3BASA

Crystal structure of the n-terminal region of the scallop myosin rod, monoclinic (c2) form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
80
structure length
80
Chain Sequence
ARQEEEMKEQLKQMDKMKEDLAKTERIKKELEEQNVTLLEQKNDLFGSMKQLEDKVEELLSKNYHLENEVARLKKLVGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An unstable head-rod junction may promote folding into the compact off-state conformation of regulated myosins.
pubmed doi rcsb
source organism Argopecten irradians
molecule tags Contractile protein
molecule keywords Myosin heavy chain, striated muscle/General control protein
total genus 40
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3basA00
3U1CA 1X79B 3P8CD 3N4XA 1IC2A 3N7NA 1WT6A 5BU5A 5BU8B 1NKNA 3C9IA 4GIFA 4O9BA 2POHA 2JEEA 3HRNA 3VP9A 4ZKUA 3U59A 5BVZA 4I1LA 3VP8A 5KTBA 3OJAB 4N78D 2FXMA 3BASA 4N3YB 3U1AA 4ZKPA 3BATA
chains in the Genus database with same CATH superfamily
2AEMA 4AQRD 2IFMA 1HGZA 3Q5PA 3CCRP 1BCCD 2QRXA 5AW3B 2VRSA 3JC22 1IJDB 2B87B 2KS1A 1URQD 2QJKB 3P8CE 1VQNP 1T6AA 4BXLA 3CCQP 2M0BA 1AV1A 1JY2P 1K8AQ 1ZXGA 4JYCA 3TGUD 4KHXA 3L71E 1OW7A 5DJTB 1OW8A 1RF0C 1MFTA 2G8YA 4D6TJ 1L0NJ 2L91A 3BRVB 3KPEA 4R4MA 2B87A 1LTJB 1NU1K 2KS1B 1LJ2A 3FGAD 5CMZA 1HJBA 2B9BA 2J58A 4PD4I 4BRYA 2WPQA 2QVAA 3PH0A 4UB6H 1EDJA 5CCHD 1ZV8A 3KQGA 3L70G 3KXDA 1VQKP 2Q5UA 1KYOI 2E42A 2YXQB 2HR3A 1GD2E 3G9RA 1SP4A 5CJ0A 3HD7D 4H44D 2QG4A 4EI2A 1GL2B 2FYNB 1L4AA 3B8EB 1VQPP 3A0HH 1EDKA 1IK9A 3E7KA 3CXHI 3H1LJ 1SQXK 3L74D 3FWLA 1N73A 1SQBE 3ABVC 3KZIH 4WY4B 5APYA 3W67A 1X8YA 3C8VA 2HG5D 1S5LX 1ZLLA 2WPRA 5H2FE 1NO4A 1SQPJ 5CCGC 3H1KE 5GTHE 2E74B 4GKGA 3CC4P 2UWJE 1GL2A 3NMDA 2E74D 4O9BA 3CCMP 1XTGB 3GG2A 2A45I 4LC1A 1GU4A 3U59A 5AVVB 1JTHB 2FYUE 3F5HA 1RQUA 1VDFA 2WPVB 2BCCD 1PPJD 3II6A 3L75J 3L72J 4L73A 3L70E 3VP8A 5KLIB 4LLHA 4EDFA 1USEA 2XZRA 3BCCG 4IFFA 1PFIA 1VQLP 1VQMP 2XNXA 1KILC 2KOGA 2QE7H 3LIDA 3WMM0 3HE4A 1GDTA 2AXTH 3O6QB 1S72P 1ZP0C 4DJGA 2CPSA 1OVUA 3RL0D 1M1JB 2FFDB 5APQA 2M3EA 4DT0A 1SQBG 1BE3G 3H1JD 1H0TB 3H1JJ 3A7OA 1PZQA 2H43A 1NTZG 3SWFA 1UIIA 1KYOE 4JPZB 1M1KQ 3AE4C 4TLFA 3O6QA 1PV3A 3N4XA 4PJ0E 5AW6B 4WB4A 2OYHC 2KK7A 2KNCA 4ZNCA 1Q81Q 1SQVK 2XNDH 4WY4A 3C9IA 3D70A 2IYOA 3A3YB 5CJ4A 1H8AA 2POHA 1AJYA 1X9VA 3EWKA 5TISE 2FYZA 1FZCC 1NTKJ 2XKMA 2BCCJ 1OVVA 4NPEA 2WWWA 1P84I 2K3RA 4WY4D 3Q1MA 1QGKB 3H1IG 4JYBA 4NPDA 1NU1J 2M5AA 2N1TC 5AVUB 1J1EB 3ZDMA 1CI6A 1L0LJ 3C1LA 3TYYA 2E76B 3TNUB 4OGQC 2PGDA 2MJZA 2E74C 4GDOA 4I7ZC 1K04A 2OGUA 2BEQD 3VN0A 5KJ7A 3L73J 4PV1D 2NRGA 3T97A 2Y9ZA 1L0LG 1T3UA 2G3AA 2W6AA 4H0LD 2IFNA 1UIXA 3RK2B 1KV4A 1N8RQ 3P8MC 3G6EP 4L74A 2CK3H 1QL1A 4GOEA 2H7HA 3L71D 1NTKG 1RF1A 2ZXXA 1P84H 1M7LA 1L0LE 4BRYB 5AVQB 5AVRB 1AA0A 1FAVA 1SQBK 2E75D 4OVNF 4YXDC 1NKZB 2P10A 1VQ5P 1ZW0A 2CPBA 2WTYA 1FDIA 2HFED 2H88C 3VYIA 1NH4A 3QWOC 2QJPB 4D6TD 3V6IA 1JTHA 2IPPA 1PP9G 3GHGA 3WUUA 1IFIA 4GT1A 1AQ5A 4KT0J 1NTZD 1SQXD 2IX7C 2KZJA 1ZOYC 2IBZD 2OYHB 2I1KA 3I5CA 5E79H 2KI7B 3AECC 3LIEA 5DJUB 2YKPA 3PTZA 4U3FD 5B5EE 1EDLA 2ZT9C 1M1JA 1TU3F 2WSCH 4PD4H 2Y0EA 1LTAC 3BATA 3SWYA 1JOCA 1YBKA 2BCCE 1RY3A 3B71A 1Q90D 3T97B 3CX5H 1LTJA 3L72G 1N2DC 1OWAA 1HVVA 2N1TB 2PAJA 1NTME 1AVOA 2OTKE 1JUNA 1HBWA 1N7SA 2V7QJ 4OGQB 1P84D 5APWA 2A45H 2AXCA 3MZWB 4JQ0D 2HPCA 3VTPC 1N73B 1FOSF 1BDDA 4I7ZB 2ZYGA 1BSHA 2PRRA 1CZQA 2WSFH 5BVZA 1DD4A 4I1LA 1L4AB 5AW2B 1JO5A 3H1LG 1M57D 2O1JA 3IR9A 2AEFA 3EQ2A 1S9KE 3AE6C 1ZR2A 1K9MQ 1BE3E 3A2AA 4L75A 3BRTB 5AW4B 2GA1A 4N3YB 3FX0A 1IFPA 4C7NA 2O1KA 2D2CD 3L70J 1RH5B 1SS1A 2OARA 2N9YB 3IAOA 1NTMG 5APUA 2Z5HA 5AW7B 1HGVA 3MD0A 5KKZB 3U1CA 1FDMA 3FWNA 1N7LA 2YKQA 1KZUB 3P8CD 1OW6A 1PL5A 1SQVE 1VF5C 1KYOD 3A0HE 4IL6H 2Q3IA 4YTPC 3V2QA 1YJWP 2JWAA 1ZRTE 3HTKA 1E79H 2JKVA 2PFXA 1LTTC 2ZT9D 3M9QA 1LT1A 5GTHH 4YPCA 1RF0A 5H2FH 3VP9A 2HPCB 1SQVG 1GW4A 2K88A 3TGUG 1SVFA 2I1JA 2N1TD 3PP5A 3EFGA 5B66H 1YI2P 1DH3A 1LTGC 3CCVP 1HF9A 1SLQA 2Q3EA 1L0ND 4H0LB 1R8EA 2A06G 1KQSO 1NTZK 3PLNA 1JCCA 1KMIZ 3CD6P 1G1JA 3PJSK 4N78E 3WUVA 1GK4A 3F89A 2FYUD 4PD4D 1HUCA 3GHGC 4I6MC 2WSEJ 4EOTA 2FXOA 3A0BE 2OTJP 3B4SA 3LW5H 5GTIE 2OTLP 3RBZA 4XA4A 2Y9YA 1L4AC 2C0WA 3RK3B 4L76A 3TGUJ 1HTLC 3CPWO 1FOSE 3GF3A 2XDJA 3H1KJ 5BU8B 3CCLP 1VQ4P 4R4LA 2O01J 3FXDA 1KYOH 2WZ7A 2W6JH 3CL3D 3Q2YA 1SQPD 2JEEA 3HTKB 3MTUE 4ZKUA 1LP1B 2A06E 2Z5IA 1QLED 1PGQA 1VPCA 2B88A 2O3JA 2YMKA 2OQQA 3Q5RA 3H32A 2QJKC 5CCGD 3V2NA 1KN7A 1GK6A 2FYUG 1KB9I 2M3BA 2R3SA 3L73G 1VF5B 4I2LC 1OZHA 2J59M 3HD7B 2I8DA 2LKMA 3BCCE 3RL0B 3TNUA 1FZAA 1M8OB 4C7RA 1A02J 4NPFX 1EXJA 1JCDA 4ZKPA 1YHQP 1XTCC 3OA7A 2KSEA 3RK3E 3R4YA 5AVTB 2NPSD 3MGNA 5KLVD 5TISH 3HUSA 1SQPE 2KUBA 1IC2A 3BCCD 3AE3C 4BWNA 1GL2D 4UB8H 1S3JA 4PV1C 4GODA 1FE6A 5KAFH 2QA4P 1VQOP 2QJYC 5L8RJ 1ZR4A 2OYHA 4AUWA 1DIPA 3GMAA 1GMJA 3L75E 1JB0J 1MV8A 2FYNC 2K37A 1NU1D 2QEXP 1QEXA 5KLVK 2ZXEB 3Q3DA 1NWQA 3D6YA 3CI9A 3L73E 3M9BA 1NTZJ 2JDIH 1SFCA 2L5GB 3B5ND 1H88A 1AQTA 5APSA 3RK3C 2M5AB 3TGUE 1BE3J 3H32B 3WUTA 1KILA 1VQ9P 3NTNA 2Q6QA 5AVWB 1S4XA 3H1LE 3NXSA 4W7ZA 1L0NE 1W2EA 3CX5D 2E76D 1YJNP 2R5BA 3GW6A 4WBAA 5KLIC 3M06A 3BCCJ 4C46A 3CCUP 2K9YA 3IFMA 3L71J 3PRJA 1WRGA 2YMYA 1LWUA 3MUDC 4LGDE 4PD4E 2SPZA 2W6BA 5KAIE 1KILB 1WT6A 1YQ4C 5AW9B 3CXHD 4H44C 2WSEH 1RE4A 4RO0A 1VQ8P 2C9LY 3HUSB 1PPJE 3CCEP 1R5SA 2P67A 1M1JC 2A45G 1SQVD 2J5UA 3V5BA 3G71P 3RL0C 3RBXA 1N7SB 1S5LE 1CSBA 1DEBA 1K05A 2M8RA 2XV5A 2NZ2A 3RK2C 2RMZA 5AVSB 1URQC 2XU6A 1JNMA 1NAYA 1Y9BA 3JCUH 1MUUA 1YTZI 2GUSA 3L75D 4M3LA 1YITP 3E1IA 5B5EH 3AEGC 1RF1C 1BE3D 4Y28J 3CC2P 2KB7P 3V4WA 1FBMA 1J1DC 2HODB 3TSIA 2WT7A 2KNCB 3KDPB 1A02F 1AFOA 2JJLA 3WU2H 5CHXA 4AYCA 2QSIA 1FZCB 1EZVD 1NTKE 3P32A 3P7KA 5KJ7C 2YNYA 2JP3A 2E43A 1KILE 1KORA 2FYUJ 1S1CX 3GF7A 1LP1A 1J1EC 3AE9C 3PHLA 3RK2D 2BCCG 4JF7A 3VMYA 2N1TA 2D2CC 1NOHA 2W83C 1EDIA 3KZIE 5AW1B 2RN0A 1L2PA 1PGJA 2OYIB 3H1KG 4H13D 1PGPA 3UIAA 5M1BA 2WSFJ 3L72D 2IZ1A 2RKLA 1BGYD 1SQBJ 4H44B 4U3FE 4DZOA 3G4SP 3H1HJ 3BASA 3M0AA 1OIPA 2IBZE 3S9OA 3L72E 1FC2C 3SWKA 3V2RA 1ZMEC 2HODA 2WT7B 4B86A 2YIUC 2LXCB 2QJPC 3L70D 1JMMA 1LT9C 4D6TE 1IK7A 3MHVA 3CWBG 2KP8A 3AEFC 1LWUC 1U57A 2IZ0A 2V4HA 3L75G 2PP6A 3NFQA 1FJKA 1IZNB 1LTSC 1SQVJ 2KLUA 1OMIA 3L74J 3AE8C 5GTIH 2E75C 2KYVA 2K9JA 1KQGB 1Q86Q 4KJMA 1JY2O 1VQ6P 1NU1E 2ZT9B 4GIFA 3L37A 3AEDC 2WSSH 3BVHA 2AEJA 1SQPG 4XFJA 3CLQA 2N9BA 3CWBD 2C9NY 1G2CB 1GL2C 2P2UA 2WVRA 1BCCG 2O01N 2OYIA 1LTIC 1KB9D 1L0LK 3AE2C 2NPSB 2Z4EA 3HE5A 2H8PD 1NTMJ 3IF4A 4OWFA 1Q7YQ 4QMAA 1IFMA 3MIWA 2WSCJ 5APVA 1KC8Q 3EFFK 2D2CB 4EIJA 1BGYG 2P1JA 3CWBE 1OX3A 4HB1A 5APTA 1G2CA 2FYUK 3V4QA 1NHLA 3I56P 2BASA 3AE1C 1GTWA 2Q7CA 2OYIC 2FXPA 3MUDA 1IO4A 1LTBC 1KB9H 4CPGA 1P84E 2IBZI 1G1IA 1EZVI 4Z1MH 1X79B 1L0NG 1SQQK 3USSA 1H89A 2YKOA 1BDCA 3GLMA 1FZGA 2YO3A 1QX8A 3CCJP 1YYCA 2JR8A 4A7PA 1S9KD 2P7JA 1X0TA 1VL2A 1JY3N 1RHZB 1H0TA 1Z56A 4RESB 3VMAA 2FFDC 2FY8A 3L74G 5KKZC 1GZLA 2YIUB 5AW0B 1JEKA 1QL2A 1QVGO 1LT9B 1U7JA 3JSVC 1RE3C 2LXBA 5CBNA 3CXHH 1USDA 1MZ9A 3CWBJ 4HJGH 3VOPA 4EYYQ 1LWUB 1SQXE 3K5BA 3TK1A 4IFDK 4GOFA 2OYOA 3LW5J 4HH2A 5AW5B 1NAFA 4WVZA 1PGOA 1NTMD 2E75B 1FS0E 1FU1A 1SQPK 5AVYB 1WMKA 1OFCX 3HD7A 1PIXA 1T2KD 1ZN5A 2RH0A 5E79E 3Q5SA 2GUVA 2QIWA 3L73D 1FDOA 1HJ0A 3B5NC 5AVXB 2O01H 3M91A 2HYNA 3ITKA 2ZJSE 3FXEA 4IFMA 4W7YA 5CCHA 3SFDC 4H0LC 1PP9J 1FZFA 1KFMA 4W80A 2NPSC 4MN4C 5EFWB 5APXA 1T3JA 1K73Q 1M90Q 2YO2A 2E76C 3H1KD 3L74E 3SSUA 1N7SD 3CMAP 5KAIH 1JY2N 2KSJA 2JWDA 2R5DA 1EZVE 1NTKD 3HRNA 3AEEC 2WQYC 4RJTA 1QVFO 3RGUA 2ZFCA 2Q1KA 4UB6E 3SFEC 1L0LD 1L0NK 1SQQG 3L36A 1MFZA 4Y99B 1S5LH 3CC7P 1GW3A 2Y0DA 2WMMA 1SFCB 1SQXJ 1LGHB 3KHUA 3JCUE 1DEEG 2KXPB 3TF5A 2FXMA 2FFDA 2QM7A 1EC5A 3H1IE 1LNQA 2ZVOB 3TDKA 4DOJA 1VF5D 3E1RA 1BSNA 1KTMA 5KLVJ 2JO1A 3H1ID 1YJ9P 1KILD 1YTZT 2ZYAA 3KYQA 4U3FG 3A5TA 2H89C 3WU2E 1FZCA 1NU1G 1N86A 1EXIA 1KFNA 1SQQJ 3H1IJ 2R32A 3H25A 3B5NA 3RL0g 4H13C 1FJPA 1HH0A 4U7JA 3M0DA 3AE7C 3HD7C 3MP7B 2E5YA 1GU5A 1CW5A 1YIJP 1Q2NA 2LR2A 4RKUJ 1JY3P 1T2KC 3H1JE 2ZYDA 1SQQE 4IL6X 4JBZA 4IL6E 5CCHC 4TT3H 4WWIA 2V7QH 3B5NB 4ZMDA 1AVYA 1RQVA 2GM4A 3D71A 1KQLA 2AXTE 5KTBA 4K35A 3L71G 5AVZB 1RE4C 3H1JG 3HE4B 1M56D 5KJ7D 5B66E 3H1HE 3D6ZA 4PV1B 1DX7A 4N78D 4ASVA 2QJYB 2Q9IA 3AE5C 3W68A 3H1HD 4DCKA 1RE3A 3V2PA 3M9HA 4PJ0H 5TJHA 1PPJG 1JM0A 1EQ7A 1MKMA 3R2PA 3VMXA 1BGYE 2Y0CA 1W2BO 4YXWH 3H1LD 4IOIH 4Y99C 1SQQD 1NJIQ 3A0BH 1HWTC 1ZRTD 1NKNA 1SFCC 2B89A 5CCGA 2FBWC 2W27A 1D7MA 3H6PA 4HKZH 2ZAEB 1NYHA 2WITA 5C39A 4N6JA 1NTKK 3IN6A 3CMEP 1JY3O 1PP9E 2HLOA 2K9JB 4OGQD 1N73C 1R5LA 2ITAA 1FZEA 2KZIA 5KLVE 4OH8B 2E5TA 1FZBA 3OAKA 3RK3D 1URQA 1EZVG 3CX5I 3M0DC 3QH9A 1E5WA 4U3FJ 1U7MA 2YXRB 2C0XA 3HUSC 4H13B 5KLVG 3HE5B 1NTMK 3O8ZA 3S4RA 3OW2O 1T8ZA 1N7SC 2FKWB 2IDBA 1BGYJ 1SQBD 2A06D 1S2EA 4ASWA 1IFNA 2K1AA 5AW8B 3CCSP 4HYTB 1OVRA 1SFCD 1SQXG 1URQB 1KD1Q 3I55P 1LTJC 2IBZG 1J2JB 1Y47A 2KIKA 2W90A 2W8ZA 5K5GB 1RF1B 1CI6B 1LT9A 2R3CA 1BCCJ 1NVOA 1PP9D 3N7NA 4D6TG 5BU5A 1KB9E 1J1DB 1VQ7P 2P58A 1KQFB 2QM8A 1X22A 2DW3A 4XE5B 1IFJA 5CBOA 1Q82Q 4UB8E 2WPSA 3GHGB 5KAFE 1Y8AA 1IFDA 4K3AA 2KLVA 3G3ZA 1L4AD 4WY4C 1JMBA 1OXZA 3L35A 2NPSA 3OJAB 1BCCE 2IYPA 2R44A 3S1KA 2ZVNB 2BEZF 3CXHE 3VMZA 4C7NB 3AEBC 3H1HG 1NTZE 3AEAC 3CX5E 1YQ3C 3U1AA 1DD3A 1W5CE 1NGMB 3L4FA 2MKVA
chains in the Genus database with same CATH topology
4AQRD 2IFMA 1HGZA 5AW3B 2VRSA 1IJDB 1URQD 3P8CE 1JY2P 4JYCA 4KHXA 1RF0C 3BRVB 3KPEA 5CCGD 1HJBA 1LTJB 1NU1K 5CMZA 2J58A 2WPQA 5CCHD 1ZV8A 3KQGA 2Q5UA 2E42A 1GD2E 1SP4A 5CJ0A 3HD7D 1GL2B 1L4AA 3B8EB 1IK9A 1N73A 1SQXK 4WY4B 5APYA 1X8YA 2HG5D 1ZLLA 2WPRA 5CCGC 1NO4A 4GKGA 4O9BA 1GL2A 3NMDA 1XTGB 2A45I 4LC1A 1GU4A 3U59A 5AVVB 1JTHB 3RK2C 1VDFA 3II6A 3VP8A 4LLHA 2XZRA 4IFFA 1PFIA 2XNXA 1KILC 2KOGA 3LIDA 3WMM0 3HE4A 1GDTA 2CPSA 3RL0D 1M1JB 2FFDB 5APQA 2H43A 3A7OA 3SWFA 5AW6B 3N4XA 2OYHC 4WB4A 1SQVK 4WY4A 3C9IA 3A3YB 5CJ4A 1H8AA 2POHA 1X9VA 2FYZA 1FZCC 2XKMA 2WWWA 4WY4D 4JYBA 2N1TC 5AVUB 1J1EB 1CI6A 3TYYA 3TNUB 2MJZA 3VN0A 5KJ7A 3T97A 1T3UA 2W6AA 3RK2B 2IFNA 3P8MC 1QL1A 1RF1A 1M7LA 5AVQB 5AVRB 1FAVA 1SQBK 1NKZB 2CPBA 2WTYA 2HFED 3VYIA 1NH4A 1JTHA 2IPPA 3GHGA 1IFIA 4GT1A 1AQ5A 2IX7C 2OYHB 2I1KA 3I5CA 3LIEA 2YKPA 1M1JA 2WSCH 1LTAC 3BATA 3SWYA 1JOCA 1RY3A 1LTJA 1N2DC 1OWAA 1HVVA 2N1TB 1JUNA 1HBWA 1N7SA 5APWA 1FOSF 2A45H 2HPCA 1N73B 3VTPC 1CZQA 2WSFH 5BVZA 4I1LA 1L4AB 5AW2B 3IR9A 2O1JA 1S9KE 3EQ2A 1ZR2A 3A2AA 3BRTB 5AW4B 4N3YB 4C7NA 2O1KA 2OARA 5APUA 2Z5HA 5AW7B 1HGVA 3MD0A 3U1CA 1FDMA 1N7LA 2YKQA 1KZUB 3P8CD 3V2QA 2Q3IA 3HTKA 1LTTC 3M9QA 1RF0A 3VP9A 2HPCB 1GW4A 1DH3A 1SVFA 2I1JA 2N1TD 3PP5A 3EFGA 1LTGC 1SLQA 1NTZK 1JCCA 1G1JA 4N78E 1GK4A 1HUCA 3GHGC 4I6MC 4EOTA 3LW5H 4XA4A 1L4AC 2C0WA 3RK3B 1HTLC 1FOSE 2XDJA 5BU8B 2WZ7A 3CL3D 2JEEA 3HTKB 3MTUE 4ZKUA 2Z5IA 1VPCA 3H32A 3V2NA 1GK6A 2M3BA 4I2LC 3HD7B 2J59M 2LKMA 3RL0B 3TNUA 1FZAA 1A02J 4C7RA 1JCDA 4ZKPA 1XTCC 3OA7A 5AVTB 2NPSD 3MGNA 3HUSA 1IC2A 1GL2D 2OYHA 4AUWA 1ZR4A 1MV8A 5KLVK 2ZXEB 1NWQA 3CI9A 3M9BA 2L5GB 1SFCA 3B5ND 1H88A 5APSA 3RK3C 3H32B 1KILA 3NTNA 5AVWB 3NXSA 4W7ZA 1W2EA 2R5BA 4WBAA 3M06A 4C46A 3IFMA 4LGDE 2H7HA 1WRGA 2YMYA 1LWUA 2W6BA 1KILB 1WT6A 5AW9B 2WSEH 1RE4A 2C9LY 3HUSB 2P67A 1M1JC 2A45G 3V5BA 3RL0C 1N7SB 1CSBA 1DEBA 2M8RA 2XV5A 5AVSB 1URQC 2XU6A 1JNMA 1MUUA 1YTZI 2GUSA 4M3LA 3E1IA 1RF1C 2KB7P 3V4WA 1FBMA 1J1DC 2HODB 3TSIA 2WT7A 1A02F 3KDPB 1AFOA 2JJLA 5CHXA 4AYCA 1FZCB 3P32A 3P7KA 5KJ7C 2YNYA 2E43A 1J1EC 3RK2D 4JF7A 3VMYA 2N1TA 1NOHA 5AW1B 2OYIB 3UIAA 4DZOA 3BASA 3M0AA 3V2RA 2HODA 2WT7B 4B86A 1JMMA 1LT9C 2KP8A 1LWUC 2Z4EA 2PP6A 3NFQA 1FJKA 1LTSC 2KYVA 1JY2O 4GIFA 3L37A 3BVHA 3CLQA 2N9BA 2C9NY 1G2CB 1GL2C 2P2UA 2OYIA 1LTIC 1L0LK 2NPSB 3HE5A 2H8PD 1IFMA 3MIWA 5APVA 4EIJA 2P1JA 5APTA 1G2CA 2FYUK 3V4QA 1NHLA 2BASA 1GTWA 2OYIC 2Q7CA 1IO4A 3MUDA 1LTBC 1G1IA 1X79B 1SQQK 1H89A 2YKOA 1FZGA 2YO3A 1YYCA 1S9KD 2P7JA 1JY3N 1Z56A 4RESB 2FFDC 1GZLA 5AW0B 1QL2A 1LT9B 1RE3C 1MZ9A 3VOPA 1LWUB 3TK1A 4IFDK 5AW5B 4HH2A 1NAFA 5AVYB 1FU1A 1SQPK 3HD7A 1T2KD 1ZN5A 2GUVA 3B5NC 5AVXB 2O01H 3M91A 2HYNA 1JO5A 5CCHA 1FZFA 4IFMA 4W7YA 1KFMA 4W80A 2NPSC 5APXA 1T3JA 2YO2A 1N7SD 1JY2N 2KSJA 2R5DA 3HRNA 2ZFCA 1L0NK 3L36A 1MFZA 4Y99B 1GW3A 1SFCB 1LGHB 2FXMA 2FFDA 2QM7A 4DOJA 1KILD 1YTZT 3KYQA 3A5TA 1FZCA 1N86A 1KFNA 2R32A 3B5NA 1FJPA 1HH0A 3M0DA 3HD7C 1GU5A 1CW5A 1JY3P 1T2KC 5CCHC 3B5NB 2GM4A 1KQLA 5KTBA 5AVZB 1RE4C 3HE4B 5KJ7D 1DX7A 4N78D 2Q9IA 1RE3A 3V2PA 3M9HA 1EQ7A 3R2PA 3VMXA 4Y99C 1HWTC 1NKNA 1SFCC 5CCGA 2W27A 3H6PA 2WITA 4N6JA 1NTKK 1JY3O 2HLOA 1N73C 1FZEA 4OH8B 1FZBA 3OAKA 3RK3D 1URQA 3M0DC 1E5WA 2C0XA 3HUSC 3HE5B 1NTMK 3O8ZA 1T8ZA 1N7SC 2FKWB 1IFNA 5AW8B 4HYTB 1SFCD 1URQB 1LTJC 1J2JB 1RF1B 1CI6B 1LT9A 2R3CA 3N7NA 5BU5A 1J1DB 2QM8A 4XE5B 1IFJA 2WPSA 3GHGB 1IFDA 2KLVA 3G3ZA 1L4AD 4WY4C 1OXZA 3L35A 2NPSA 3OJAB 3VMZA 4C7NB 3U1AA 2PAJA 3L4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U1C A;  1X79 B;  3P8C D;  3N4X A;  1IC2 A;  3N7N A;  1WT6 A;  5BU5 A;  5BU8 B;  1NKN A;  3C9I A;  4GIF A;  4O9B A;  2POH A;  2JEE A;  3HRN A;  3VP9 A;  4ZKU A;  3U59 A;  5BVZ A;  4I1L A;  3VP8 A;  5KTB A;  3OJA B;  4N78 D;  2FXM A;  3BAS A;  4N3Y B;  3U1A A;  4ZKP A;  3BAT A; 
#chains in the Genus database with same CATH topology
 2AEM A;  4AQR D;  2IFM A;  1HGZ A;  3Q5P A;  3CCR P;  1BCC D;  2QRX A;  5AW3 B;  2VRS A;  3JC2 2;  1IJD B;  2B87 B;  2KS1 A;  1URQ D;  2QJK B;  3P8C E;  1VQN P;  1T6A A;  4BXL A;  3CCQ P;  2M0B A;  1AV1 A;  1JY2 P;  1K8A Q;  1ZXG A;  4JYC A;  3TGU D;  4KHX A;  3L71 E;  1OW7 A;  5DJT B;  1OW8 A;  1RF0 C;  1MFT A;  2G8Y A;  4D6T J;  1L0N J;  2L91 A;  3BRV B;  3KPE A;  4R4M A;  2B87 A;  1LTJ B;  1NU1 K;  2KS1 B;  1LJ2 A;  3FGA D;  5CMZ A;  1HJB A;  2B9B A;  2J58 A;  4PD4 I;  4BRY A;  2WPQ A;  2QVA A;  3PH0 A;  4UB6 H;  1EDJ A;  5CCH D;  1ZV8 A;  3KQG A;  3L70 G;  3KXD A;  1VQK P;  2Q5U A;  1KYO I;  2E42 A;  2YXQ B;  2HR3 A;  1GD2 E;  3G9R A;  1SP4 A;  5CJ0 A;  3HD7 D;  4H44 D;  2QG4 A;  4EI2 A;  1GL2 B;  2FYN B;  1L4A A;  3B8E B;  1VQP P;  3A0H H;  1EDK A;  1IK9 A;  3E7K A;  3CXH I;  3H1L J;  1SQX K;  3L74 D;  3FWL A;  1N73 A;  1SQB E;  3ABV C;  3KZI H;  4WY4 B;  5APY A;  3W67 A;  1X8Y A;  3C8V A;  2HG5 D;  1S5L X;  1ZLL A;  2WPR A;  5H2F E;  1NO4 A;  1SQP J;  5CCG C;  3H1K E;  5GTH E;  2E74 B;  4GKG A;  3CC4 P;  2UWJ E;  1GL2 A;  3NMD A;  2E74 D;  4O9B A;  3CCM P;  1XTG B;  3GG2 A;  2A45 I;  4LC1 A;  1GU4 A;  3U59 A;  5AVV B;  1JTH B;  2FYU E;  3F5H A;  1RQU A;  1VDF A;  2WPV B;  2BCC D;  1PPJ D;  3II6 A;  3L75 J;  3L72 J;  4L73 A;  3L70 E;  3VP8 A;  5KLI B;  4LLH A;  4EDF A;  1USE A;  2XZR A;  3BCC G;  4IFF A;  1PFI A;  1VQL P;  1VQM P;  2XNX A;  1KIL C;  2KOG A;  2QE7 H;  3LID A;  3WMM 0;  3HE4 A;  1GDT A;  2AXT H;  3O6Q B;  1S72 P;  1ZP0 C;  4DJG A;  2CPS A;  1OVU A;  3RL0 D;  1M1J B;  2FFD B;  5APQ A;  2M3E A;  4DT0 A;  1SQB G;  1BE3 G;  3H1J D;  1H0T B;  3H1J J;  3A7O A;  1PZQ A;  2H43 A;  1NTZ G;  3SWF A;  1UII A;  1KYO E;  4JPZ B;  1M1K Q;  3AE4 C;  4TLF A;  3O6Q A;  1PV3 A;  3N4X A;  4PJ0 E;  5AW6 B;  4WB4 A;  2OYH C;  2KK7 A;  2KNC A;  4ZNC A;  1Q81 Q;  1SQV K;  2XND H;  4WY4 A;  3C9I A;  3D70 A;  2IYO A;  3A3Y B;  5CJ4 A;  1H8A A;  2POH A;  1AJY A;  1X9V A;  3EWK A;  5TIS E;  2FYZ A;  1FZC C;  1NTK J;  2XKM A;  2BCC J;  1OVV A;  4NPE A;  2WWW A;  1P84 I;  2K3R A;  4WY4 D;  3Q1M A;  1QGK B;  3H1I G;  4JYB A;  4NPD A;  1NU1 J;  2M5A A;  2N1T C;  5AVU B;  1J1E B;  3ZDM A;  1CI6 A;  1L0L J;  3C1L A;  3TYY A;  2E76 B;  3TNU B;  4OGQ C;  2PGD A;  2MJZ A;  2E74 C;  4GDO A;  4I7Z C;  1K04 A;  2OGU A;  2BEQ D;  3VN0 A;  5KJ7 A;  3L73 J;  4PV1 D;  2NRG A;  3T97 A;  2Y9Z A;  1L0L G;  1T3U A;  2G3A A;  2W6A A;  4H0L D;  2IFN A;  1UIX A;  3RK2 B;  1KV4 A;  1N8R Q;  3P8M C;  3G6E P;  4L74 A;  2CK3 H;  1QL1 A;  4GOE A;  2H7H A;  3L71 D;  1NTK G;  1RF1 A;  2ZXX A;  1P84 H;  1M7L A;  1L0L E;  4BRY B;  5AVQ B;  5AVR B;  1AA0 A;  1FAV A;  1SQB K;  2E75 D;  4OVN F;  4YXD C;  1NKZ B;  2P10 A;  1VQ5 P;  1ZW0 A;  2CPB A;  2WTY A;  1FDI A;  2HFE D;  2H88 C;  3VYI A;  1NH4 A;  3QWO C;  2QJP B;  4D6T D;  3V6I A;  1JTH A;  2IPP A;  1PP9 G;  3GHG A;  3WUU A;  1IFI A;  4GT1 A;  1AQ5 A;  4KT0 J;  1NTZ D;  1SQX D;  2IX7 C;  2KZJ A;  1ZOY C;  2IBZ D;  2OYH B;  2I1K A;  3I5C A;  5E79 H;  2KI7 B;  3AEC C;  3LIE A;  5DJU B;  2YKP A;  3PTZ A;  4U3F D;  5B5E E;  1EDL A;  2ZT9 C;  1M1J A;  1TU3 F;  2WSC H;  4PD4 H;  2Y0E A;  1LTA C;  3BAT A;  3SWY A;  1JOC A;  1YBK A;  2BCC E;  1RY3 A;  3B71 A;  1Q90 D;  3T97 B;  3CX5 H;  1LTJ A;  3L72 G;  1N2D C;  1OWA A;  1HVV A;  2N1T B;  2PAJ A;  1NTM E;  1AVO A;  2OTK E;  1JUN A;  1HBW A;  1N7S A;  2V7Q J;  4OGQ B;  1P84 D;  5APW A;  2A45 H;  2AXC A;  3MZW B;  4JQ0 D;  2HPC A;  3VTP C;  1N73 B;  1FOS F;  1BDD A;  4I7Z B;  2ZYG A;  1BSH A;  2PRR A;  1CZQ A;  2WSF H;  5BVZ A;  1DD4 A;  4I1L A;  1L4A B;  5AW2 B;  1JO5 A;  3H1L G;  1M57 D;  2O1J A;  3IR9 A;  2AEF A;  3EQ2 A;  1S9K E;  3AE6 C;  1ZR2 A;  1K9M Q;  1BE3 E;  3A2A A;  4L75 A;  3BRT B;  5AW4 B;  2GA1 A;  4N3Y B;  3FX0 A;  1IFP A;  4C7N A;  2O1K A;  2D2C D;  3L70 J;  1RH5 B;  1SS1 A;  2OAR A;  2N9Y B;  3IAO A;  1NTM G;  5APU A;  2Z5H A;  5AW7 B;  1HGV A;  3MD0 A;  5KKZ B;  3U1C A;  1FDM A;  3FWN A;  1N7L A;  2YKQ A;  1KZU B;  3P8C D;  1OW6 A;  1PL5 A;  1SQV E;  1VF5 C;  1KYO D;  3A0H E;  4IL6 H;  2Q3I A;  4YTP C;  3V2Q A;  1YJW P;  2JWA A;  1ZRT E;  3HTK A;  1E79 H;  2JKV A;  2PFX A;  1LTT C;  2ZT9 D;  3M9Q A;  1LT1 A;  5GTH H;  4YPC A;  1RF0 A;  5H2F H;  3VP9 A;  2HPC B;  1SQV G;  1GW4 A;  2K88 A;  3TGU G;  1SVF A;  2I1J A;  2N1T D;  3PP5 A;  3EFG A;  5B66 H;  1YI2 P;  1DH3 A;  1LTG C;  3CCV P;  1HF9 A;  1SLQ A;  2Q3E A;  1L0N D;  4H0L B;  1R8E A;  2A06 G;  1KQS O;  1NTZ K;  3PLN A;  1JCC A;  1KMI Z;  3CD6 P;  1G1J A;  3PJS K;  4N78 E;  3WUV A;  1GK4 A;  3F89 A;  2FYU D;  4PD4 D;  1HUC A;  3GHG C;  4I6M C;  2WSE J;  4EOT A;  2FXO A;  3A0B E;  2OTJ P;  3B4S A;  3LW5 H;  5GTI E;  2OTL P;  3RBZ A;  4XA4 A;  2Y9Y A;  1L4A C;  2C0W A;  3RK3 B;  4L76 A;  3TGU J;  1HTL C;  3CPW O;  1FOS E;  3GF3 A;  2XDJ A;  3H1K J;  5BU8 B;  3CCL P;  1VQ4 P;  4R4L A;  2O01 J;  3FXD A;  1KYO H;  2WZ7 A;  2W6J H;  3CL3 D;  3Q2Y A;  1SQP D;  2JEE A;  3HTK B;  3MTU E;  4ZKU A;  1LP1 B;  2A06 E;  2Z5I A;  1QLE D;  1PGQ A;  1VPC A;  2B88 A;  2O3J A;  2YMK A;  2OQQ A;  3Q5R A;  3H32 A;  2QJK C;  5CCG D;  3V2N A;  1KN7 A;  1GK6 A;  2FYU G;  1KB9 I;  2M3B A;  2R3S A;  3L73 G;  1VF5 B;  4I2L C;  1OZH A;  2J59 M;  3HD7 B;  2I8D A;  2LKM A;  3BCC E;  3RL0 B;  3TNU A;  1FZA A;  1M8O B;  4C7R A;  1A02 J;  4NPF X;  1EXJ A;  1JCD A;  4ZKP A;  1YHQ P;  1XTC C;  3OA7 A;  2KSE A;  3RK3 E;  3R4Y A;  5AVT B;  2NPS D;  3MGN A;  5KLV D;  5TIS H;  3HUS A;  1SQP E;  2KUB A;  1IC2 A;  3BCC D;  3AE3 C;  4BWN A;  1GL2 D;  4UB8 H;  1S3J A;  4PV1 C;  4GOD A;  1FE6 A;  5KAF H;  2QA4 P;  1VQO P;  2QJY C;  5L8R J;  1ZR4 A;  2OYH A;  4AUW A;  1DIP A;  3GMA A;  1GMJ A;  3L75 E;  1JB0 J;  1MV8 A;  2FYN C;  2K37 A;  1NU1 D;  2QEX P;  1QEX A;  5KLV K;  2ZXE B;  3Q3D A;  1NWQ A;  3D6Y A;  3CI9 A;  3L73 E;  3M9B A;  1NTZ J;  2JDI H;  1SFC A;  2L5G B;  3B5N D;  1H88 A;  1AQT A;  5APS A;  3RK3 C;  2M5A B;  3TGU E;  1BE3 J;  3H32 B;  3WUT A;  1KIL A;  1VQ9 P;  3NTN A;  2Q6Q A;  5AVW B;  1S4X A;  3H1L E;  3NXS A;  4W7Z A;  1L0N E;  1W2E A;  3CX5 D;  2E76 D;  1YJN P;  2R5B A;  3GW6 A;  4WBA A;  5KLI C;  3M06 A;  3BCC J;  4C46 A;  3CCU P;  2K9Y A;  3IFM A;  3L71 J;  3PRJ A;  1WRG A;  2YMY A;  1LWU A;  3MUD C;  4LGD E;  4PD4 E;  2SPZ A;  2W6B A;  5KAI E;  1KIL B;  1WT6 A;  1YQ4 C;  5AW9 B;  3CXH D;  4H44 C;  2WSE H;  1RE4 A;  4RO0 A;  1VQ8 P;  2C9L Y;  3HUS B;  1PPJ E;  3CCE P;  1R5S A;  2P67 A;  1M1J C;  2A45 G;  1SQV D;  2J5U A;  3V5B A;  3G71 P;  3RL0 C;  3RBX A;  1N7S B;  1S5L E;  1CSB A;  1DEB A;  1K05 A;  2M8R A;  2XV5 A;  2NZ2 A;  3RK2 C;  2RMZ A;  5AVS B;  1URQ C;  2XU6 A;  1JNM A;  1NAY A;  1Y9B A;  3JCU H;  1MUU A;  1YTZ I;  2GUS A;  3L75 D;  4M3L A;  1YIT P;  3E1I A;  5B5E H;  3AEG C;  1RF1 C;  1BE3 D;  4Y28 J;  3CC2 P;  2KB7 P;  3V4W A;  1FBM A;  1J1D C;  2HOD B;  3TSI A;  2WT7 A;  2KNC B;  3KDP B;  1A02 F;  1AFO A;  2JJL A;  3WU2 H;  5CHX A;  4AYC A;  2QSI A;  1FZC B;  1EZV D;  1NTK E;  3P32 A;  3P7K A;  5KJ7 C;  2YNY A;  2JP3 A;  2E43 A;  1KIL E;  1KOR A;  2FYU J;  1S1C X;  3GF7 A;  1LP1 A;  1J1E C;  3AE9 C;  3PHL A;  3RK2 D;  2BCC G;  4JF7 A;  3VMY A;  2N1T A;  2D2C C;  1NOH A;  2W83 C;  1EDI A;  3KZI E;  5AW1 B;  2RN0 A;  1L2P A;  1PGJ A;  2OYI B;  3H1K G;  4H13 D;  1PGP A;  3UIA A;  5M1B A;  2WSF J;  3L72 D;  2IZ1 A;  2RKL A;  1BGY D;  1SQB J;  4H44 B;  4U3F E;  4DZO A;  3G4S P;  3H1H J;  3BAS A;  3M0A A;  1OIP A;  2IBZ E;  3S9O A;  3L72 E;  1FC2 C;  3SWK A;  3V2R A;  1ZME C;  2HOD A;  2WT7 B;  4B86 A;  2YIU C;  2LXC B;  2QJP C;  3L70 D;  1JMM A;  1LT9 C;  4D6T E;  1IK7 A;  3MHV A;  3CWB G;  2KP8 A;  3AEF C;  1LWU C;  1U57 A;  2IZ0 A;  2V4H A;  3L75 G;  2PP6 A;  3NFQ A;  1FJK A;  1IZN B;  1LTS C;  1SQV J;  2KLU A;  1OMI A;  3L74 J;  3AE8 C;  5GTI H;  2E75 C;  2KYV A;  2K9J A;  1KQG B;  1Q86 Q;  4KJM A;  1JY2 O;  1VQ6 P;  1NU1 E;  2ZT9 B;  4GIF A;  3L37 A;  3AED C;  2WSS H;  3BVH A;  2AEJ A;  1SQP G;  4XFJ A;  3CLQ A;  2N9B A;  3CWB D;  2C9N Y;  1G2C B;  1GL2 C;  2P2U A;  2WVR A;  1BCC G;  2O01 N;  2OYI A;  1LTI C;  1KB9 D;  1L0L K;  3AE2 C;  2NPS B;  2Z4E A;  3HE5 A;  2H8P D;  1NTM J;  3IF4 A;  4OWF A;  1Q7Y Q;  4QMA A;  1IFM A;  3MIW A;  2WSC J;  5APV A;  1KC8 Q;  3EFF K;  2D2C B;  4EIJ A;  1BGY G;  2P1J A;  3CWB E;  1OX3 A;  4HB1 A;  5APT A;  1G2C A;  2FYU K;  3V4Q A;  1NHL A;  3I56 P;  2BAS A;  3AE1 C;  1GTW A;  2Q7C A;  2OYI C;  2FXP A;  3MUD A;  1IO4 A;  1LTB C;  1KB9 H;  4CPG A;  1P84 E;  2IBZ I;  1G1I A;  1EZV I;  4Z1M H;  1X79 B;  1L0N G;  1SQQ K;  3USS A;  1H89 A;  2YKO A;  1BDC A;  3GLM A;  1FZG A;  2YO3 A;  1QX8 A;  3CCJ P;  1YYC A;  2JR8 A;  4A7P A;  1S9K D;  2P7J A;  1X0T A;  1VL2 A;  1JY3 N;  1RHZ B;  1H0T A;  1Z56 A;  4RES B;  3VMA A;  2FFD C;  2FY8 A;  3L74 G;  5KKZ C;  1GZL A;  2YIU B;  5AW0 B;  1JEK A;  1QL2 A;  1QVG O;  1LT9 B;  1U7J A;  3JSV C;  1RE3 C;  2LXB A;  5CBN A;  3CXH H;  1USD A;  1MZ9 A;  3CWB J;  4HJG H;  3VOP A;  4EYY Q;  1LWU B;  1SQX E;  3K5B A;  3TK1 A;  4IFD K;  4GOF A;  2OYO A;  3LW5 J;  4HH2 A;  5AW5 B;  1NAF A;  4WVZ A;  1PGO A;  1NTM D;  2E75 B;  1FS0 E;  1FU1 A;  1SQP K;  5AVY B;  1WMK A;  1OFC X;  3HD7 A;  1PIX A;  1T2K D;  1ZN5 A;  2RH0 A;  5E79 E;  3Q5S A;  2GUV A;  2QIW A;  3L73 D;  1FDO A;  1HJ0 A;  3B5N C;  5AVX B;  2O01 H;  3M91 A;  2HYN A;  3ITK A;  2ZJS E;  3FXE A;  4IFM A;  4W7Y A;  5CCH A;  3SFD C;  4H0L C;  1PP9 J;  1FZF A;  1KFM A;  4W80 A;  2NPS C;  4MN4 C;  5EFW B;  5APX A;  1T3J A;  1K73 Q;  1M90 Q;  2YO2 A;  2E76 C;  3H1K D;  3L74 E;  3SSU A;  1N7S D;  3CMA P;  5KAI H;  1JY2 N;  2KSJ A;  2JWD A;  2R5D A;  1EZV E;  1NTK D;  3HRN A;  3AEE C;  2WQY C;  4RJT A;  1QVF O;  3RGU A;  2ZFC A;  2Q1K A;  4UB6 E;  3SFE C;  1L0L D;  1L0N K;  1SQQ G;  3L36 A;  1MFZ A;  4Y99 B;  1S5L H;  3CC7 P;  1GW3 A;  2Y0D A;  2WMM A;  1SFC B;  1SQX J;  1LGH B;  3KHU A;  3JCU E;  1DEE G;  2KXP B;  3TF5 A;  2FXM A;  2FFD A;  2QM7 A;  1EC5 A;  3H1I E;  1LNQ A;  2ZVO B;  3TDK A;  4DOJ A;  1VF5 D;  3E1R A;  1BSN A;  1KTM A;  5KLV J;  2JO1 A;  3H1I D;  1YJ9 P;  1KIL D;  1YTZ T;  2ZYA A;  3KYQ A;  4U3F G;  3A5T A;  2H89 C;  3WU2 E;  1FZC A;  1NU1 G;  1N86 A;  1EXI A;  1KFN A;  1SQQ J;  3H1I J;  2R32 A;  3H25 A;  3B5N A;  3RL0 g;  4H13 C;  1FJP A;  1HH0 A;  4U7J A;  3M0D A;  3AE7 C;  3HD7 C;  3MP7 B;  2E5Y A;  1GU5 A;  1CW5 A;  1YIJ P;  1Q2N A;  2LR2 A;  4RKU J;  1JY3 P;  1T2K C;  3H1J E;  2ZYD A;  1SQQ E;  4IL6 X;  4JBZ A;  4IL6 E;  5CCH C;  4TT3 H;  4WWI A;  2V7Q H;  3B5N B;  4ZMD A;  1AVY A;  1RQV A;  2GM4 A;  3D71 A;  1KQL A;  2AXT E;  5KTB A;  4K35 A;  3L71 G;  5AVZ B;  1RE4 C;  3H1J G;  3HE4 B;  1M56 D;  5KJ7 D;  5B66 E;  3H1H E;  3D6Z A;  4PV1 B;  1DX7 A;  4N78 D;  4ASV A;  2QJY B;  2Q9I A;  3AE5 C;  3W68 A;  3H1H D;  4DCK A;  1RE3 A;  3V2P A;  3M9H A;  4PJ0 H;  5TJH A;  1PPJ G;  1JM0 A;  1EQ7 A;  1MKM A;  3R2P A;  3VMX A;  1BGY E;  2Y0C A;  1W2B O;  4YXW H;  3H1L D;  4IOI H;  4Y99 C;  1SQQ D;  1NJI Q;  3A0B H;  1HWT C;  1ZRT D;  1NKN A;  1SFC C;  2B89 A;  5CCG A;  2FBW C;  2W27 A;  1D7M A;  3H6P A;  4HKZ H;  2ZAE B;  1NYH A;  2WIT A;  5C39 A;  4N6J A;  1NTK K;  3IN6 A;  3CME P;  1JY3 O;  1PP9 E;  2HLO A;  2K9J B;  4OGQ D;  1N73 C;  1R5L A;  2ITA A;  1FZE A;  2KZI A;  5KLV E;  4OH8 B;  2E5T A;  1FZB A;  3OAK A;  3RK3 D;  1URQ A;  1EZV G;  3CX5 I;  3M0D C;  3QH9 A;  1E5W A;  4U3F J;  1U7M A;  2YXR B;  2C0X A;  3HUS C;  4H13 B;  5KLV G;  3HE5 B;  1NTM K;  3O8Z A;  3S4R A;  3OW2 O;  1T8Z A;  1N7S C;  2FKW B;  2IDB A;  1BGY J;  1SQB D;  2A06 D;  1S2E A;  4ASW A;  1IFN A;  2K1A A;  5AW8 B;  3CCS P;  4HYT B;  1OVR A;  1SFC D;  1SQX G;  1URQ B;  1KD1 Q;  3I55 P;  1LTJ C;  2IBZ G;  1J2J B;  1Y47 A;  2KIK A;  2W90 A;  2W8Z A;  5K5G B;  1RF1 B;  1CI6 B;  1LT9 A;  2R3C A;  1BCC J;  1NVO A;  1PP9 D;  3N7N A;  4D6T G;  5BU5 A;  1KB9 E;  1J1D B;  1VQ7 P;  2P58 A;  1KQF B;  2QM8 A;  1X22 A;  2DW3 A;  4XE5 B;  1IFJ A;  5CBO A;  1Q82 Q;  4UB8 E;  2WPS A;  3GHG B;  5KAF E;  1Y8A A;  1IFD A;  4K3A A;  2KLV A;  3G3Z A;  1L4A D;  4WY4 C;  1JMB A;  1OXZ A;  3L35 A;  2NPS A;  3OJA B;  1BCC E;  2IYP A;  2R44 A;  3S1K A;  2ZVN B;  2BEZ F;  3CXH E;  3VMZ A;  4C7N B;  3AEB C;  3H1H G;  1NTZ E;  3AEA C;  3CX5 E;  1YQ3 C;  3U1A A;  1DD3 A;  1W5C E;  1NGM B;  3L4F A;  2MKV A; 
#chains in the Genus database with same CATH homology
 4AQR D;  2IFM A;  1HGZ A;  5AW3 B;  2VRS A;  1IJD B;  1URQ D;  3P8C E;  1JY2 P;  4JYC A;  4KHX A;  1RF0 C;  3BRV B;  3KPE A;  5CCG D;  1HJB A;  1LTJ B;  1NU1 K;  5CMZ A;  2J58 A;  2WPQ A;  5CCH D;  1ZV8 A;  3KQG A;  2Q5U A;  2E42 A;  1GD2 E;  1SP4 A;  5CJ0 A;  3HD7 D;  1GL2 B;  1L4A A;  3B8E B;  1IK9 A;  1N73 A;  1SQX K;  4WY4 B;  5APY A;  1X8Y A;  2HG5 D;  1ZLL A;  2WPR A;  5CCG C;  1NO4 A;  4GKG A;  4O9B A;  1GL2 A;  3NMD A;  1XTG B;  2A45 I;  4LC1 A;  1GU4 A;  3U59 A;  5AVV B;  1JTH B;  3RK2 C;  1VDF A;  3II6 A;  3VP8 A;  4LLH A;  2XZR A;  4IFF A;  1PFI A;  2XNX A;  1KIL C;  2KOG A;  3LID A;  3WMM 0;  3HE4 A;  1GDT A;  2CPS A;  3RL0 D;  1M1J B;  2FFD B;  5APQ A;  2H43 A;  3A7O A;  3SWF A;  5AW6 B;  3N4X A;  2OYH C;  4WB4 A;  1SQV K;  4WY4 A;  3C9I A;  3A3Y B;  5CJ4 A;  1H8A A;  2POH A;  1X9V A;  2FYZ A;  1FZC C;  2XKM A;  2WWW A;  4WY4 D;  4JYB A;  2N1T C;  5AVU B;  1J1E B;  1CI6 A;  3TYY A;  3TNU B;  2MJZ A;  3VN0 A;  5KJ7 A;  3T97 A;  1T3U A;  2W6A A;  3RK2 B;  2IFN A;  3P8M C;  1QL1 A;  1RF1 A;  1M7L A;  5AVQ B;  5AVR B;  1FAV A;  1SQB K;  1NKZ B;  2CPB A;  2WTY A;  2HFE D;  3VYI A;  1NH4 A;  1JTH A;  2IPP A;  3GHG A;  1IFI A;  4GT1 A;  1AQ5 A;  2IX7 C;  2OYH B;  2I1K A;  3I5C A;  3LIE A;  2YKP A;  1M1J A;  2WSC H;  1LTA C;  3BAT A;  3SWY A;  1JOC A;  1RY3 A;  1LTJ A;  1N2D C;  1OWA A;  1HVV A;  2N1T B;  1JUN A;  1HBW A;  1N7S A;  5APW A;  1FOS F;  2A45 H;  2HPC A;  1N73 B;  3VTP C;  1CZQ A;  2WSF H;  5BVZ A;  4I1L A;  1L4A B;  5AW2 B;  3IR9 A;  2O1J A;  1S9K E;  3EQ2 A;  1ZR2 A;  3A2A A;  3BRT B;  5AW4 B;  4N3Y B;  4C7N A;  2O1K A;  2OAR A;  5APU A;  2Z5H A;  5AW7 B;  1HGV A;  3MD0 A;  3U1C A;  1FDM A;  1N7L A;  2YKQ A;  1KZU B;  3P8C D;  3V2Q A;  2Q3I A;  3HTK A;  1LTT C;  3M9Q A;  1RF0 A;  3VP9 A;  2HPC B;  1GW4 A;  1DH3 A;  1SVF A;  2I1J A;  2N1T D;  3PP5 A;  3EFG A;  1LTG C;  1SLQ A;  1NTZ K;  1JCC A;  1G1J A;  4N78 E;  1GK4 A;  1HUC A;  3GHG C;  4I6M C;  4EOT A;  3LW5 H;  4XA4 A;  1L4A C;  2C0W A;  3RK3 B;  1HTL C;  1FOS E;  2XDJ A;  5BU8 B;  2WZ7 A;  3CL3 D;  2JEE A;  3HTK B;  3MTU E;  4ZKU A;  2Z5I A;  1VPC A;  3H32 A;  3V2N A;  1GK6 A;  2M3B A;  4I2L C;  3HD7 B;  2J59 M;  2LKM A;  3RL0 B;  3TNU A;  1FZA A;  1A02 J;  4C7R A;  1JCD A;  4ZKP A;  1XTC C;  3OA7 A;  5AVT B;  2NPS D;  3MGN A;  3HUS A;  1IC2 A;  1GL2 D;  2OYH A;  4AUW A;  1ZR4 A;  1MV8 A;  5KLV K;  2ZXE B;  1NWQ A;  3CI9 A;  3M9B A;  2L5G B;  1SFC A;  3B5N D;  1H88 A;  5APS A;  3RK3 C;  3H32 B;  1KIL A;  3NTN A;  5AVW B;  3NXS A;  4W7Z A;  1W2E A;  2R5B A;  4WBA A;  3M06 A;  4C46 A;  3IFM A;  4LGD E;  2H7H A;  1WRG A;  2YMY A;  1LWU A;  2W6B A;  1KIL B;  1WT6 A;  5AW9 B;  2WSE H;  1RE4 A;  2C9L Y;  3HUS B;  2P67 A;  1M1J C;  2A45 G;  3V5B A;  3RL0 C;  1N7S B;  1CSB A;  1DEB A;  2M8R A;  2XV5 A;  5AVS B;  1URQ C;  2XU6 A;  1JNM A;  1MUU A;  1YTZ I;  2GUS A;  4M3L A;  3E1I A;  1RF1 C;  2KB7 P;  3V4W A;  1FBM A;  1J1D C;  2HOD B;  3TSI A;  2WT7 A;  1A02 F;  3KDP B;  1AFO A;  2JJL A;  5CHX A;  4AYC A;  1FZC B;  3P32 A;  3P7K A;  5KJ7 C;  2YNY A;  2E43 A;  1J1E C;  3RK2 D;  4JF7 A;  3VMY A;  2N1T A;  1NOH A;  5AW1 B;  2OYI B;  3UIA A;  4DZO A;  3BAS A;  3M0A A;  3V2R A;  2HOD A;  2WT7 B;  4B86 A;  1JMM A;  1LT9 C;  2KP8 A;  1LWU C;  2Z4E A;  2PP6 A;  3NFQ A;  1FJK A;  1LTS C;  2KYV A;  1JY2 O;  4GIF A;  3L37 A;  3BVH A;  3CLQ A;  2N9B A;  2C9N Y;  1G2C B;  1GL2 C;  2P2U A;  2OYI A;  1LTI C;  1L0L K;  2NPS B;  3HE5 A;  2H8P D;  1IFM A;  3MIW A;  5APV A;  4EIJ A;  2P1J A;  5APT A;  1G2C A;  2FYU K;  3V4Q A;  1NHL A;  2BAS A;  1GTW A;  2OYI C;  2Q7C A;  1IO4 A;  3MUD A;  1LTB C;  1G1I A;  1X79 B;  1SQQ K;  1H89 A;  2YKO A;  1FZG A;  2YO3 A;  1YYC A;  1S9K D;  2P7J A;  1JY3 N;  1Z56 A;  4RES B;  2FFD C;  1GZL A;  5AW0 B;  1QL2 A;  1LT9 B;  1RE3 C;  1MZ9 A;  3VOP A;  1LWU B;  3TK1 A;  4IFD K;  5AW5 B;  4HH2 A;  1NAF A;  5AVY B;  1FU1 A;  1SQP K;  3HD7 A;  1T2K D;  1ZN5 A;  2GUV A;  3B5N C;  5AVX B;  2O01 H;  3M91 A;  2HYN A;  1JO5 A;  5CCH A;  1FZF A;  4IFM A;  4W7Y A;  1KFM A;  4W80 A;  2NPS C;  5APX A;  1T3J A;  2YO2 A;  1N7S D;  1JY2 N;  2KSJ A;  2R5D A;  3HRN A;  2ZFC A;  1L0N K;  3L36 A;  1MFZ A;  4Y99 B;  1GW3 A;  1SFC B;  1LGH B;  2FXM A;  2FFD A;  2QM7 A;  4DOJ A;  1KIL D;  1YTZ T;  3KYQ A;  3A5T A;  1FZC A;  1N86 A;  1KFN A;  2R32 A;  3B5N A;  1FJP A;  1HH0 A;  3M0D A;  3HD7 C;  1GU5 A;  1CW5 A;  1JY3 P;  1T2K C;  5CCH C;  3B5N B;  2GM4 A;  1KQL A;  5KTB A;  5AVZ B;  1RE4 C;  3HE4 B;  5KJ7 D;  1DX7 A;  4N78 D;  2Q9I A;  1RE3 A;  3V2P A;  3M9H A;  1EQ7 A;  3R2P A;  3VMX A;  4Y99 C;  1HWT C;  1NKN A;  1SFC C;  5CCG A;  2W27 A;  3H6P A;  2WIT A;  4N6J A;  1NTK K;  1JY3 O;  2HLO A;  1N73 C;  1FZE A;  4OH8 B;  1FZB A;  3OAK A;  3RK3 D;  1URQ A;  3M0D C;  1E5W A;  2C0X A;  3HUS C;  3HE5 B;  1NTM K;  3O8Z A;  1T8Z A;  1N7S C;  2FKW B;  1IFN A;  5AW8 B;  4HYT B;  1SFC D;  1URQ B;  1LTJ C;  1J2J B;  1RF1 B;  1CI6 B;  1LT9 A;  2R3C A;  3N7N A;  5BU5 A;  1J1D B;  2QM8 A;  4XE5 B;  1IFJ A;  2WPS A;  3GHG B;  1IFD A;  2KLV A;  3G3Z A;  1L4A D;  4WY4 C;  1OXZ A;  3L35 A;  2NPS A;  3OJA B;  3VMZ A;  4C7N B;  3U1A A;  2PAJ A;  3L4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...