1KILB

Three-dimensional structure of the complexin/snare complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
59
structure length
59
Chain Sequence
LSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Synaptobrevin SNARE motif
publication title Three-dimensional structure of the complexin/SNARE complex.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 27
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2001-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1kilB00
1L4AD 1SFCD 1N7SC 2WZ7A 1URQA 3PP5A 2NPSD 4WY4C 2N1TC 1URQD 3B5ND 1GL2C 5KJ7A 4W7ZA 2PP6A 3M0DC 3RL0B 3RK3B 1JTHA 3HD7A 3P8CE 4N78E 5CCHA 1SFCC 1T3JA 1NHLA 3RL0C 3RK3C 1N7SB 3HD7D 4WY4B 2N1TB 1KILC 1GL2A 1GL2B 3TSIA 5CCGC 1SFCB 1HVVA 1L4AC 5KJ7D 3RK2D 1N7SA 4JF7A 2NPSB 4W80A 2HG5D 2HFED 5CCHD 2NPSC 1KILB 1N7SD 4WY4A 2KOGA 2N1TA 1URQC 3B5NC 3HTKB 4WY4D 2N1TD 2YMYA 3KYQA 1GL2D 5CCGA 1XTGB 1SFCA 1L4AB 4LGDE 3HD7C 5CCHC 2NPSA 3RL0D 3RK3D 2XDJA 1KILA 3B5NA 1URQB 3B5NB 1KILD 4W7YA 3RK2B 4OH8B 1L4AA 2H8PD 1JTHB 3VOPA 5KJ7C 5CCGD 3HD7B 3RK2C 2M8RA
chains in the Genus database with same CATH superfamily
1IFMA 1SFCD 1G1JA 2J5UA 3CLQA 1NTKK 3CXHD 3CXHI 4N78D 4XFJA 3VYIA 2QJKC 5AVVB 1QVFO 3L75G 5AW2B 1KB9E 4H44C 1U57A 1GD2E 3HD7D 2ZYGA 1LTTC 1H88A 2O01J 2A06E 1X9VA 1VQ6P 2CPSA 1QLED 1YJ9P 1HBWA 5KLVD 3H1KD 1FE6A 3H1IJ 1Q2NA 1QVGO 4BXLA 1YIJP 3B5NC 3W67A 3GF7A 1H0TB 5CCGA 1NTMJ 1M56D 5GTIE 3CX5E 3SSUA 1A02F 1HWTC 1X79B 2K88A 2Q9IA 2NPSA 3KQGA 2GUVA 2IYOA 2YNYA 5APUA 1FZCC 4I2LC 2HODA 1JO5A 4KHXA 2KSEA 3CMAP 2Y0EA 1L0NG 3RK2B 2ZJSE 5AW1B 1JTHB 1M57D 1SP4A 5CJ4A 2M8RA 1K73Q 4B86A 3LIDA 2IBZG 3PP5A 2QJKB 2YXRB 1PPJG 2P67A 1NTZG 3L71G 1GW4A 3TF5A 4ASVA 4KJMA 4H44B 2PP6A 4PJ0H 2J58A 1D7MA 1CZQA 1T3JA 2WSCJ 1PP9G 1NTKE 2C0XA 2DW3A 2FXPA 3L74D 1KQLA 4WY4B 2XNXA 2KLVA 2FBWC 3K5BA 2E5YA 1JMMA 3Q1MA 1X8YA 3M0DA 5APQA 3TGUJ 2BEZF 3T97A 2FXOA 4BWNA 2FYUK 3KHUA 4EDFA 2PFXA 3II6A 1RE3C 5CCHD 1JUNA 1GTWA 1DH3A 4BRYA 1LTIC 3HTKB 4WY4D 5CMZA 2YMYA 4M3LA 5GTHH 2WMMA 3MD0A 1M1JC 1FZEA 2WT7A 1KQFB 4LGDE 3AECC 2H88C 3L70J 5KLIC 4Z1MH 3FXEA 4D6TE 3CCVP 2QG4A 1VQNP 3G6EP 3IAOA 5KAFH 3CWBE 1VQ9P 1GW3A 3KZIH 2W83C 5AVRB 3L75J 1VF5C 1P84E 1NJIQ 3Q3DA 1NGMB 3EFFK 2JKVA 1FC2C 3SWYA 3RL0C 3CCUP 1T8ZA 1JCDA 1SQBK 5KAIH 5KLVG 3H1KG 3CPWO 2KS1B 2FYNC 3SWFA 1BGYE 1S1CX 1FZCA 1GU4A 2BCCD 4JBZA 2CPBA 1H89A 2G8YA 1BDDA 1Y47A 3A0BH 2P10A 3TDKA 4K3AA 1R5LA 1IK7A 5E79E 2HG5D 3H1LD 5TISE 1FDOA 2E76D 3H25A 1URQC 1FZAA 1FZFA 1A02J 4ZMDA 3HUSB 1M1JB 2IZ1A 1OVRA 3PHLA 2VRSA 2WPRA 2FYUE 1OVUA 3M9QA 1L0NJ 3V5BA 5KLIB 3SWKA 3L73G 4PV1B 4N6JA 5AVUB 2LXBA 1S72P 5AVWB 1S9KE 1J1EC 2KXPB 1QL2A 1LTJC 2ZT9C 2GM4A 4W7YA 3NFQA 1NTZJ 3L71J 4HH2A 1YQ4C 1PV3A 3CCSP 3ITKA 2QSIA 5APVA 2AXTE 2RKLA 1PP9J 3L74G 4PV1D 1BCCE 2WSFJ 5B5EH 4YPCA 1T6AA 5AVYB 1IK9A 3G4SP 4W7ZA 3RL0B 1OVVA 1EZVI 1AFOA 1N7SB 3V4QA 2WPVB 2N1TB 1VQ7P 1GL2B 2Q3IA 2XU6A 4PD4E 2WITA 3RGUA 4U3FD 1FBMA 5APSA 3S4RA 4IL6X 4AQRD 1E79H 1SQBE 4JYBA 4IFFA 5KJ7D 2MKVA 1J1DC 2WWWA 1SQXK 1N7SD 3C8VA 3F89A 2N1TD 3OAKA 1CW5A 1GL2D 2KUBA 2WSEJ 2C9NY 1MFZA 1NKNA 1G2CA 1YTZI 4GOEA 3CCJP 1ZOYC 3KPEA 2PAJA 4H0LD 1VQMP 2FYZA 3MGNA 1SQPK 1LTJB 4H13B 2D2CC 5H2FH 1VQ8P 1KTMA 2K9JB 2R3SA 2ZVNB 2W6BA 1USDA 1LTBC 4ASWA 1RF1A 5C39A 1URQA 2E74C 4ZNCA 2AEJA 2M5AA 5KLVJ 3H1KJ 1KB9D 3M9BA 3M0AA 1NTMG 2BCCG 4XE5B 1FJPA 5AVSB 2H89C 4H13D 1SFCC 2QVAA 2YMKA 1VL2A 4L76A 3G9RA 3Q2YA 3AEDC 2A06D 2O3JA 3H1LG 3PLNA 3TNUA 2FFDB 1JCCA 1NVOA 1RQUA 5B66E 3BATA 5CCGC 1MKMA 3A2AA 3F5HA 4W80A 2XZRA 2G3AA 1QX8A 2NPSC 5AVTB 3CX5D 2IBZI 1BSNA 1S4XA 3N4XA 3P32A 3GMAA 4DT0A 3E1IA 3MUDC 3RBXA 3VMYA 1SQXE 2Q5UA 2O01N 2B87B 2CK3H 2O01H 4GODA 2KB7P 3R4YA 5AW4B 4QMAA 4DCKA 3L74J 2H43A 2OYOA 2Y9YA 2H8PD 1FOSE 1SQPE 2N9YB 2LKMA 1JB0J 1JMBA 1S5LH 3VMAA 3S1KA 2OTLP 3JC22 5AW6B 3PRJA 1BSHA 1NTKD 3H1JD 4U3FG 3M0DC 4I1LA 2W90A 3RK3C 1Q81Q 3CMEP 1R5SA 1JM0A 1RH5B 2M3EA 3V4WA 2AXCA 4PJ0E 4WB4A 3OA7A 4AUWA 3B8EB 2ZVOB 3BCCE 1R8EA 1BE3E 4JF7A 3U1AA 2NPSB 2V4HA 1JY3O 3BVHA 3HE5A 1AA0A 4XA4A 2WSCH 2HODB 2ITAA 4D6TD 1EDLA 2BEQD 2A45H 1SFCA 5AVZB 3VP8A 1IFIA 1KORA 5CCHC 1JY3N 2XDJA 3L4FA 1M7LA 1VQOP 4OGQC 5GTHE 3D70A 3JCUE 3CWBD 5TJHA 4Y28J 3AEBC 2HPCA 4C7NA 1P84D 1KYOH 2BCCJ 4Y99C 3OW2O 4EYYQ 4AYCA 4HJGH 3M9HA 5CBNA 1OZHA 2L5GB 2A06G 3CCMP 3CCEP 1FDIA 3H1LJ 4JPZB 3KZIE 3MUDA 3T97B 4EOTA 1QL1A 3RK3B 1RY3A 1WRGA 1LWUC 1BGYD 2PGDA 3L72D 2P58A 2QM7A 4NPFX 4RO0A 4RJTA 2XNDH 2JEEA 4BRYB 1CI6A 2WT7B 5KAIE 2HYNA 1OFCX 3H1HE 1N73A 3RK2D 4DOJA 2FYUD 3H1JE 2ZYAA 3AE6C 3HE4B 3A0BE 4C7RA 2E75C 1PGJA 2Y0DA 5APYA 2IFNA 1DIPA 2OYIC 4I7ZC 2Y0CA 3AE4C 1S9KD 4H44D 4OGQB 3H32A 4N3YB 2R5DA 1LP1A 2B88A 3B5NB 1M8OB 4TLFA 5EFWB 3WMM0 2K3RA 3RBZA 3IR9A 3GHGA 1NTKG 1DEEG 3EQ2A 3V2NA 4U3FJ 1BCCD 3GLMA 2R32A 2XV5A 1FZCB 2JR8A 2V7QJ 3B5ND 4R4MA 3V2RA 1W2EA 1SS1A 5CCHA 4IFMA 2JP3A 1QEXA 4PD4D 2YKOA 3OJAB 1KILC 1SQBD 1JY2O 4LC1A 1NU1D 1SQQE 4D6TG 3D71A 1ZXGA 2WSFH 1VQPP 3FGAD 1PL5A 3A7OA 2QJYC 4CPGA 1EC5A 3CL3D 3L72E 1NU1K 3CWBG 1RF0C 3EWKA 4WVZA 3CC7P 1LWUA 2WPQA 3Q5PA 3M91A 1AVYA 1LT9A 1HUCA 3AE9C 1RF1C 3RK3E 2JO1A 4OVNF 5AW8B 3RL0g 1N86A 1Y9BA 1BGYG 4H0LC 3CC2P 3AE5C 4RESB 3C9IA 2WSEH 2WZ7A 1Y8AA 3CXHH 5H2FE 2WSSH 2WPSA 1SQVE 1EDIA 1L0LE 1YBKA 2OYIA 2YIUC 2QRXA 3P8CE 1KZUB 1Q7YQ 2YO2A 1VF5B 2ZXXA 1FS0E 1T2KC 2L91A 2FYUG 3S9OA 2R5BA 3R2PA 1NAFA 2KLUA 1RHZB 1JEKA 1IZNB 3I5CA 3SFEC 1G2CB 1GK6A 1L4AC 1OW8A 1RQVA 1VF5D 4EIJA 2FYNB 1ZW0A 3A3YB 3USSA 1G1IA 1N7LA 3HUSA 2K37A 1SQXD 3CI9A 1AQTA 2Z4EA 4TT3H 2Y9ZA 2QJPC 1NTKJ 3I56P 3H1JJ 3RL0D 3L36A 3W68A 1BCCG 4YTPC 1NU1E 1KILA 2RMZA 1RF1B 1URQB 1VDFA 2SPZA 3IF4A 1FDMA 2M5AB 1KFNA 1GMJA 4YXWH 1SQPD 2Z5IA 4GT1A 1VQLP 2JWDA 4RKUJ 2B9BA 1ZV8A 3GW6A 3FX0A 3AE2C 5CHXA 1J1EB 3H1IE 1RF0A 3MIWA 3MP7B 1URQD 1SQBG 3FXDA 1U7JA 2ZT9B 1NOHA 1YJWP 5TISH 3G71P 5L8RJ 5KJ7A 3MTUE 5APXA 2KK7A 4D6TJ 3WUVA 1S5LE 3VMZA 3BCCD 1S3JA 1LGHB 1FAVA 1GL2A 1IFPA 1BE3D 1KB9I 1HGZA 4ZKPA 3CWBJ 2ZT9D 3CCLP 3BASA 4UB6H 1Q90D 5KTBA 2P2UA 1NO4A 3TYYA 1DEBA 1VQKP 1W2BO 1OW6A 2KOGA 1EXJA 1X0TA 3CD6P 3AE3C 5KKZC 4IFDK 1WMKA 2AXTH 2YKPA 3PJSK 3E1RA 3O6QA 2QJPB 1DX7A 3BRTB 2LXCB 2IFMA 3V6IA 1K05A 1J1DB 1LT1A 3HD7C 2HLOA 5APTA 2RH0A 1Z56A 3M06A 1BGYJ 1NH4A 3L72J 3CC4P 2KI7B 3CX5I 1K8AQ 2GA1A 3LW5J 3TGUE 1L4AA 4IL6H 1KILE 3BRVB 1QGKB 1PGOA 1EZVE 1OX3A 1KYOE 2FYUJ 1L0NK 2D2CB 1GZLA 3H6PA 3O8ZA 1AQ5A 4YXDC 2JWAA 4R4LA 3L70E 1N73C 3HE5B 2E74B 4WWIA 1NTZK 4GKGA 2Q7CA 2AEFA 2YKQA 1LTAC 1EDJA 3H1HD 1SQXG 1PGPA 5CJ0A 2D2CD 2NRGA 1OW7A 1SFCB 1KQSO 3A0HH 1MV8A 1YQ3C 3KXDA 1RE4C 3L75E 3VTPC 1FOSF 1BCCJ 4MN4C 2OTJP 2W6AA 3PTZA 2HPCB 4C7NB 3L37A 3AE1C 1SQPG 3GHGC 3I55P 2QM8A 2I1KA 2B87A 1XTCC 3C1LA 3LIEA 1LTSC 2KNCA 4UB8H 1USEA 2IDBA 1HTLC 3AE7C 3B71A 2BASA 3AEFC 1SQBJ 1MUUA 2OYHA 3VOPA 2IZ0A 5CCGD 5B66H 2ZYDA 1NU1J 4GOFA 1HH0A 2XKMA 1FU1A 3GF3A 3MHVA 1H8AA 3BCCG 2NPSD 4WY4C 1NAYA 1ZRTE 4A7PA 1ZR2A 2Q6QA 1BE3G 1CI6B 1P84I 3HD7A 1N73B 1J2JB 1L0NE 2QA4P 1JY3P 1SQQD 3QH9A 1Q86Q 5DJTB 3D6ZA 5KAFE 3ABVC 3WU2H 2IBZE 5BU5A 2GUSA 4U7JA 1PPJE 5KLVK 1NTZE 2UWJE 2V7QH 3L71E 3VN0A 2J59M 1SQQK 5K5GB 3H32B 1LP1B 2RN0A 2P1JA 1PP9E 3G3ZA 3IN6A 1M90Q 3AEAC 1LT9C 2WTYA 3GHGB 1GK4A 3L73D 2K1AA 4I6MC 3RK3D 1ZN5A 1W5CE 3SFDC 3P8MC 1H0TA 3TK1A 1L2PA 2R44A 4NPEA 1HGVA 1SQVD 1RE4A 1L0LD 2E76C 1KB9H 1YI2P 3P8CD 2N9BA 3H1HG 1K9MQ 3WUTA 4Y99B 1SQXJ 1OIPA 5AVXB 3CCRP 1JTHA 1SQVK 3CXHE 3H1JG 4HKZH 1WT6A 4N78E 1L0LK 3IFMA 3NXSA 2IX7C 4OGQD 2FY8A 3TSIA 3HUSC 3JCUH 3AEEC 1LWUB 2Q3EA 2ZFCA 1SQPJ 4JQ0D 1UIXA 5GTIH 3CX5H 1VPCA 2Q1KA 4PD4I 4WY4A 3HE4A 4PV1C 5B5EE 1AVOA 1LT9B 1LJ2A 3N7NA 3H1KE 2B89A 3KYQA 5KLVE 4NPDA 1XTGB 2POHA 4DZOA 1YJNP 5AW3B 2C9LY 1N8RQ 1ZMEC 3B5NA 3L35A 1JY2N 2E75B 3HTKA 1NWQA 3BCCJ 3B4SA 1SLQA 3WUUA 3Q5RA 4OWFA 2OYIB 4I7ZB 2Z5HA 1NYHA 2ZXEB 1BE3J 5KJ7C 1DD4A 3H1ID 2E42A 1S2EA 2E76B 1N7SC 1SQQG 1NTMD 5AW0B 1IFJA 2N1TC 2WVRA 1KC8Q 3L73E 1GL2C 1JY2P 1N2DC 2E75D 4KT0J 2OARA 2QEXP 3P7KA 2W8ZA 3EFGA 5AVQB 1KN7A 2M0BA 1NHLA 2HR3A 4HB1A 3V2PA 1JOCA 3VP9A 3L72G 1NTMK 2KP8A 2KYVA 2O1KA 1OXZA 3L74E 2YO3A 1YHQP 1IFNA 1HVVA 2R3CA 3FWLA 1MZ9A 3U59A 3HRNA 1KILB 2KS1A 4HYTB 1X22A 5AW7B 1E5WA 4UB6E 1KV4A 4H13C 5DJUB 2JDIH 4K35A 2OGUA 4JYCA 2I8DA 1RE3A 2KZJA 1EDKA 2A45I 2WQYC 1SQVG 2ZAEB 1CSBA 1L0LG 2QJYB 4L74A 3TGUD 1KILD 1HF9A 1M1JA 1P84H 2W6JH 1SVFA 5AW5B 3ZDMA 1BDCA 1EZVD 3H1HJ 1PFIA 1KYOD 4GIFA 4O9BA 2H7HA 5APWA 1KYOI 5CBOA 1IFDA 3KDPB 2PRRA 1K04A 2QE7H 2FFDC 4IL6E 1FJKA 1AV1A 3AE8C 3L70D 1PGQA 1VQ4P 1PZQA 4H0LB 1OWAA 1ZLLA 3V2QA 1GDTA 3LW5H 2I1JA 4C46A 1IJDB 3Q5SA 2OQQA 3UIAA 3TNUB 2AEMA 5E79H 4DJGA 3CCQP 2P7JA 2YIUB 3O6QB 1GU5A 3L75D 4IOIH 1NU1G 1NTME 2BCCE 1N7SA 2LR2A 2KIKA 2HFED 3VMXA 2N1TA 2FKWB 1S5LX 3D6YA 1T3UA 2IYPA 1MFTA 2IPPA 3A0HE 1LNQA 3H1LE 2E43A 4ZKUA 2KSJA 1L4AB 5M1BA 2OTKE 1TU3F 3JSVC 2OYHC 3H1IG 1VQ5P 1T2KD 1Q82Q 1OMIA 4WBAA 1SQQJ 2YXQB 1ZP0C 1ZR4A 2MJZA 1UIIA 1HJ0A 2NZ2A 4UB8E 3NMDA 1L4AD 1ZRTD 2M3BA 1YTZT 3FWNA 5BU8B 3A5TA 1LTJA 5AW9B 1AJYA 3AEGC 2K9JA 1L0ND 1FZBA 3PH0A 4GDOA 4PD4H 2QIWA 1NKZB 1EQ7A 2C0WA 2O1JA 2E5TA 4LLHA 3NTNA 2IBZD 3GG2A 2JJLA 3L73J 3MZWB 1KQGB 3E7KA 2FXMA 1PPJD 1U7MA 1FZGA 1NTZD 3L71D 2KZIA 1PIXA 1HJBA 1EXIA 1DD3A 1PP9D 2A45G 4L73A 4U3FE 2KNCB 1IO4A 3WU2E 1KMIZ 1SQVJ 2FFDA 1L0LJ 3TGUG 1IC2A 1KD1Q 3U1CA 3QWOC 1M1KQ 2OYHB 1EZVG 1YITP 4L75A 2K9YA 5BVZA 1JNMA 1YYCA 5KKZB 2W27A 4EI2A 1LTGC 2E74D 1KFMA 3L70G 4OH8B 3HD7B 3RK2C
chains in the Genus database with same CATH topology
1IFMA 1SFCD 4RESB 1RE4A 3C9IA 1LTBC 2WSEH 1G1JA 2WZ7A 1RF1A 1URQA 3CLQA 1NTKK 3P8CD 4N78D 2WPSA 3M9BA 2N9BA 3M0AA 4XE5B 3VYIA 1FJPA 5AVSB 5AVVB 4Y99B 2OYIA 5AVXB 1JTHA 1SQVK 1WT6A 5AW2B 3P8CE 4N78E 1KZUB 1L0LK 1SFCC 2YO2A 3IFMA 1GD2E 3HD7D 1T2KC 3NXSA 2IX7C 2R5BA 3TNUA 2FFDB 3R2PA 1JCCA 1NAFA 1LTTC 3TSIA 1H88A 3HUSC 3BATA 3I5CA 1LWUB 5CCGC 1X9VA 2ZFCA 1G2CB 1GK6A 1L4AC 2CPSA 3A2AA 1VPCA 4W80A 2XZRA 1HBWA 4EIJA 2NPSC 5AVTB 4WY4A 3A3YB 3HE4A 1G1IA 1LT9B 3N4XA 1N7LA 3B5NC 3HUSA 3CI9A 2Z4EA 3P32A 3N7NA 3KYQA 5CCGA 3E1IA 1XTGB 2POHA 4DZOA 3VMYA 1A02F 1HWTC 1X79B 5AW3B 2Q5UA 2C9LY 2Q9IA 2NPSA 3KQGA 3RL0D 3L36A 2GUVA 2O01H 1KILA 3B5NA 1RF1B 1URQB 1VDFA 2KB7P 3L35A 2YNYA 5APUA 5AW4B 1JY2N 1FDMA 3HTKA 1NWQA 1KFNA 1FZCC 1SLQA 4I2LC 2HODA 2H43A 4KHXA 1JO5A 2Z5IA 2OYIB 4GT1A 3RK2B 2Z5HA 2ZXEB 2H8PD 5AW1B 1JTHB 5KJ7C 1ZV8A 1SP4A 2E42A 1FOSE 5CJ4A 2M8RA 2LKMA 1N7SC 4B86A 3LIDA 5CHXA 3PP5A 1J1EB 5AW0B 1IFJA 2N1TC 1RF0A 3MIWA 1URQD 1GL2C 5AW6B 1JY2P 2P67A 1N2DC 1NOHA 1GW4A 2OARA 5KJ7A 3P7KA 3EFGA 2PP6A 3M0DC 3MTUE 5AVQB 4I1LA 2J58A 5APXA 1CZQA 1T3JA 1NHLA 3RK3C 3V2PA 1JOCA 3VP9A 2C0XA 3VMZA 1NTMK 1LGHB 1KQLA 4WY4B 1FAVA 2KP8A 2XNXA 1GL2A 3V4WA 2KLVA 2KYVA 2O1KA 4WB4A 3OA7A 4AUWA 1OXZA 3B8EB 1JMMA 1HGZA 1X8YA 3M0DA 5APQA 4ZKPA 2YO3A 3T97A 3BASA 2FYUK 1IFNA 1HVVA 2R3CA 5KTBA 2P2UA 1NO4A 3TYYA 1DEBA 4JF7A 3U1AA 1MZ9A 2NPSB 3U59A 3II6A 1JY3O 1RE3C 3HE5A 3HRNA 5CCHD 3BVHA 1KILB 1JUNA 2KOGA 1GTWA 4HYTB 1DH3A 1LTIC 5AW7B 1E5WA 4XA4A 3HTKB 4WY4D 4IFDK 2WSCH 5CMZA 2YMYA 4M3LA 2YKPA 2HODB 3MD0A 1M1JC 1FZEA 2WT7A 1DX7A 2A45H 3BRTB 1SFCA 5AVZB 2IFMA 3VP8A 4LGDE 1IFIA 4JYCA 1J1DB 1RE3A 3HD7C 2HLOA 5APTA 1JY3N 5CCHC 2A45I 2XDJA 3L4FA 1Z56A 1M7LA 1CSBA 3M06A 1NH4A 1KILD 1M1JA 5AW5B 1SVFA 2HPCA 4C7NA 4Y99C 1L4AA 1PFIA 4GIFA 4O9BA 4AYCA 2H7HA 1GW3A 5APWA 1IFDA 3BRVB 5AVRB 3KDPB 3M9HA 2L5GB 1L0NK 2FFDC 1GZLA 3H6PA 1FJKA 3MUDA 3O8ZA 1AQ5A 4EOTA 1QL1A 3RK3B 1RY3A 3SWYA 1WRGA 1LWUC 3RL0C 1T8ZA 1JCDA 1N73C 1SQBK 2QM7A 3HE5B 1OWAA 1ZLLA 3V2QA 1GDTA 1NTZK 4GKGA 2Q7CA 3LW5H 2YKQA 2I1JA 3SWFA 4C46A 1IJDB 1LTAC 2JEEA 1FZCA 3UIAA 3TNUB 1GU4A 2CPBA 1H89A 2P7JA 5CJ0A 1GU5A 1CI6A 2WT7B 1SFCB 2HYNA 1N73A 1MV8A 3RK2D 1N7SA 4DOJA 2HG5D 2HFED 3VMXA 1RE4C 3VTPC 2N1TA 1FOSF 2FKWB 3HE4B 1T3UA 1URQC 1FZAA 1FZFA 1A02J 4C7RA 3HUSB 1M1JB 2VRSA 2WPRA 2W6AA 2IPPA 2HPCB 5APYA 4C7NB 3L37A 2IFNA 2E43A 4ZKUA 2OYIC 2KSJA 1L4AB 3GHGC 3M9QA 2QM8A 2I1KA 3V5BA 1S9KD 2OYHC 3LIEA 1XTCC 1LTSC 3H32A 4N3YB 2R5DA 4N6JA 5AVUB 1T2KD 3B5NB 5AVWB 1S9KE 3WMM0 1J1EC 4WBAA 1QL2A 1HTLC 1LTJC 2BASA 3IR9A 2GM4A 4W7YA 3NFQA 3GHGA 1ZR4A 1MUUA 2MJZA 3EQ2A 4HH2A 2OYHA 3VOPA 5CCGD 3V2NA 3NMDA 1L4AD 2M3BA 1HH0A 2XKMA 5APVA 1YTZT 1FU1A 2R32A 1H8AA 5BU8B 2NPSD 3A5TA 2XV5A 4WY4C 1LTJA 1FZCB 5AW9B 3B5ND 3V2RA 1ZR2A 1W2EA 5AVYB 1CI6B 1IK9A 1FZBA 4W7ZA 3RL0B 3HD7A 5CCHA 1AFOA 1NKZB 4IFMA 1EQ7A 1N73B 2C0WA 2O1JA 1N7SB 1J2JB 3V4QA 4LLHA 3NTNA 2YKOA 3OJAB 1JY3P 2JJLA 2N1TB 1KILC 2FXMA 1JY2O 1GL2B 2Q3IA 2XU6A 1FZGA 4LC1A 2WITA 5BU5A 1FBMA 2GUSA 1HJBA 5APSA 4AQRD 4JYBA 4IFFA 5KLVK 3VN0A 5KJ7D 2J59M 2WSFH 1SQQK 1J1DC 2A45G 3H32B 2WWWA 1SQXK 1IO4A 1N7SD 3A7OA 2FFDA 2P1JA 3G3ZA 3CL3D 1NU1K 2N1TD 1LT9C 3OAKA 1RF0C 1IC2A 1CW5A 3U1CA 1GL2D 2WTYA 3GHGB 1LWUA 1GK4A 2C9NY 1MFZA 1NKNA 2WPQA 2OYHB 1G2CA 1YTZI 4I6MC 3RK3D 1ZN5A 3KPEA 5BVZA 2PAJA 1JNMA 1YYCA 2FYZA 3M91A 2W27A 3MGNA 1LT9A 1HUCA 3P8MC 1RF1C 1SQPK 1LTGC 1LTJB 1KFMA 3TK1A 4OH8B 1HGVA 5AW8B 3HD7B 3RK2C 1N86A 2W6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L4A D;  1SFC D;  1N7S C;  2WZ7 A;  1URQ A;  3PP5 A;  2NPS D;  4WY4 C;  2N1T C;  1URQ D;  3B5N D;  1GL2 C;  5KJ7 A;  4W7Z A;  2PP6 A;  3M0D C;  3RL0 B;  3RK3 B;  1JTH A;  3HD7 A;  3P8C E;  4N78 E;  5CCH A;  1SFC C;  1T3J A;  1NHL A;  3RL0 C;  3RK3 C;  1N7S B;  3HD7 D;  4WY4 B;  2N1T B;  1KIL C;  1GL2 A;  1GL2 B;  3TSI A;  5CCG C;  1SFC B;  1HVV A;  1L4A C;  5KJ7 D;  3RK2 D;  1N7S A;  4JF7 A;  2NPS B;  4W80 A;  2HG5 D;  2HFE D;  5CCH D;  2NPS C;  1KIL B;  1N7S D;  4WY4 A;  2KOG A;  2N1T A;  1URQ C;  3B5N C;  3HTK B;  4WY4 D;  2N1T D;  2YMY A;  3KYQ A;  1GL2 D;  5CCG A;  1XTG B;  1SFC A;  1L4A B;  4LGD E;  3HD7 C;  5CCH C;  2NPS A;  3RL0 D;  3RK3 D;  2XDJ A;  1KIL A;  3B5N A;  1URQ B;  3B5N B;  1KIL D;  4W7Y A;  3RK2 B;  4OH8 B;  1L4A A;  2H8P D;  1JTH B;  3VOP A;  5KJ7 C;  5CCG D;  3HD7 B;  3RK2 C;  2M8R A; 
#chains in the Genus database with same CATH topology
 1IFM A;  1SFC D;  1G1J A;  2J5U A;  3CLQ A;  1NTK K;  3CXH D;  3CXH I;  4N78 D;  4XFJ A;  3VYI A;  2QJK C;  5AVV B;  1QVF O;  3L75 G;  5AW2 B;  1KB9 E;  4H44 C;  1U57 A;  1GD2 E;  3HD7 D;  2ZYG A;  1LTT C;  1H88 A;  2O01 J;  2A06 E;  1X9V A;  1VQ6 P;  2CPS A;  1QLE D;  1YJ9 P;  1HBW A;  5KLV D;  3H1K D;  1FE6 A;  3H1I J;  1Q2N A;  1QVG O;  4BXL A;  1YIJ P;  3B5N C;  3W67 A;  3GF7 A;  1H0T B;  5CCG A;  1NTM J;  1M56 D;  5GTI E;  3CX5 E;  3SSU A;  1A02 F;  1HWT C;  1X79 B;  2K88 A;  2Q9I A;  2NPS A;  3KQG A;  2GUV A;  2IYO A;  2YNY A;  5APU A;  1FZC C;  4I2L C;  2HOD A;  1JO5 A;  4KHX A;  2KSE A;  3CMA P;  2Y0E A;  1L0N G;  3RK2 B;  2ZJS E;  5AW1 B;  1JTH B;  1M57 D;  1SP4 A;  5CJ4 A;  2M8R A;  1K73 Q;  4B86 A;  3LID A;  2IBZ G;  3PP5 A;  2QJK B;  2YXR B;  1PPJ G;  2P67 A;  1NTZ G;  3L71 G;  1GW4 A;  3TF5 A;  4ASV A;  4KJM A;  4H44 B;  2PP6 A;  4PJ0 H;  2J58 A;  1D7M A;  1CZQ A;  1T3J A;  2WSC J;  1PP9 G;  1NTK E;  2C0X A;  2DW3 A;  2FXP A;  3L74 D;  1KQL A;  4WY4 B;  2XNX A;  2KLV A;  2FBW C;  3K5B A;  2E5Y A;  1JMM A;  3Q1M A;  1X8Y A;  3M0D A;  5APQ A;  3TGU J;  2BEZ F;  3T97 A;  2FXO A;  4BWN A;  2FYU K;  3KHU A;  4EDF A;  2PFX A;  3II6 A;  1RE3 C;  5CCH D;  1JUN A;  1GTW A;  1DH3 A;  4BRY A;  1LTI C;  3HTK B;  4WY4 D;  5CMZ A;  2YMY A;  4M3L A;  5GTH H;  2WMM A;  3MD0 A;  1M1J C;  1FZE A;  2WT7 A;  1KQF B;  4LGD E;  3AEC C;  2H88 C;  3L70 J;  5KLI C;  4Z1M H;  3FXE A;  4D6T E;  3CCV P;  2QG4 A;  1VQN P;  3G6E P;  3IAO A;  5KAF H;  3CWB E;  1VQ9 P;  1GW3 A;  3KZI H;  2W83 C;  5AVR B;  3L75 J;  1VF5 C;  1P84 E;  1NJI Q;  3Q3D A;  1NGM B;  3EFF K;  2JKV A;  1FC2 C;  3SWY A;  3RL0 C;  3CCU P;  1T8Z A;  1JCD A;  1SQB K;  5KAI H;  5KLV G;  3H1K G;  3CPW O;  2KS1 B;  2FYN C;  3SWF A;  1BGY E;  1S1C X;  1FZC A;  1GU4 A;  2BCC D;  4JBZ A;  2CPB A;  1H89 A;  2G8Y A;  1BDD A;  1Y47 A;  3A0B H;  2P10 A;  3TDK A;  4K3A A;  1R5L A;  1IK7 A;  5E79 E;  2HG5 D;  3H1L D;  5TIS E;  1FDO A;  2E76 D;  3H25 A;  1URQ C;  1FZA A;  1FZF A;  1A02 J;  4ZMD A;  3HUS B;  1M1J B;  2IZ1 A;  1OVR A;  3PHL A;  2VRS A;  2WPR A;  2FYU E;  1OVU A;  3M9Q A;  1L0N J;  3V5B A;  5KLI B;  3SWK A;  3L73 G;  4PV1 B;  4N6J A;  5AVU B;  2LXB A;  1S72 P;  5AVW B;  1S9K E;  1J1E C;  2KXP B;  1QL2 A;  1LTJ C;  2ZT9 C;  2GM4 A;  4W7Y A;  3NFQ A;  1NTZ J;  3L71 J;  4HH2 A;  1YQ4 C;  1PV3 A;  3CCS P;  3ITK A;  2QSI A;  5APV A;  2AXT E;  2RKL A;  1PP9 J;  3L74 G;  4PV1 D;  1BCC E;  2WSF J;  5B5E H;  4YPC A;  1T6A A;  5AVY B;  1IK9 A;  3G4S P;  4W7Z A;  3RL0 B;  1OVV A;  1EZV I;  1AFO A;  1N7S B;  3V4Q A;  2WPV B;  2N1T B;  1VQ7 P;  1GL2 B;  2Q3I A;  2XU6 A;  4PD4 E;  2WIT A;  3RGU A;  4U3F D;  1FBM A;  5APS A;  3S4R A;  4IL6 X;  4AQR D;  1E79 H;  1SQB E;  4JYB A;  4IFF A;  5KJ7 D;  2MKV A;  1J1D C;  2WWW A;  1SQX K;  1N7S D;  3C8V A;  3F89 A;  2N1T D;  3OAK A;  1CW5 A;  1GL2 D;  2KUB A;  2WSE J;  2C9N Y;  1MFZ A;  1NKN A;  1G2C A;  1YTZ I;  4GOE A;  3CCJ P;  1ZOY C;  3KPE A;  2PAJ A;  4H0L D;  1VQM P;  2FYZ A;  3MGN A;  1SQP K;  1LTJ B;  4H13 B;  2D2C C;  5H2F H;  1VQ8 P;  1KTM A;  2K9J B;  2R3S A;  2ZVN B;  2W6B A;  1USD A;  1LTB C;  4ASW A;  1RF1 A;  5C39 A;  1URQ A;  2E74 C;  4ZNC A;  2AEJ A;  2M5A A;  5KLV J;  3H1K J;  1KB9 D;  3M9B A;  3M0A A;  1NTM G;  2BCC G;  4XE5 B;  1FJP A;  5AVS B;  2H89 C;  4H13 D;  1SFC C;  2QVA A;  2YMK A;  1VL2 A;  4L76 A;  3G9R A;  3Q2Y A;  3AED C;  2A06 D;  2O3J A;  3H1L G;  3PLN A;  3TNU A;  2FFD B;  1JCC A;  1NVO A;  1RQU A;  5B66 E;  3BAT A;  5CCG C;  1MKM A;  3A2A A;  3F5H A;  4W80 A;  2XZR A;  2G3A A;  1QX8 A;  2NPS C;  5AVT B;  3CX5 D;  2IBZ I;  1BSN A;  1S4X A;  3N4X A;  3P32 A;  3GMA A;  4DT0 A;  3E1I A;  3MUD C;  3RBX A;  3VMY A;  1SQX E;  2Q5U A;  2O01 N;  2B87 B;  2CK3 H;  2O01 H;  4GOD A;  2KB7 P;  3R4Y A;  5AW4 B;  4QMA A;  4DCK A;  3L74 J;  2H43 A;  2OYO A;  2Y9Y A;  2H8P D;  1FOS E;  1SQP E;  2N9Y B;  2LKM A;  1JB0 J;  1JMB A;  1S5L H;  3VMA A;  3S1K A;  2OTL P;  3JC2 2;  5AW6 B;  3PRJ A;  1BSH A;  1NTK D;  3H1J D;  4U3F G;  3M0D C;  4I1L A;  2W90 A;  3RK3 C;  1Q81 Q;  3CME P;  1R5S A;  1JM0 A;  1RH5 B;  2M3E A;  3V4W A;  2AXC A;  4PJ0 E;  4WB4 A;  3OA7 A;  4AUW A;  3B8E B;  2ZVO B;  3BCC E;  1R8E A;  1BE3 E;  4JF7 A;  3U1A A;  2NPS B;  2V4H A;  1JY3 O;  3BVH A;  3HE5 A;  1AA0 A;  4XA4 A;  2WSC H;  2HOD B;  2ITA A;  4D6T D;  1EDL A;  2BEQ D;  2A45 H;  1SFC A;  5AVZ B;  3VP8 A;  1IFI A;  1KOR A;  5CCH C;  1JY3 N;  2XDJ A;  3L4F A;  1M7L A;  1VQO P;  4OGQ C;  5GTH E;  3D70 A;  3JCU E;  3CWB D;  5TJH A;  4Y28 J;  3AEB C;  2HPC A;  4C7N A;  1P84 D;  1KYO H;  2BCC J;  4Y99 C;  3OW2 O;  4EYY Q;  4AYC A;  4HJG H;  3M9H A;  5CBN A;  1OZH A;  2L5G B;  2A06 G;  3CCM P;  3CCE P;  1FDI A;  3H1L J;  4JPZ B;  3KZI E;  3MUD A;  3T97 B;  4EOT A;  1QL1 A;  3RK3 B;  1RY3 A;  1WRG A;  1LWU C;  1BGY D;  2PGD A;  3L72 D;  2P58 A;  2QM7 A;  4NPF X;  4RO0 A;  4RJT A;  2XND H;  2JEE A;  4BRY B;  1CI6 A;  2WT7 B;  5KAI E;  2HYN A;  1OFC X;  3H1H E;  1N73 A;  3RK2 D;  4DOJ A;  2FYU D;  3H1J E;  2ZYA A;  3AE6 C;  3HE4 B;  3A0B E;  4C7R A;  2E75 C;  1PGJ A;  2Y0D A;  5APY A;  2IFN A;  1DIP A;  2OYI C;  4I7Z C;  2Y0C A;  3AE4 C;  1S9K D;  4H44 D;  4OGQ B;  3H32 A;  4N3Y B;  2R5D A;  1LP1 A;  2B88 A;  3B5N B;  1M8O B;  4TLF A;  5EFW B;  3WMM 0;  2K3R A;  3RBZ A;  3IR9 A;  3GHG A;  1NTK G;  1DEE G;  3EQ2 A;  3V2N A;  4U3F J;  1BCC D;  3GLM A;  2R32 A;  2XV5 A;  1FZC B;  2JR8 A;  2V7Q J;  3B5N D;  4R4M A;  3V2R A;  1W2E A;  1SS1 A;  5CCH A;  4IFM A;  2JP3 A;  1QEX A;  4PD4 D;  2YKO A;  3OJA B;  1KIL C;  1SQB D;  1JY2 O;  4LC1 A;  1NU1 D;  1SQQ E;  4D6T G;  3D71 A;  1ZXG A;  2WSF H;  1VQP P;  3FGA D;  1PL5 A;  3A7O A;  2QJY C;  4CPG A;  1EC5 A;  3CL3 D;  3L72 E;  1NU1 K;  3CWB G;  1RF0 C;  3EWK A;  4WVZ A;  3CC7 P;  1LWU A;  2WPQ A;  3Q5P A;  3M91 A;  1AVY A;  1LT9 A;  1HUC A;  3AE9 C;  1RF1 C;  3RK3 E;  2JO1 A;  4OVN F;  5AW8 B;  3RL0 g;  1N86 A;  1Y9B A;  1BGY G;  4H0L C;  3CC2 P;  3AE5 C;  4RES B;  3C9I A;  2WSE H;  2WZ7 A;  1Y8A A;  3CXH H;  5H2F E;  2WSS H;  2WPS A;  1SQV E;  1EDI A;  1L0L E;  1YBK A;  2OYI A;  2YIU C;  2QRX A;  3P8C E;  1KZU B;  1Q7Y Q;  2YO2 A;  1VF5 B;  2ZXX A;  1FS0 E;  1T2K C;  2L91 A;  2FYU G;  3S9O A;  2R5B A;  3R2P A;  1NAF A;  2KLU A;  1RHZ B;  1JEK A;  1IZN B;  3I5C A;  3SFE C;  1G2C B;  1GK6 A;  1L4A C;  1OW8 A;  1RQV A;  1VF5 D;  4EIJ A;  2FYN B;  1ZW0 A;  3A3Y B;  3USS A;  1G1I A;  1N7L A;  3HUS A;  2K37 A;  1SQX D;  3CI9 A;  1AQT A;  2Z4E A;  4TT3 H;  2Y9Z A;  2QJP C;  1NTK J;  3I56 P;  3H1J J;  3RL0 D;  3L36 A;  3W68 A;  1BCC G;  4YTP C;  1NU1 E;  1KIL A;  2RMZ A;  1RF1 B;  1URQ B;  1VDF A;  2SPZ A;  3IF4 A;  1FDM A;  2M5A B;  1KFN A;  1GMJ A;  4YXW H;  1SQP D;  2Z5I A;  4GT1 A;  1VQL P;  2JWD A;  4RKU J;  2B9B A;  1ZV8 A;  3GW6 A;  3FX0 A;  3AE2 C;  5CHX A;  1J1E B;  3H1I E;  1RF0 A;  3MIW A;  3MP7 B;  1URQ D;  1SQB G;  3FXD A;  1U7J A;  2ZT9 B;  1NOH A;  1YJW P;  5TIS H;  3G71 P;  5L8R J;  5KJ7 A;  3MTU E;  5APX A;  2KK7 A;  4D6T J;  3WUV A;  1S5L E;  3VMZ A;  3BCC D;  1S3J A;  1LGH B;  1FAV A;  1GL2 A;  1IFP A;  1BE3 D;  1KB9 I;  1HGZ A;  4ZKP A;  3CWB J;  2ZT9 D;  3CCL P;  3BAS A;  4UB6 H;  1Q90 D;  5KTB A;  2P2U A;  1NO4 A;  3TYY A;  1DEB A;  1VQK P;  1W2B O;  1OW6 A;  2KOG A;  1EXJ A;  1X0T A;  3CD6 P;  3AE3 C;  5KKZ C;  4IFD K;  1WMK A;  2AXT H;  2YKP A;  3PJS K;  3E1R A;  3O6Q A;  2QJP B;  1DX7 A;  3BRT B;  2LXC B;  2IFM A;  3V6I A;  1K05 A;  1J1D B;  1LT1 A;  3HD7 C;  2HLO A;  5APT A;  2RH0 A;  1Z56 A;  3M06 A;  1BGY J;  1NH4 A;  3L72 J;  3CC4 P;  2KI7 B;  3CX5 I;  1K8A Q;  2GA1 A;  3LW5 J;  3TGU E;  1L4A A;  4IL6 H;  1KIL E;  3BRV B;  1QGK B;  1PGO A;  1EZV E;  1OX3 A;  1KYO E;  2FYU J;  1L0N K;  2D2C B;  1GZL A;  3H6P A;  3O8Z A;  1AQ5 A;  4YXD C;  2JWA A;  4R4L A;  3L70 E;  1N73 C;  3HE5 B;  2E74 B;  4WWI A;  1NTZ K;  4GKG A;  2Q7C A;  2AEF A;  2YKQ A;  1LTA C;  1EDJ A;  3H1H D;  1SQX G;  1PGP A;  5CJ0 A;  2D2C D;  2NRG A;  1OW7 A;  1SFC B;  1KQS O;  3A0H H;  1MV8 A;  1YQ3 C;  3KXD A;  1RE4 C;  3L75 E;  3VTP C;  1FOS F;  1BCC J;  4MN4 C;  2OTJ P;  2W6A A;  3PTZ A;  2HPC B;  4C7N B;  3L37 A;  3AE1 C;  1SQP G;  3GHG C;  3I55 P;  2QM8 A;  2I1K A;  2B87 A;  1XTC C;  3C1L A;  3LIE A;  1LTS C;  2KNC A;  4UB8 H;  1USE A;  2IDB A;  1HTL C;  3AE7 C;  3B71 A;  2BAS A;  3AEF C;  1SQB J;  1MUU A;  2OYH A;  3VOP A;  2IZ0 A;  5CCG D;  5B66 H;  2ZYD A;  1NU1 J;  4GOF A;  1HH0 A;  2XKM A;  1FU1 A;  3GF3 A;  3MHV A;  1H8A A;  3BCC G;  2NPS D;  4WY4 C;  1NAY A;  1ZRT E;  4A7P A;  1ZR2 A;  2Q6Q A;  1BE3 G;  1CI6 B;  1P84 I;  3HD7 A;  1N73 B;  1J2J B;  1L0N E;  2QA4 P;  1JY3 P;  1SQQ D;  3QH9 A;  1Q86 Q;  5DJT B;  3D6Z A;  5KAF E;  3ABV C;  3WU2 H;  2IBZ E;  5BU5 A;  2GUS A;  4U7J A;  1PPJ E;  5KLV K;  1NTZ E;  2UWJ E;  2V7Q H;  3L71 E;  3VN0 A;  2J59 M;  1SQQ K;  5K5G B;  3H32 B;  1LP1 B;  2RN0 A;  2P1J A;  1PP9 E;  3G3Z A;  3IN6 A;  1M90 Q;  3AEA C;  1LT9 C;  2WTY A;  3GHG B;  1GK4 A;  3L73 D;  2K1A A;  4I6M C;  3RK3 D;  1ZN5 A;  1W5C E;  3SFD C;  3P8M C;  1H0T A;  3TK1 A;  1L2P A;  2R44 A;  4NPE A;  1HGV A;  1SQV D;  1RE4 A;  1L0L D;  2E76 C;  1KB9 H;  1YI2 P;  3P8C D;  2N9B A;  3H1H G;  1K9M Q;  3WUT A;  4Y99 B;  1SQX J;  1OIP A;  5AVX B;  3CCR P;  1JTH A;  1SQV K;  3CXH E;  3H1J G;  4HKZ H;  1WT6 A;  4N78 E;  1L0L K;  3IFM A;  3NXS A;  2IX7 C;  4OGQ D;  2FY8 A;  3TSI A;  3HUS C;  3JCU H;  3AEE C;  1LWU B;  2Q3E A;  2ZFC A;  1SQP J;  4JQ0 D;  1UIX A;  5GTI H;  3CX5 H;  1VPC A;  2Q1K A;  4PD4 I;  4WY4 A;  3HE4 A;  4PV1 C;  5B5E E;  1AVO A;  1LT9 B;  1LJ2 A;  3N7N A;  3H1K E;  2B89 A;  3KYQ A;  5KLV E;  4NPD A;  1XTG B;  2POH A;  4DZO A;  1YJN P;  5AW3 B;  2C9L Y;  1N8R Q;  1ZME C;  3B5N A;  3L35 A;  1JY2 N;  2E75 B;  3HTK A;  1NWQ A;  3BCC J;  3B4S A;  1SLQ A;  3WUU A;  3Q5R A;  4OWF A;  2OYI B;  4I7Z B;  2Z5H A;  1NYH A;  2ZXE B;  1BE3 J;  5KJ7 C;  1DD4 A;  3H1I D;  2E42 A;  1S2E A;  2E76 B;  1N7S C;  1SQQ G;  1NTM D;  5AW0 B;  1IFJ A;  2N1T C;  2WVR A;  1KC8 Q;  3L73 E;  1GL2 C;  1JY2 P;  1N2D C;  2E75 D;  4KT0 J;  2OAR A;  2QEX P;  3P7K A;  2W8Z A;  3EFG A;  5AVQ B;  1KN7 A;  2M0B A;  1NHL A;  2HR3 A;  4HB1 A;  3V2P A;  1JOC A;  3VP9 A;  3L72 G;  1NTM K;  2KP8 A;  2KYV A;  2O1K A;  1OXZ A;  3L74 E;  2YO3 A;  1YHQ P;  1IFN A;  1HVV A;  2R3C A;  3FWL A;  1MZ9 A;  3U59 A;  3HRN A;  1KIL B;  2KS1 A;  4HYT B;  1X22 A;  5AW7 B;  1E5W A;  4UB6 E;  1KV4 A;  4H13 C;  5DJU B;  2JDI H;  4K35 A;  2OGU A;  4JYC A;  2I8D A;  1RE3 A;  2KZJ A;  1EDK A;  2A45 I;  2WQY C;  1SQV G;  2ZAE B;  1CSB A;  1L0L G;  2QJY B;  4L74 A;  3TGU D;  1KIL D;  1HF9 A;  1M1J A;  1P84 H;  2W6J H;  1SVF A;  5AW5 B;  3ZDM A;  1BDC A;  1EZV D;  3H1H J;  1PFI A;  1KYO D;  4GIF A;  4O9B A;  2H7H A;  5APW A;  1KYO I;  5CBO A;  1IFD A;  3KDP B;  2PRR A;  1K04 A;  2QE7 H;  2FFD C;  4IL6 E;  1FJK A;  1AV1 A;  3AE8 C;  3L70 D;  1PGQ A;  1VQ4 P;  1PZQ A;  4H0L B;  1OWA A;  1ZLL A;  3V2Q A;  1GDT A;  3LW5 H;  2I1J A;  4C46 A;  1IJD B;  3Q5S A;  2OQQ A;  3UIA A;  3TNU B;  2AEM A;  5E79 H;  4DJG A;  3CCQ P;  2P7J A;  2YIU B;  3O6Q B;  1GU5 A;  3L75 D;  4IOI H;  1NU1 G;  1NTM E;  2BCC E;  1N7S A;  2LR2 A;  2KIK A;  2HFE D;  3VMX A;  2N1T A;  2FKW B;  1S5L X;  3D6Y A;  1T3U A;  2IYP A;  1MFT A;  2IPP A;  3A0H E;  1LNQ A;  3H1L E;  2E43 A;  4ZKU A;  2KSJ A;  1L4A B;  5M1B A;  2OTK E;  1TU3 F;  3JSV C;  2OYH C;  3H1I G;  1VQ5 P;  1T2K D;  1Q82 Q;  1OMI A;  4WBA A;  1SQQ J;  2YXQ B;  1ZP0 C;  1ZR4 A;  2MJZ A;  1UII A;  1HJ0 A;  2NZ2 A;  4UB8 E;  3NMD A;  1L4A D;  1ZRT D;  2M3B A;  1YTZ T;  3FWN A;  5BU8 B;  3A5T A;  1LTJ A;  5AW9 B;  1AJY A;  3AEG C;  2K9J A;  1L0N D;  1FZB A;  3PH0 A;  4GDO A;  4PD4 H;  2QIW A;  1NKZ B;  1EQ7 A;  2C0W A;  2O1J A;  2E5T A;  4LLH A;  3NTN A;  2IBZ D;  3GG2 A;  2JJL A;  3L73 J;  3MZW B;  1KQG B;  3E7K A;  2FXM A;  1PPJ D;  1U7M A;  1FZG A;  1NTZ D;  3L71 D;  2KZI A;  1PIX A;  1HJB A;  1EXI A;  1DD3 A;  1PP9 D;  2A45 G;  4L73 A;  4U3F E;  2KNC B;  1IO4 A;  3WU2 E;  1KMI Z;  1SQV J;  2FFD A;  1L0L J;  3TGU G;  1IC2 A;  1KD1 Q;  3U1C A;  3QWO C;  1M1K Q;  2OYH B;  1EZV G;  1YIT P;  4L75 A;  2K9Y A;  5BVZ A;  1JNM A;  1YYC A;  5KKZ B;  2W27 A;  4EI2 A;  1LTG C;  2E74 D;  1KFM A;  3L70 G;  4OH8 B;  3HD7 B;  3RK2 C; 
#chains in the Genus database with same CATH homology
 1IFM A;  1SFC D;  4RES B;  1RE4 A;  3C9I A;  1LTB C;  2WSE H;  1G1J A;  2WZ7 A;  1RF1 A;  1URQ A;  3CLQ A;  1NTK K;  3P8C D;  4N78 D;  2WPS A;  3M9B A;  2N9B A;  3M0A A;  4XE5 B;  3VYI A;  1FJP A;  5AVS B;  5AVV B;  4Y99 B;  2OYI A;  5AVX B;  1JTH A;  1SQV K;  1WT6 A;  5AW2 B;  3P8C E;  4N78 E;  1KZU B;  1L0L K;  1SFC C;  2YO2 A;  3IFM A;  1GD2 E;  3HD7 D;  1T2K C;  3NXS A;  2IX7 C;  2R5B A;  3TNU A;  2FFD B;  3R2P A;  1JCC A;  1NAF A;  1LTT C;  3TSI A;  1H88 A;  3HUS C;  3BAT A;  3I5C A;  1LWU B;  5CCG C;  1X9V A;  2ZFC A;  1G2C B;  1GK6 A;  1L4A C;  2CPS A;  3A2A A;  1VPC A;  4W80 A;  2XZR A;  1HBW A;  4EIJ A;  2NPS C;  5AVT B;  4WY4 A;  3A3Y B;  3HE4 A;  1G1I A;  1LT9 B;  3N4X A;  1N7L A;  3B5N C;  3HUS A;  3CI9 A;  2Z4E A;  3P32 A;  3N7N A;  3KYQ A;  5CCG A;  3E1I A;  1XTG B;  2POH A;  4DZO A;  3VMY A;  1A02 F;  1HWT C;  1X79 B;  5AW3 B;  2Q5U A;  2C9L Y;  2Q9I A;  2NPS A;  3KQG A;  3RL0 D;  3L36 A;  2GUV A;  2O01 H;  1KIL A;  3B5N A;  1RF1 B;  1URQ B;  1VDF A;  2KB7 P;  3L35 A;  2YNY A;  5APU A;  5AW4 B;  1JY2 N;  1FDM A;  3HTK A;  1NWQ A;  1KFN A;  1FZC C;  1SLQ A;  4I2L C;  2HOD A;  2H43 A;  4KHX A;  1JO5 A;  2Z5I A;  2OYI B;  4GT1 A;  3RK2 B;  2Z5H A;  2ZXE B;  2H8P D;  5AW1 B;  1JTH B;  5KJ7 C;  1ZV8 A;  1SP4 A;  2E42 A;  1FOS E;  5CJ4 A;  2M8R A;  2LKM A;  1N7S C;  4B86 A;  3LID A;  5CHX A;  3PP5 A;  1J1E B;  5AW0 B;  1IFJ A;  2N1T C;  1RF0 A;  3MIW A;  1URQ D;  1GL2 C;  5AW6 B;  1JY2 P;  2P67 A;  1N2D C;  1NOH A;  1GW4 A;  2OAR A;  5KJ7 A;  3P7K A;  3EFG A;  2PP6 A;  3M0D C;  3MTU E;  5AVQ B;  4I1L A;  2J58 A;  5APX A;  1CZQ A;  1T3J A;  1NHL A;  3RK3 C;  3V2P A;  1JOC A;  3VP9 A;  2C0X A;  3VMZ A;  1NTM K;  1LGH B;  1KQL A;  4WY4 B;  1FAV A;  2KP8 A;  2XNX A;  1GL2 A;  3V4W A;  2KLV A;  2KYV A;  2O1K A;  4WB4 A;  3OA7 A;  4AUW A;  1OXZ A;  3B8E B;  1JMM A;  1HGZ A;  1X8Y A;  3M0D A;  5APQ A;  4ZKP A;  2YO3 A;  3T97 A;  3BAS A;  2FYU K;  1IFN A;  1HVV A;  2R3C A;  5KTB A;  2P2U A;  1NO4 A;  3TYY A;  1DEB A;  4JF7 A;  3U1A A;  1MZ9 A;  2NPS B;  3U59 A;  3II6 A;  1JY3 O;  1RE3 C;  3HE5 A;  3HRN A;  5CCH D;  3BVH A;  1KIL B;  1JUN A;  2KOG A;  1GTW A;  4HYT B;  1DH3 A;  1LTI C;  5AW7 B;  1E5W A;  4XA4 A;  3HTK B;  4WY4 D;  4IFD K;  2WSC H;  5CMZ A;  2YMY A;  4M3L A;  2YKP A;  2HOD B;  3MD0 A;  1M1J C;  1FZE A;  2WT7 A;  1DX7 A;  2A45 H;  3BRT B;  1SFC A;  5AVZ B;  2IFM A;  3VP8 A;  4LGD E;  1IFI A;  4JYC A;  1J1D B;  1RE3 A;  3HD7 C;  2HLO A;  5APT A;  1JY3 N;  5CCH C;  2A45 I;  2XDJ A;  3L4F A;  1Z56 A;  1M7L A;  1CSB A;  3M06 A;  1NH4 A;  1KIL D;  1M1J A;  5AW5 B;  1SVF A;  2HPC A;  4C7N A;  4Y99 C;  1L4A A;  1PFI A;  4GIF A;  4O9B A;  4AYC A;  2H7H A;  1GW3 A;  5APW A;  1IFD A;  3BRV B;  5AVR B;  3KDP B;  3M9H A;  2L5G B;  1L0N K;  2FFD C;  1GZL A;  3H6P A;  1FJK A;  3MUD A;  3O8Z A;  1AQ5 A;  4EOT A;  1QL1 A;  3RK3 B;  1RY3 A;  3SWY A;  1WRG A;  1LWU C;  3RL0 C;  1T8Z A;  1JCD A;  1N73 C;  1SQB K;  2QM7 A;  3HE5 B;  1OWA A;  1ZLL A;  3V2Q A;  1GDT A;  1NTZ K;  4GKG A;  2Q7C A;  3LW5 H;  2YKQ A;  2I1J A;  3SWF A;  4C46 A;  1IJD B;  1LTA C;  2JEE A;  1FZC A;  3UIA A;  3TNU B;  1GU4 A;  2CPB A;  1H89 A;  2P7J A;  5CJ0 A;  1GU5 A;  1CI6 A;  2WT7 B;  1SFC B;  2HYN A;  1N73 A;  1MV8 A;  3RK2 D;  1N7S A;  4DOJ A;  2HG5 D;  2HFE D;  3VMX A;  1RE4 C;  3VTP C;  2N1T A;  1FOS F;  2FKW B;  3HE4 B;  1T3U A;  1URQ C;  1FZA A;  1FZF A;  1A02 J;  4C7R A;  3HUS B;  1M1J B;  2VRS A;  2WPR A;  2W6A A;  2IPP A;  2HPC B;  5APY A;  4C7N B;  3L37 A;  2IFN A;  2E43 A;  4ZKU A;  2OYI C;  2KSJ A;  1L4A B;  3GHG C;  3M9Q A;  2QM8 A;  2I1K A;  3V5B A;  1S9K D;  2OYH C;  3LIE A;  1XTC C;  1LTS C;  3H32 A;  4N3Y B;  2R5D A;  4N6J A;  5AVU B;  1T2K D;  3B5N B;  5AVW B;  1S9K E;  3WMM 0;  1J1E C;  4WBA A;  1QL2 A;  1HTL C;  1LTJ C;  2BAS A;  3IR9 A;  2GM4 A;  4W7Y A;  3NFQ A;  3GHG A;  1ZR4 A;  1MUU A;  2MJZ A;  3EQ2 A;  4HH2 A;  2OYH A;  3VOP A;  5CCG D;  3V2N A;  3NMD A;  1L4A D;  2M3B A;  1HH0 A;  2XKM A;  5APV A;  1YTZ T;  1FU1 A;  2R32 A;  1H8A A;  5BU8 B;  2NPS D;  3A5T A;  2XV5 A;  4WY4 C;  1LTJ A;  1FZC B;  5AW9 B;  3B5N D;  3V2R A;  1ZR2 A;  1W2E A;  5AVY B;  1CI6 B;  1IK9 A;  1FZB A;  4W7Z A;  3RL0 B;  3HD7 A;  5CCH A;  1AFO A;  1NKZ B;  4IFM A;  1EQ7 A;  1N73 B;  2C0W A;  2O1J A;  1N7S B;  1J2J B;  3V4Q A;  4LLH A;  3NTN A;  2YKO A;  3OJA B;  1JY3 P;  2JJL A;  2N1T B;  1KIL C;  2FXM A;  1JY2 O;  1GL2 B;  2Q3I A;  2XU6 A;  1FZG A;  4LC1 A;  2WIT A;  5BU5 A;  1FBM A;  2GUS A;  1HJB A;  5APS A;  4AQR D;  4JYB A;  4IFF A;  5KLV K;  3VN0 A;  5KJ7 D;  2J59 M;  2WSF H;  1SQQ K;  1J1D C;  2A45 G;  3H32 B;  2WWW A;  1SQX K;  1IO4 A;  1N7S D;  3A7O A;  2FFD A;  2P1J A;  3G3Z A;  3CL3 D;  1NU1 K;  2N1T D;  1LT9 C;  3OAK A;  1RF0 C;  1IC2 A;  1CW5 A;  3U1C A;  1GL2 D;  2WTY A;  3GHG B;  1LWU A;  1GK4 A;  2C9N Y;  1MFZ A;  1NKN A;  2WPQ A;  2OYH B;  1G2C A;  1YTZ I;  4I6M C;  3RK3 D;  1ZN5 A;  3KPE A;  5BVZ A;  2PAJ A;  1JNM A;  1YYC A;  2FYZ A;  3M91 A;  2W27 A;  3MGN A;  1LT9 A;  1HUC A;  3P8M C;  1RF1 C;  1SQP K;  1LTG C;  1LTJ B;  1KFM A;  3TK1 A;  4OH8 B;  1HGV A;  5AW8 B;  3HD7 B;  3RK2 C;  1N86 A;  2W6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...