1KILB

Three-dimensional structure of the complexin/snare complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
59
structure length
59
Chain Sequence
LSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three-dimensional structure of the complexin/SNARE complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Synaptobrevin SNARE motif
total genus 27
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2001-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1kilB00
1SFCC 1N7SC 2N1TB 1L4AC 1XTGB 2WZ7A 2NPSC 3P8CE 5KJ7C 1KILD 2N1TA 4OH8B 3HTKB 2KOGA 1URQB 5CCGA 2H8PD 1L4AB 1URQC 1URQA 1NHLA 1N7SD 1SFCB 5CCGD 2XDJA 1N7SA 3RK2B 2N1TD 5KJ7D 4LGDE 1SFCA 3RK3D 1GL2B 4WY4A 4WY4C 1GL2A 3RL0D 2M8RA 5CCHA 5CCHC 1GL2C 4W7ZA 5CCHD 3RK2C 2HFED 1L4AD 4N78E 3RK2D 1N7SB 4JF7A 3TSIA 3B5ND 3KYQA 3RK3B 2NPSB 3B5NA 3M0DC 1JTHB 3RK3C 1T3JA 3HD7A 3HD7C 3RL0B 5KJ7A 1HVVA 1JTHA 3HD7D 4WY4B 1GL2D 5CCGC 2NPSD 3PP5A 3B5NB 2NPSA 2N1TC 1KILC 3VOPA 3B5NC 1KILB 4W7YA 2YMYA 1L4AA 3RL0C 3HD7B 4WY4D 2PP6A 1URQD 4W80A 2HG5D 1SFCD 1KILA
chains in the Genus database with same CATH superfamily
2SPZA 3EFFK 2ZT9D 1OW6A 4D6TD 3CC4P 3EFGA 1VQNP 3AEDC 2C9NY 2ITAA 1YJNP 1IFNA 5GTIE 2NPSC 4DT0A 1HJ0A 1S1CX 1JB0J 2K9JA 2QJPB 3P8CE 4WVZA 1QLED 2FFDB 5B66H 3CCUP 1KILE 4U3FD 2QJKC 1CZQA 4YXWH 5KLVJ 4EIJA 3MUDA 2K1AA 3H1JG 1VQ8P 2KNCB 2KOGA 2FXPA 1RE4C 2D2CD 2JDIH 1SQPJ 2A45G 1KB9E 1MUUA 2FKWB 3MGNA 3TDKA 2I8DA 1Z56A 4C7RA 4H44B 3H1HE 3N7NA 1JY3P 2C0WA 2QG4A 3OA7A 3P32A 3LW5H 2O3JA 4CPGA 2OYIC 1SP4A 1URQC 2M0BA 1EXJA 1YJ9P 3D71A 2RMZA 4OWFA 1ZOYC 1NU1E 3U1AA 2OGUA 1H89A 3MHVA 1N7SD 1SQVD 2YMKA 1LT9B 1FOSF 1DH3A 2KK7A 3EQ2A 2ZT9B 1QVFO 1SFCB 2JWAA 1L0NJ 1H88A 5H2FH 4DCKA 1IK7A 1JY2P 1LTJA 4ZKPA 5KKZC 3VMYA 1N7SA 1LTAC 2Y0CA 4HJGH 2QA4P 2N1TD 1JMMA 3EWKA 3L72D 3HE4B 5KLVK 1NU1D 5TISE 2HR3A 1JMBA 1LWUC 1IC2A 1ZRTD 2KS1A 3CL3D 4PV1C 3VN0A 1FZEA 4EI2A 3G6EP 1AFOA 1PPJD 4H0LD 1NTZJ 4A7PA 1VQPP 1T3UA 1FE6A 1Y9BA 2IBZG 1DD3A 4I7ZB 1EC5A 1FAVA 1KORA 1YTZT 5C39A 2Q7CA 3O8ZA 2XU6A 3AE8C 1T6AA 2HODB 3L75J 1BGYJ 5AW0B 5CCHC 1QGKB 1NTME 5AVQB 1BCCJ 3G4SP 3PTZA 4TLFA 1USDA 1GL2C 3USSA 1YITP 5CCHD 1LTSC 1HH0A 1QEXA 1UIIA 2HFED 1OVRA 1RQVA 3A7OA 3HE4A 3HTKA 5CMZA 1ZR4A 1KN7A 1CSBA 3MD0A 1N7SB 5AW4B 3V2QA 1L2PA 2LXBA 3O6QA 3SWFA 1PP9D 1DD4A 1LT9A 1BDCA 3CI9A 2PAJA 1VDFA 1J2JB 2Z5IA 3H1JD 4Y99B 1SQVG 3CCJP 3L70J 3FWLA 3QH9A 2QE7H 1X0TA 1G1IA 2R32A 3BATA 2LR2A 1OVVA 1PGJA 5AW7B 1VQLP 2Y0DA 4IL6E 1JTHB 1Q2NA 1S5LE 2KZJA 4GKGA 3VMXA 3RK3C 1GD2E 1KYOH 2ZXEB 1NVOA 4PJ0E 3E1RA 3BRVB 3ZDMA 2H43A 1BSHA 1AV1A 2WSFJ 4WWIA 4M3LA 3JCUH 4IFDK 1OIPA 3L37A 3C1LA 4UB6E 1PP9E 3HUSC 5KJ7A 1NAYA 1D7MA 1BE3D 3CCEP 5CCGC 2P58A 1VPCA 2R3SA 2OYOA 4JYBA 1ZR2A 1PGOA 3Q5RA 1FZCB 2FFDA 3JCUE 5AW8B 1EZVI 3L73G 2WMMA 3F5HA 2NPSA 3RBXA 1X8YA 3P7KA 4R4LA 3AECC 1NTMD 1LTGC 2FYUE 2E74C 3H1ID 3HRNA 3M9BA 3CCLP 2OTJP 1OX3A 1P84E 1FU1A 1K8AQ 2JEEA 1IFPA 3SFEC 3AE2C 4ZMDA 3PRJA 1JY2O 3M0AA 1W5CE 2FXOA 4HYTB 2MKVA 3HD7B 2G8YA 3PH0A 3RL0C 2FY8A 1M57D 1URQD 3AE9C 5AVYB 2IBZD 1S4XA 2IZ1A 2BEZF 4W80A 3V6IA 1M90Q 1A02F 3TK1A 1SQXK 2CK3H 3AE5C 1YTZI 1XTCC 2N1TB 3CCRP 1VF5C 1LWUA 2E42A 1OXZA 2QJPC 5DJUB 3Q3DA 1A02J 3L71G 2JP3A 2E75C 1EZVE 2AXCA 3L74E 5KJ7C 2XNXA 2OTLP 3BCCJ 3D6ZA 5AW2B 2I1KA 2KLUA 4C7NB 1KILD 1S5LH 2YIUC 4K3AA 1KYOD 1YQ4C 1NYHA 2N9YB 3HTKB 1GMJA 1IO4A 1URQB 4D6TG 1T2KD 4N78D 1LTJC 2IDBA 1GK6A 2Z5HA 1LGHB 1YYCA 4EOTA 5CBOA 2QIWA 3KZIE 4TT3H 3I55P 4UB8H 2IBZI 4DOJA 2Y9ZA 1X79B 2W6JH 1NO4A 1N7LA 5H2FE 4KT0J 5APUA 3TNUA 2QSIA 2FYUD 3JSVC 2O01J 3H1LE 2GUSA 2O01N 3P8CD 4L74A 1URQA 2ZXXA 1KQLA 2IZ0A 5APYA 1FDIA 2KIKA 2RKLA 2WPQA 3A0HH 4PV1B 5TJHA 4AYCA 1NTKG 1J1DC 2K9YA 2YNYA 1M7LA 3H1IJ 3V2RA 5CCGD 3L72G 4C46A 2WTYA 2M3EA 2WSSH 3Q5SA 1FJPA 3RK2B 4L75A 1NH4A 1VQ7P 1JUNA 1EXIA 3H1LD 1RQUA 3ABVC 4JQ0D 4B86A 1OFCX 1AQTA 2O01H 1SFCA 2W6BA 3ITKA 3L70G 4U3FE 3S9OA 1RE3C 3RK3D 1OWAA 3I5CA 1LWUB 5AW3B 2KYVA 3M91A 5E79E 3CXHE 1G1JA 2KI7B 3L75E 3B4SA 3H1LJ 1T8ZA 4WY4A 2K37A 1GL2A 5KAIE 3RL0D 1WT6A 1NTZE 2M5AA 5CCHA 1HWTC 2AEMA 3AE4C 2WPVB 1QL1A 2AXTH 3KHUA 3NMDA 4L76A 2G3AA 2ZYGA 3U59A 2J58A 4RO0A 1VQ5P 3TGUD 5AVSB 2YXQB 3H1KE 3VP8A 3L70D 3M9HA 2OTKE 3F89A 4N78E 1NTKK 2HPCB 3CC7P 4OVNF 4JF7A 1JM0A 4U3FG 4PD4H 3AE7C 3TGUG 3WUUA 1FDOA 5B5EE 5CBNA 1E5WA 4IL6H 1PFIA 2FBWC 4AUWA 3VMAA 3RK3B 2KUBA 2WWWA 1FS0E 1FZCA 3SFDC 1HJBA 1LP1A 3JC22 4BXLA 1OMIA 2H89C 3TGUJ 1BGYG 2K88A 1Q86Q 1J1EB 2FFDC 4NPEA 2YKQA 1M1JC 3M0DC 1N73A 3D6YA 2AXTE 1W2BO 3A0BH 3V2NA 2FYUK 3WUVA 3GLMA 1YQ3C 3H1LG 3L71E 1YJWP 5APQA 4BWNA 1N73C 3AE3C 1OW7A 1P84I 1SQBK 2IYPA 1SQVE 2PGDA 3CLQA 3HD7C 3RL0B 2QM8A 2QVAA 3OJAB 2A06D 1ZRTE 4JYCA 5BU8B 2A06E 2WVRA 1HVVA 1JTHA 1OZHA 3H1HG 1L0LG 1GL2D 1BE3J 2Y0EA 1W2EA 2HLOA 3HD7D 4WB4A 3CMEP 2NPSD 4C7NA 2LKMA 3A2AA 1FJKA 2XV5A 4DJGA 3U1CA 3E7KA 4D6TE 1IFDA 2WPSA 3D70A 2OARA 4IL6X 4UB8E 1SQPG 1SLQA 1SQQE 1AJYA 1LT9C 1DEEG 2OYHC 3IAOA 4I1LA 3VOPA 1SS1A 3CX5E 5KAFH 1PPJG 1FZCC 4HKZH 3N4XA 1NTMG 4I6MC 3UIAA 1AVOA 3CCMP 1SQVJ 1KILB 1L0NG 3B71A 1NTZG 2P1JA 2WSFH 3V5BA 2FYUJ 2JJLA 1JCCA 1QVGO 1LTIC 1BDDA 1L4AA 1USEA 1NTMJ 3FGAD 2L5GB 3RK3E 2XKMA 1BE3E 5CCGA 1H0TA 2KSEA 2LXCB 5APVA 1SQPK 1ZP0C 3GHGB 3PHLA 2NRGA 1SFCD 3CX5D 3CXHI 3IR9A 2BCCE 2OYHA 1GU4A 1NJIQ 1SQPD 1N2DC 2W83C 1MFTA 3H1JE 1CI6A 1SFCC 3G9RA 4O9BA 4YXDC 1DX7A 1S5LX 4NPFX 1L4AC 1LP1B 1KC8Q 4PD4D 2C9LY 1VL2A 1HBWA 2WPRA 4ASVA 1G2CB 1SVFA 1M56D 2IYOA 1EQ7A 1HUCA 3HE5A 3BCCD 3WU2E 2GM4A 1EDKA 2KS1B 2Q5UA 3HE5B 3L75D 4PJ0H 1KTMA 1FZGA 1HGVA 3CCSP 1FZAA 5AVVB 1RF1A 3MTUE 1PZQA 3VYIA 1LTJB 3KDPB 4OH8B 1SQVK 1PIXA 2WQYC 1KV4A 4ZNCA 2E75B 2OQQA 1BCCG 2QJYB 5KTBA 4HH2A 3GMAA 2AEFA 4YPCA 1NTMK 1SQBE 1E79H 1UIXA 2FYNC 1YI2P 2YIUB 2B87A 2BCCG 3H1JJ 4GIFA 3VMZA 1NTZK 2JWDA 2YO3A 2WT7A 3CPWO 4MN4C 3MZWB 1L4AB 1NU1K 2Q3IA 2V4HA 2V7QJ 3V4QA 1M8OB 2I1JA 2PFXA 3BCCG 3M9QA 1FOSE 4IOIH 3W68A 3LIEA 3CXHH 1JY3O 5AW9B 1L0ND 1FBMA 1BE3G 1PGQA 3GHGC 2JKVA 3L72E 1ZLLA 2E76B 1PL5A 3B8EB 2KNCA 2WT7B 1VQMP 2B87B 3Q2YA 1VQKP 1VQ6P 3FX0A 2AEJA 1S9KE 3CC2P 1BCCD 1BGYE 4EYYQ 2XDJA 1BGYD 2P7JA 1Q82Q 1PPJE 3L35A 2Q6QA 1QL2A 3GF7A 1N8RQ 1VQ4P 5L8RJ 1RF1C 2K9JB 5KJ7D 5B66E 3T97B 1YBKA 2DW3A 4LGDE 1J1DB 3L73E 1NTZD 1ZMEC 1IFIA 5AVUB 3SWKA 2QRXA 2A06G 2KP8A 1FZFA 2JR8A 3MP7B 5CJ4A 3CX5H 4Y99C 5AW1B 1NU1J 2K3RA 2E74B 4U3FJ 4BRYB 1R5LA 3AEAC 1J1EC 3AE6C 3HUSB 3PLNA 2D2CB 4KHXA 4ZKUA 2ZVNB 5AVWB 4AQRD 1FZBA 1JNMA 3G3ZA 3GF3A 4HB1A 4L73A 3CWBD 4W7ZA 4JBZA 1RY3A 1TU3F 1MZ9A 3S1KA 2W8ZA 1L0NK 1VF5D 1K73Q 2RH0A 1KB9D 3CWBG 2OYIB 3H25A 2W27A 1PP9J 2A45H 3H1KJ 1X22A 3OAKA 4PD4E 2BEQD 1U7MA 1LJ2A 3KYQA 5KLIC 3TSIA 2P2UA 3TGUE 2WSEH 2E74D 2Q9IA 4I7ZC 2H7HA 5AVRB 1ZW0A 1U57A 3B5NA 3H1KG 2JO1A 4PV1D 1KMIZ 1RF0A 2W6AA 5KKZB 1GW4A 3RBZA 3L71J 1NTKE 2OYIA 1SQXE 1HTLC 2M5AB 1S2EA 2WITA 3C9IA 5AVTB 5KLVD 3CMAP 1VQ9P 4XE5B 3CXHD 5KAFE 1KYOE 1NU1G 1DEBA 1T3JA 2FYUG 3HD7A 1SQPE 1ZXGA 3Q1MA 2O1KA 2R3CA 2ZT9C 3HUSA 3V2PA 3BVHA 1EDJA 2QEXP 1K04A 2RN0A 4RJTA 2Q1KA 1GDTA 1N73B 2FYZA 3L4FA 3LW5J 1RF1B 1FC2C 1IFMA 2KXPB 3NFQA 3PP5A 1AQ5A 3L72J 1MFZA 2IPPA 4GOEA 1JY2N 1MKMA 2N1TC 1WMKA 3KXDA 5AVZB 3T97A 3L73D 1KILC 1K05A 2E5YA 3PJSK 1HGZA 2Y9YA 3H6PA 3RGUA 5B5EH 3B5NC 1R8EA 5APWA 3VTPC 1EZVG 1MV8A 3A0BE 1JY3N 3Q5PA 1JCDA 3CCVP 2OYHB 1T2KC 1GW3A 1ZN5A 1S72P 1JOCA 4WY4D 2E76D 1EDLA 1L0LJ 1SQQK 5APXA 3FXDA 2C0XA 3KZIH 1H0TB 2J59M 2ZJSE 4N6JA 4H13D 1AA0A 3LIDA 1IZNB 1KILA 2YKOA 3CWBE 1KB9H 3II6A 2P67A 3WUTA 4QMAA 5KLVG 1N7SC 3KQGA 1XTGB 2KB7P 1S3JA 2WZ7A 4U7JA 2BCCJ 2KSJA 4XA4A 5E79H 3W67A 1BCCE 4Y28J 1CW5A 1PP9G 1SQBD 2Q3EA 4Z1MH 1WRGA 3O6QB 1M1KQ 4EDFA 3QWOC 3MIWA 3SSUA 4DZOA 2Z4EA 1GK4A 1SQXG 1Y8AA 4IFFA 1ZV8A 1LTBC 2N1TA 5AW6B 1IFJA 3S4RA 1RH5B 5CHXA 2A45I 4GOFA 5DJTB 4D6TJ 3FWNA 3OW2O 3VP9A 1KQGB 1QX8A 2CPBA 1AVYA 1L0LK 1RHZB 1RE4A 1SQQJ 2HYNA 1NOHA 2WSCJ 3GG2A 3NXSA 1Q81Q 3L70E 1GTWA 1X9VA 2B89A 4H0LB 2H8PD 2YKPA 4H13B 1RF0C 1VF5B 3G71P 1S9KD 2KZIA 1SQXJ 1DIPA 1OW8A 1SQBG 2E76C 2J5UA 2L91A 1P84D 2FYNB 4LC1A 5CJ0A 2GUVA 4BRYA 3RL0g 2ZVOB 1KYOI 3GHGA 1L0NE 1KQSO 3H1HJ 1NHLA 3A0HE 2PRRA 3H1HD 1YHQP 1R5SA 2IFNA 3BASA 2CPSA 4PD4I 1NKZB 2FXMA 1NTKJ 2UWJE 1Q90D 2E5TA 2P10A 2QJYC 2VRSA 1EDIA 2YXRB 3A3YB 3NTNA 3MUDC 2GA1A 4RESB 3TYYA 1VQOP 4H0LC 1SQQD 2ZYAA 3I56P 1NKNA 5EFWB 3CCQP 2B9BA 4YTPC 2W90A 2E43A 2B88A 3C8VA 4OGQB 1GL2B 1LNQA 3R2PA 3SWYA 4WY4C 5KAIH 2XNDH 2M8RA 2ZAEB 3AEEC 1NTKD 3AEGC 5K5GB 4ASWA 2R44A 4NPDA 4H13C 1SQBJ 1RE3A 5GTIH 3CD6P 2V7QH 5AVXB 2BCCD 3RK2C 3L71D 3GW6A 3L74D 1L4AD 1EZVD 1SQQG 2O1JA 2WSCH 3M06A 5APTA 3RK2D 1KFNA 4GT1A 1K9MQ 1IJDB 1U7JA 1GU5A 2R5DA 1BSNA 3AE1C 3AEBC 3B5ND 1N86A 3R4YA 1L0LD 3FXEA 4OGQC 1L0LE 3K5BA 2BASA 2NPSB 4WBAA 1G2CA 1KB9I 3L74J 1HF9A 1LT1A 3TNUB 2ZYDA 4OGQD 2HPCA 3CWBJ 4XFJA 1M1JA 2D2CC 2HODA 2MJZA 3M0DA 4IFMA 1CI6B 4GDOA 1P84H 3L74G 2N9BA 1Y47A 3H32A 4R4MA 2H88C 3L36A 3CX5I 3L73J 4K35A 1IK9A 3H1IG 2IFMA 3WU2H 1FDMA 2QM7A 1KZUB 2R5BA 2WSEJ 2YO2A 3L75G 5AW5B 2M3BA 1H8AA 1OVUA 4WY4B 4GODA 2IBZE 3BCCE 1LTTC 1PGPA 3A5TA 2ZFCA 5KLIB 3B5NB 5TISH 2E75D 3AEFC 1NGMB 4UB6H 2QJKB 3KPEA 4RKUJ 3IF4A 1YIJP 5BVZA 5M1BA 3P8MC 3V4WA 1JEKA 3H1IE 5GTHH 3TF5A 4N3YB 3IFMA 1NWQA 4H44D 3E1IA 1KD1Q 3IN6A 1NAFA 2NZ2A 4W7YA 4H44C 4LLHA 1KFMA 1JO5A 2IX7C 4JPZB 2YMYA 2KLVA 1GZLA 1PV3A 2XZRA 2PP6A 3BRTB 5GTHE 1Q7YQ 4I2LC 5BU5A 1SQXD 4KJMA 5KLVE 2HG5D 3H32B 3WMM0 3H1KD 5APSA 1KQFB 2POHA 1M1JB
chains in the Genus database with same CATH topology
3EFGA 2C9NY 1IFNA 2NPSC 3P8CE 2FFDB 1CZQA 4EIJA 3MUDA 2KOGA 1RE4C 5CJ4A 2A45G 3MGNA 1MUUA 2FKWB 4C7RA 1Z56A 3N7NA 1JY3P 2C0WA 3OA7A 3P32A 3LW5H 2OYIC 1SP4A 1URQC 3U1AA 1H89A 1N7SD 1FOSF 1LT9B 3EQ2A 1SFCB 1H88A 1LTJA 1JY2P 4ZKPA 3VMYA 1N7SA 1LTAC 2N1TD 1JMMA 3HE4B 5KLVK 1AQ5A 1LWUC 3CL3D 1IC2A 3VN0A 1FZEA 1AFOA 1T3UA 1FAVA 2Q7CA 1YTZT 3O8ZA 2XU6A 2HODB 5AW0B 5CCHC 5AVQB 1GL2C 5CCHD 1LTSC 1HH0A 2HFED 3A7OA 3HE4A 3HTKA 5CMZA 1ZR4A 1CSBA 3MD0A 1N7SB 5AW4B 3V2QA 3SWFA 1LT9A 3CI9A 2PAJA 1VDFA 1J2JB 2Z5IA 4Y99B 2R32A 1G1IA 3BATA 5AW7B 1JTHB 1GD2E 4GKGA 3VMXA 3RK3C 2ZXEB 3BRVB 2H43A 4M3LA 4IFDK 3L37A 5KJ7A 3HUSC 5CCGC 4JYBA 1VPCA 2FFDA 1ZR2A 1FZCB 5AW8B 2NPSA 1X8YA 3P7KA 1LTGC 3M9BA 3HRNA 1FU1A 2JEEA 3M0AA 1JY2O 4HYTB 3HD7B 3RL0C 5AVYB 1URQD 1A02F 1DH3A 4W80A 3TK1A 1SQXK 1YTZI 1XTCC 2N1TB 1LWUA 2E42A 1OXZA 1A02J 5KJ7C 2XNXA 5AW2B 2I1KA 4C7NB 1KILD 3HTKB 1IO4A 1URQB 1T2KD 4N78D 1LTJC 1GK6A 2Z5HA 1LGHB 1YYCA 4EOTA 4DOJA 1X79B 1NO4A 1N7LA 5APUA 3TNUA 2GUSA 3P8CD 1URQA 1KQLA 5APYA 2WPQA 4AYCA 3BVHA 5CCGD 2YNYA 1J1DC 1M7LA 1FJPA 4C46A 2WTYA 3RK2B 1NH4A 1JUNA 4B86A 2O01H 1SFCA 2W6BA 1RE3C 3RK3D 1OWAA 3I5CA 1LWUB 5AW3B 2KYVA 3M91A 1G1JA 1T8ZA 4WY4A 3RL0D 1GL2A 1WT6A 5CCHA 1HWTC 1QL1A 3NMDA 3U59A 2J58A 5AVSB 3VP8A 3M9HA 4N78E 1NTKK 2HPCB 4JF7A 1E5WA 1PFIA 4AUWA 3RK3B 2WWWA 1FZCA 1HJBA 1J1EB 2FFDC 2YKQA 1M1JC 3M0DC 1N73A 3V2NA 2FYUK 5APQA 1N73C 1SQBK 3CLQA 3HD7C 3RL0B 2QM8A 3OJAB 5BU8B 4JYCA 1HVVA 1JTHA 3HD7D 1GL2D 4WB4A 1W2EA 2HLOA 2NPSD 4C7NA 2LKMA 3A2AA 1FJKA 2XV5A 3U1CA 1IFDA 2WPSA 2OARA 1SLQA 1LT9C 2OYHC 4I1LA 3VOPA 1FZCC 3N4XA 4I6MC 3UIAA 1KILB 2P1JA 2WSFH 3V5BA 2JJLA 1JCCA 1LTIC 1L4AA 2L5GB 2XKMA 5APVA 1SQPK 3GHGB 1SFCD 3IR9A 2OYHA 1GU4A 1N2DC 1DX7A 1CI6A 1SFCC 4O9BA 1L4AC 2C9LY 1HBWA 2WPRA 1G2CB 1SVFA 2GM4A 1EQ7A 1HUCA 3HE5A 2Q5UA 3HE5B 1FZGA 1HGVA 1FZAA 5AVVB 1RF1A 3MTUE 3VYIA 1LTJB 3KDPB 4OH8B 1SQVK 5KTBA 4HH2A 1NTMK 4GIFA 3VMZA 1NTZK 2YO3A 2WT7A 1L4AB 1NU1K 2Q3IA 1FOSE 3V4QA 2I1JA 3M9QA 3LIEA 5AW9B 1JY3O 1FBMA 3GHGC 1ZLLA 2WT7B 3B8EB 1S9KE 2XDJA 2P7JA 3L35A 1QL2A 1RF1C 5KJ7D 4LGDE 1J1DB 1IFIA 5AVUB 2KP8A 4Y99C 5AW1B 1J1EC 3HUSB 4KHXA 5AVWB 4AQRD 1FZBA 1JNMA 3G3ZA 4W7ZA 1RY3A 1MZ9A 1L0NK 2OYIB 2W27A 2A45H 3OAKA 3TSIA 3KYQA 2H7HA 2P2UA 2WSEH 5AVRB 3B5NA 2W6AA 1RF0A 1GW4A 2OYIA 3C9IA 1HTLC 2WITA 5AVTB 4XE5B 1DEBA 1T3JA 3HD7A 2O1KA 2R3CA 3HUSA 3V2PA 1GDTA 1N73B 2FYZA 3L4FA 1RF1B 1IFMA 3PP5A 3NFQA 1MFZA 2IPPA 1JY2N 2N1TC 5AVZB 3T97A 1KILC 1HGZA 3H6PA 1FZFA 3B5NC 5APWA 3VTPC 1MV8A 1JY3N 1JCDA 2OYHB 1T2KC 1GW3A 1ZN5A 1JOCA 4WY4D 1SQQK 5APXA 2C0XA 2J59M 4N6JA 3LIDA 1KILA 3II6A 2YKOA 2P67A 1N7SC 3KQGA 1XTGB 2KB7P 4XA4A 2WZ7A 4ZKUA 2KSJA 1CW5A 1WRGA 3MIWA 4DZOA 2Z4EA 1GK4A 4IFFA 5AW6B 1ZV8A 1LTBC 2N1TA 1IFJA 5CHXA 2A45I 3VP9A 2CPBA 3V2RA 1L0LK 5CCGA 1RE4A 2HYNA 1NOHA 3NXSA 1GTWA 1X9VA 2H8PD 2YKPA 1RF0C 1S9KD 4LC1A 5CJ0A 2GUVA 3GHGA 1NHLA 2IFNA 3BASA 2CPSA 1NKZB 2FXMA 2Q9IA 2VRSA 4RESB 3A3YB 3NTNA 3TYYA 1NKNA 2E43A 1GL2B 3R2PA 3SWYA 4WY4C 2M8RA 1RE3A 3RK2C 5AVXB 1L4AD 2O1JA 2WSCH 3M06A 5APTA 3RK2D 1KFNA 4GT1A 1IJDB 1GU5A 2R5DA 3B5ND 1N86A 2BASA 2NPSB 4WBAA 1G2CA 3TNUB 2HPCA 1M1JA 3M0DA 2HODA 2MJZA 4IFMA 1CI6B 2N9BA 3H32A 3L36A 1IK9A 2IFMA 1FDMA 2QM7A 1KZUB 2R5BA 2YO2A 5AW5B 2M3BA 1H8AA 4WY4B 1LTTC 3A5TA 2ZFCA 3B5NB 3KPEA 5BVZA 3P8MC 3V4WA 1NWQA 4N3YB 3IFMA 3E1IA 1NAFA 4W7YA 4LLHA 1KFMA 1JO5A 2IX7C 2YMYA 2KLVA 2XZRA 3BRTB 1GZLA 2PP6A 4I2LC 5BU5A 2HG5D 3H32B 3WMM0 5APSA 2POHA 1M1JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFC C;  1N7S C;  2N1T B;  1L4A C;  1XTG B;  2WZ7 A;  2NPS C;  3P8C E;  5KJ7 C;  1KIL D;  2N1T A;  4OH8 B;  3HTK B;  2KOG A;  1URQ B;  5CCG A;  2H8P D;  1L4A B;  1URQ C;  1URQ A;  1NHL A;  1N7S D;  1SFC B;  5CCG D;  2XDJ A;  1N7S A;  3RK2 B;  2N1T D;  5KJ7 D;  4LGD E;  1SFC A;  3RK3 D;  1GL2 B;  4WY4 A;  4WY4 C;  1GL2 A;  3RL0 D;  2M8R A;  5CCH A;  5CCH C;  1GL2 C;  4W7Z A;  5CCH D;  3RK2 C;  2HFE D;  1L4A D;  4N78 E;  3RK2 D;  1N7S B;  4JF7 A;  3TSI A;  3B5N D;  3KYQ A;  3RK3 B;  2NPS B;  3B5N A;  3M0D C;  1JTH B;  3RK3 C;  1T3J A;  3HD7 A;  3HD7 C;  3RL0 B;  5KJ7 A;  1HVV A;  1JTH A;  3HD7 D;  4WY4 B;  1GL2 D;  5CCG C;  2NPS D;  3PP5 A;  3B5N B;  2NPS A;  2N1T C;  1KIL C;  3VOP A;  3B5N C;  1KIL B;  4W7Y A;  2YMY A;  1L4A A;  3RL0 C;  3HD7 B;  4WY4 D;  2PP6 A;  1URQ D;  4W80 A;  2HG5 D;  1SFC D;  1KIL A; 
#chains in the Genus database with same CATH topology
 2SPZ A;  3EFF K;  2ZT9 D;  1OW6 A;  4D6T D;  3CC4 P;  3EFG A;  1VQN P;  3AED C;  2C9N Y;  2ITA A;  1YJN P;  1IFN A;  5GTI E;  2NPS C;  4DT0 A;  1HJ0 A;  1S1C X;  1JB0 J;  2K9J A;  2QJP B;  3P8C E;  4WVZ A;  1QLE D;  2FFD B;  5B66 H;  3CCU P;  1KIL E;  4U3F D;  2QJK C;  1CZQ A;  4YXW H;  5KLV J;  4EIJ A;  3MUD A;  2K1A A;  3H1J G;  1VQ8 P;  2KNC B;  2KOG A;  2FXP A;  1RE4 C;  2D2C D;  2JDI H;  1SQP J;  2A45 G;  1KB9 E;  1MUU A;  2FKW B;  3MGN A;  3TDK A;  2I8D A;  1Z56 A;  4C7R A;  4H44 B;  3H1H E;  3N7N A;  1JY3 P;  2C0W A;  2QG4 A;  3OA7 A;  3P32 A;  3LW5 H;  2O3J A;  4CPG A;  2OYI C;  1SP4 A;  1URQ C;  2M0B A;  1EXJ A;  1YJ9 P;  3D71 A;  2RMZ A;  4OWF A;  1ZOY C;  1NU1 E;  3U1A A;  2OGU A;  1H89 A;  3MHV A;  1N7S D;  1SQV D;  2YMK A;  1LT9 B;  1FOS F;  1DH3 A;  2KK7 A;  3EQ2 A;  2ZT9 B;  1QVF O;  1SFC B;  2JWA A;  1L0N J;  1H88 A;  5H2F H;  4DCK A;  1IK7 A;  1JY2 P;  1LTJ A;  4ZKP A;  5KKZ C;  3VMY A;  1N7S A;  1LTA C;  2Y0C A;  4HJG H;  2QA4 P;  2N1T D;  1JMM A;  3EWK A;  3L72 D;  3HE4 B;  5KLV K;  1NU1 D;  5TIS E;  2HR3 A;  1JMB A;  1LWU C;  1IC2 A;  1ZRT D;  2KS1 A;  3CL3 D;  4PV1 C;  3VN0 A;  1FZE A;  4EI2 A;  3G6E P;  1AFO A;  1PPJ D;  4H0L D;  1NTZ J;  4A7P A;  1VQP P;  1T3U A;  1FE6 A;  1Y9B A;  2IBZ G;  1DD3 A;  4I7Z B;  1EC5 A;  1FAV A;  1KOR A;  1YTZ T;  5C39 A;  2Q7C A;  3O8Z A;  2XU6 A;  3AE8 C;  1T6A A;  2HOD B;  3L75 J;  1BGY J;  5AW0 B;  5CCH C;  1QGK B;  1NTM E;  5AVQ B;  1BCC J;  3G4S P;  3PTZ A;  4TLF A;  1USD A;  1GL2 C;  3USS A;  1YIT P;  5CCH D;  1LTS C;  1HH0 A;  1QEX A;  1UII A;  2HFE D;  1OVR A;  1RQV A;  3A7O A;  3HE4 A;  3HTK A;  5CMZ A;  1ZR4 A;  1KN7 A;  1CSB A;  3MD0 A;  1N7S B;  5AW4 B;  3V2Q A;  1L2P A;  2LXB A;  3O6Q A;  3SWF A;  1PP9 D;  1DD4 A;  1LT9 A;  1BDC A;  3CI9 A;  2PAJ A;  1VDF A;  1J2J B;  2Z5I A;  3H1J D;  4Y99 B;  1SQV G;  3CCJ P;  3L70 J;  3FWL A;  3QH9 A;  2QE7 H;  1X0T A;  1G1I A;  2R32 A;  3BAT A;  2LR2 A;  1OVV A;  1PGJ A;  5AW7 B;  1VQL P;  2Y0D A;  4IL6 E;  1JTH B;  1Q2N A;  1S5L E;  2KZJ A;  4GKG A;  3VMX A;  3RK3 C;  1GD2 E;  1KYO H;  2ZXE B;  1NVO A;  4PJ0 E;  3E1R A;  3BRV B;  3ZDM A;  2H43 A;  1BSH A;  1AV1 A;  2WSF J;  4WWI A;  4M3L A;  3JCU H;  4IFD K;  1OIP A;  3L37 A;  3C1L A;  4UB6 E;  1PP9 E;  3HUS C;  5KJ7 A;  1NAY A;  1D7M A;  1BE3 D;  3CCE P;  5CCG C;  2P58 A;  1VPC A;  2R3S A;  2OYO A;  4JYB A;  1ZR2 A;  1PGO A;  3Q5R A;  1FZC B;  2FFD A;  3JCU E;  5AW8 B;  1EZV I;  3L73 G;  2WMM A;  3F5H A;  2NPS A;  3RBX A;  1X8Y A;  3P7K A;  4R4L A;  3AEC C;  1NTM D;  1LTG C;  2FYU E;  2E74 C;  3H1I D;  3HRN A;  3M9B A;  3CCL P;  2OTJ P;  1OX3 A;  1P84 E;  1FU1 A;  1K8A Q;  2JEE A;  1IFP A;  3SFE C;  3AE2 C;  4ZMD A;  3PRJ A;  1JY2 O;  3M0A A;  1W5C E;  2FXO A;  4HYT B;  2MKV A;  3HD7 B;  2G8Y A;  3PH0 A;  3RL0 C;  2FY8 A;  1M57 D;  1URQ D;  3AE9 C;  5AVY B;  2IBZ D;  1S4X A;  2IZ1 A;  2BEZ F;  4W80 A;  3V6I A;  1M90 Q;  1A02 F;  3TK1 A;  1SQX K;  2CK3 H;  3AE5 C;  1YTZ I;  1XTC C;  2N1T B;  3CCR P;  1VF5 C;  1LWU A;  2E42 A;  1OXZ A;  2QJP C;  5DJU B;  3Q3D A;  1A02 J;  3L71 G;  2JP3 A;  2E75 C;  1EZV E;  2AXC A;  3L74 E;  5KJ7 C;  2XNX A;  2OTL P;  3BCC J;  3D6Z A;  5AW2 B;  2I1K A;  2KLU A;  4C7N B;  1KIL D;  1S5L H;  2YIU C;  4K3A A;  1KYO D;  1YQ4 C;  1NYH A;  2N9Y B;  3HTK B;  1GMJ A;  1IO4 A;  1URQ B;  4D6T G;  1T2K D;  4N78 D;  1LTJ C;  2IDB A;  1GK6 A;  2Z5H A;  1LGH B;  1YYC A;  4EOT A;  5CBO A;  2QIW A;  3KZI E;  4TT3 H;  3I55 P;  4UB8 H;  2IBZ I;  4DOJ A;  2Y9Z A;  1X79 B;  2W6J H;  1NO4 A;  1N7L A;  5H2F E;  4KT0 J;  5APU A;  3TNU A;  2QSI A;  2FYU D;  3JSV C;  2O01 J;  3H1L E;  2GUS A;  2O01 N;  3P8C D;  4L74 A;  1URQ A;  2ZXX A;  1KQL A;  2IZ0 A;  5APY A;  1FDI A;  2KIK A;  2RKL A;  2WPQ A;  3A0H H;  4PV1 B;  5TJH A;  4AYC A;  1NTK G;  1J1D C;  2K9Y A;  2YNY A;  1M7L A;  3H1I J;  3V2R A;  5CCG D;  3L72 G;  4C46 A;  2WTY A;  2M3E A;  2WSS H;  3Q5S A;  1FJP A;  3RK2 B;  4L75 A;  1NH4 A;  1VQ7 P;  1JUN A;  1EXI A;  3H1L D;  1RQU A;  3ABV C;  4JQ0 D;  4B86 A;  1OFC X;  1AQT A;  2O01 H;  1SFC A;  2W6B A;  3ITK A;  3L70 G;  4U3F E;  3S9O A;  1RE3 C;  3RK3 D;  1OWA A;  3I5C A;  1LWU B;  5AW3 B;  2KYV A;  3M91 A;  5E79 E;  3CXH E;  1G1J A;  2KI7 B;  3L75 E;  3B4S A;  3H1L J;  1T8Z A;  4WY4 A;  2K37 A;  1GL2 A;  5KAI E;  3RL0 D;  1WT6 A;  1NTZ E;  2M5A A;  5CCH A;  1HWT C;  2AEM A;  3AE4 C;  2WPV B;  1QL1 A;  2AXT H;  3KHU A;  3NMD A;  4L76 A;  2G3A A;  2ZYG A;  3U59 A;  2J58 A;  4RO0 A;  1VQ5 P;  3TGU D;  5AVS B;  2YXQ B;  3H1K E;  3VP8 A;  3L70 D;  3M9H A;  2OTK E;  3F89 A;  4N78 E;  1NTK K;  2HPC B;  3CC7 P;  4OVN F;  4JF7 A;  1JM0 A;  4U3F G;  4PD4 H;  3AE7 C;  3TGU G;  3WUU A;  1FDO A;  5B5E E;  5CBN A;  1E5W A;  4IL6 H;  1PFI A;  2FBW C;  4AUW A;  3VMA A;  3RK3 B;  2KUB A;  2WWW A;  1FS0 E;  1FZC A;  3SFD C;  1HJB A;  1LP1 A;  3JC2 2;  4BXL A;  1OMI A;  2H89 C;  3TGU J;  1BGY G;  2K88 A;  1Q86 Q;  1J1E B;  2FFD C;  4NPE A;  2YKQ A;  1M1J C;  3M0D C;  1N73 A;  3D6Y A;  2AXT E;  1W2B O;  3A0B H;  3V2N A;  2FYU K;  3WUV A;  3GLM A;  1YQ3 C;  3H1L G;  3L71 E;  1YJW P;  5APQ A;  4BWN A;  1N73 C;  3AE3 C;  1OW7 A;  1P84 I;  1SQB K;  2IYP A;  1SQV E;  2PGD A;  3CLQ A;  3HD7 C;  3RL0 B;  2QM8 A;  2QVA A;  3OJA B;  2A06 D;  1ZRT E;  4JYC A;  5BU8 B;  2A06 E;  2WVR A;  1HVV A;  1JTH A;  1OZH A;  3H1H G;  1L0L G;  1GL2 D;  1BE3 J;  2Y0E A;  1W2E A;  2HLO A;  3HD7 D;  4WB4 A;  3CME P;  2NPS D;  4C7N A;  2LKM A;  3A2A A;  1FJK A;  2XV5 A;  4DJG A;  3U1C A;  3E7K A;  4D6T E;  1IFD A;  2WPS A;  3D70 A;  2OAR A;  4IL6 X;  4UB8 E;  1SQP G;  1SLQ A;  1SQQ E;  1AJY A;  1LT9 C;  1DEE G;  2OYH C;  3IAO A;  4I1L A;  3VOP A;  1SS1 A;  3CX5 E;  5KAF H;  1PPJ G;  1FZC C;  4HKZ H;  3N4X A;  1NTM G;  4I6M C;  3UIA A;  1AVO A;  3CCM P;  1SQV J;  1KIL B;  1L0N G;  3B71 A;  1NTZ G;  2P1J A;  2WSF H;  3V5B A;  2FYU J;  2JJL A;  1JCC A;  1QVG O;  1LTI C;  1BDD A;  1L4A A;  1USE A;  1NTM J;  3FGA D;  2L5G B;  3RK3 E;  2XKM A;  1BE3 E;  5CCG A;  1H0T A;  2KSE A;  2LXC B;  5APV A;  1SQP K;  1ZP0 C;  3GHG B;  3PHL A;  2NRG A;  1SFC D;  3CX5 D;  3CXH I;  3IR9 A;  2BCC E;  2OYH A;  1GU4 A;  1NJI Q;  1SQP D;  1N2D C;  2W83 C;  1MFT A;  3H1J E;  1CI6 A;  1SFC C;  3G9R A;  4O9B A;  4YXD C;  1DX7 A;  1S5L X;  4NPF X;  1L4A C;  1LP1 B;  1KC8 Q;  4PD4 D;  2C9L Y;  1VL2 A;  1HBW A;  2WPR A;  4ASV A;  1G2C B;  1SVF A;  1M56 D;  2IYO A;  1EQ7 A;  1HUC A;  3HE5 A;  3BCC D;  3WU2 E;  2GM4 A;  1EDK A;  2KS1 B;  2Q5U A;  3HE5 B;  3L75 D;  4PJ0 H;  1KTM A;  1FZG A;  1HGV A;  3CCS P;  1FZA A;  5AVV B;  1RF1 A;  3MTU E;  1PZQ A;  3VYI A;  1LTJ B;  3KDP B;  4OH8 B;  1SQV K;  1PIX A;  2WQY C;  1KV4 A;  4ZNC A;  2E75 B;  2OQQ A;  1BCC G;  2QJY B;  5KTB A;  4HH2 A;  3GMA A;  2AEF A;  4YPC A;  1NTM K;  1SQB E;  1E79 H;  1UIX A;  2FYN C;  1YI2 P;  2YIU B;  2B87 A;  2BCC G;  3H1J J;  4GIF A;  3VMZ A;  1NTZ K;  2JWD A;  2YO3 A;  2WT7 A;  3CPW O;  4MN4 C;  3MZW B;  1L4A B;  1NU1 K;  2Q3I A;  2V4H A;  2V7Q J;  3V4Q A;  1M8O B;  2I1J A;  2PFX A;  3BCC G;  3M9Q A;  1FOS E;  4IOI H;  3W68 A;  3LIE A;  3CXH H;  1JY3 O;  5AW9 B;  1L0N D;  1FBM A;  1BE3 G;  1PGQ A;  3GHG C;  2JKV A;  3L72 E;  1ZLL A;  2E76 B;  1PL5 A;  3B8E B;  2KNC A;  2WT7 B;  1VQM P;  2B87 B;  3Q2Y A;  1VQK P;  1VQ6 P;  3FX0 A;  2AEJ A;  1S9K E;  3CC2 P;  1BCC D;  1BGY E;  4EYY Q;  2XDJ A;  1BGY D;  2P7J A;  1Q82 Q;  1PPJ E;  3L35 A;  2Q6Q A;  1QL2 A;  3GF7 A;  1N8R Q;  1VQ4 P;  5L8R J;  1RF1 C;  2K9J B;  5KJ7 D;  5B66 E;  3T97 B;  1YBK A;  2DW3 A;  4LGD E;  1J1D B;  3L73 E;  1NTZ D;  1ZME C;  1IFI A;  5AVU B;  3SWK A;  2QRX A;  2A06 G;  2KP8 A;  1FZF A;  2JR8 A;  3MP7 B;  5CJ4 A;  3CX5 H;  4Y99 C;  5AW1 B;  1NU1 J;  2K3R A;  2E74 B;  4U3F J;  4BRY B;  1R5L A;  3AEA C;  1J1E C;  3AE6 C;  3HUS B;  3PLN A;  2D2C B;  4KHX A;  4ZKU A;  2ZVN B;  5AVW B;  4AQR D;  1FZB A;  1JNM A;  3G3Z A;  3GF3 A;  4HB1 A;  4L73 A;  3CWB D;  4W7Z A;  4JBZ A;  1RY3 A;  1TU3 F;  1MZ9 A;  3S1K A;  2W8Z A;  1L0N K;  1VF5 D;  1K73 Q;  2RH0 A;  1KB9 D;  3CWB G;  2OYI B;  3H25 A;  2W27 A;  1PP9 J;  2A45 H;  3H1K J;  1X22 A;  3OAK A;  4PD4 E;  2BEQ D;  1U7M A;  1LJ2 A;  3KYQ A;  5KLI C;  3TSI A;  2P2U A;  3TGU E;  2WSE H;  2E74 D;  2Q9I A;  4I7Z C;  2H7H A;  5AVR B;  1ZW0 A;  1U57 A;  3B5N A;  3H1K G;  2JO1 A;  4PV1 D;  1KMI Z;  1RF0 A;  2W6A A;  5KKZ B;  1GW4 A;  3RBZ A;  3L71 J;  1NTK E;  2OYI A;  1SQX E;  1HTL C;  2M5A B;  1S2E A;  2WIT A;  3C9I A;  5AVT B;  5KLV D;  3CMA P;  1VQ9 P;  4XE5 B;  3CXH D;  5KAF E;  1KYO E;  1NU1 G;  1DEB A;  1T3J A;  2FYU G;  3HD7 A;  1SQP E;  1ZXG A;  3Q1M A;  2O1K A;  2R3C A;  2ZT9 C;  3HUS A;  3V2P A;  3BVH A;  1EDJ A;  2QEX P;  1K04 A;  2RN0 A;  4RJT A;  2Q1K A;  1GDT A;  1N73 B;  2FYZ A;  3L4F A;  3LW5 J;  1RF1 B;  1FC2 C;  1IFM A;  2KXP B;  3NFQ A;  3PP5 A;  1AQ5 A;  3L72 J;  1MFZ A;  2IPP A;  4GOE A;  1JY2 N;  1MKM A;  2N1T C;  1WMK A;  3KXD A;  5AVZ B;  3T97 A;  3L73 D;  1KIL C;  1K05 A;  2E5Y A;  3PJS K;  1HGZ A;  2Y9Y A;  3H6P A;  3RGU A;  5B5E H;  3B5N C;  1R8E A;  5APW A;  3VTP C;  1EZV G;  1MV8 A;  3A0B E;  1JY3 N;  3Q5P A;  1JCD A;  3CCV P;  2OYH B;  1T2K C;  1GW3 A;  1ZN5 A;  1S72 P;  1JOC A;  4WY4 D;  2E76 D;  1EDL A;  1L0L J;  1SQQ K;  5APX A;  3FXD A;  2C0X A;  3KZI H;  1H0T B;  2J59 M;  2ZJS E;  4N6J A;  4H13 D;  1AA0 A;  3LID A;  1IZN B;  1KIL A;  2YKO A;  3CWB E;  1KB9 H;  3II6 A;  2P67 A;  3WUT A;  4QMA A;  5KLV G;  1N7S C;  3KQG A;  1XTG B;  2KB7 P;  1S3J A;  2WZ7 A;  4U7J A;  2BCC J;  2KSJ A;  4XA4 A;  5E79 H;  3W67 A;  1BCC E;  4Y28 J;  1CW5 A;  1PP9 G;  1SQB D;  2Q3E A;  4Z1M H;  1WRG A;  3O6Q B;  1M1K Q;  4EDF A;  3QWO C;  3MIW A;  3SSU A;  4DZO A;  2Z4E A;  1GK4 A;  1SQX G;  1Y8A A;  4IFF A;  1ZV8 A;  1LTB C;  2N1T A;  5AW6 B;  1IFJ A;  3S4R A;  1RH5 B;  5CHX A;  2A45 I;  4GOF A;  5DJT B;  4D6T J;  3FWN A;  3OW2 O;  3VP9 A;  1KQG B;  1QX8 A;  2CPB A;  1AVY A;  1L0L K;  1RHZ B;  1RE4 A;  1SQQ J;  2HYN A;  1NOH A;  2WSC J;  3GG2 A;  3NXS A;  1Q81 Q;  3L70 E;  1GTW A;  1X9V A;  2B89 A;  4H0L B;  2H8P D;  2YKP A;  4H13 B;  1RF0 C;  1VF5 B;  3G71 P;  1S9K D;  2KZI A;  1SQX J;  1DIP A;  1OW8 A;  1SQB G;  2E76 C;  2J5U A;  2L91 A;  1P84 D;  2FYN B;  4LC1 A;  5CJ0 A;  2GUV A;  4BRY A;  3RL0 g;  2ZVO B;  1KYO I;  3GHG A;  1L0N E;  1KQS O;  3H1H J;  1NHL A;  3A0H E;  2PRR A;  3H1H D;  1YHQ P;  1R5S A;  2IFN A;  3BAS A;  2CPS A;  4PD4 I;  1NKZ B;  2FXM A;  1NTK J;  2UWJ E;  1Q90 D;  2E5T A;  2P10 A;  2QJY C;  2VRS A;  1EDI A;  2YXR B;  3A3Y B;  3NTN A;  3MUD C;  2GA1 A;  4RES B;  3TYY A;  1VQO P;  4H0L C;  1SQQ D;  2ZYA A;  3I56 P;  1NKN A;  5EFW B;  3CCQ P;  2B9B A;  4YTP C;  2W90 A;  2E43 A;  2B88 A;  3C8V A;  4OGQ B;  1GL2 B;  1LNQ A;  3R2P A;  3SWY A;  4WY4 C;  5KAI H;  2XND H;  2M8R A;  2ZAE B;  3AEE C;  1NTK D;  3AEG C;  5K5G B;  4ASW A;  2R44 A;  4NPD A;  4H13 C;  1SQB J;  1RE3 A;  5GTI H;  3CD6 P;  2V7Q H;  5AVX B;  2BCC D;  3RK2 C;  3L71 D;  3GW6 A;  3L74 D;  1L4A D;  1EZV D;  1SQQ G;  2O1J A;  2WSC H;  3M06 A;  5APT A;  3RK2 D;  1KFN A;  4GT1 A;  1K9M Q;  1IJD B;  1U7J A;  1GU5 A;  2R5D A;  1BSN A;  3AE1 C;  3AEB C;  3B5N D;  1N86 A;  3R4Y A;  1L0L D;  3FXE A;  4OGQ C;  1L0L E;  3K5B A;  2BAS A;  2NPS B;  4WBA A;  1G2C A;  1KB9 I;  3L74 J;  1HF9 A;  1LT1 A;  3TNU B;  2ZYD A;  4OGQ D;  2HPC A;  3CWB J;  4XFJ A;  1M1J A;  2D2C C;  2HOD A;  2MJZ A;  3M0D A;  4IFM A;  1CI6 B;  4GDO A;  1P84 H;  3L74 G;  2N9B A;  1Y47 A;  3H32 A;  4R4M A;  2H88 C;  3L36 A;  3CX5 I;  3L73 J;  4K35 A;  1IK9 A;  3H1I G;  2IFM A;  3WU2 H;  1FDM A;  2QM7 A;  1KZU B;  2R5B A;  2WSE J;  2YO2 A;  3L75 G;  5AW5 B;  2M3B A;  1H8A A;  1OVU A;  4WY4 B;  4GOD A;  2IBZ E;  3BCC E;  1LTT C;  1PGP A;  3A5T A;  2ZFC A;  5KLI B;  3B5N B;  5TIS H;  2E75 D;  3AEF C;  1NGM B;  4UB6 H;  2QJK B;  3KPE A;  4RKU J;  3IF4 A;  1YIJ P;  5BVZ A;  5M1B A;  3P8M C;  3V4W A;  1JEK A;  3H1I E;  5GTH H;  3TF5 A;  4N3Y B;  3IFM A;  1NWQ A;  4H44 D;  3E1I A;  1KD1 Q;  3IN6 A;  1NAF A;  2NZ2 A;  4W7Y A;  4H44 C;  4LLH A;  1KFM A;  1JO5 A;  2IX7 C;  4JPZ B;  2YMY A;  2KLV A;  1GZL A;  1PV3 A;  2XZR A;  2PP6 A;  3BRT B;  5GTH E;  1Q7Y Q;  4I2L C;  5BU5 A;  1SQX D;  4KJM A;  5KLV E;  2HG5 D;  3H32 B;  3WMM 0;  3H1K D;  5APS A;  1KQF B;  2POH A;  1M1J B; 
#chains in the Genus database with same CATH homology
 3EFG A;  2C9N Y;  1IFN A;  2NPS C;  3P8C E;  2FFD B;  1CZQ A;  4EIJ A;  3MUD A;  2KOG A;  1RE4 C;  5CJ4 A;  2A45 G;  3MGN A;  1MUU A;  2FKW B;  4C7R A;  1Z56 A;  3N7N A;  1JY3 P;  2C0W A;  3OA7 A;  3P32 A;  3LW5 H;  2OYI C;  1SP4 A;  1URQ C;  3U1A A;  1H89 A;  1N7S D;  1FOS F;  1LT9 B;  3EQ2 A;  1SFC B;  1H88 A;  1LTJ A;  1JY2 P;  4ZKP A;  3VMY A;  1N7S A;  1LTA C;  2N1T D;  1JMM A;  3HE4 B;  5KLV K;  1AQ5 A;  1LWU C;  3CL3 D;  1IC2 A;  3VN0 A;  1FZE A;  1AFO A;  1T3U A;  1FAV A;  2Q7C A;  1YTZ T;  3O8Z A;  2XU6 A;  2HOD B;  5AW0 B;  5CCH C;  5AVQ B;  1GL2 C;  5CCH D;  1LTS C;  1HH0 A;  2HFE D;  3A7O A;  3HE4 A;  3HTK A;  5CMZ A;  1ZR4 A;  1CSB A;  3MD0 A;  1N7S B;  5AW4 B;  3V2Q A;  3SWF A;  1LT9 A;  3CI9 A;  2PAJ A;  1VDF A;  1J2J B;  2Z5I A;  4Y99 B;  2R32 A;  1G1I A;  3BAT A;  5AW7 B;  1JTH B;  1GD2 E;  4GKG A;  3VMX A;  3RK3 C;  2ZXE B;  3BRV B;  2H43 A;  4M3L A;  4IFD K;  3L37 A;  5KJ7 A;  3HUS C;  5CCG C;  4JYB A;  1VPC A;  2FFD A;  1ZR2 A;  1FZC B;  5AW8 B;  2NPS A;  1X8Y A;  3P7K A;  1LTG C;  3M9B A;  3HRN A;  1FU1 A;  2JEE A;  3M0A A;  1JY2 O;  4HYT B;  3HD7 B;  3RL0 C;  5AVY B;  1URQ D;  1A02 F;  1DH3 A;  4W80 A;  3TK1 A;  1SQX K;  1YTZ I;  1XTC C;  2N1T B;  1LWU A;  2E42 A;  1OXZ A;  1A02 J;  5KJ7 C;  2XNX A;  5AW2 B;  2I1K A;  4C7N B;  1KIL D;  3HTK B;  1IO4 A;  1URQ B;  1T2K D;  4N78 D;  1LTJ C;  1GK6 A;  2Z5H A;  1LGH B;  1YYC A;  4EOT A;  4DOJ A;  1X79 B;  1NO4 A;  1N7L A;  5APU A;  3TNU A;  2GUS A;  3P8C D;  1URQ A;  1KQL A;  5APY A;  2WPQ A;  4AYC A;  3BVH A;  5CCG D;  2YNY A;  1J1D C;  1M7L A;  1FJP A;  4C46 A;  2WTY A;  3RK2 B;  1NH4 A;  1JUN A;  4B86 A;  2O01 H;  1SFC A;  2W6B A;  1RE3 C;  3RK3 D;  1OWA A;  3I5C A;  1LWU B;  5AW3 B;  2KYV A;  3M91 A;  1G1J A;  1T8Z A;  4WY4 A;  3RL0 D;  1GL2 A;  1WT6 A;  5CCH A;  1HWT C;  1QL1 A;  3NMD A;  3U59 A;  2J58 A;  5AVS B;  3VP8 A;  3M9H A;  4N78 E;  1NTK K;  2HPC B;  4JF7 A;  1E5W A;  1PFI A;  4AUW A;  3RK3 B;  2WWW A;  1FZC A;  1HJB A;  1J1E B;  2FFD C;  2YKQ A;  1M1J C;  3M0D C;  1N73 A;  3V2N A;  2FYU K;  5APQ A;  1N73 C;  1SQB K;  3CLQ A;  3HD7 C;  3RL0 B;  2QM8 A;  3OJA B;  5BU8 B;  4JYC A;  1HVV A;  1JTH A;  3HD7 D;  1GL2 D;  4WB4 A;  1W2E A;  2HLO A;  2NPS D;  4C7N A;  2LKM A;  3A2A A;  1FJK A;  2XV5 A;  3U1C A;  1IFD A;  2WPS A;  2OAR A;  1SLQ A;  1LT9 C;  2OYH C;  4I1L A;  3VOP A;  1FZC C;  3N4X A;  4I6M C;  3UIA A;  1KIL B;  2P1J A;  2WSF H;  3V5B A;  2JJL A;  1JCC A;  1LTI C;  1L4A A;  2L5G B;  2XKM A;  5APV A;  1SQP K;  3GHG B;  1SFC D;  3IR9 A;  2OYH A;  1GU4 A;  1N2D C;  1DX7 A;  1CI6 A;  1SFC C;  4O9B A;  1L4A C;  2C9L Y;  1HBW A;  2WPR A;  1G2C B;  1SVF A;  2GM4 A;  1EQ7 A;  1HUC A;  3HE5 A;  2Q5U A;  3HE5 B;  1FZG A;  1HGV A;  1FZA A;  5AVV B;  1RF1 A;  3MTU E;  3VYI A;  1LTJ B;  3KDP B;  4OH8 B;  1SQV K;  5KTB A;  4HH2 A;  1NTM K;  4GIF A;  3VMZ A;  1NTZ K;  2YO3 A;  2WT7 A;  1L4A B;  1NU1 K;  2Q3I A;  1FOS E;  3V4Q A;  2I1J A;  3M9Q A;  3LIE A;  5AW9 B;  1JY3 O;  1FBM A;  3GHG C;  1ZLL A;  2WT7 B;  3B8E B;  1S9K E;  2XDJ A;  2P7J A;  3L35 A;  1QL2 A;  1RF1 C;  5KJ7 D;  4LGD E;  1J1D B;  1IFI A;  5AVU B;  2KP8 A;  4Y99 C;  5AW1 B;  1J1E C;  3HUS B;  4KHX A;  5AVW B;  4AQR D;  1FZB A;  1JNM A;  3G3Z A;  4W7Z A;  1RY3 A;  1MZ9 A;  1L0N K;  2OYI B;  2W27 A;  2A45 H;  3OAK A;  3TSI A;  3KYQ A;  2H7H A;  2P2U A;  2WSE H;  5AVR B;  3B5N A;  2W6A A;  1RF0 A;  1GW4 A;  2OYI A;  3C9I A;  1HTL C;  2WIT A;  5AVT B;  4XE5 B;  1DEB A;  1T3J A;  3HD7 A;  2O1K A;  2R3C A;  3HUS A;  3V2P A;  1GDT A;  1N73 B;  2FYZ A;  3L4F A;  1RF1 B;  1IFM A;  3PP5 A;  3NFQ A;  1MFZ A;  2IPP A;  1JY2 N;  2N1T C;  5AVZ B;  3T97 A;  1KIL C;  1HGZ A;  3H6P A;  1FZF A;  3B5N C;  5APW A;  3VTP C;  1MV8 A;  1JY3 N;  1JCD A;  2OYH B;  1T2K C;  1GW3 A;  1ZN5 A;  1JOC A;  4WY4 D;  1SQQ K;  5APX A;  2C0X A;  2J59 M;  4N6J A;  3LID A;  1KIL A;  3II6 A;  2YKO A;  2P67 A;  1N7S C;  3KQG A;  1XTG B;  2KB7 P;  4XA4 A;  2WZ7 A;  4ZKU A;  2KSJ A;  1CW5 A;  1WRG A;  3MIW A;  4DZO A;  2Z4E A;  1GK4 A;  4IFF A;  5AW6 B;  1ZV8 A;  1LTB C;  2N1T A;  1IFJ A;  5CHX A;  2A45 I;  3VP9 A;  2CPB A;  3V2R A;  1L0L K;  5CCG A;  1RE4 A;  2HYN A;  1NOH A;  3NXS A;  1GTW A;  1X9V A;  2H8P D;  2YKP A;  1RF0 C;  1S9K D;  4LC1 A;  5CJ0 A;  2GUV A;  3GHG A;  1NHL A;  2IFN A;  3BAS A;  2CPS A;  1NKZ B;  2FXM A;  2Q9I A;  2VRS A;  4RES B;  3A3Y B;  3NTN A;  3TYY A;  1NKN A;  2E43 A;  1GL2 B;  3R2P A;  3SWY A;  4WY4 C;  2M8R A;  1RE3 A;  3RK2 C;  5AVX B;  1L4A D;  2O1J A;  2WSC H;  3M06 A;  5APT A;  3RK2 D;  1KFN A;  4GT1 A;  1IJD B;  1GU5 A;  2R5D A;  3B5N D;  1N86 A;  2BAS A;  2NPS B;  4WBA A;  1G2C A;  3TNU B;  2HPC A;  1M1J A;  3M0D A;  2HOD A;  2MJZ A;  4IFM A;  1CI6 B;  2N9B A;  3H32 A;  3L36 A;  1IK9 A;  2IFM A;  1FDM A;  2QM7 A;  1KZU B;  2R5B A;  2YO2 A;  5AW5 B;  2M3B A;  1H8A A;  4WY4 B;  1LTT C;  3A5T A;  2ZFC A;  3B5N B;  3KPE A;  5BVZ A;  3P8M C;  3V4W A;  1NWQ A;  4N3Y B;  3IFM A;  3E1I A;  1NAF A;  4W7Y A;  4LLH A;  1KFM A;  1JO5 A;  2IX7 C;  2YMY A;  2KLV A;  2XZR A;  3BRT B;  1GZL A;  2PP6 A;  4I2L C;  5BU5 A;  2HG5 D;  3H32 B;  3WMM 0;  5APS A;  2POH A;  1M1J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...