z56 A;  2ZXE B;  5AW1 B;  1YTZ I;  3VN0 A;  1CSB A;  3RK2 C;  4M3L A;  1SLQ A;  3GHG C;  3TK1 A;  4DOJ A;  2YNY A;  3HTK B;  1LWU A;  4C7N A;  5APU A;  1JOC A;  2KYV A;  3HRN A;  2IFN A;  1JCD A;  4N6J A;  1N2D C;  1LTB C;  2JEE A;  4N3Y B;  4JYC A;  1HWT C;  1RF1 A;  5APS A;  1SFC C;  4W7Y A;  4IFM A;  1IFM A;  1X9V A;  1LT9 C;  3IFM A;  3M0D A;  4WB4 A;  2R32 A;  1URQ B;  4I1L A;  3BAT A;  2MJZ A;  5AVS B;  3BRV B;  2N1T B;  1SVF A;  2WSC H;  1FJK A;  2POH A;  4GIF A;  1DEB A;  1HVV A;  1FZC B;  2C0W A;  1JNM A;  3TYY A;  3HD7 A;  5APW A;  3V4W A;  3LID A;  3V5B A;  1SQP K;  2C0X A;  2HG5 D;  1QL1 A;  3T97 A;  1LTS C;  2NPS C;  3EFG A;  1XTG B;  2GM4 A;  2P2U A;  3NXS A;  1T3J A;  1SQQ K;  2QM7 A;  3MIW A;  1NKN A;  2XDJ A;  5AW4 B;  1NWQ A;  1GDT A;  2O1K A;  3RK2 B;  1NTM K;  3M9H A;  3GHG B;  2HOD A;  1JY2 O;  1FZB A;  1SFC A;  3U59 A;  2H43 A;  1KIL A;  2FXM A;  1J2J B;  1KZU B;  4HYT B;  3L36 A;  2WSF H;  1L4A C;  1NU1 K;  3WMM 0;  3M91 A;  4EIJ A;  5AW6 B;  3TSI A;  3B5N C;  1IFJ A;  2WT7 B;  1LTJ A;  2QM8 A;  5KLV K;  1NO4 A;  4DZO A;  1FJP A;  5AW8 B;  3VOP A;  1JY3 P;  3VTP C;  3U1C A;  1GL2 D;  2E42 A;  4B86 A;  2GUS A;  2ZFC A;  3HE4 A;  1LWU C;  5AVR B;  1HGV A;  5AW3 B;  2A45 I;  1JY2 P;  1LT9 B;  1GU4 A;  3L35 A;  1CI6 B;  2A45 H;  1XTC C;  2OYI B;  1MFZ A;  1NKZ B;  2FFD A;  2Q3I A;  1URQ D;  1SQX K;  2P1J A;  5CCH C;  3P7K A;  3V2Q A;  1GD2 E;  2WWW A;  1FZF A;  3M0D C;  1IC2 A;  3KQG A;  3KPE A;  2P67 A;  1RE3 C;  4C7R A;  2BAS A;  2YKO A;  3CI9 A;  4WY4 A;  1G1I A;  2WSE H;  4AUW A;  3HD7 C;  2VRS A;  5APV A;  2GUV A;  3O8Z A;  4LLH A;  4XA4 A;  1NHL A;  3B5N A;  1H88 A;  1T8Z A;  1NAF A;  1NH4 A;  2I1J A;  2CPS A;  3OAK A;  1ZLL A;  1KFM A;  3A5T A;  1FZE A;  5CMZ A;  5AW2 B;  2W6B A;  3CL3 D;  5CCG A;  3RK2 D;  1ZR4 A;  1GL2 B;  4AYC A;  3I5C A;  4I2L C;  3HUS B;  1ZN5 A;  4ZKU A;  1FZG A;  1KIL C;  4JF7 A;  2XNX A;  5CCH A;  3HE5 A;  5AVX B;  1WRG A;  3M9B A;  2WIT A;  3VMX A;  1LWU B;  2PP6 A;  1LGH B;  1CW5 A;  2HYN A;  3NMD A;  1SFC D;  1FOS F;  1RE3 A;  1N7S A;  1KIL D;  1LTJ C;  1RF1 B;  2OYH A;  2Z5H A;  2YMY A;  1AQ5 A;  1IO4 A;  4LC1 A;  5AW0 B;  3NFQ A;  2FKW B;  3BRT B;  1J1E B;  2J58 A;  2FFD C;  3SWF A;  1X8Y A;  2HFE D;  1ZV8 A;  2NPS D;  3UIA A;  3IR9 A;  4Y99 C;  1JY3 O;  5AVW B;  3RL0 C;  2IPP A;  4WY4 C;  1FDM A;  1YYC A;  1RE4 A;  1VDF A;  3V2P A;  5KTB A;  3N7N A;  2XU6 A;  4AQR D;  1GZL A;  2Z4E A;  3M0A A;  2Q9I A;  4IFD K;  2HLO A;  3KYQ A;  5CJ4 A;  3H32 B;  2HPC B;  1G2C A;  2LKM A;  1HTL C;  1M1J C;  2WTY A;  1G1J A;  1L4A D;  2HOD B;  3L37 A;  1SFC B;  2XKM A;  1KIL B;  2R5B A;  2YKP A;  1E5W A;  1S9K E;  3B5N D;  5AVQ B;  5CCG C;  1KFN A;  5BU8 B;  4IFF A;  1CI6 A;  2L5G B;  1HBW A;  1DX7 A;  1LTJ B;  4JYB A;  4WBA A;  1JTH A;  1LTA C;  2OYI A;  2O1J A;  4N78 D;  5CCG D;  1HGZ A;  1ZR2 A;  3VMY A;  1N7L A;  3HE4 B;  1GW4 A;  4O9B A;  3TNU A;  5AW5 B;  2I1K A;  1GTW A;  3II6 A;  1M7L A;  5APT A;  2NPS B;  1N7S C;  3VYI A;  5CCH D;  1N73 A;  4N78 E;  3V4Q A;  1N86 A;  2FFD B;  1NTK K;  5AW7 B;  1FZC C;  3M06 A;  2OYH C;  1OWA A;  1A02 F;  5APY A;  1N7S D;  1IFD A;  1QL2 A;  1GU5 A;  4Y99 B;  5AVU B;  2R3C A;  5AW9 B;  1KQL A;  1M1J A;  1PFI A;  3HD7 D;  3A3Y B;  2P7J A;  3L4F A;  1FZA A;  1RF0 A;  1SQV K;  3B8E B;  3HTK A;  1L4A B;  3U1A A;  1DH3 A;  2WPR A;  3CLQ A;  1SQB K;  2CPB A;  5APQ A;  4LGD E;  3B5N B;  2Z5I A;  1LTG C;  3VMZ A;  3HUS A;  2FYU K;  5CJ0 A;  2PAJ A;  1T3U A;  5KJ7 A;  1RE4 C;  1FOS E;  5AVV B;  4C7N B;  2C9L Y;  1FAV A;  2YO2 A;  5AVZ B;  2Q5U A;  2XZR A;  2KSJ A;  3LW5 H;  4XE5 B;  1URQ A;  3R2P A;  2N1T A;  1MV8 A;  3C9I A;  2W27 A;  3PP5 A;  1FZC A;  4W7Z A;  3RK3 C;  4ZKP A;  3HE5 B;  1HUC A;  5AVY B;  1YTZ T;  1FBM A;  2J59 M;  2KP8 A;  1JMM A;  1JY3 N;  1IFN A;  3P32 A;  3SWY A;  2H8P D;  1N7S B;  3RK3 D;  1JY2 N;  1L0N K;  2N9B A;  2OYI C;  1AFO A;  2YO3 A;  1LTT C;  3HD7 B;  2KB7 P;  3MGN A;  2OYH B;  3G3Z A;  3P8C D;  1SP4 A;  2E43 A;  1A02 J;  2XV5 A;  1GK6 A;  3V2N A;  4HH2 A;  3NTN A;  1NTZ K;  1N73 C;  3E1I A;  5APX A;  1VPC A;  3GHG A;  1HJB A;  2C9N Y;  3P8C E;  1W2E A;  1L0L K;  3N4X A;  1S9K D;  3RL0 D;  4EOT A;  2WPQ A;  2W6A A;  3VP9 A;  2A45 G;  1J1D C;  4WY4 D;  5BU5 A;  3H32 A;  2HPC A;  4KHX A;  1HH0 A;  2R5D A;  2WT7 A;  2M3B A;  1EQ7 A;  3LIE A;  1IJD B;  1RF0 C;  3H6P A;  2H7H A;  2WPS A;  1IFI A;  3OA7 A;  1GK4 A;  1LT9 A;  1G2C B;  1IK9 A;  2FYZ A;  1GL2 C;  3P8M C;  4GT1 A;  3HUS C;  4C46 A;  2WZ7 A;  1H89 A;  3BAS A;  1FU1 A;  3A2A A;  2O01 H;  1OXZ A;  3RK3 B;  5KJ7 C;  2IX7 C;  3VP8 A;  4I6M C;  3MTU E;  3M9Q A;  1GW3 A;  2JJL A;  3KDP B;  1X79 B;  3MUD A;  1H8A A;  2M8R A;  1MZ9 A;  1URQ C;  4RES B;  1NOH A;  5KJ7 D;  2N1T C;  1RY3 A;  2NPS A;  1LTI C;  5BVZ A;  1CZQ A;  1JTH B;  1RF1 C;  3V2R A;  2OAR A;  5AVT B;  1MUU A;  3TNU B;  2N1T D;  3OJA B;  4OH8 B;  1T2K C;  4GKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...