3BASA

Crystal structure of the n-terminal region of the scallop myosin rod, monoclinic (c2) form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
80
structure length
80
Chain Sequence
ARQEEEMKEQLKQMDKMKEDLAKTERIKKELEEQNVTLLEQKNDLFGSMKQLEDKVEELLSKNYHLENEVARLKKLVGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Contractile protein
molecule keywords Myosin heavy chain, striated muscle/General control protein
publication title An unstable head-rod junction may promote folding into the compact off-state conformation of regulated myosins.
pubmed doi rcsb
source organism Argopecten irradians
total genus 40
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3basA00
4ZKUA 4ZKPA 5BU5A 3U1AA 4O9BA 1WT6A 4N3YB 3BATA 4GIFA 3U59A 3C9IA 1NKNA 3OJAB 5BVZA 3N4XA 3U1CA 3HRNA 3P8CD 2JEEA 4N78D 3BASA 1X79B 4I1LA 1IC2A 3VP9A 2POHA 5BU8B 3N7NA 5KTBA 3VP8A 2FXMA
chains in the Genus database with same CATH superfamily
1QX8A 3EWKA 1PP9J 5CCGD 3ZDMA 1N73C 2OTLP 3M9BA 3H1IJ 1J1EB 3D6YA 2B9BA 4M3LA 1P84D 1LT9B 2XNXA 3WUUA 3FWLA 1LTJC 1NH4A 3T97A 3FX0A 2V7QH 2Q3EA 5APXA 5CBNA 5KTBA 1LP1A 4L75A 1E5WA 2A45I 1GL2D 2ZT9B 1ZW0A 2P2UA 3IAOA 3M0DC 2WQYC 2M5AA 3HD7A 4W7ZA 5E79H 3L70D 2Q5UA 1PP9G 1L4AA 1SQQD 3AE1C 4PD4H 1SQBD 3GW6A 1N7SD 2OYHA 3H1IG 1N86A 1KORA 1KILD 2H43A 3AEDC 2OGUA 5AW3B 2KB7P 2A45G 3L73D 2CK3H 3GG2A 2LKMA 5APTA 5AVRB 3P8CD 1ZR2A 4H0LC 1MFZA 2POHA 5AW1B 3BCCE 1S72P 5CCGA 1M8OB 3JCUH 1SQPK 3RL0B 2KP8A 1BGYD 3V2NA 4RO0A 2M0BA 2FXOA 1CI6B 2ITAA 3Q5RA 3VMAA 2WSSH 2KZIA 1HWTC 1H8AA 1OXZA 2HPCB 1DEEG 1YTZI 3H1HD 4ZKUA 3RK3B 5BU5A 3UIAA 1JM0A 4L73A 1JO5A 1KQSO 1IK7A 1S1CX 3RGUA 1IC2A 3MZWB 1GL2A 1Y9BA 3L75D 2AXTE 1JTHB 5KLVE 3M0AA 3CXHH 4XE5B 3HE5A 4C46A 2QIWA 3LW5J 2JWDA 5K5GB 1LTBC 3GF3A 2B87A 2V4HA 1NAFA 2IYOA 3L36A 5AVQB 1S2EA 2YKPA 3TSIA 4KT0J 2L5GB 1NHLA 4BRYB 2LXCB 3L71E 1YJNP 2E74C 1PGPA 1U57A 1T8ZA 1FZFA 3M91A 1RE3C 3AE5C 5APQA 2PP6A 1W2BO 1SQVD 4WVZA 4U3FD 2GUVA 2A06G 1BCCE 2XZRA 4LGDE 3C8VA 1JY3P 3CCUP 1VPCA 1S5LX 3F5HA 2W83C 1S5LH 3CC4P 3MGNA 1RQUA 3L74E 1FS0E 5KKZC 3JC22 3V2PA 4B86A 1X79B 3H1LD 3RK2D 3HD7C 3S1KA 3LIDA 5AVWB 1L4AC 3PTZA 4U7JA 2KLUA 2L91A 1H0TA 2OYHC 1L0LK 2RN0A 4W80A 4GODA 4NPEA 3CLQA 4PD4D 2ZVOB 2OYIB 4PV1C 4RESB 1NTKD 1YQ3C 5CCHA 2WPRA 1QL2A 1S3JA 1EDJA 3P8MC 1NTZD 1YQ4C 2FYUE 5CCGC 1FZCA 3KPEA 2YMKA 2MKVA 2IBZD 5AVUB 4N78E 2W90A 1WMKA 1FDIA 2IYPA 1CW5A 3Q5PA 1GDTA 3L74J 1KYOH 4D6TD 1OVRA 5GTHE 2PGDA 1VF5D 1VQOP 2IX7C 2R5DA 3S4RA 1Q90D 2N1TA 4WB4A 5GTIH 1MZ9A 2C0WA 4Y99B 3SFEC 4EOTA 4R4MA 4GDOA 1P84E 1KB9H 1FU1A 2Y9ZA 1GL2C 1QL1A 1BCCG 3C9IA 1U7MA 2HLOA 4H0LD 1CZQA 2JEEA 1Q7YQ 4IFFA 4WY4B 4QMAA 3VN0A 2C9LY 3CXHD 1BDCA 2FFDA 1FDMA 1BSNA 3E7KA 1KILC 1N73B 2WSCJ 3TGUD 1SP4A 3L70E 3EFFK 3L74G 1T3UA 1SQQE 1EZVD 3TNUA 2OTJP 1SQBE 3HE4B 1JMMA 4L74A 1KILE 1KB9I 3B5NB 4L76A 4GT1A 4OH8B 1DD3A 3L72D 1SQXK 1LTJB 4EYYQ 2WSFJ 3L73E 3E1IA 3KDPB 4YXWH 1NU1J 2NRGA 3NTNA 4EDFA 3P8CE 2KUBA 2YXQB 2M3EA 1AVOA 4ASWA 3A0HH 3WUTA 4BWNA 1BGYE 1JEKA 1NU1K 2QVAA 2WSEH 1KC8Q 2OARA 4OWFA 1RF0A 2I8DA 1GU4A 3CX5D 1VQ4P 4OGQD 1L2PA 4C7NB 3H1HE 2KNCB 1ZRTD 1PZQA 1FZGA 5KAIE 1SQQJ 4HYTB 4GIFA 5DJTB 1SQBJ 3W67A 5M1BA 1Q86Q 5APVA 2PFXA 3HRNA 1NU1G 3KXDA 4K3AA 1IZNB 1IFMA 3L75E 1M1JA 3ITKA 3WMM0 3L73J 3AEBC 3WU2E 2O01H 3GMAA 3CCQP 1GZLA 3ABVC 2HR3A 1LWUA 1PFIA 2E76C 1BGYJ 1KMIZ 3D6ZA 1FZCC 5KLIB 1QVFO 1NAYA 2NPSA 2Z5HA 1MFTA 1ZLLA 3FWNA 3H32A 3CD6P 4UB6E 1SQQG 4DZOA 2BCCD 3CCJP 3HD7D 1SQBG 1XTGB 3PRJA 1SQVE 1FZBA 1JB0J 3MTUE 3O8ZA 3QWOC 1KYOD 4U3FE 4JYBA 4JBZA 2WPSA 3L73G 1G2CA 2N1TC 1DIPA 2Z5IA 4PV1D 3RL0g 3P32A 1FZEA 1ZN5A 5APSA 1IK9A 1T6AA 2QG4A 4CPGA 3KZIE 1OW6A 3RK2C 1BGYG 2H89C 3H6PA 2E74B 1RF1B 5AW8B 2WT7B 3HTKA 2A45H 2FFDC 3CL3D 3H1LE 2J5UA 4IFMA 1S9KD 1LTIC 1FJKA 1SS1A 2M3BA 3IR9A 3H1HG 3H1JD 2KLVA 3V2QA 4NPDA 2FBWC 2KZJA 2E5TA 3GHGC 1URQD 4LLHA 4I6MC 4GOFA 3OW2O 1Q2NA 1AQ5A 1MV8A 1NTKE 5AW9B 1A02F 1K9MQ 1OVUA 1NTMJ 3TK1A 3F89A 5B5EH 1HF9A 1M56D 3E1RA 3OA7A 5APYA 1NTZE 1YJWP 5KKZB 2IBZE 3MD0A 1NTMK 1OW7A 3GF7A 3JCUE 1VF5C 4I1LA 2G3AA 2Y9YA 1L4AB 1OX3A 2CPBA 2D2CC 3SSUA 1OFCX 2OYHB 1RF0C 4D6TE 3A2AA 3MUDA 4GKGA 1YHQP 2GUSA 2YNYA 1BE3D 1GW4A 1HGVA 1WRGA 1Y8AA 5AVTB 1SQVG 2KYVA 4JF7A 1JY2N 2B89A 5AW7B 1EC5A 3FXEA 1NTMG 2R3SA 4BXLA 2FYZA 1WT6A 2WZ7A 3VMYA 1M1JC 1FC2C 1Y47A 2YO2A 3G9RA 1NTKJ 3EFGA 3CXHE 1GK4A 1EDKA 1CI6A 3TGUE 1URQA 1NGMB 4H44D 3VMXA 2YXRB 3O6QB 1EZVE 1K8AQ 1KFNA 1PPJD 5AVYB 2HPCA 1IFJA 3LW5H 2NPSC 4D6TJ 4HJGH 3L72E 1GL2B 1L0ND 4ZNCA 4O9BA 4YXDC 3HUSB 2J58A 1HVVA 3D70A 4I7ZC 1NJIQ 4W7YA 1JTHA 3BCCJ 1N7SB 1NTKG 1KILB 4OGQC 1OMIA 3AEGC 2XNDH 1PGQA 1VQKP 3VYIA 5CCHD 4PJ0H 3BRVB 2IBZG 2E76D 3CX5E 1K73Q 1GW3A 3H1ID 1RHZB 1ZRTE 3TGUJ 4BRYA 2AXTH 2SPZA 4D6TG 2R3CA 1HJBA 3U59A 1D7MA 2AEMA 4DOJA 1X0TA 5AW6B 2B88A 2IZ1A 3M06A 1KZUB 3AE9C 1YJ9P 5KLVJ 1YI2P 1OIPA 3FXDA 1AFOA 2FY8A 3BCCG 2QM8A 1K04A 2N1TD 2HODA 3WUVA 2JKVA 2FYNC 5AW0B 1LNQA 2YMYA 5KLVK 1KD1Q 1EXIA 1FBMA 1M57D 2FXMA 4OVNF 2FXPA 4KJMA 3PLNA 5KAFH 3M9QA 1LTSC 2K9YA 3TGUG 3L71J 4DCKA 2KIKA 1JCCA 2BCCE 1EZVG 1Z56A 1SQPD 3NFQA 4Z1MH 2YKQA 1DH3A 3RBZA 3MUDC 1KYOE 5KLVG 1BCCJ 4ZMDA 1T2KC 2OYIA 3L4FA 1VDFA 2R5BA 3P7KA 4HH2A 1N8RQ 4N6JA 1K05A 1FZCB 2RH0A 2WPVB 3VTPC 4XA4A 3R4YA 1SLQA 1NOHA 2QSIA 5H2FH 1QGKB 3Q3DA 3USSA 3L71G 1NYHA 1S9KE 2D2CD 3TYYA 1URQC 3B71A 3H1JE 1YYCA 2N9YB 5B66E 5CJ4A 3AECC 3PH0A 1HGZA 2BCCJ 2QA4P 2WVRA 3RK3C 2A06D 1IFIA 1XTCC 5BVZA 1KQLA 5AVXB 1VQ5P 3V2RA 2C9NY 4UB8E 4H13D 3RK2B 2WSCH 2XKMA 1JY3N 3B4SA 1HTLC 1MKMA 2FYUJ 2FFDB 2K9JA 2QRXA 4WY4A 1U7JA 1GTWA 1YTZT 2WSFH 1YBKA 1GD2E 1N7LA 2C0XA 2IZ0A 3TNUB 2FYUK 2MJZA 5TISE 2Y0DA 1M7LA 2JJLA 1QLED 2I1JA 3GHGB 3AE2C 3RBXA 2XU6A 3HE4A 3L37A 1H89A 3CCVP 2BCCG 3B5NA 1ZOYC 2NPSD 1BE3E 3H1JJ 1AV1A 5AVZB 4A7PA 1RE4A 1E79H 4IL6E 2WTYA 3BATA 1SFCD 3JSVC 3QH9A 1MUUA 1VF5B 2FYUG 5APWA 2BEQD 4H44C 1L0LD 1LT1A 2E5YA 2IPPA 3CC2P 1P84I 2I1KA 3AE6C 3L70J 1LTAC 3CC7P 2K37A 2W8ZA 1PPJE 1T3JA 2E75D 4H0LB 1GMJA 4C7NA 3K5BA 2KNCA 1FOSF 2P10A 4IOIH 4YTPC 3H1JG 1JOCA 4HB1A 1SQQK 1L0NE 1J2JB 1SQBK 3A3YB 1BE3J 3V5BA 2KS1B 3SWYA 4C7RA 5C39A 3CCMP 5CCHC 2P7JA 2W27A 1VQ9P 4AYCA 2JO1A 2QJPC 2OYIC 2WWWA 3AE4C 1ZMEC 2G8YA 2WITA 4KHXA 5KAIH 3L70G 3I5CA 1YIJP 4JYCA 4XFJA 3H1HJ 1NVOA 3H1IE 1IFPA 2YIUC 3CWBD 1JUNA 5CBOA 1SFCA 5KJ7A 2ZT9D 4TLFA 2O1JA 4I7ZB 1NO4A 2ZFCA 3AE8C 2ZXXA 3WU2H 3N4XA 3L75J 1BE3G 4OGQB 1TU3F 5AVSB 1L0NJ 3CPWO 2IFNA 5EFWB 2Q3IA 4EI2A 1KB9D 2HG5D 1T2KD 1JY2O 2UWJE 3TDKA 4Y99C 1VQ8P 4DT0A 1Q82Q 5B5EE 3HTKB 3I56P 1N2DC 1SQXD 4UB6H 4GOEA 3A0BH 3SWFA 1FDOA 1RF1A 2WT7A 4WY4C 5E79E 2R32A 3RL0D 2XDJA 2ZVNB 3H1KD 1RE3A 1QEXA 1ZV8A 1PPJG 1SQPE 3V4QA 4PD4E 1OWAA 2O01N 2RMZA 2H7HA 3SWKA 1FJPA 1SQVJ 1NU1D 3AE3C 2VRSA 5DJUB 3PHLA 3N7NA 3T97B 1AQTA 3L75G 4U3FJ 1LT9A 3B5NC 1L0NG 2FYNB 4RKUJ 3KZIH 3RK3D 2WPQA 1KN7A 2W6JH 3MP7B 1LP1B 3NXSA 2ZYAA 1SQVK 3S9OA 5CMZA 3AEFC 2M5AB 1RE4C 3HD7B 1JMBA 1FZAA 1DX7A 2FKWB 2OYOA 3KHUA 3CCRP 2CPSA 2KOGA 2N9BA 1H88A 2V7QJ 3H1LJ 2H8PD 1PV3A 2WMMA 4PV1B 1M1KQ 4H13C 1FE6A 2NZ2A 2LR2A 2YO3A 1AJYA 4U3FG 1SQPJ 2A06E 1QVGO 4Y28J 4WWIA 3V6IA 3IN6A 2YKOA 1USEA 2H88C 1PIXA 4JPZB 1J1DC 1BDDA 1NTZJ 1VQNP 2OQQA 2GA1A 1LWUC 3GLMA 1NTKK 1OW8A 1R5SA 4PD4I 1Q81Q 1URQB 1NTZK 2AXCA 3H1LG 3IF4A 1R5LA 3O6QA 2QJYC 4PJ0E 3VOPA 5KLIC 1IO4A 2Z4EA 2IFMA 2IBZI 3HE5B 1SQPG 1ZXGA 5KJ7C 1SFCC 2W6BA 1NKZB 3VP9A 1KTMA 1GU5A 4NPFX 2B87B 2JP3A 2ZJSE 2K3RA 3HUSA 2Q7CA 3Q1MA 1NTZG 5L8RJ 3CCEP 1N7SA 3AEAC 1PP9D 1KILA 2O1KA 2KI7B 3Q5SA 2E75C 1KQFB 1L0LE 3VMZA 2OTKE 1S5LE 2ZYGA 3G6EP 2QJKC 2HYNA 3CMEP 1X22A 1CSBA 1RF1C 3CCSP 2AEFA 1JNMA 3CXHI 4ASVA 1HH0A 3L72J 1S4XA 5KAFE 1J1EC 2PAJA 2JR8A 2XV5A 1NTMD 3U1AA 2QM7A 4H44B 4WBAA 1EZVI 3TF5A 1NKNA 1LT9C 2KSJA 2HODB 2AEJA 2ZYDA 3CX5H 3V4WA 4IFDK 3BVHA 1JY3O 4YPCA 2DW3A 2ZT9C 1ZP0C 3AE7C 1L0LJ 1H0TB 1HUCA 1HJ0A 3SFDC 1G1JA 5AVVB 4WY4D 1IFDA 1VL2A 3CWBE 3D71A 3L72G 5H2FE 2LXBA 3MIWA 3C1LA 1VQMP 3OAKA 5AW5B 3CX5I 2E76B 1USDA 1EDIA 1EDLA 2QJPB 5GTIE 3BRTB 1RY3A 3B5ND 1KB9E 2K88A 1X9VA 1AVYA 4N3YB 3RL0C 2P1JA 3U1CA 2BEZF 1FOSE 1EXJA 2GM4A 1SQXE 3CMAP 2YIUB 1L0LG 1YITP 3H1KE 2N1TB 1VQ7P 3AEEC 2P58A 1SVFA 1NU1E 3CWBJ 1GK6A 2P67A 1LGHB 3BCCD 3G4SP 3RK3E 1RQVA 3CI9A 3MHVA 2K1AA 5CJ0A 3G3ZA 4TT3H 5GTHH 3HUSC 2K9JB 3A0HE 3EQ2A 1LTTC 4JQ0D 1KYOI 1N73A 1IJDB 1N7SC 3VP8A 3A5TA 2Q9IA 2Q1KA 1AA0A 1W5CE 3NMDA 5B66H 3KQGA 1P84H 1SQXJ 3II6A 3H25A 1VQPP 3R2PA 5AW2B 2E42A 3M9HA 4DJGA 1PL5A 3H1KJ 3GHGA 4UB8H 1LTJA 3CWBG 4LC1A 5KLVD 4ZKPA 2RKLA 1VQ6P 3KYQA 3W68A 3LIEA 1DD4A 5KJ7D 4I2LC 4AQRD 3OJAB 2JWAA 3I55P 3M0DA 2D2CB 1OVVA 3FGAD 1PGJA 1BSHA 2KXPB 5TISH 4RJTA 3L71D 1M90Q 1SQXG 5TJHA 1KQGB 4H13B 2Y0CA 2WSEJ 1JCDA 2M8RA 2IDBA 2KK7A 1UIXA 3H1KG 1R8EA 1IFNA 1M1JB 1X8YA 2E74D 4IL6X 4IL6H 1BCCD 1J1DB 3L35A 1HBWA 2J59M 3PP5A 2PRRA 3IFMA 1PGOA 1LWUB 3A7OA 2KS1A 2W6AA 1LTGC 1PP9E 2KSEA 4R4LA 2NPSB 1W2EA 3L74D 4EIJA 3H32B 2QJYB 5APUA 2ZXEB 2O01J 1VQLP 1DEBA 2Q6QA 1ZR4A 3G71P 5AW4B 1UIIA 1SFCB 1EQ7A 1RH5B 2Y0EA 3A0BE 3CCLP 1A02J 1KFMA 3BASA 1G1IA 3B8EB 1G2CB 1JY2P 4K35A 1L4AD 2E43A 2R44A 2O3JA 2HFED 1FAVA 1NTME 1KV4A 4MN4C 1LJ2A 2JDIH 4AUWA 2FYUD 2E75B 3Q2YA 5CHXA 1L0NK 2ZAEB 2QE7H 2QEXP 4N78D 5BU8B 2QJKB 4HKZH 1NWQA 1OZHA 3PJSK 2BASA
chains in the Genus database with same CATH topology
1NU1K 3VOPA 1T2KC 5CCGD 2WSEH 1IO4A 2Z4EA 2IFMA 2OYIA 3L4FA 1N73C 2OARA 3HE5B 1VDFA 2R5BA 3M9BA 1RF0A 1SFCC 2W6BA 3P7KA 5KJ7C 4HH2A 1GU4A 4N6JA 1NKZB 1FZCB 1J1EB 3VP9A 1GU5A 4C7NB 4M3LA 3HUSA 2Q7CA 3VTPC 4XA4A 1FZGA 1LT9B 1SLQA 1NOHA 2XNXA 4HYTB 4GIFA 1N7SA 1LTJC 1NH4A 3T97A 5APVA 1KILA 2O1KA 3HRNA 1S9KE 3TYYA 1URQC 1IFMA 5APXA 1M1JA 3VMZA 5KTBA 3WMM0 1YYCA 1E5WA 5CJ4A 2A45I 1GL2D 2HYNA 1HGZA 2P2UA 3M0DC 4W7ZA 3HD7A 2O01H 3RK3C 1IFIA 1CSBA 1XTCC 2Q5UA 1GZLA 1RF1C 1JNMA 5BVZA 1L4AA 1KQLA 5AVXB 3V2RA 2C9NY 1LWUA 1PFIA 3RK2B 1HH0A 2WSCH 1N7SD 2OYHA 2XKMA 1N86A 1KILD 2H43A 1JY3N 1FZCC 1J1EC 2PAJA 2XV5A 1HTLC 2NPSA 2Z5HA 5AW3B 1ZLLA 2KB7P 3U1AA 2A45G 2QM7A 4WBAA 2FFDB 2LKMA 3H32A 1NKNA 1LT9C 4WY4A 1GTWA 2KSJA 5APTA 5AVRB 1YTZT 4DZOA 2HODB 3HD7D 3P8CD 1ZR2A 2WSFH 1GD2E 1N7LA 2C0XA 1MFZA 2POHA 5AW1B 1XTGB 3V4WA 3TNUB 5CCGA 4IFDK 2FYUK 2MJZA 3BVHA 1FZBA 1SQPK 1JY3O 3MTUE 3O8ZA 3RL0B 2KP8A 3V2NA 1M7LA 2JJLA 2I1JA 3GHGB 4JYBA 2WPSA 2XU6A 3HE4A 1G2CA 3L37A 2N1TC 1CI6B 1H89A 3B5NA 2NPSD 2Z5IA 1HUCA 3P32A 1FZEA 1ZN5A 5APSA 1G1JA 1IK9A 5AVVB 4WY4D 1HWTC 1IFDA 5AVZB 1H8AA 1OXZA 2HPCB 3RK2C 1YTZI 1RE4A 4ZKUA 3RK3B 5BU5A 3H6PA 3MIWA 1RF1B 2WTYA 5AW8B 2WT7B 3BATA 3HTKA 1SFCD 3UIAA 1MUUA 2A45H 5APWA 3OAKA 5AW5B 1JO5A 2FFDC 3CL3D 4IFMA 1S9KD 1IC2A 1LTIC 1GL2A 3BRTB 1RY3A 3B5ND 1FJKA 2IPPA 1JTHB 1X9VA 2M3BA 3IR9A 3M0AA 2I1KA 4XE5B 2KLVA 3HE5A 3V2QA 1LTAC 4C46A 4N3YB 3RL0C 1LTBC 1T3JA 3GHGC 2P1JA 1URQD 3U1CA 4LLHA 4C7NA 4I6MC 1FOSE 2GM4A 1FOSF 1AQ5A 1MV8A 5AW9B 1A02F 1NAFA 3TK1A 3L36A 5AVQB 3OA7A 5APYA 1JOCA 1SQQK 2YKPA 1J2JB 3TSIA 1SQBK 3A3YB 2N1TB 2L5GB 3V5BA 3SWYA 1NHLA 4C7RA 3MD0A 1NTMK 1SVFA 5CCHC 2P7JA 1T8ZA 2W27A 1FZFA 4I1LA 1GK6A 4AYCA 3M91A 1L4AB 2CPBA 1RE3C 2P67A 2OYIC 1LGHB 5APQA 2WWWA 2PP6A 2OYHB 1RF0C 3CI9A 2GUVA 2WITA 5CJ0A 3A2AA 4KHXA 3MUDA 3G3ZA 3I5CA 4GKGA 4JYCA 2XZRA 2GUSA 3HUSC 2YNYA 4LGDE 3EQ2A 1JY3P 1LTTC 1GW4A 1HGVA 1WRGA 1N73A 1IJDB 1N7SC 5AVTB 3VP8A 3A5TA 2KYVA 4JF7A 1JUNA 1JY2N 2Q9IA 5KJ7A 1SFCA 1VPCA 5AW7B 3NMDA 2O1JA 2FYZA 1WT6A 2WZ7A 3KQGA 3VMYA 1NO4A 3MGNA 1M1JC 3II6A 2ZFCA 2YO2A 3N4XA 5AVSB 3V2PA 4B86A 3R2PA 1X79B 3EFGA 5AW2B 3RK2D 3HD7C 2E42A 3M9HA 3GHGA 1LTJA 3LIDA 4LC1A 2IFNA 1GK4A 2Q3IA 1T2KD 2HG5D 5AVWB 1JY2O 1L4AC 4ZKPA 1CI6A 3KYQA 4Y99C 1URQA 3LIEA 3VMXA 1L0LK 2OYHC 4W80A 5KJ7D 4I2LC 4AQRD 3OJAB 1KFNA 3CLQA 5AVYB 2HPCA 3HTKB 1IFJA 3M0DA 3LW5H 1N2DC 2NPSC 2OYIB 3SWFA 4RESB 1RF1A 2WT7A 4WY4C 5CCHA 2WPRA 2R32A 1GL2B 1QL2A 3RL0D 2XDJA 3P8MC 4O9BA 1RE3A 1ZV8A 3HUSB 5CCGC 1FZCA 3KPEA 2J58A 1HVVA 3V4QA 1OWAA 4W7YA 5AVUB 4N78E 2H7HA 1JTHA 1FJPA 1N7SB 2VRSA 1JCDA 3N7NA 2M8RA 1KILB 1LT9A 1CW5A 3B5NC 1GDTA 3RK3D 2WPQA 1IFNA 1M1JB 1X8YA 3VYIA 3NXSA 5CCHD 3BRVB 1SQVK 1J1DB 2IX7C 5CMZA 2R5DA 3L35A 1RE4C 3HD7B 1HBWA 2J59M 3PP5A 3IFMA 1GW3A 1FZAA 2N1TA 4WB4A 1DX7A 1MZ9A 1LWUB 2C0WA 3A7OA 4Y99B 4EOTA 2FKWB 2CPSA 2KOGA 2N9BA 2W6AA 1FU1A 2R3CA 1HJBA 1H88A 1LTGC 1GL2C 1QL1A 3U59A 3C9IA 2H8PD 4DOJA 2HLOA 2NPSB 1W2EA 5AW6B 1CZQA 3M06A 2JEEA 1KZUB 4EIJA 3H32B 4IFFA 4WY4B 5APUA 2ZXEB 3VN0A 2C9LY 1AFOA 1DEBA 1ZR4A 2FFDA 1FDMA 2QM8A 2YO3A 1KILC 5AW4B 1N73B 2N1TD 2HODA 1SP4A 1SFCB 1EQ7A 5AW0B 2YMYA 5KLVK 1T3UA 1A02J 3TNUA 2YKOA 1KFMA 3BASA 3HE4B 1G1IA 1FBMA 3B8EB 1JMMA 1G2CB 1J1DC 1JY2P 3B5NB 1L4AD 2E43A 4GT1A 4OH8B 2FXMA 2HFED 1FAVA 1SQXK 3M9QA 1LTJB 1LTSC 1LWUC 1NTKK 3E1IA 3KDPB 4AUWA 1JCCA 3NTNA 1URQB 3P8CE 1Z56A 5CHXA 1L0NK 1NTZK 3NFQA 4N78D 5BU8B 1NWQA 2YKQA 1DH3A 2BASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKU A;  4ZKP A;  5BU5 A;  3U1A A;  4O9B A;  1WT6 A;  4N3Y B;  3BAT A;  4GIF A;  3U59 A;  3C9I A;  1NKN A;  3OJA B;  5BVZ A;  3N4X A;  3U1C A;  3HRN A;  3P8C D;  2JEE A;  4N78 D;  3BAS A;  1X79 B;  4I1L A;  1IC2 A;  3VP9 A;  2POH A;  5BU8 B;  3N7N A;  5KTB A;  3VP8 A;  2FXM A; 
#chains in the Genus database with same CATH topology
 1QX8 A;  3EWK A;  1PP9 J;  5CCG D;  3ZDM A;  1N73 C;  2OTL P;  3M9B A;  3H1I J;  1J1E B;  3D6Y A;  2B9B A;  4M3L A;  1P84 D;  1LT9 B;  2XNX A;  3WUU A;  3FWL A;  1LTJ C;  1NH4 A;  3T97 A;  3FX0 A;  2V7Q H;  2Q3E A;  5APX A;  5CBN A;  5KTB A;  1LP1 A;  4L75 A;  1E5W A;  2A45 I;  1GL2 D;  2ZT9 B;  1ZW0 A;  2P2U A;  3IAO A;  3M0D C;  2WQY C;  2M5A A;  3HD7 A;  4W7Z A;  5E79 H;  3L70 D;  2Q5U A;  1PP9 G;  1L4A A;  1SQQ D;  3AE1 C;  4PD4 H;  1SQB D;  3GW6 A;  1N7S D;  2OYH A;  3H1I G;  1N86 A;  1KOR A;  1KIL D;  2H43 A;  3AED C;  2OGU A;  5AW3 B;  2KB7 P;  2A45 G;  3L73 D;  2CK3 H;  3GG2 A;  2LKM A;  5APT A;  5AVR B;  3P8C D;  1ZR2 A;  4H0L C;  1MFZ A;  2POH A;  5AW1 B;  3BCC E;  1S72 P;  5CCG A;  1M8O B;  3JCU H;  1SQP K;  3RL0 B;  2KP8 A;  1BGY D;  3V2N A;  4RO0 A;  2M0B A;  2FXO A;  1CI6 B;  2ITA A;  3Q5R A;  3VMA A;  2WSS H;  2KZI A;  1HWT C;  1H8A A;  1OXZ A;  2HPC B;  1DEE G;  1YTZ I;  3H1H D;  4ZKU A;  3RK3 B;  5BU5 A;  3UIA A;  1JM0 A;  4L73 A;  1JO5 A;  1KQS O;  1IK7 A;  1S1C X;  3RGU A;  1IC2 A;  3MZW B;  1GL2 A;  1Y9B A;  3L75 D;  2AXT E;  1JTH B;  5KLV E;  3M0A A;  3CXH H;  4XE5 B;  3HE5 A;  4C46 A;  2QIW A;  3LW5 J;  2JWD A;  5K5G B;  1LTB C;  3GF3 A;  2B87 A;  2V4H A;  1NAF A;  2IYO A;  3L36 A;  5AVQ B;  1S2E A;  2YKP A;  3TSI A;  4KT0 J;  2L5G B;  1NHL A;  4BRY B;  2LXC B;  3L71 E;  1YJN P;  2E74 C;  1PGP A;  1U57 A;  1T8Z A;  1FZF A;  3M91 A;  1RE3 C;  3AE5 C;  5APQ A;  2PP6 A;  1W2B O;  1SQV D;  4WVZ A;  4U3F D;  2GUV A;  2A06 G;  1BCC E;  2XZR A;  4LGD E;  3C8V A;  1JY3 P;  3CCU P;  1VPC A;  1S5L X;  3F5H A;  2W83 C;  1S5L H;  3CC4 P;  3MGN A;  1RQU A;  3L74 E;  1FS0 E;  5KKZ C;  3JC2 2;  3V2P A;  4B86 A;  1X79 B;  3H1L D;  3RK2 D;  3HD7 C;  3S1K A;  3LID A;  5AVW B;  1L4A C;  3PTZ A;  4U7J A;  2KLU A;  2L91 A;  1H0T A;  2OYH C;  1L0L K;  2RN0 A;  4W80 A;  4GOD A;  4NPE A;  3CLQ A;  4PD4 D;  2ZVO B;  2OYI B;  4PV1 C;  4RES B;  1NTK D;  1YQ3 C;  5CCH A;  2WPR A;  1QL2 A;  1S3J A;  1EDJ A;  3P8M C;  1NTZ D;  1YQ4 C;  2FYU E;  5CCG C;  1FZC A;  3KPE A;  2YMK A;  2MKV A;  2IBZ D;  5AVU B;  4N78 E;  2W90 A;  1WMK A;  1FDI A;  2IYP A;  1CW5 A;  3Q5P A;  1GDT A;  3L74 J;  1KYO H;  4D6T D;  1OVR A;  5GTH E;  2PGD A;  1VF5 D;  1VQO P;  2IX7 C;  2R5D A;  3S4R A;  1Q90 D;  2N1T A;  4WB4 A;  5GTI H;  1MZ9 A;  2C0W A;  4Y99 B;  3SFE C;  4EOT A;  4R4M A;  4GDO A;  1P84 E;  1KB9 H;  1FU1 A;  2Y9Z A;  1GL2 C;  1QL1 A;  1BCC G;  3C9I A;  1U7M A;  2HLO A;  4H0L D;  1CZQ A;  2JEE A;  1Q7Y Q;  4IFF A;  4WY4 B;  4QMA A;  3VN0 A;  2C9L Y;  3CXH D;  1BDC A;  2FFD A;  1FDM A;  1BSN A;  3E7K A;  1KIL C;  1N73 B;  2WSC J;  3TGU D;  1SP4 A;  3L70 E;  3EFF K;  3L74 G;  1T3U A;  1SQQ E;  1EZV D;  3TNU A;  2OTJ P;  1SQB E;  3HE4 B;  1JMM A;  4L74 A;  1KIL E;  1KB9 I;  3B5N B;  4L76 A;  4GT1 A;  4OH8 B;  1DD3 A;  3L72 D;  1SQX K;  1LTJ B;  4EYY Q;  2WSF J;  3L73 E;  3E1I A;  3KDP B;  4YXW H;  1NU1 J;  2NRG A;  3NTN A;  4EDF A;  3P8C E;  2KUB A;  2YXQ B;  2M3E A;  1AVO A;  4ASW A;  3A0H H;  3WUT A;  4BWN A;  1BGY E;  1JEK A;  1NU1 K;  2QVA A;  2WSE H;  1KC8 Q;  2OAR A;  4OWF A;  1RF0 A;  2I8D A;  1GU4 A;  3CX5 D;  1VQ4 P;  4OGQ D;  1L2P A;  4C7N B;  3H1H E;  2KNC B;  1ZRT D;  1PZQ A;  1FZG A;  5KAI E;  1SQQ J;  4HYT B;  4GIF A;  5DJT B;  1SQB J;  3W67 A;  5M1B A;  1Q86 Q;  5APV A;  2PFX A;  3HRN A;  1NU1 G;  3KXD A;  4K3A A;  1IZN B;  1IFM A;  3L75 E;  1M1J A;  3ITK A;  3WMM 0;  3L73 J;  3AEB C;  3WU2 E;  2O01 H;  3GMA A;  3CCQ P;  1GZL A;  3ABV C;  2HR3 A;  1LWU A;  1PFI A;  2E76 C;  1BGY J;  1KMI Z;  3D6Z A;  1FZC C;  5KLI B;  1QVF O;  1NAY A;  2NPS A;  2Z5H A;  1MFT A;  1ZLL A;  3FWN A;  3H32 A;  3CD6 P;  4UB6 E;  1SQQ G;  4DZO A;  2BCC D;  3CCJ P;  3HD7 D;  1SQB G;  1XTG B;  3PRJ A;  1SQV E;  1FZB A;  1JB0 J;  3MTU E;  3O8Z A;  3QWO C;  1KYO D;  4U3F E;  4JYB A;  4JBZ A;  2WPS A;  3L73 G;  1G2C A;  2N1T C;  1DIP A;  2Z5I A;  4PV1 D;  3RL0 g;  3P32 A;  1FZE A;  1ZN5 A;  5APS A;  1IK9 A;  1T6A A;  2QG4 A;  4CPG A;  3KZI E;  1OW6 A;  3RK2 C;  1BGY G;  2H89 C;  3H6P A;  2E74 B;  1RF1 B;  5AW8 B;  2WT7 B;  3HTK A;  2A45 H;  2FFD C;  3CL3 D;  3H1L E;  2J5U A;  4IFM A;  1S9K D;  1LTI C;  1FJK A;  1SS1 A;  2M3B A;  3IR9 A;  3H1H G;  3H1J D;  2KLV A;  3V2Q A;  4NPD A;  2FBW C;  2KZJ A;  2E5T A;  3GHG C;  1URQ D;  4LLH A;  4I6M C;  4GOF A;  3OW2 O;  1Q2N A;  1AQ5 A;  1MV8 A;  1NTK E;  5AW9 B;  1A02 F;  1K9M Q;  1OVU A;  1NTM J;  3TK1 A;  3F89 A;  5B5E H;  1HF9 A;  1M56 D;  3E1R A;  3OA7 A;  5APY A;  1NTZ E;  1YJW P;  5KKZ B;  2IBZ E;  3MD0 A;  1NTM K;  1OW7 A;  3GF7 A;  3JCU E;  1VF5 C;  4I1L A;  2G3A A;  2Y9Y A;  1L4A B;  1OX3 A;  2CPB A;  2D2C C;  3SSU A;  1OFC X;  2OYH B;  1RF0 C;  4D6T E;  3A2A A;  3MUD A;  4GKG A;  1YHQ P;  2GUS A;  2YNY A;  1BE3 D;  1GW4 A;  1HGV A;  1WRG A;  1Y8A A;  5AVT B;  1SQV G;  2KYV A;  4JF7 A;  1JY2 N;  2B89 A;  5AW7 B;  1EC5 A;  3FXE A;  1NTM G;  2R3S A;  4BXL A;  2FYZ A;  1WT6 A;  2WZ7 A;  3VMY A;  1M1J C;  1FC2 C;  1Y47 A;  2YO2 A;  3G9R A;  1NTK J;  3EFG A;  3CXH E;  1GK4 A;  1EDK A;  1CI6 A;  3TGU E;  1URQ A;  1NGM B;  4H44 D;  3VMX A;  2YXR B;  3O6Q B;  1EZV E;  1K8A Q;  1KFN A;  1PPJ D;  5AVY B;  2HPC A;  1IFJ A;  3LW5 H;  2NPS C;  4D6T J;  4HJG H;  3L72 E;  1GL2 B;  1L0N D;  4ZNC A;  4O9B A;  4YXD C;  3HUS B;  2J58 A;  1HVV A;  3D70 A;  4I7Z C;  1NJI Q;  4W7Y A;  1JTH A;  3BCC J;  1N7S B;  1NTK G;  1KIL B;  4OGQ C;  1OMI A;  3AEG C;  2XND H;  1PGQ A;  1VQK P;  3VYI A;  5CCH D;  4PJ0 H;  3BRV B;  2IBZ G;  2E76 D;  3CX5 E;  1K73 Q;  1GW3 A;  3H1I D;  1RHZ B;  1ZRT E;  3TGU J;  4BRY A;  2AXT H;  2SPZ A;  4D6T G;  2R3C A;  1HJB A;  3U59 A;  1D7M A;  2AEM A;  4DOJ A;  1X0T A;  5AW6 B;  2B88 A;  2IZ1 A;  3M06 A;  1KZU B;  3AE9 C;  1YJ9 P;  5KLV J;  1YI2 P;  1OIP A;  3FXD A;  1AFO A;  2FY8 A;  3BCC G;  2QM8 A;  1K04 A;  2N1T D;  2HOD A;  3WUV A;  2JKV A;  2FYN C;  5AW0 B;  1LNQ A;  2YMY A;  5KLV K;  1KD1 Q;  1EXI A;  1FBM A;  1M57 D;  2FXM A;  4OVN F;  2FXP A;  4KJM A;  3PLN A;  5KAF H;  3M9Q A;  1LTS C;  2K9Y A;  3TGU G;  3L71 J;  4DCK A;  2KIK A;  1JCC A;  2BCC E;  1EZV G;  1Z56 A;  1SQP D;  3NFQ A;  4Z1M H;  2YKQ A;  1DH3 A;  3RBZ A;  3MUD C;  1KYO E;  5KLV G;  1BCC J;  4ZMD A;  1T2K C;  2OYI A;  3L4F A;  1VDF A;  2R5B A;  3P7K A;  4HH2 A;  1N8R Q;  4N6J A;  1K05 A;  1FZC B;  2RH0 A;  2WPV B;  3VTP C;  4XA4 A;  3R4Y A;  1SLQ A;  1NOH A;  2QSI A;  5H2F H;  1QGK B;  3Q3D A;  3USS A;  3L71 G;  1NYH A;  1S9K E;  2D2C D;  3TYY A;  1URQ C;  3B71 A;  3H1J E;  1YYC A;  2N9Y B;  5B66 E;  5CJ4 A;  3AEC C;  3PH0 A;  1HGZ A;  2BCC J;  2QA4 P;  2WVR A;  3RK3 C;  2A06 D;  1IFI A;  1XTC C;  5BVZ A;  1KQL A;  5AVX B;  1VQ5 P;  3V2R A;  2C9N Y;  4UB8 E;  4H13 D;  3RK2 B;  2WSC H;  2XKM A;  1JY3 N;  3B4S A;  1HTL C;  1MKM A;  2FYU J;  2FFD B;  2K9J A;  2QRX A;  4WY4 A;  1U7J A;  1GTW A;  1YTZ T;  2WSF H;  1YBK A;  1GD2 E;  1N7L A;  2C0X A;  2IZ0 A;  3TNU B;  2FYU K;  2MJZ A;  5TIS E;  2Y0D A;  1M7L A;  2JJL A;  1QLE D;  2I1J A;  3GHG B;  3AE2 C;  3RBX A;  2XU6 A;  3HE4 A;  3L37 A;  1H89 A;  3CCV P;  2BCC G;  3B5N A;  1ZOY C;  2NPS D;  1BE3 E;  3H1J J;  1AV1 A;  5AVZ B;  4A7P A;  1RE4 A;  1E79 H;  4IL6 E;  2WTY A;  3BAT A;  1SFC D;  3JSV C;  3QH9 A;  1MUU A;  1VF5 B;  2FYU G;  5APW A;  2BEQ D;  4H44 C;  1L0L D;  1LT1 A;  2E5Y A;  2IPP A;  3CC2 P;  1P84 I;  2I1K A;  3AE6 C;  3L70 J;  1LTA C;  3CC7 P;  2K37 A;  2W8Z A;  1PPJ E;  1T3J A;  2E75 D;  4H0L B;  1GMJ A;  4C7N A;  3K5B A;  2KNC A;  1FOS F;  2P10 A;  4IOI H;  4YTP C;  3H1J G;  1JOC A;  4HB1 A;  1SQQ K;  1L0N E;  1J2J B;  1SQB K;  3A3Y B;  1BE3 J;  3V5B A;  2KS1 B;  3SWY A;  4C7R A;  5C39 A;  3CCM P;  5CCH C;  2P7J A;  2W27 A;  1VQ9 P;  4AYC A;  2JO1 A;  2QJP C;  2OYI C;  2WWW A;  3AE4 C;  1ZME C;  2G8Y A;  2WIT A;  4KHX A;  5KAI H;  3L70 G;  3I5C A;  1YIJ P;  4JYC A;  4XFJ A;  3H1H J;  1NVO A;  3H1I E;  1IFP A;  2YIU C;  3CWB D;  1JUN A;  5CBO A;  1SFC A;  5KJ7 A;  2ZT9 D;  4TLF A;  2O1J A;  4I7Z B;  1NO4 A;  2ZFC A;  3AE8 C;  2ZXX A;  3WU2 H;  3N4X A;  3L75 J;  1BE3 G;  4OGQ B;  1TU3 F;  5AVS B;  1L0N J;  3CPW O;  2IFN A;  5EFW B;  2Q3I A;  4EI2 A;  1KB9 D;  2HG5 D;  1T2K D;  1JY2 O;  2UWJ E;  3TDK A;  4Y99 C;  1VQ8 P;  4DT0 A;  1Q82 Q;  5B5E E;  3HTK B;  3I56 P;  1N2D C;  1SQX D;  4UB6 H;  4GOE A;  3A0B H;  3SWF A;  1FDO A;  1RF1 A;  2WT7 A;  4WY4 C;  5E79 E;  2R32 A;  3RL0 D;  2XDJ A;  2ZVN B;  3H1K D;  1RE3 A;  1QEX A;  1ZV8 A;  1PPJ G;  1SQP E;  3V4Q A;  4PD4 E;  1OWA A;  2O01 N;  2RMZ A;  2H7H A;  3SWK A;  1FJP A;  1SQV J;  1NU1 D;  3AE3 C;  2VRS A;  5DJU B;  3PHL A;  3N7N A;  3T97 B;  1AQT A;  3L75 G;  4U3F J;  1LT9 A;  3B5N C;  1L0N G;  2FYN B;  4RKU J;  3KZI H;  3RK3 D;  2WPQ A;  1KN7 A;  2W6J H;  3MP7 B;  1LP1 B;  3NXS A;  2ZYA A;  1SQV K;  3S9O A;  5CMZ A;  3AEF C;  2M5A B;  1RE4 C;  3HD7 B;  1JMB A;  1FZA A;  1DX7 A;  2FKW B;  2OYO A;  3KHU A;  3CCR P;  2CPS A;  2KOG A;  2N9B A;  1H88 A;  2V7Q J;  3H1L J;  2H8P D;  1PV3 A;  2WMM A;  4PV1 B;  1M1K Q;  4H13 C;  1FE6 A;  2NZ2 A;  2LR2 A;  2YO3 A;  1AJY A;  4U3F G;  1SQP J;  2A06 E;  1QVG O;  4Y28 J;  4WWI A;  3V6I A;  3IN6 A;  2YKO A;  1USE A;  2H88 C;  1PIX A;  4JPZ B;  1J1D C;  1BDD A;  1NTZ J;  1VQN P;  2OQQ A;  2GA1 A;  1LWU C;  3GLM A;  1NTK K;  1OW8 A;  1R5S A;  4PD4 I;  1Q81 Q;  1URQ B;  1NTZ K;  2AXC A;  3H1L G;  3IF4 A;  1R5L A;  3O6Q A;  2QJY C;  4PJ0 E;  3VOP A;  5KLI C;  1IO4 A;  2Z4E A;  2IFM A;  2IBZ I;  3HE5 B;  1SQP G;  1ZXG A;  5KJ7 C;  1SFC C;  2W6B A;  1NKZ B;  3VP9 A;  1KTM A;  1GU5 A;  4NPF X;  2B87 B;  2JP3 A;  2ZJS E;  2K3R A;  3HUS A;  2Q7C A;  3Q1M A;  1NTZ G;  5L8R J;  3CCE P;  1N7S A;  3AEA C;  1PP9 D;  1KIL A;  2O1K A;  2KI7 B;  3Q5S A;  2E75 C;  1KQF B;  1L0L E;  3VMZ A;  2OTK E;  1S5L E;  2ZYG A;  3G6E P;  2QJK C;  2HYN A;  3CME P;  1X22 A;  1CSB A;  1RF1 C;  3CCS P;  2AEF A;  1JNM A;  3CXH I;  4ASV A;  1HH0 A;  3L72 J;  1S4X A;  5KAF E;  1J1E C;  2PAJ A;  2JR8 A;  2XV5 A;  1NTM D;  3U1A A;  2QM7 A;  4H44 B;  4WBA A;  1EZV I;  3TF5 A;  1NKN A;  1LT9 C;  2KSJ A;  2HOD B;  2AEJ A;  2ZYD A;  3CX5 H;  3V4W A;  4IFD K;  3BVH A;  1JY3 O;  4YPC A;  2DW3 A;  2ZT9 C;  1ZP0 C;  3AE7 C;  1L0L J;  1H0T B;  1HUC A;  1HJ0 A;  3SFD C;  1G1J A;  5AVV B;  4WY4 D;  1IFD A;  1VL2 A;  3CWB E;  3D71 A;  3L72 G;  5H2F E;  2LXB A;  3MIW A;  3C1L A;  1VQM P;  3OAK A;  5AW5 B;  3CX5 I;  2E76 B;  1USD A;  1EDI A;  1EDL A;  2QJP B;  5GTI E;  3BRT B;  1RY3 A;  3B5N D;  1KB9 E;  2K88 A;  1X9V A;  1AVY A;  4N3Y B;  3RL0 C;  2P1J A;  3U1C A;  2BEZ F;  1FOS E;  1EXJ A;  2GM4 A;  1SQX E;  3CMA P;  2YIU B;  1L0L G;  1YIT P;  3H1K E;  2N1T B;  1VQ7 P;  3AEE C;  2P58 A;  1SVF A;  1NU1 E;  3CWB J;  1GK6 A;  2P67 A;  1LGH B;  3BCC D;  3G4S P;  3RK3 E;  1RQV A;  3CI9 A;  3MHV A;  2K1A A;  5CJ0 A;  3G3Z A;  4TT3 H;  5GTH H;  3HUS C;  2K9J B;  3A0H E;  3EQ2 A;  1LTT C;  4JQ0 D;  1KYO I;  1N73 A;  1IJD B;  1N7S C;  3VP8 A;  3A5T A;  2Q9I A;  2Q1K A;  1AA0 A;  1W5C E;  3NMD A;  5B66 H;  3KQG A;  1P84 H;  1SQX J;  3II6 A;  3H25 A;  1VQP P;  3R2P A;  5AW2 B;  2E42 A;  3M9H A;  4DJG A;  1PL5 A;  3H1K J;  3GHG A;  4UB8 H;  1LTJ A;  3CWB G;  4LC1 A;  5KLV D;  4ZKP A;  2RKL A;  1VQ6 P;  3KYQ A;  3W68 A;  3LIE A;  1DD4 A;  5KJ7 D;  4I2L C;  4AQR D;  3OJA B;  2JWA A;  3I55 P;  3M0D A;  2D2C B;  1OVV A;  3FGA D;  1PGJ A;  1BSH A;  2KXP B;  5TIS H;  4RJT A;  3L71 D;  1M90 Q;  1SQX G;  5TJH A;  1KQG B;  4H13 B;  2Y0C A;  2WSE J;  1JCD A;  2M8R A;  2IDB A;  2KK7 A;  1UIX A;  3H1K G;  1R8E A;  1IFN A;  1M1J B;  1X8Y A;  2E74 D;  4IL6 X;  4IL6 H;  1BCC D;  1J1D B;  3L35 A;  1HBW A;  2J59 M;  3PP5 A;  2PRR A;  3IFM A;  1PGO A;  1LWU B;  3A7O A;  2KS1 A;  2W6A A;  1LTG C;  1PP9 E;  2KSE A;  4R4L A;  2NPS B;  1W2E A;  3L74 D;  4EIJ A;  3H32 B;  2QJY B;  5APU A;  2ZXE B;  2O01 J;  1VQL P;  1DEB A;  2Q6Q A;  1ZR4 A;  3G71 P;  5AW4 B;  1UII A;  1SFC B;  1EQ7 A;  1RH5 B;  2Y0E A;  3A0B E;  3CCL P;  1A02 J;  1KFM A;  3BAS A;  1G1I A;  3B8E B;  1G2C B;  1JY2 P;  4K35 A;  1L4A D;  2E43 A;  2R44 A;  2O3J A;  2HFE D;  1FAV A;  1NTM E;  1KV4 A;  4MN4 C;  1LJ2 A;  2JDI H;  4AUW A;  2FYU D;  2E75 B;  3Q2Y A;  5CHX A;  1L0N K;  2ZAE B;  2QE7 H;  2QEX P;  4N78 D;  5BU8 B;  2QJK B;  4HKZ H;  1NWQ A;  1OZH A;  3PJS K;  2BAS A; 
#chains in the Genus database with same CATH homology
 1NU1 K;  3VOP A;  1T2K C;  5CCG D;  2WSE H;  1IO4 A;  2Z4E A;  2IFM A;  2OYI A;  3L4F A;  1N73 C;  2OAR A;  3HE5 B;  1VDF A;  2R5B A;  3M9B A;  1RF0 A;  1SFC C;  2W6B A;  3P7K A;  5KJ7 C;  4HH2 A;  1GU4 A;  4N6J A;  1NKZ B;  1FZC B;  1J1E B;  3VP9 A;  1GU5 A;  4C7N B;  4M3L A;  3HUS A;  2Q7C A;  3VTP C;  4XA4 A;  1FZG A;  1LT9 B;  1SLQ A;  1NOH A;  2XNX A;  4HYT B;  4GIF A;  1N7S A;  1LTJ C;  1NH4 A;  3T97 A;  5APV A;  1KIL A;  2O1K A;  3HRN A;  1S9K E;  3TYY A;  1URQ C;  1IFM A;  5APX A;  1M1J A;  3VMZ A;  5KTB A;  3WMM 0;  1YYC A;  1E5W A;  5CJ4 A;  2A45 I;  1GL2 D;  2HYN A;  1HGZ A;  2P2U A;  3M0D C;  4W7Z A;  3HD7 A;  2O01 H;  3RK3 C;  1IFI A;  1CSB A;  1XTC C;  2Q5U A;  1GZL A;  1RF1 C;  1JNM A;  5BVZ A;  1L4A A;  1KQL A;  5AVX B;  3V2R A;  2C9N Y;  1LWU A;  1PFI A;  3RK2 B;  1HH0 A;  2WSC H;  1N7S D;  2OYH A;  2XKM A;  1N86 A;  1KIL D;  2H43 A;  1JY3 N;  1FZC C;  1J1E C;  2PAJ A;  2XV5 A;  1HTL C;  2NPS A;  2Z5H A;  5AW3 B;  1ZLL A;  2KB7 P;  3U1A A;  2A45 G;  2QM7 A;  4WBA A;  2FFD B;  2LKM A;  3H32 A;  1NKN A;  1LT9 C;  4WY4 A;  1GTW A;  2KSJ A;  5APT A;  5AVR B;  1YTZ T;  4DZO A;  2HOD B;  3HD7 D;  3P8C D;  1ZR2 A;  2WSF H;  1GD2 E;  1N7L A;  2C0X A;  1MFZ A;  2POH A;  5AW1 B;  1XTG B;  3V4W A;  3TNU B;  5CCG A;  4IFD K;  2FYU K;  2MJZ A;  3BVH A;  1FZB A;  1SQP K;  1JY3 O;  3MTU E;  3O8Z A;  3RL0 B;  2KP8 A;  3V2N A;  1M7L A;  2JJL A;  2I1J A;  3GHG B;  4JYB A;  2WPS A;  2XU6 A;  3HE4 A;  1G2C A;  3L37 A;  2N1T C;  1CI6 B;  1H89 A;  3B5N A;  2NPS D;  2Z5I A;  1HUC A;  3P32 A;  1FZE A;  1ZN5 A;  5APS A;  1G1J A;  1IK9 A;  5AVV B;  4WY4 D;  1HWT C;  1IFD A;  5AVZ B;  1H8A A;  1OXZ A;  2HPC B;  3RK2 C;  1YTZ I;  1RE4 A;  4ZKU A;  3RK3 B;  5BU5 A;  3H6P A;  3MIW A;  1RF1 B;  2WTY A;  5AW8 B;  2WT7 B;  3BAT A;  3HTK A;  1SFC D;  3UIA A;  1MUU A;  2A45 H;  5APW A;  3OAK A;  5AW5 B;  1JO5 A;  2FFD C;  3CL3 D;  4IFM A;  1S9K D;  1IC2 A;  1LTI C;  1GL2 A;  3BRT B;  1RY3 A;  3B5N D;  1FJK A;  2IPP A;  1JTH B;  1X9V A;  2M3B A;  3IR9 A;  3M0A A;  2I1K A;  4XE5 B;  2KLV A;  3HE5 A;  3V2Q A;  1LTA C;  4C46 A;  4N3Y B;  3RL0 C;  1LTB C;  1T3J A;  3GHG C;  2P1J A;  1URQ D;  3U1C A;  4LLH A;  4C7N A;  4I6M C;  1FOS E;  2GM4 A;  1FOS F;  1AQ5 A;  1MV8 A;  5AW9 B;  1A02 F;  1NAF A;  3TK1 A;  3L36 A;  5AVQ B;  3OA7 A;  5APY A;  1JOC A;  1SQQ K;  2YKP A;  1J2J B;  3TSI A;  1SQB K;  3A3Y B;  2N1T B;  2L5G B;  3V5B A;  3SWY A;  1NHL A;  4C7R A;  3MD0 A;  1NTM K;  1SVF A;  5CCH C;  2P7J A;  1T8Z A;  2W27 A;  1FZF A;  4I1L A;  1GK6 A;  4AYC A;  3M91 A;  1L4A B;  2CPB A;  1RE3 C;  2P67 A;  2OYI C;  1LGH B;  5APQ A;  2WWW A;  2PP6 A;  2OYH B;  1RF0 C;  3CI9 A;  2GUV A;  2WIT A;  5CJ0 A;  3A2A A;  4KHX A;  3MUD A;  3G3Z A;  3I5C A;  4GKG A;  4JYC A;  2XZR A;  2GUS A;  3HUS C;  2YNY A;  4LGD E;  3EQ2 A;  1JY3 P;  1LTT C;  1GW4 A;  1HGV A;  1WRG A;  1N73 A;  1IJD B;  1N7S C;  5AVT B;  3VP8 A;  3A5T A;  2KYV A;  4JF7 A;  1JUN A;  1JY2 N;  2Q9I A;  5KJ7 A;  1SFC A;  1VPC A;  5AW7 B;  3NMD A;  2O1J A;  2FYZ A;  1WT6 A;  2WZ7 A;  3KQG A;  3VMY A;  1NO4 A;  3MGN A;  1M1J C;  3II6 A;  2ZFC A;  2YO2 A;  3N4X A;  5AVS B;  3V2P A;  4B86 A;  3R2P A;  1X79 B;  3EFG A;  5AW2 B;  3RK2 D;  3HD7 C;  2E42 A;  3M9H A;  3GHG A;  1LTJ A;  3LID A;  4LC1 A;  2IFN A;  1GK4 A;  2Q3I A;  1T2K D;  2HG5 D;  5AVW B;  1JY2 O;  1L4A C;  4ZKP A;  1CI6 A;  3KYQ A;  4Y99 C;  1URQ A;  3LIE A;  3VMX A;  1L0L K;  2OYH C;  4W80 A;  5KJ7 D;  4I2L C;  4AQR D;  3OJA B;  1KFN A;  3CLQ A;  5AVY B;  2HPC A;  3HTK B;  1IFJ A;  3M0D A;  3LW5 H;  1N2D C;  2NPS C;  2OYI B;  3SWF A;  4RES B;  1RF1 A;  2WT7 A;  4WY4 C;  5CCH A;  2WPR A;  2R32 A;  1GL2 B;  1QL2 A;  3RL0 D;  2XDJ A;  3P8M C;  4O9B A;  1RE3 A;  1ZV8 A;  3HUS B;  5CCG C;  1FZC A;  3KPE A;  2J58 A;  1HVV A;  3V4Q A;  1OWA A;  4W7Y A;  5AVU B;  4N78 E;  2H7H A;  1JTH A;  1FJP A;  1N7S B;  2VRS A;  1JCD A;  3N7N A;  2M8R A;  1KIL B;  1LT9 A;  1CW5 A;  3B5N C;  1GDT A;  3RK3 D;  2WPQ A;  1IFN A;  1M1J B;  1X8Y A;  3VYI A;  3NXS A;  5CCH D;  3BRV B;  1SQV K;  1J1D B;  2IX7 C;  5CMZ A;  2R5D A;  3L35 A;  1RE4 C;  3HD7 B;  1HBW A;  2J59 M;  3PP5 A;  3IFM A;  1GW3 A;  1FZA A;  2N1T A;  4WB4 A;  1DX7 A;  1MZ9 A;  1LWU B;  2C0W A;  3A7O A;  4Y99 B;  4EOT A;  2FKW B;  2CPS A;  2KOG A;  2N9B A;  2W6A A;  1FU1 A;  2R3C A;  1HJB A;  1H88 A;  1LTG C;  1GL2 C;  1QL1 A;  3U59 A;  3C9I A;  2H8P D;  4DOJ A;  2HLO A;  2NPS B;  1W2E A;  5AW6 B;  1CZQ A;  3M06 A;  2JEE A;  1KZU B;  4EIJ A;  3H32 B;  4IFF A;  4WY4 B;  5APU A;  2ZXE B;  3VN0 A;  2C9L Y;  1AFO A;  1DEB A;  1ZR4 A;  2FFD A;  1FDM A;  2QM8 A;  2YO3 A;  1KIL C;  5AW4 B;  1N73 B;  2N1T D;  2HOD A;  1SP4 A;  1SFC B;  1EQ7 A;  5AW0 B;  2YMY A;  5KLV K;  1T3U A;  1A02 J;  3TNU A;  2YKO A;  1KFM A;  3BAS A;  3HE4 B;  1G1I A;  1FBM A;  3B8E B;  1JMM A;  1G2C B;  1J1D C;  1JY2 P;  3B5N B;  1L4A D;  2E43 A;  4GT1 A;  4OH8 B;  2FXM A;  2HFE D;  1FAV A;  1SQX K;  3M9Q A;  1LTJ B;  1LTS C;  1LWU C;  1NTK K;  3E1I A;  3KDP B;  4AUW A;  1JCC A;  3NTN A;  1URQ B;  3P8C E;  1Z56 A;  5CHX A;  1L0N K;  1NTZ K;  3NFQ A;  4N78 D;  5BU8 B;  1NWQ A;  2YKQ A;  1DH3 A;  2BAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...