1RY3A

Nmr solution structure of the precursor for carnobacteriocin b2, an antimicrobial peptide from carnobacterium piscicola
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
b'MNSVKELNVKEMKQLHGGVNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacteriocin carnobacteriocin B2
publication title NMR solution structure of the precursor for carnobacteriocin B2, an antimicrobial peptide from Carnobacterium piscicola.
pubmed doi rcsb
source organism Carnobacterium maltaromaticum
molecule tags Antibiotic
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2003-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01721 Bacteriocin_II Class II bacteriocin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.130 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ry3A00
1RY3A 1CW5A
chains in the Genus database with same CATH superfamily
2ZFCA 1Q82Q 2P1JA 2K9JA 1BE3D 2AXTE 2NZ2A 1RF1A 4OGQB 4XFJA 1M1KQ 1RE4C 4OH8B 3NMDA 3U1AA 2Q6QA 2FYNC 3BRVB 3RK3D 3H1LG 4BXLA 5AW1B 2ZT9D 1W2EA 1HGVA 1MFZA 1N7LA 2P67A 3CXHH 3H1LE 5KLVG 2GUVA 3NXSA 1XTCC 3ABVC 4EIJA 1NTKK 5KLVE 4WBAA 3L73G 5AVYB 1WT6A 3PJSK 1X79B 2D2CB 3GF3A 5KJ7C 1GK4A 2Z4EA 1ZN5A 3L73E 3AEAC 3CCJP 1SQPK 3V4QA 1FJPA 1UIIA 1KILD 2FYUJ 3KYQA 5E79E 1JY2O 2E5TA 4IL6E 1M56D 3CCLP 1N73B 2KOGA 5EFWB 2O1JA 2O1KA 4D6TJ 1N7SB 1OMIA 1SP4A 1NVOA 2AEFA 1LTBC 4XE5B 2WSFH 3MUDC 1BE3J 3CCVP 2NRGA 1SQQK 4XA4A 3VMZA 1NWQA 3VMYA 2WPSA 4R4LA 1L2PA 2E42A 1SQVG 5AVRB 2E76C 3IAOA 5KAFE 1NTMK 2ZYAA 2E74B 1SQVE 3FWNA 3C8VA 2YO3A 4UB8H 1M7LA 1QL1A 3TSIA 4D6TG 1S5LX 4OGQC 5APQA 4D6TE 1SFCB 2H7HA 3EFGA 2HODB 3K5BA 2FBWC 1N2DC 5B5EE 3CC4P 4YXWH 1L0LG 3CX5E 1G2CA 1NTZK 1SQXK 1L0LE 1EXIA 1JMMA 1G1IA 1NU1D 5CHXA 1P84D 1KILA 3JC22 1SS1A 1FOSF 2OYIB 1AFOA 1Q86Q 1OXZA 1GMJA 3W68A 3SFDC 1ZRTE 1KB9D 4U3FD 2E5YA 5BU5A 3MHVA 3C9IA 2XDJA 3OJAB 1RF0C 4MN4C 2IFMA 2N1TB 1RQVA 5GTIE 4K3AA 4GOFA 3CMAP 2HFED 1NH4A 3H1HG 1N7SC 2KZJA 1FZCC 1FDOA 4ASVA 1QVFO 4EYYQ 2IX7C 4PD4D 3KQGA 3H1HE 3QWOC 3CXHI 1HJ0A 3M91A 1LTSC 2IYOA 5DJUB 4WY4C 2GM4A 3U1CA 2WVRA 1LT9C 1ZXGA 3MTUE 1R5LA 2R44A 2YKQA 4L76A 1IO4A 3EWKA 2H43A 3L37A 3P8CD 2WSEH 1KQSO 3L71D 1LGHB 5KAIH 1QGKB 3AE7C 1W2BO 1KYOI 1LP1B 4ZMDA 2ZYDA 3L75G 3Q3DA 5DJTB 1SQBD 3RK2D 2Q9IA 3CC7P 3BCCG 1GU5A 1NU1J 3PLNA 1ZV8A 1OVRA 3L75E 3Q5SA 1M1JA 2M8RA 2GA1A 4NPFX 3BCCE 1FZAA 2E76D 3F89A 1LTTC 1S5LH 1FAVA 1SQPG 2QA4P 2FY8A 4U3FJ 1RHZB 1YQ4C 2SPZA 1SQPE 2H89C 1L0NK 1N86A 4RESB 1IZNB 2KZIA 1IK9A 5M1BA 1H0TA 1BSHA 3TK1A 3HD7B 3ZDMA 4PV1D 2W90A 2Q1KA 1S72P 3HUSA 3H32B 3WMM0 2QJKC 2XKMA 2R32A 5H2FH 1ZP0C 1L4AC 1DIPA 1R8EA 1JCDA 1K8AQ 2WSCJ 3LW5H 1VDFA 1KFNA 4C7NB 1KN7A 1AA0A 3L73D 3S9OA 3A0HH 1DD4A 3GHGB 4ZKPA 3L71J 4N78E 1KV4A 3RBZA 2N1TC 1NYHA 4EDFA 2YNYA 2VRSA 2IBZG 1K9MQ 1Y9BA 3I5CA 3IN6A 4Y99C 1SQBJ 3BASA 4UB8E 2XNXA 2IBZE 2O01J 5CCHC 3P7KA 1SLQA 4HKZH 2WT7A 1T8ZA 3ITKA 3E1IA 4DOJA 4TT3H 1OVUA 4PJ0H 1PP9G 2QIWA 3G3ZA 2FXPA 2KK7A 5AW0B 2JJLA 2KS1A 1PP9E 1MV8A 4YTPC 1OZHA 3MUDA 2OTLP 2RH0A 4WVZA 2CPSA 3D6ZA 1YIJP 3T97B 1JY3N 4WY4D 2G3AA 3CD6P 3V5BA 2AEJA 1DX7A 2KI7B 2RMZA 3L71G 2M5AB 2E75B 1JTHA 5B66H 1SQVD 3L71E 1N8RQ 2K3RA 2C9NY 1SQBG 4HB1A 4AUWA 1PFIA 2K1AA 3L73J 1SQBE 3G4SP 1JUNA 2CK3H 3B5NB 3H1IG 3RK2B 2WWWA 2Z5HA 3H1IE 5KKZC 1GL2C 3VN0A 4O9BA 3AE2C 3RGUA 3H6PA 3HE5A 2WQYC 2Q3EA 3CX5D 3EFFK 1HWTC 2GUSA 1L0LD 5APUA 2P2UA 1JEKA 3CCMP 1T2KD 3RL0B 2BCCJ 1AQ5A 1VF5B 2QSIA 1YJ9P 1UIXA 3TGUG 3GHGC 3TNUA 1NAYA 4I6MC 5CBOA 2FFDC 5KAIE 1URQC 3B4SA 3TGUE 1ZRTD 1AV1A 1RY3A 1L4AD 2R3CA 4DCKA 2K9JB 1HTLC 4W80A 3M0DA 1RF0A 1ZR4A 1RF1B 1JMBA 4ZNCA 2W6BA 3AEBC 4LLHA 2I8DA 3FX0A 1SQVJ 1GTWA 1S5LE 3A0BH 2KNCA 1FZCA 1FC2C 4H44B 3H1HD 3MD0A 3G9RA 5AVUB 1QEXA 3CPWO 1KYOH 1IC2A 4H0LB 2QJYB 3G6EP 1HBWA 2J59M 4W7ZA 3AEDC 1VQ9P 1L0NG 4WY4A 1YI2P 1BDDA 2YMYA 1KTMA 1LT9A 3TF5A 3SFEC 1J1EC 1L0NE 4M3LA 5APYA 2BCCG 1QVGO 1JY2N 5BU8B 1VQ8P 1YJWP 3GW6A 2IDBA 1BDCA 1M8OB 3SWYA 1MUUA 2BCCE 3CXHD 3BVHA 1WMKA 2KLUA 5H2FE 1JB0J 1L0LJ 1FU1A 1QX8A 1IFJA 3CWBD 3L75D 4I2LC 3A5TA 3A0HE 1LTJA 2M0BA 1NTKD 1S1CX 3BCCD 4I7ZB 2Y0EA 3C1LA 4GKGA 4RKUJ 1RE3C 1MKMA 1NHLA 4H13B 2XU6A 1T3JA 1CI6A 1K05A 1SQPD 1H88A 4KHXA 4LGDE 1EDJA 2PP6A 2NPSD 3LIEA 4JBZA 4IFMA 1Q90D 3GG2A 2KP8A 3KXDA 1IK7A 4PJ0E 2LXBA 2JDIH 1G1JA 2A06D 3H1HJ 1LT1A 1FOSE 1GL2D 1LWUA 4JF7A 1VF5C 1NKNA 1T3UA 2R5BA 1PV3A 3V6IA 3R2PA 1U57A 2OYHA 1L4AA 4EI2A 5APTA 1H8AA 3Q5PA 4IL6X 2IFNA 5TISH 3D71A 2A45H 3B71A 2D2CC 3P8MC 3V2PA 4N78D 1RF1C 2W8ZA 1HH0A 3KPEA 1NOHA 2W6AA 1X9VA 4L74A 3RK3B 2I1JA 5B66E 1PZQA 1EDLA 2ZT9B 1URQD 3F5HA 5APXA 2IBZD 4GDOA 3A3YB 5L8RJ 2K9YA 1LJ2A 3CWBJ 1IFDA 3L75J 1AVOA 1NTKJ 1NTMD 1Z56A 2QJYC 1Q2NA 5TJHA 3BCCJ 3I56P 3O6QA 5KJ7D 2E43A 1PGQA 3HE4A 1N73C 1G2CB 2JEEA 1IFMA 3L70G 3JCUH 3TYYA 3B8EB 1LTIC 1SQPJ 2Y0DA 1OW7A 1PP9D 3L70E 2PRRA 4Y28J 3GMAA 4OWFA 1M90Q 1J2JB 1KILB 1NAFA 2P10A 1GZLA 2ZVOB 2C0WA 4GODA 4Z1MH 2P7JA 3FWLA 4RJTA 2WSFJ 3WUTA 3NFQA 4IOIH 3CXHE 3NTNA 1AVYA 2QJPB 3CCRP 1A02J 3IR9A 4NPEA 1VQKP 3FGAD 1J1DB 2E74C 3CWBG 4H13C 5KLVK 2C0XA 1NTKG 2NPSA 1NGMB 3AE8C 3H1KG 3CWBE 1QLED 1NTKE 3CI9A 2OYOA 1NJIQ 2UWJE 2Z5IA 3H1KE 1DD3A 3H1ID 3A0BE 1K04A 1SFCC 1KC8Q 1GL2A 2FYZA 1KYOE 1NTMJ 2WMMA 4L75A 4AYCA 1K73Q 2Y0CA 4ASWA 2OTKE 2A06G 1WRGA 3WU2H 3Q2YA 1RE4A 1EDKA 3M9QA 4BRYA 4OGQD 1PP9J 2YXRB 1AJYA 2A06E 4IL6H 3S4RA 1M1JB 3OA7A 2H8PD 3L72G 1LTAC 2FXMA 1OW6A 1PIXA 2V4HA 3RK3C 2OGUA 1SVFA 3V4WA 2FFDA 3VMXA 5AVQB 1BSNA 2RN0A 3H1JG 3TGUD 1URQA 3L72E 1EQ7A 1FDIA 2QEXP 1SQQG 2OYIC 2ZT9C 3H1JE 2AXCA 1SQQE 5KJ7A 5APVA 3M9HA 1IFNA 3HTKB 2D2CD 1H0TB 2ZXEB 1NTZJ 1SQXJ 2KIKA 1HUCA 5AW9B 1YYCA 2B87A 1LNQA 4RO0A 2ZXXA 1PPJG 1NTMG 2N9YB 3SWFA 2FYUK 2ZYGA 3HUSB 2HPCA 3CL3D 1JO5A 2BEQD 1KILC 3M0AA 1PPJE 1NTME 4B86A 2Q7CA 3EQ2A 2QE7H 2JWDA 3H1IJ 5GTHH 4PD4I 5CMZA 1L0ND 3T97A 2A45I 1N7SD 2W27A 1EZVI 2BCCD 2OARA 2PAJA 2KLVA 1S9KE 2QJPC 1KORA 2R5DA 3CLQA 2A45G 2K88A 1EZVG 3E1RA 1L0LK 2R3SA 2WSEJ 2WT7B 3II6A 3USSA 3U59A 1NTZG 1SQXG 1EZVE 1YQ3C 3TGUJ 2QM8A 1NTZE 3V2RA 1SQXE 2KS1B 1DEEG 4CPGA 5CJ4A 4YPCA 3PH0A 2KSJA 3GF7A 3AEEC 3PTZA 1CZQA 1H89A 3AE9C 3AEFC 2XNDH 3RL0g 1VQPP 3JCUE 2YMKA 3HD7C 2IZ1A 1FJKA 1E79H 1SFCD 2E76B 5AW7B 1M1JC 1JTHB 1E5WA 3A2AA 1L0NJ 4A7PA 3V2NA 3AEGC 3BATA 1PL5A 5AW3B 1KMIZ 2M3EA 1RQUA 3GLMA 3KZIH 2YKPA 2PGDA 4HH2A 3SSUA 1IFPA 3N4XA 2QM7A 4PV1B 2ITAA 3LW5J 2B88A 3S1KA 2KUBA 3L36A 2KXPB 2B9BA 3HUSC 2XZRA 3HE5B 2YIUB 4N6JA 5CCGC 2JWAA 1OFCX 4NPDA 1N73A 3L74J 2H88C 2N1TD 1M57D 2FXOA 2Y9YA 1YTZI 1N7SA 3L70D 4UB6H 3FXEA 3D6YA 2JKVA 3TNUB 2O3JA 1LTGC 1ZMEC 2J5UA 2WPQA 5CCHD 3JSVC 1KQLA 3WU2E 2KSEA 3M06A 4U7JA 1VPCA 1YJNP 1USEA 1ZW0A 1Q81Q 2K37A 2LKMA 1Y47A 2E75C 2KNCB 1FZCB 3G71P 2FKWB 2CPBA 4JYBA 1YTZT 1JOCA 3TDKA 2OQQA 3V2QA 2B89A 1USDA 2WSSH 1VQLP 2QG4A 4WY4B 5AVTB 3AE4C 3H1KD 1LT9B 1FS0E 3B5NC 3L74G 1NU1K 3FXDA 3R4YA 1X8YA 3RK2C 3KDPB 2PFXA 2DW3A 3L74E 2V7QH 1SFCA 1VQ5P 1KYOD 1JM0A 1HVVA 1JCCA 1VQ7P 2HODA 1P84H 3WUUA 2FYUG 2LXCB 4YXDC 2W83C 5GTHE 2FYUE 1OWAA 3L70J 3Q1MA 1KB9H 5CJ0A 4HYTB 1LTJB 2BASA 1QL2A 3E7KA 3VOPA 3HD7D 3PHLA 3AE5C 3RL0C 3CX5I 3AE1C 3AE6C 2IZ0A 1GW3A 3L72D 1CI6B 4LC1A 4PV1C 2HR3A 2M3BA 2OYIA 3H1JD 1EXJA 4PD4H 1BE3G 1KQFB 5AVWB 1SQQD 1Y8AA 3VTPC 1HGZA 3VYIA 4EOTA 1BCCD 1BE3E 2YIUC 1YBKA 4IFDK 3KHUA 2N1TA 3BRTB 3O8ZA 4W7YA 2WSCH 3RK3E 2WPVB 1LWUB 2MJZA 1PGJA 2C9LY 1VQNP 4H44C 2MKVA 4KJMA 1FZEA 1PPJD 5CCHA 4H0LC 2QJKB 1SQBK 3VMAA 2KB7P 3H1KJ 2OYHB 1GD2E 1L4AB 2JO1A 5CCGD 3HRNA 1X0TA 1FE6A 2YXQB 1PGOA 3Q5RA 3MZWB 3CCQP 2L5GB 4ZKUA 2XV5A 2LR2A 1VQ6P 1VQ4P 3M0DC 2O01H 1S2EA 1Q7YQ 1S9KD 3CC2P 2P58A 1U7JA 4K35A 5CBNA 1KILE 4Y99B 1JY3P 1AQTA 5APSA 2G8YA 4JQ0D 1LP1A 1GU4A 3RBXA 3O6QB 1MFTA 3HE4B 1EZVD 3KZIE 1IJDB 1OIPA 2AXTH 3L72J 3CCSP 4I7ZC 3QH9A 1NTZD 1SQXD 4BWNA 1BGYD 2E75D 2WPRA 5C39A 3H1JJ 4I1LA 1PGPA 4GIFA 1SQQJ 1FBMA 3AE3C 1BCCJ 3IF4A 2J58A 2QRXA 3WUVA 2YKOA 1MZ9A 2ZVNB 2Q5UA 4HJGH 3B5ND 2V7QJ 1KQGB 4UB6E 3HD7A 4R4MA 3UIAA 1LTJC 3A7OA 1OVVA 2IPPA 4C46A 1NKZB 1VL2A 3MIWA 2I1KA 3H32A 1RH5B 1YHQP 2JP3A 2WZ7A 5KLIB 2Q3IA 1HJBA 2NPSB 2OTJP 5E79H 1FZGA 1GK6A 3I55P 4DT0A 5AW6B 2WITA 1VQMP 4C7NA 3RL0D 3GHGA 1X22A 3OW2O 2POHA 3HTKA 1JNMA 1VF5D 5AVZB 5KKZB 1GL2B 2QVAA 1T2KC 1LWUC 1BCCG 1EC5A 1P84I 3H1LD 4AQRD 2HG5D 4WWIA 1FZFA 5CCGA 1ZOYC 1BCCE 2N9BA 5APWA 4OVNF 2WTYA 2Y9ZA 2OYHC 3OAKA 3D70A 4BRYB 5KLVD 1BGYJ 1KB9I 1KFMA 2FYNB 2IBZI 1U7MA 4N3YB 1R5SA 5AVVB 2L91A 1SQVK 1NU1G 1XTGB 1CSBA 1EDIA 5AVSB 3L4FA 1FZBA 4H44D 1NU1E 2FFDB 5K5GB 2HLOA 1KD1Q 1P84E 1URQB 5KAFH 3MP7B 1FDMA 4H0LD 4U3FG 1S4XA 2HYNA 2AEMA 1W5CE 3L35A 4IFFA 1KB9E 5KTBA 4U3FE 1JY2P 3SWKA 1A02F 4JPZB 5AW8B 4DJGA 1YITP 1CW5A 2M5AA 2B87B 3LIDA 4WB4A 1JY3O 3P32A 1GDTA 1D7MA 2HPCB 1J1DC 2YO2A 1DEBA 5TISE 1OW8A 4PD4E 5B5EH 1NO4A 1DH3A 5BVZA 1OX3A 2KYVA 5AW2B 3VP9A 3M9BA 1BGYG 3CX5H 3B5NA 4KT0J 4DZOA 3CCEP 1J1EB 2BEZF 3PP5A 1RE3A 1ZR2A 4L73A 1BGYE 1HF9A 3L74D 1KZUB 3CMEP 5AW5B 2ZJSE 1VQOP 2E74D 3H1LJ 3VP8A 3MGNA 4H13D 2RKLA 3P8CE 3IFMA 2W6JH 5AW4B 5KLVJ 4GOEA 2FYUD 1TU3F 3N7NA 2ZAEB 3PRJA 4C7RA 5KLIC 3CCUP 2JR8A 2NPSC 1ZLLA 5AVXB 3AECC 1T6AA 1GW4A 3H25A 1S3JA 1IFIA 2O01N 2IYPA 5GTIH 4TLFA 3W67A 4GT1A 4QMAA 4D6TD 4JYCA
chains in the Genus database with same CATH topology
4ZKPA 2ZFCA 3KDPB 4N78E 2C0WA 2P1JA 2N1TC 2YNYA 2VRSA 1SFCA 2P7JA 1HVVA 1RF1A 1JCCA 3I5CA 2HODA 4Y99C 1RE4C 4OH8B 3NMDA 3U1AA 3BASA 3NFQA 2XNXA 3BRVB 3RK3D 5CCHC 3P7KA 3NTNA 1SLQA 1OWAA 1A02J 5CJ0A 2WT7A 5AW1B 3IR9A 4HYTB 1LTJB 1J1DB 1T8ZA 1W2EA 2BASA 3E1IA 1HGVA 1MFZA 1N7LA 2P67A 4DOJA 1QL2A 3VOPA 3HD7D 2GUVA 3NXSA 5KLVK 3G3ZA 3RL0C 1XTCC 2C0XA 4EIJA 2NPSA 1NTKK 5AW0B 2JJLA 4WBAA 1GW3A 1CI6B 1MV8A 3CI9A 4LC1A 5AVYB 1WT6A 3MUDA 1X79B 2Z5IA 5KJ7C 2M3BA 1GK4A 2Z4EA 2OYIA 1ZN5A 2CPSA 1SQPK 5AVWB 1JY3N 3VTPC 1HGZA 1SFCC 3VYIA 3V4QA 1FJPA 4WY4D 4EOTA 1GL2A 1KILD 2FYZA 4IFDK 3V5BA 3KYQA 2N1TA 4AYCA 3BRTB 1DX7A 3O8ZA 1JY2O 4W7YA 2WSCH 1WRGA 1JTHA 1LWUB 2MJZA 1RE4A 2C9LY 1N73B 3M9QA 2KOGA 2C9NY 2O1JA 1FZEA 2O1KA 5CCHA 1SQBK 1N7SB 1M1JB 2KB7P 1SP4A 4AUWA 2OYHB 3OA7A 1GD2E 1PFIA 1L4AB 2H8PD 5CCGD 3HRNA 1LTAC 2FXMA 1JUNA 1LTBC 3RK3C 1SVFA 3V4WA 2FFDA 3VMXA 2L5GB 4XE5B 4ZKUA 2XV5A 5AVQB 3B5NB 1URQA 2WSFH 1EQ7A 3M0DC 2WWWA 3RK2B 2OYIC 1SQQK 2O01H 4XA4A 2Z5HA 1S9KD 3VMZA 5KJ7A 1NWQA 1GL2C 5APVA 3VMYA 3M9HA 1IFNA 3VN0A 3HTKB 4O9BA 4Y99B 2WPSA 2ZXEB 1JY3P 3H6PA 1HUCA 5APSA 5AW9B 1YYCA 2E42A 3HE5A 1GU4A 5AVRB 3HE4B 1IJDB 1NTMK 2FYUK 3HUSB 3SWFA 1HWTC 2GUSA 2HPCA 3CL3D 5APUA 1JO5A 2P2UA 1KILC 3M0AA 1T2KD 3RL0B 4B86A 1AQ5A 2YO3A 2Q7CA 2WPRA 3EQ2A 1M7LA 4I1LA 3GHGC 3TNUA 1QL1A 3TSIA 4GIFA 4I6MC 2FFDC 5CMZA 3T97A 1FBMA 1URQC 2A45I 1N7SD 2W27A 2J58A 5APQA 1RY3A 1L4AD 2R3CA 1SFCB 2OARA 2PAJA 1MZ9A 2YKOA 2Q5UA 1HTLC 2KLVA 4W80A 3M0DA 1RF0A 1ZR4A 1RF1B 2H7HA 1S9KE 2W6BA 3B5ND 3EFGA 2HODB 4LLHA 1N2DC 3HD7A 3CLQA 2R5DA 2A45G 3UIAA 1LTJC 3A7OA 1GTWA 2IPPA 1FZCA 4C46A 1L0LK 1NKZB 3MIWA 2WT7B 3II6A 1G2CA 3MD0A 5AVUB 2I1KA 3H32A 3U59A 1IC2A 1NTZK 1HBWA 1SQXK 2J59M 1JMMA 2WZ7A 2QM8A 2Q3IA 1HJBA 4W7ZA 1G1IA 2NPSB 1FZGA 3V2RA 1GK6A 5CHXA 4WY4A 5CJ4A 5AW6B 2WITA 1KILA 2YMYA 2KSJA 4C7NA 1LT9A 1FOSF 1J1EC 4M3LA 2OYIB 5APYA 3RL0D 1JY2N 3GHGA 1AFOA 2POHA 3HTKA 1OXZA 5BU8B 1JNMA 1CZQA 5AVZB 5BU5A 1H89A 3SWYA 1GL2B 1T2KC 1MUUA 2XDJA 3C9IA 3OJAB 1RF0C 3BVHA 2IFMA 1LWUC 2N1TB 3HD7C 4AQRD 1FJKA 2HG5D 1FZFA 2HFED 1NH4A 5CCGA 1SFCD 1N7SC 5AW7B 1M1JC 1JTHB 2N9BA 1FZCC 5APWA 2WTYA 2OYHC 3OAKA 1FU1A 1IFJA 1KFMA 4I2LC 3A5TA 1LTJA 2IX7C 1E5WA 4N3YB 3KQGA 5AVVB 3A2AA 1SQVK 3M91A 4GKGA 1LTSC 1XTGB 3V2NA 1CSBA 1RE3C 5AVSB 3L4FA 1NHLA 1FZBA 3BATA 4WY4C 5AW3B 2GM4A 2FFDB 3U1CA 2XU6A 1T3JA 2HLOA 1CI6A 1URQB 1LT9C 1FDMA 1H88A 4KHXA 2YKPA 3MTUE 4LGDE 4HH2A 2PP6A 3N4XA 2YKQA 2HYNA 2NPSD 1IO4A 2QM7A 3LIEA 4IFMA 2H43A 3L35A 4IFFA 3L37A 5KTBA 3P8CD 1JY2P 2KP8A 2WSEH 1LGHB 1A02F 5AW8B 3L36A 1G1JA 3HUSC 2XZRA 1CW5A 3HE5B 4N6JA 5CCGC 3LIDA 1FOSE 1GL2D 1JY3O 1LWUA 3P32A 4JF7A 4WB4A 1GDTA 3RK2D 1N73A 2Q9IA 1NKNA 1T3UA 1GU5A 2HPCB 1J1DC 1ZV8A 1DEBA 2N1TD 2YO2A 1YTZI 2R5BA 1N7SA 1M1JA 2M8RA 3R2PA 2OYHA 1L4AA 1NO4A 5APTA 1DH3A 1FZAA 5BVZA 1H8AA 2IFNA 1LTTC 2KYVA 1FAVA 3TNUB 5AW2B 3VP9A 3M9BA 1LTGC 2WPQA 2A45H 3B5NA 4DZOA 5CCHD 1J1EB 3P8MC 3V2PA 3PP5A 4N78D 1RE3A 1RF1C 1HH0A 1ZR2A 3KPEA 1L0NK 1NOHA 2W6AA 1KZUB 1X9VA 3RK3B 1N86A 1KQLA 3M06A 2I1JA 4RESB 5AW5B 3VP8A 1IK9A 3MGNA 3P8CE 3IFMA 1URQD 1VPCA 5APXA 5AW4B 3A3YB 3TK1A 3HD7B 1IFDA 2LKMA 1Z56A 1FZCB 5KJ7D 3N7NA 4C7RA 2E43A 2FKWB 3HE4A 2CPBA 1N73C 2NPSC 1G2CB 1ZLLA 1YTZT 2JEEA 3HUSA 1IFMA 1JOCA 3H32B 1GW4A 4JYBA 5AVXB 3V2QA 3WMM0 1IFIA 2XKMA 2R32A 3TYYA 3B8EB 1L4AC 1LTIC 1JCDA 4GT1A 4WY4B 3LW5H 1VDFA 1J2JB 5AVTB 1KILB 1KFNA 4C7NB 1LT9B 1NAFA 3B5NC 1NU1K 1GZLA 1X8YA 4JYCA 3RK2C 3GHGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RY3 A;  1CW5 A; 
#chains in the Genus database with same CATH topology
 2ZFC A;  1Q82 Q;  2P1J A;  2K9J A;  1BE3 D;  2AXT E;  2NZ2 A;  1RF1 A;  4OGQ B;  4XFJ A;  1M1K Q;  1RE4 C;  4OH8 B;  3NMD A;  3U1A A;  2Q6Q A;  2FYN C;  3BRV B;  3RK3 D;  3H1L G;  4BXL A;  5AW1 B;  2ZT9 D;  1W2E A;  1HGV A;  1MFZ A;  1N7L A;  2P67 A;  3CXH H;  3H1L E;  5KLV G;  2GUV A;  3NXS A;  1XTC C;  3ABV C;  4EIJ A;  1NTK K;  5KLV E;  4WBA A;  3L73 G;  5AVY B;  1WT6 A;  3PJS K;  1X79 B;  2D2C B;  3GF3 A;  5KJ7 C;  1GK4 A;  2Z4E A;  1ZN5 A;  3L73 E;  3AEA C;  3CCJ P;  1SQP K;  3V4Q A;  1FJP A;  1UII A;  1KIL D;  2FYU J;  3KYQ A;  5E79 E;  1JY2 O;  2E5T A;  4IL6 E;  1M56 D;  3CCL P;  1N73 B;  2KOG A;  5EFW B;  2O1J A;  2O1K A;  4D6T J;  1N7S B;  1OMI A;  1SP4 A;  1NVO A;  2AEF A;  1LTB C;  4XE5 B;  2WSF H;  3MUD C;  1BE3 J;  3CCV P;  2NRG A;  1SQQ K;  4XA4 A;  3VMZ A;  1NWQ A;  3VMY A;  2WPS A;  4R4L A;  1L2P A;  2E42 A;  1SQV G;  5AVR B;  2E76 C;  3IAO A;  5KAF E;  1NTM K;  2ZYA A;  2E74 B;  1SQV E;  3FWN A;  3C8V A;  2YO3 A;  4UB8 H;  1M7L A;  1QL1 A;  3TSI A;  4D6T G;  1S5L X;  4OGQ C;  5APQ A;  4D6T E;  1SFC B;  2H7H A;  3EFG A;  2HOD B;  3K5B A;  2FBW C;  1N2D C;  5B5E E;  3CC4 P;  4YXW H;  1L0L G;  3CX5 E;  1G2C A;  1NTZ K;  1SQX K;  1L0L E;  1EXI A;  1JMM A;  1G1I A;  1NU1 D;  5CHX A;  1P84 D;  1KIL A;  3JC2 2;  1SS1 A;  1FOS F;  2OYI B;  1AFO A;  1Q86 Q;  1OXZ A;  1GMJ A;  3W68 A;  3SFD C;  1ZRT E;  1KB9 D;  4U3F D;  2E5Y A;  5BU5 A;  3MHV A;  3C9I A;  2XDJ A;  3OJA B;  1RF0 C;  4MN4 C;  2IFM A;  2N1T B;  1RQV A;  5GTI E;  4K3A A;  4GOF A;  3CMA P;  2HFE D;  1NH4 A;  3H1H G;  1N7S C;  2KZJ A;  1FZC C;  1FDO A;  4ASV A;  1QVF O;  4EYY Q;  2IX7 C;  4PD4 D;  3KQG A;  3H1H E;  3QWO C;  3CXH I;  1HJ0 A;  3M91 A;  1LTS C;  2IYO A;  5DJU B;  4WY4 C;  2GM4 A;  3U1C A;  2WVR A;  1LT9 C;  1ZXG A;  3MTU E;  1R5L A;  2R44 A;  2YKQ A;  4L76 A;  1IO4 A;  3EWK A;  2H43 A;  3L37 A;  3P8C D;  2WSE H;  1KQS O;  3L71 D;  1LGH B;  5KAI H;  1QGK B;  3AE7 C;  1W2B O;  1KYO I;  1LP1 B;  4ZMD A;  2ZYD A;  3L75 G;  3Q3D A;  5DJT B;  1SQB D;  3RK2 D;  2Q9I A;  3CC7 P;  3BCC G;  1GU5 A;  1NU1 J;  3PLN A;  1ZV8 A;  1OVR A;  3L75 E;  3Q5S A;  1M1J A;  2M8R A;  2GA1 A;  4NPF X;  3BCC E;  1FZA A;  2E76 D;  3F89 A;  1LTT C;  1S5L H;  1FAV A;  1SQP G;  2QA4 P;  2FY8 A;  4U3F J;  1RHZ B;  1YQ4 C;  2SPZ A;  1SQP E;  2H89 C;  1L0N K;  1N86 A;  4RES B;  1IZN B;  2KZI A;  1IK9 A;  5M1B A;  1H0T A;  1BSH A;  3TK1 A;  3HD7 B;  3ZDM A;  4PV1 D;  2W90 A;  2Q1K A;  1S72 P;  3HUS A;  3H32 B;  3WMM 0;  2QJK C;  2XKM A;  2R32 A;  5H2F H;  1ZP0 C;  1L4A C;  1DIP A;  1R8E A;  1JCD A;  1K8A Q;  2WSC J;  3LW5 H;  1VDF A;  1KFN A;  4C7N B;  1KN7 A;  1AA0 A;  3L73 D;  3S9O A;  3A0H H;  1DD4 A;  3GHG B;  4ZKP A;  3L71 J;  4N78 E;  1KV4 A;  3RBZ A;  2N1T C;  1NYH A;  4EDF A;  2YNY A;  2VRS A;  2IBZ G;  1K9M Q;  1Y9B A;  3I5C A;  3IN6 A;  4Y99 C;  1SQB J;  3BAS A;  4UB8 E;  2XNX A;  2IBZ E;  2O01 J;  5CCH C;  3P7K A;  1SLQ A;  4HKZ H;  2WT7 A;  1T8Z A;  3ITK A;  3E1I A;  4DOJ A;  4TT3 H;  1OVU A;  4PJ0 H;  1PP9 G;  2QIW A;  3G3Z A;  2FXP A;  2KK7 A;  5AW0 B;  2JJL A;  2KS1 A;  1PP9 E;  1MV8 A;  4YTP C;  1OZH A;  3MUD A;  2OTL P;  2RH0 A;  4WVZ A;  2CPS A;  3D6Z A;  1YIJ P;  3T97 B;  1JY3 N;  4WY4 D;  2G3A A;  3CD6 P;  3V5B A;  2AEJ A;  1DX7 A;  2KI7 B;  2RMZ A;  3L71 G;  2M5A B;  2E75 B;  1JTH A;  5B66 H;  1SQV D;  3L71 E;  1N8R Q;  2K3R A;  2C9N Y;  1SQB G;  4HB1 A;  4AUW A;  1PFI A;  2K1A A;  3L73 J;  1SQB E;  3G4S P;  1JUN A;  2CK3 H;  3B5N B;  3H1I G;  3RK2 B;  2WWW A;  2Z5H A;  3H1I E;  5KKZ C;  1GL2 C;  3VN0 A;  4O9B A;  3AE2 C;  3RGU A;  3H6P A;  3HE5 A;  2WQY C;  2Q3E A;  3CX5 D;  3EFF K;  1HWT C;  2GUS A;  1L0L D;  5APU A;  2P2U A;  1JEK A;  3CCM P;  1T2K D;  3RL0 B;  2BCC J;  1AQ5 A;  1VF5 B;  2QSI A;  1YJ9 P;  1UIX A;  3TGU G;  3GHG C;  3TNU A;  1NAY A;  4I6M C;  5CBO A;  2FFD C;  5KAI E;  1URQ C;  3B4S A;  3TGU E;  1ZRT D;  1AV1 A;  1RY3 A;  1L4A D;  2R3C A;  4DCK A;  2K9J B;  1HTL C;  4W80 A;  3M0D A;  1RF0 A;  1ZR4 A;  1RF1 B;  1JMB A;  4ZNC A;  2W6B A;  3AEB C;  4LLH A;  2I8D A;  3FX0 A;  1SQV J;  1GTW A;  1S5L E;  3A0B H;  2KNC A;  1FZC A;  1FC2 C;  4H44 B;  3H1H D;  3MD0 A;  3G9R A;  5AVU B;  1QEX A;  3CPW O;  1KYO H;  1IC2 A;  4H0L B;  2QJY B;  3G6E P;  1HBW A;  2J59 M;  4W7Z A;  3AED C;  1VQ9 P;  1L0N G;  4WY4 A;  1YI2 P;  1BDD A;  2YMY A;  1KTM A;  1LT9 A;  3TF5 A;  3SFE C;  1J1E C;  1L0N E;  4M3L A;  5APY A;  2BCC G;  1QVG O;  1JY2 N;  5BU8 B;  1VQ8 P;  1YJW P;  3GW6 A;  2IDB A;  1BDC A;  1M8O B;  3SWY A;  1MUU A;  2BCC E;  3CXH D;  3BVH A;  1WMK A;  2KLU A;  5H2F E;  1JB0 J;  1L0L J;  1FU1 A;  1QX8 A;  1IFJ A;  3CWB D;  3L75 D;  4I2L C;  3A5T A;  3A0H E;  1LTJ A;  2M0B A;  1NTK D;  1S1C X;  3BCC D;  4I7Z B;  2Y0E A;  3C1L A;  4GKG A;  4RKU J;  1RE3 C;  1MKM A;  1NHL A;  4H13 B;  2XU6 A;  1T3J A;  1CI6 A;  1K05 A;  1SQP D;  1H88 A;  4KHX A;  4LGD E;  1EDJ A;  2PP6 A;  2NPS D;  3LIE A;  4JBZ A;  4IFM A;  1Q90 D;  3GG2 A;  2KP8 A;  3KXD A;  1IK7 A;  4PJ0 E;  2LXB A;  2JDI H;  1G1J A;  2A06 D;  3H1H J;  1LT1 A;  1FOS E;  1GL2 D;  1LWU A;  4JF7 A;  1VF5 C;  1NKN A;  1T3U A;  2R5B A;  1PV3 A;  3V6I A;  3R2P A;  1U57 A;  2OYH A;  1L4A A;  4EI2 A;  5APT A;  1H8A A;  3Q5P A;  4IL6 X;  2IFN A;  5TIS H;  3D71 A;  2A45 H;  3B71 A;  2D2C C;  3P8M C;  3V2P A;  4N78 D;  1RF1 C;  2W8Z A;  1HH0 A;  3KPE A;  1NOH A;  2W6A A;  1X9V A;  4L74 A;  3RK3 B;  2I1J A;  5B66 E;  1PZQ A;  1EDL A;  2ZT9 B;  1URQ D;  3F5H A;  5APX A;  2IBZ D;  4GDO A;  3A3Y B;  5L8R J;  2K9Y A;  1LJ2 A;  3CWB J;  1IFD A;  3L75 J;  1AVO A;  1NTK J;  1NTM D;  1Z56 A;  2QJY C;  1Q2N A;  5TJH A;  3BCC J;  3I56 P;  3O6Q A;  5KJ7 D;  2E43 A;  1PGQ A;  3HE4 A;  1N73 C;  1G2C B;  2JEE A;  1IFM A;  3L70 G;  3JCU H;  3TYY A;  3B8E B;  1LTI C;  1SQP J;  2Y0D A;  1OW7 A;  1PP9 D;  3L70 E;  2PRR A;  4Y28 J;  3GMA A;  4OWF A;  1M90 Q;  1J2J B;  1KIL B;  1NAF A;  2P10 A;  1GZL A;  2ZVO B;  2C0W A;  4GOD A;  4Z1M H;  2P7J A;  3FWL A;  4RJT A;  2WSF J;  3WUT A;  3NFQ A;  4IOI H;  3CXH E;  3NTN A;  1AVY A;  2QJP B;  3CCR P;  1A02 J;  3IR9 A;  4NPE A;  1VQK P;  3FGA D;  1J1D B;  2E74 C;  3CWB G;  4H13 C;  5KLV K;  2C0X A;  1NTK G;  2NPS A;  1NGM B;  3AE8 C;  3H1K G;  3CWB E;  1QLE D;  1NTK E;  3CI9 A;  2OYO A;  1NJI Q;  2UWJ E;  2Z5I A;  3H1K E;  1DD3 A;  3H1I D;  3A0B E;  1K04 A;  1SFC C;  1KC8 Q;  1GL2 A;  2FYZ A;  1KYO E;  1NTM J;  2WMM A;  4L75 A;  4AYC A;  1K73 Q;  2Y0C A;  4ASW A;  2OTK E;  2A06 G;  1WRG A;  3WU2 H;  3Q2Y A;  1RE4 A;  1EDK A;  3M9Q A;  4BRY A;  4OGQ D;  1PP9 J;  2YXR B;  1AJY A;  2A06 E;  4IL6 H;  3S4R A;  1M1J B;  3OA7 A;  2H8P D;  3L72 G;  1LTA C;  2FXM A;  1OW6 A;  1PIX A;  2V4H A;  3RK3 C;  2OGU A;  1SVF A;  3V4W A;  2FFD A;  3VMX A;  5AVQ B;  1BSN A;  2RN0 A;  3H1J G;  3TGU D;  1URQ A;  3L72 E;  1EQ7 A;  1FDI A;  2QEX P;  1SQQ G;  2OYI C;  2ZT9 C;  3H1J E;  2AXC A;  1SQQ E;  5KJ7 A;  5APV A;  3M9H A;  1IFN A;  3HTK B;  2D2C D;  1H0T B;  2ZXE B;  1NTZ J;  1SQX J;  2KIK A;  1HUC A;  5AW9 B;  1YYC A;  2B87 A;  1LNQ A;  4RO0 A;  2ZXX A;  1PPJ G;  1NTM G;  2N9Y B;  3SWF A;  2FYU K;  2ZYG A;  3HUS B;  2HPC A;  3CL3 D;  1JO5 A;  2BEQ D;  1KIL C;  3M0A A;  1PPJ E;  1NTM E;  4B86 A;  2Q7C A;  3EQ2 A;  2QE7 H;  2JWD A;  3H1I J;  5GTH H;  4PD4 I;  5CMZ A;  1L0N D;  3T97 A;  2A45 I;  1N7S D;  2W27 A;  1EZV I;  2BCC D;  2OAR A;  2PAJ A;  2KLV A;  1S9K E;  2QJP C;  1KOR A;  2R5D A;  3CLQ A;  2A45 G;  2K88 A;  1EZV G;  3E1R A;  1L0L K;  2R3S A;  2WSE J;  2WT7 B;  3II6 A;  3USS A;  3U59 A;  1NTZ G;  1SQX G;  1EZV E;  1YQ3 C;  3TGU J;  2QM8 A;  1NTZ E;  3V2R A;  1SQX E;  2KS1 B;  1DEE G;  4CPG A;  5CJ4 A;  4YPC A;  3PH0 A;  2KSJ A;  3GF7 A;  3AEE C;  3PTZ A;  1CZQ A;  1H89 A;  3AE9 C;  3AEF C;  2XND H;  3RL0 g;  1VQP P;  3JCU E;  2YMK A;  3HD7 C;  2IZ1 A;  1FJK A;  1E79 H;  1SFC D;  2E76 B;  5AW7 B;  1M1J C;  1JTH B;  1E5W A;  3A2A A;  1L0N J;  4A7P A;  3V2N A;  3AEG C;  3BAT A;  1PL5 A;  5AW3 B;  1KMI Z;  2M3E A;  1RQU A;  3GLM A;  3KZI H;  2YKP A;  2PGD A;  4HH2 A;  3SSU A;  1IFP A;  3N4X A;  2QM7 A;  4PV1 B;  2ITA A;  3LW5 J;  2B88 A;  3S1K A;  2KUB A;  3L36 A;  2KXP B;  2B9B A;  3HUS C;  2XZR A;  3HE5 B;  2YIU B;  4N6J A;  5CCG C;  2JWA A;  1OFC X;  4NPD A;  1N73 A;  3L74 J;  2H88 C;  2N1T D;  1M57 D;  2FXO A;  2Y9Y A;  1YTZ I;  1N7S A;  3L70 D;  4UB6 H;  3FXE A;  3D6Y A;  2JKV A;  3TNU B;  2O3J A;  1LTG C;  1ZME C;  2J5U A;  2WPQ A;  5CCH D;  3JSV C;  1KQL A;  3WU2 E;  2KSE A;  3M06 A;  4U7J A;  1VPC A;  1YJN P;  1USE A;  1ZW0 A;  1Q81 Q;  2K37 A;  2LKM A;  1Y47 A;  2E75 C;  2KNC B;  1FZC B;  3G71 P;  2FKW B;  2CPB A;  4JYB A;  1YTZ T;  1JOC A;  3TDK A;  2OQQ A;  3V2Q A;  2B89 A;  1USD A;  2WSS H;  1VQL P;  2QG4 A;  4WY4 B;  5AVT B;  3AE4 C;  3H1K D;  1LT9 B;  1FS0 E;  3B5N C;  3L74 G;  1NU1 K;  3FXD A;  3R4Y A;  1X8Y A;  3RK2 C;  3KDP B;  2PFX A;  2DW3 A;  3L74 E;  2V7Q H;  1SFC A;  1VQ5 P;  1KYO D;  1JM0 A;  1HVV A;  1JCC A;  1VQ7 P;  2HOD A;  1P84 H;  3WUU A;  2FYU G;  2LXC B;  4YXD C;  2W83 C;  5GTH E;  2FYU E;  1OWA A;  3L70 J;  3Q1M A;  1KB9 H;  5CJ0 A;  4HYT B;  1LTJ B;  2BAS A;  1QL2 A;  3E7K A;  3VOP A;  3HD7 D;  3PHL A;  3AE5 C;  3RL0 C;  3CX5 I;  3AE1 C;  3AE6 C;  2IZ0 A;  1GW3 A;  3L72 D;  1CI6 B;  4LC1 A;  4PV1 C;  2HR3 A;  2M3B A;  2OYI A;  3H1J D;  1EXJ A;  4PD4 H;  1BE3 G;  1KQF B;  5AVW B;  1SQQ D;  1Y8A A;  3VTP C;  1HGZ A;  3VYI A;  4EOT A;  1BCC D;  1BE3 E;  2YIU C;  1YBK A;  4IFD K;  3KHU A;  2N1T A;  3BRT B;  3O8Z A;  4W7Y A;  2WSC H;  3RK3 E;  2WPV B;  1LWU B;  2MJZ A;  1PGJ A;  2C9L Y;  1VQN P;  4H44 C;  2MKV A;  4KJM A;  1FZE A;  1PPJ D;  5CCH A;  4H0L C;  2QJK B;  1SQB K;  3VMA A;  2KB7 P;  3H1K J;  2OYH B;  1GD2 E;  1L4A B;  2JO1 A;  5CCG D;  3HRN A;  1X0T A;  1FE6 A;  2YXQ B;  1PGO A;  3Q5R A;  3MZW B;  3CCQ P;  2L5G B;  4ZKU A;  2XV5 A;  2LR2 A;  1VQ6 P;  1VQ4 P;  3M0D C;  2O01 H;  1S2E A;  1Q7Y Q;  1S9K D;  3CC2 P;  2P58 A;  1U7J A;  4K35 A;  5CBN A;  1KIL E;  4Y99 B;  1JY3 P;  1AQT A;  5APS A;  2G8Y A;  4JQ0 D;  1LP1 A;  1GU4 A;  3RBX A;  3O6Q B;  1MFT A;  3HE4 B;  1EZV D;  3KZI E;  1IJD B;  1OIP A;  2AXT H;  3L72 J;  3CCS P;  4I7Z C;  3QH9 A;  1NTZ D;  1SQX D;  4BWN A;  1BGY D;  2E75 D;  2WPR A;  5C39 A;  3H1J J;  4I1L A;  1PGP A;  4GIF A;  1SQQ J;  1FBM A;  3AE3 C;  1BCC J;  3IF4 A;  2J58 A;  2QRX A;  3WUV A;  2YKO A;  1MZ9 A;  2ZVN B;  2Q5U A;  4HJG H;  3B5N D;  2V7Q J;  1KQG B;  4UB6 E;  3HD7 A;  4R4M A;  3UIA A;  1LTJ C;  3A7O A;  1OVV A;  2IPP A;  4C46 A;  1NKZ B;  1VL2 A;  3MIW A;  2I1K A;  3H32 A;  1RH5 B;  1YHQ P;  2JP3 A;  2WZ7 A;  5KLI B;  2Q3I A;  1HJB A;  2NPS B;  2OTJ P;  5E79 H;  1FZG A;  1GK6 A;  3I55 P;  4DT0 A;  5AW6 B;  2WIT A;  1VQM P;  4C7N A;  3RL0 D;  3GHG A;  1X22 A;  3OW2 O;  2POH A;  3HTK A;  1JNM A;  1VF5 D;  5AVZ B;  5KKZ B;  1GL2 B;  2QVA A;  1T2K C;  1LWU C;  1BCC G;  1EC5 A;  1P84 I;  3H1L D;  4AQR D;  2HG5 D;  4WWI A;  1FZF A;  5CCG A;  1ZOY C;  1BCC E;  2N9B A;  5APW A;  4OVN F;  2WTY A;  2Y9Z A;  2OYH C;  3OAK A;  3D70 A;  4BRY B;  5KLV D;  1BGY J;  1KB9 I;  1KFM A;  2FYN B;  2IBZ I;  1U7M A;  4N3Y B;  1R5S A;  5AVV B;  2L91 A;  1SQV K;  1NU1 G;  1XTG B;  1CSB A;  1EDI A;  5AVS B;  3L4F A;  1FZB A;  4H44 D;  1NU1 E;  2FFD B;  5K5G B;  2HLO A;  1KD1 Q;  1P84 E;  1URQ B;  5KAF H;  3MP7 B;  1FDM A;  4H0L D;  4U3F G;  1S4X A;  2HYN A;  2AEM A;  1W5C E;  3L35 A;  4IFF A;  1KB9 E;  5KTB A;  4U3F E;  1JY2 P;  3SWK A;  1A02 F;  4JPZ B;  5AW8 B;  4DJG A;  1YIT P;  1CW5 A;  2M5A A;  2B87 B;  3LID A;  4WB4 A;  1JY3 O;  3P32 A;  1GDT A;  1D7M A;  2HPC B;  1J1D C;  2YO2 A;  1DEB A;  5TIS E;  1OW8 A;  4PD4 E;  5B5E H;  1NO4 A;  1DH3 A;  5BVZ A;  1OX3 A;  2KYV A;  5AW2 B;  3VP9 A;  3M9B A;  1BGY G;  3CX5 H;  3B5N A;  4KT0 J;  4DZO A;  3CCE P;  1J1E B;  2BEZ F;  3PP5 A;  1RE3 A;  1ZR2 A;  4L73 A;  1BGY E;  1HF9 A;  3L74 D;  1KZU B;  3CME P;  5AW5 B;  2ZJS E;  1VQO P;  2E74 D;  3H1L J;  3VP8 A;  3MGN A;  4H13 D;  2RKL A;  3P8C E;  3IFM A;  2W6J H;  5AW4 B;  5KLV J;  4GOE A;  2FYU D;  1TU3 F;  3N7N A;  2ZAE B;  3PRJ A;  4C7R A;  5KLI C;  3CCU P;  2JR8 A;  2NPS C;  1ZLL A;  5AVX B;  3AEC C;  1T6A A;  1GW4 A;  3H25 A;  1S3J A;  1IFI A;  2O01 N;  2IYP A;  5GTI H;  4TLF A;  3W67 A;  4GT1 A;  4QMA A;  4D6T D;  4JYC A; 
#chains in the Genus database with same CATH homology
 4ZKP A;  2ZFC A;  3KDP B;  4N78 E;  2C0W A;  2P1J A;  2N1T C;  2YNY A;  2VRS A;  1SFC A;  2P7J A;  1HVV A;  1RF1 A;  1JCC A;  3I5C A;  2HOD A;  4Y99 C;  1RE4 C;  4OH8 B;  3NMD A;  3U1A A;  3BAS A;  3NFQ A;  2XNX A;  3BRV B;  3RK3 D;  5CCH C;  3P7K A;  3NTN A;  1SLQ A;  1OWA A;  1A02 J;  5CJ0 A;  2WT7 A;  5AW1 B;  3IR9 A;  4HYT B;  1LTJ B;  1J1D B;  1T8Z A;  1W2E A;  2BAS A;  3E1I A;  1HGV A;  1MFZ A;  1N7L A;  2P67 A;  4DOJ A;  1QL2 A;  3VOP A;  3HD7 D;  2GUV A;  3NXS A;  5KLV K;  3G3Z A;  3RL0 C;  1XTC C;  2C0X A;  4EIJ A;  2NPS A;  1NTK K;  5AW0 B;  2JJL A;  4WBA A;  1GW3 A;  1CI6 B;  1MV8 A;  3CI9 A;  4LC1 A;  5AVY B;  1WT6 A;  3MUD A;  1X79 B;  2Z5I A;  5KJ7 C;  2M3B A;  1GK4 A;  2Z4E A;  2OYI A;  1ZN5 A;  2CPS A;  1SQP K;  5AVW B;  1JY3 N;  3VTP C;  1HGZ A;  1SFC C;  3VYI A;  3V4Q A;  1FJP A;  4WY4 D;  4EOT A;  1GL2 A;  1KIL D;  2FYZ A;  4IFD K;  3V5B A;  3KYQ A;  2N1T A;  4AYC A;  3BRT B;  1DX7 A;  3O8Z A;  1JY2 O;  4W7Y A;  2WSC H;  1WRG A;  1JTH A;  1LWU B;  2MJZ A;  1RE4 A;  2C9L Y;  1N73 B;  3M9Q A;  2KOG A;  2C9N Y;  2O1J A;  1FZE A;  2O1K A;  5CCH A;  1SQB K;  1N7S B;  1M1J B;  2KB7 P;  1SP4 A;  4AUW A;  2OYH B;  3OA7 A;  1GD2 E;  1PFI A;  1L4A B;  2H8P D;  5CCG D;  3HRN A;  1LTA C;  2FXM A;  1JUN A;  1LTB C;  3RK3 C;  1SVF A;  3V4W A;  2FFD A;  3VMX A;  2L5G B;  4XE5 B;  4ZKU A;  2XV5 A;  5AVQ B;  3B5N B;  1URQ A;  2WSF H;  1EQ7 A;  3M0D C;  2WWW A;  3RK2 B;  2OYI C;  1SQQ K;  2O01 H;  4XA4 A;  2Z5H A;  1S9K D;  3VMZ A;  5KJ7 A;  1NWQ A;  1GL2 C;  5APV A;  3VMY A;  3M9H A;  1IFN A;  3VN0 A;  3HTK B;  4O9B A;  4Y99 B;  2WPS A;  2ZXE B;  1JY3 P;  3H6P A;  1HUC A;  5APS A;  5AW9 B;  1YYC A;  2E42 A;  3HE5 A;  1GU4 A;  5AVR B;  3HE4 B;  1IJD B;  1NTM K;  2FYU K;  3HUS B;  3SWF A;  1HWT C;  2GUS A;  2HPC A;  3CL3 D;  5APU A;  1JO5 A;  2P2U A;  1KIL C;  3M0A A;  1T2K D;  3RL0 B;  4B86 A;  1AQ5 A;  2YO3 A;  2Q7C A;  2WPR A;  3EQ2 A;  1M7L A;  4I1L A;  3GHG C;  3TNU A;  1QL1 A;  3TSI A;  4GIF A;  4I6M C;  2FFD C;  5CMZ A;  3T97 A;  1FBM A;  1URQ C;  2A45 I;  1N7S D;  2W27 A;  2J58 A;  5APQ A;  1RY3 A;  1L4A D;  2R3C A;  1SFC B;  2OAR A;  2PAJ A;  1MZ9 A;  2YKO A;  2Q5U A;  1HTL C;  2KLV A;  4W80 A;  3M0D A;  1RF0 A;  1ZR4 A;  1RF1 B;  2H7H A;  1S9K E;  2W6B A;  3B5N D;  3EFG A;  2HOD B;  4LLH A;  1N2D C;  3HD7 A;  3CLQ A;  2R5D A;  2A45 G;  3UIA A;  1LTJ C;  3A7O A;  1GTW A;  2IPP A;  1FZC A;  4C46 A;  1L0L K;  1NKZ B;  3MIW A;  2WT7 B;  3II6 A;  1G2C A;  3MD0 A;  5AVU B;  2I1K A;  3H32 A;  3U59 A;  1IC2 A;  1NTZ K;  1HBW A;  1SQX K;  2J59 M;  1JMM A;  2WZ7 A;  2QM8 A;  2Q3I A;  1HJB A;  4W7Z A;  1G1I A;  2NPS B;  1FZG A;  3V2R A;  1GK6 A;  5CHX A;  4WY4 A;  5CJ4 A;  5AW6 B;  2WIT A;  1KIL A;  2YMY A;  2KSJ A;  4C7N A;  1LT9 A;  1FOS F;  1J1E C;  4M3L A;  2OYI B;  5APY A;  3RL0 D;  1JY2 N;  3GHG A;  1AFO A;  2POH A;  3HTK A;  1OXZ A;  5BU8 B;  1JNM A;  1CZQ A;  5AVZ B;  5BU5 A;  1H89 A;  3SWY A;  1GL2 B;  1T2K C;  1MUU A;  2XDJ A;  3C9I A;  3OJA B;  1RF0 C;  3BVH A;  2IFM A;  1LWU C;  2N1T B;  3HD7 C;  4AQR D;  1FJK A;  2HG5 D;  1FZF A;  2HFE D;  1NH4 A;  5CCG A;  1SFC D;  1N7S C;  5AW7 B;  1M1J C;  1JTH B;  2N9B A;  1FZC C;  5APW A;  2WTY A;  2OYH C;  3OAK A;  1FU1 A;  1IFJ A;  1KFM A;  4I2L C;  3A5T A;  1LTJ A;  2IX7 C;  1E5W A;  4N3Y B;  3KQG A;  5AVV B;  3A2A A;  1SQV K;  3M91 A;  4GKG A;  1LTS C;  1XTG B;  3V2N A;  1CSB A;  1RE3 C;  5AVS B;  3L4F A;  1NHL A;  1FZB A;  3BAT A;  4WY4 C;  5AW3 B;  2GM4 A;  2FFD B;  3U1C A;  2XU6 A;  1T3J A;  2HLO A;  1CI6 A;  1URQ B;  1LT9 C;  1FDM A;  1H88 A;  4KHX A;  2YKP A;  3MTU E;  4LGD E;  4HH2 A;  2PP6 A;  3N4X A;  2YKQ A;  2HYN A;  2NPS D;  1IO4 A;  2QM7 A;  3LIE A;  4IFM A;  2H43 A;  3L35 A;  4IFF A;  3L37 A;  5KTB A;  3P8C D;  1JY2 P;  2KP8 A;  2WSE H;  1LGH B;  1A02 F;  5AW8 B;  3L36 A;  1G1J A;  3HUS C;  2XZR A;  1CW5 A;  3HE5 B;  4N6J A;  5CCG C;  3LID A;  1FOS E;  1GL2 D;  1JY3 O;  1LWU A;  3P32 A;  4JF7 A;  4WB4 A;  1GDT A;  3RK2 D;  1N73 A;  2Q9I A;  1NKN A;  1T3U A;  1GU5 A;  2HPC B;  1J1D C;  1ZV8 A;  1DEB A;  2N1T D;  2YO2 A;  1YTZ I;  2R5B A;  1N7S A;  1M1J A;  2M8R A;  3R2P A;  2OYH A;  1L4A A;  1NO4 A;  5APT A;  1DH3 A;  1FZA A;  5BVZ A;  1H8A A;  2IFN A;  1LTT C;  2KYV A;  1FAV A;  3TNU B;  5AW2 B;  3VP9 A;  3M9B A;  1LTG C;  2WPQ A;  2A45 H;  3B5N A;  4DZO A;  5CCH D;  1J1E B;  3P8M C;  3V2P A;  3PP5 A;  4N78 D;  1RE3 A;  1RF1 C;  1HH0 A;  1ZR2 A;  3KPE A;  1L0N K;  1NOH A;  2W6A A;  1KZU B;  1X9V A;  3RK3 B;  1N86 A;  1KQL A;  3M06 A;  2I1J A;  4RES B;  5AW5 B;  3VP8 A;  1IK9 A;  3MGN A;  3P8C E;  3IFM A;  1URQ D;  1VPC A;  5APX A;  5AW4 B;  3A3Y B;  3TK1 A;  3HD7 B;  1IFD A;  2LKM A;  1Z56 A;  1FZC B;  5KJ7 D;  3N7N A;  4C7R A;  2E43 A;  2FKW B;  3HE4 A;  2CPB A;  1N73 C;  2NPS C;  1G2C B;  1ZLL A;  1YTZ T;  2JEE A;  3HUS A;  1IFM A;  1JOC A;  3H32 B;  1GW4 A;  4JYB A;  5AVX B;  3V2Q A;  3WMM 0;  1IFI A;  2XKM A;  2R32 A;  3TYY A;  3B8E B;  1L4A C;  1LTI C;  1JCD A;  4GT1 A;  4WY4 B;  3LW5 H;  1VDF A;  1J2J B;  5AVT B;  1KIL B;  1KFN A;  4C7N B;  1LT9 B;  1NAF A;  3B5N C;  1NU1 K;  1GZL A;  1X8Y A;  4JYC A;  3RK2 C;  3GHG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...