1RY3A

Nmr solution structure of the precursor for carnobacteriocin b2, an antimicrobial peptide from carnobacterium piscicola
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
MNSVKELNVKEMKQLHGGVNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic
molecule keywords Bacteriocin carnobacteriocin B2
publication title NMR solution structure of the precursor for carnobacteriocin B2, an antimicrobial peptide from Carnobacterium piscicola.
pubmed doi rcsb
source organism Carnobacterium maltaromaticum
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2003-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01721 Bacteriocin_II Class II bacteriocin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.130 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ry3A00
1RY3A 1CW5A
chains in the Genus database with same CATH superfamily
4JPZB 2POHA 1JY3P 4RESB 4U3FJ 2LXBA 4DT0A 3NTNA 3M9BA 2O1KA 4C7NB 3AE1C 3H1KD 1AFOA 1SS1A 1QX8A 1R8EA 3KQGA 2VRSA 1LWUA 3FWNA 4BXLA 5GTHH 4AQRD 3L73E 1PGJA 2OYOA 2WSEH 3CX5E 1M1JB 4BWNA 1JY3O 2BCCE 2E75D 2N9YB 2NPSC 2LXCB 1N73C 4U3FE 1W2BO 4N3YB 3V2NA 4H44B 3VMZA 1NU1K 1NU1D 1OFCX 1KFMA 2QEXP 2KP8A 1T3JA 2GUSA 1S9KE 1UIXA 2E76D 1BCCG 3V2PA 3GLMA 4EIJA 1MKMA 5APWA 2QJYC 1OVRA 2IBZD 1L0LJ 1NHLA 2M5AA 1N73A 3BCCD 3I5CA 3GF3A 3CWBD 1KILC 2OYIB 2ZAEB 2KLVA 1QVFO 1HUCA 1X9VA 4WWIA 1KB9E 2H89C 2WVRA 2Y0CA 1N7SB 2HR3A 3B71A 1YTZI 3WU2E 1YIJP 1L0LE 1RF0C 2KSJA 3HE4B 4N78E 1AQ5A 2WITA 2V7QH 3L36A 1MFZA 3MUDA 1KILA 3M06A 1AV1A 4L73A 1FDMA 1KD1Q 3V6IA 3HTKA 3D6YA 4ZKPA 5AW0B 3II6A 4PJ0E 1PPJG 1LP1B 1BGYD 2NPSD 3E7KA 3L74G 2ZJSE 1RF0A 4NPEA 2B88A 2ZFCA 5K5GB 4JYBA 3HE5B 4LGDE 1YBKA 1PP9D 1YI2P 2UWJE 2FFDA 2N1TA 1KORA 2KZJA 1VQOP 1GL2B 4GOEA 2KI7B 2AEJA 2RH0A 2QM8A 1KILD 2QJKC 2A45I 1X79B 1SLQA 2WSFH 3L73G 1ZMEC 2Q7CA 5TJHA 5KLIB 4UB8E 2WPVB 2BCCG 2QJPC 3H1KJ 3CCEP 4U3FG 3G4SP 1IK9A 2WT7B 1DD3A 2WMMA 5AW7B 1PGPA 1RE3C 2ZVOB 3H6PA 3AE6C 1JCCA 1M1KQ 2K88A 3AEAC 2ITAA 3VYIA 1T2KC 4OWFA 3RL0B 5APQA 2N1TD 3L70D 3H1KE 4H13B 1NU1J 4TT3H 3AE4C 1GU4A 1RE3A 1NKZB 1VL2A 3JC22 5GTIH 4L75A 2Q3IA 3R4YA 1PL5A 5AVXB 1JOCA 3I55P 2D2CC 4GT1A 2QVAA 4LLHA 3BCCJ 1JO5A 1L0LG 1NJIQ 4KJMA 3CCJP 1NU1E 2IZ1A 1IFDA 3CX5H 3U59A 2IBZE 4DJGA 2P1JA 1OW7A 1DIPA 3TDKA 3CXHD 1FZEA 3BCCE 5KKZB 1HBWA 3A2AA 1KQSO 1PPJD 1H0TB 2H8PD 2JO1A 3SWYA 2GUVA 1KC8Q 3NFQA 3L74D 1BGYJ 3G71P 1ZRTD 1M1JC 4XA4A 1T2KD 3E1IA 2HYNA 4H44C 1KMIZ 1N8RQ 4K3AA 5AW6B 4OH8B 1PP9J 1PFIA 1LNQA 2KUBA 1MFTA 2J58A 3H32B 1LT9B 4ZKUA 1BGYE 2HLOA 1M1JA 1LJ2A 2D2CD 3OW2O 4XFJA 3HTKB 3RK2B 1RQVA 3MZWB 2IPPA 1J1DB 3FWLA 4GDOA 2OYIC 1KZUB 4L74A 2YXQB 4PJ0H 3CC2P 1NGMB 4U3FD 1PP9E 2GA1A 2QSIA 1N7SC 1NTKG 4AUWA 2OARA 2KZIA 1NTMK 1NTMD 2XNDH 3QWOC 1RH5B 1HTLC 1NTZK 2FFDB 1CSBA 1NOHA 2FXMA 1JNMA 5B66E 1KILE 2OYIA 2L91A 2N1TB 3E1RA 1SP4A 3FXDA 2NZ2A 4W7ZA 1BSNA 1NVOA 3L70J 5KAFE 1FDOA 3CCLP 1JTHA 1KB9D 1W5CE 3HE4A 1NU1G 1WMKA 4H44D 2YKQA 3AE7C 3KDPB 4UB8H 1CZQA 2HODA 3A3YB 1L0LD 3Q5SA 4N78D 4YPCA 4R4MA 1JY2P 3RL0g 1CW5A 2IBZG 1RY3A 1LP1A 2G3AA 2Z4EA 3L70E 3CI9A 1URQB 1GL2C 2MJZA 1M8OB 1R5SA 3HE5A 2W83C 5E79H 1YQ3C 1GDTA 3GHGB 3KXDA 3V4WA 5KLIC 3CX5I 2W6JH 1JY2O 3EWKA 1N7SD 1G2CA 2FYNB 1OWAA 1A02F 1A02J 3TK1A 3H1LJ 2QIWA 3P8MC 1FC2C 1YYCA 2CPSA 2SPZA 3RBXA 3EQ2A 3VMYA 3CCRP 4EI2A 2WWWA 1JY3N 5AW8B 4GODA 2FBWC 1BGYG 2B9BA 3RL0C 4H13C 2WT7A 3CXHE 5TISE 1KYOD 3Q5PA 3Q5RA 4KHXA 1PPJE 4I7ZB 3H1LE 1PP9G 1KB9I 4Y99B 2WPRA 2E74B 2PRRA 3AE3C 1EDKA 4D6TJ 2JWAA 2A45H 2G8YA 5KLVG 1IFIA 5AVSB 1GD2E 2KIKA 3V5BA 1CI6B 1NTKK 1GL2D 1NTKD 3IR9A 3CD6P 5APXA 4UB6E 2ZYAA 1IK7A 3L37A 2C0XA 3AEDC 1NTMJ 1Q82Q 1FDIA 2KSEA 3MGNA 1NTZJ 1L0NJ 3V4QA 3HD7B 2J59M 3A0HH 2BASA 5KKZC 2WSCJ 3P32A 1HH0A 4ASVA 3USSA 3PRJA 1IC2A 1FJKA 2FKWB 2RKLA 1NKNA 3L70G 1NTME 1P84D 3RL0D 2ZXEB 4H13D 2IX7C 1NTZE 1QEXA 1H0TA 3GF7A 4RKUJ 4GKGA 1LT9C 4K35A 3CL3D 2WPQA 3MUDC 3L71J 4H0LB 3RK2C 1HVVA 2K9JB 3P7KA 1MZ9A 1J1DC 1FZBA 1LTJA 1L4AB 2JR8A 3H1IJ 1JTHB 1FAVA 3JSVC 1R5LA 1VQ7P 2B89A 3H32A 1LT9A 2PP6A 3D70A 1Q81Q 2PGDA 3N4XA 4NPFX 2HODB 3L71E 1ZOYC 1S5LX 5APYA 4JYCA 2I1JA 5CJ0A 2FFDC 3H1LG 2O01N 1EQ7A 1HF9A 2N1TC 2NRGA 2R5DA 2ZYDA 2AXTE 1VQMP 5B5EE 3H1IE 1G1IA 1VQ4P 2YNYA 4EDFA 2M8RA 4IFDK 1LTAC 2ZT9B 1QGKB 1L2PA 1G1JA 4RJTA 1U7MA 3BRVB 1G2CB 3G3ZA 5KLVD 5KLVK 1VQLP 2M0BA 3LW5J 1SQPK 1SQPD 4Y28J 3CMEP 4D6TG 2IBZI 1HJ0A 2K1AA 1SQVK 1SQVD 3CLQA 1NTKJ 1GW4A 3RK2D 1KYOE 1URQC 1JMMA 4O9BA 3A0BH 5CHXA 1NH4A 4IFFA 3P8CD 5AVYB 3GHGC 1S4XA 2Y0DA 2QE7H 4ZNCA 1BE3D 1J2JB 3CXHH 5TISH 1OW6A 2FYNC 1NTMG 3L75J 4JQ0D 2KNCB 1FOSF 5DJTB 1NTZG 1GU5A 1L0NG 5DJUB 3EFFK 1URQA 3CC4P 4IL6E 2P58A 1NTKE 2FYUK 4I2LC 2YXRB 4EYYQ 3WUVA 1PZQA 3PJSK 5BVZA 4PD4E 3GHGA 3C8VA 3FXEA 1RF1B 4YXDC 1RHZB 3IFMA 2Z5IA 1IJDB 1SQQK 3L75E 2Y9ZA 3KZIE 3RK3B 3IN6A 2P2UA 4I7ZC 4PV1D 1HWTC 4OGQB 4Y99C 1VQ5P 1LTIC 2KXPB 2E74C 2QA4P 4L76A 1YJNP 1AVOA 2KB7P 1M56D 5CCHC 3VMAA 3L71G 1P84E 4A7PA 1DEBA 1URQD 1E5WA 4W80A 5AVQB 5L8RJ 1LTBC 3H1IG 2IYPA 5C39A 2C9NY 3RK3E 3C1LA 5CCHA 3H1LD 2Y9YA 5AW1B 1JEKA 3IAOA 5AVVB 1S72P 1IZNB 4DZOA 3M9HA 3HD7C 2WSCH 1CI6A 2FY8A 2QM7A 1K73Q 1M90Q 1GK4A 3VP8A 2R3CA 2H43A 1S5LE 3B4SA 1LTJB 1KB9H 2YO3A 3WUUA 3K5BA 3SFEC 1IO4A 1FBMA 3W67A 1VQ8P 2ZVNB 5KLVJ 3HD7A 2W8ZA 3V2RA 3CCVP 3WU2H 2PFXA 4D6TD 5GTHE 1SQPJ 3C9IA 2XZRA 1WRGA 2E74D 4EOTA 1JM0A 1SQVJ 2Q5UA 1FS0E 5AW4B 3F89A 2WZ7A 4H0LC 3L72G 5CCHD 5CJ4A 3SWKA 1GMJA 3GMAA 1DH3A 3ABVC 1KFNA 2R5BA 2AXTH 5KLVE 1L4AC 5B5EH 1KN7A 1U7JA 1BE3J 1QLED 1JY2N 5BU5A 1SQPE 3TNUB 2E43A 1NTZD 1L0NK 1L0ND 3M91A 4WVZA 2RMZA 1SQVE 1KTMA 3SWFA 2V7QJ 3CXHI 1FZCA 2FYUJ 3L75G 2K9JA 1PGQA 4R4LA 3HD7D 2K37A 4HH2A 2O3JA 1L4AA 3P8CE 3D6ZA 1LGHB 1IFMA 1SQXK 3CCMP 1EDLA 2R32A 4ASWA 3RBZA 1NAFA 1BE3E 4PV1B 1X0TA 2P7JA 3NXSA 1MV8A 1SQQJ 1KYOH 3OA7A 2ZT9C 1OW8A 2W90A 1USEA 2ZYGA 2P10A 2JEEA 1SQBK 2FYUE 3BRTB 4CPGA 1NWQA 1ZXGA 4QMAA 3LW5H 3L71D 2IFNA 4I6MC 1ZP0C 2XDJA 4IOIH 5AVWB 4C7RA 1SQQE 4H0LD 2KYVA 3H1ID 1BSHA 3CC7P 1IFJA 1LTSC 2FXPA 2CK3H 1ZW0A 2YIUB 1L4AD 4M3LA 3B5NB 1VQ6P 3H1HD 3TF5A 2HPCA 1EZVE 3G9RA 3KZIH 2GM4A 3G6EP 1XTCC 2Z5HA 2OTJP 2RN0A 1ZN5A 3L4FA 4KT0J 4RO0A 3AE8C 2WSSH 4YTPC 1KQLA 1RF1C 1P84H 2KOGA 2QG4A 2IFMA 2JWDA 1K05A 2KNCA 2ZT9D 3FGAD 1FZGA 1H89A 2A06D 3AE5C 5H2FE 3HUSA 2DW3A 3RK3C 1XTGB 3AE9C 3MHVA 4OGQC 1EC5A 1SQPG 3L72D 1ZR4A 2AEMA 3MTUE 1RF1A 1SQVG 2YKPA 3ZDMA 2OYHB 2OGUA 4W7YA 4IL6X 4PD4D 1ZR2A 4JBZA 3A5TA 4JF7A 2P67A 4D6TE 3JCUE 3V2QA 1S5LH 2OTKE 1Q90D 1QL2A 3VP9A 1BE3G 3L75D 4U7JA 3TGUD 4AYCA 3PHLA 2E5YA 4WY4A 1FE6A 2FYUG 1SVFA 2Q1KA 3CCUP 1SQXJ 5AVZB 2L5GB 2IZ0A 2JP3A 1L0NE 4HKZH 5AVTB 1VQ9P 1LTJC 1FJPA 1Q86Q 3U1AA 1SQQG 2BEZF 1SQBJ 1KYOI 3S1KA 3RK3D 3T97B 1VDFA 1YTZT 1W2EA 3B8EB 1FZCB 4OGQD 2O01J 5B66H 1SQXE 2NPSA 1KQGB 2YMYA 3S9OA 1EZVG 4WY4D 3KHUA 2W27A 2HFED 5KAFH 3AEBC 3QH9A 3O6QA 2Q9IA 1OMIA 1SQBE 1DD4A 4DCKA 3BASA 2BEQD 1JMBA 3TYYA 3H1HJ 4PD4I 1T6AA 3PH0A 4I1LA 5APTA 2KS1B 1Y9BA 4LC1A 2LKMA 3H1JJ 5KAIE 4GIFA 3CMAP 1YHQP 4B86A 1E79H 1OZHA 2YO2A 2C9LY 1TU3F 1PV3A 2FXOA 4IFMA 3TNUA 3H1HE 3ITKA 4PV1C 3AEGC 3MIWA 2B87A 2WQYC 1P84I 1GK6A 1S1CX 1MUUA 1Y47A 1USDA 2I1KA 3H1JE 3L35A 2K9YA 1U57A 3H25A 2HPCB 3L72J 2R3SA 3IF4A 1LTGC 1VF5B 1PGOA 1SFCB 1X22A 1N86A 3Q2YA 2N9BA 2HG5D 4HYTB 2CPBA 1HGZA 3EFGA 3FX0A 4WBAA 2I8DA 2OTLP 2A06E 2JDIH 5KTBA 4HB1A 1PIXA 3GG2A 2YIUC 1YQ4C 3RGUA 1KV4A 3TGUJ 3B5NC 3L72E 4OVNF 3VTPC 2WTYA 3HUSB 1EXJA 5M1BA 2FYUD 1J1EB 2W6AA 1H8AA 2K3RA 2PAJA 2E75B 5H2FH 2H7HA 4XE5B 2OQQA 3SSUA 2IYOA 3MD0A 2Q6QA 3NMDA 5AW5B 5E79E 4C46A 1JUNA 3VOPA 1SQXG 1SQQD 3B5NA 1ZLLA 3O8ZA 4BRYB 3WUTA 4NPDA 3TGUE 2E76B 3M0DC 4UB6H 1AA0A 2C0WA 1BCCD 1FOSE 1LTTC 3JCUH 1OVUA 4N6JA 1HJBA 1SQBG 3LIDA 1NYHA 3GW6A 4WY4B 1JCDA 1EZVD 1LWUB 3W68A 3VMXA 1EXIA 1VQKP 3PLNA 1K8AQ 3CWBJ 3M0DA 1VPCA 4MN4C 3BATA 1GW3A 2OYHC 1DX7A 3A7OA 5APSA 2E5TA 1K9MQ 4HJGH 1ZV8A 2JKVA 3B5ND 3H1HG 3LIEA 3TSIA 3CWBE 3F5HA 1GTWA 2WSEJ 1EDJA 3M0AA 2OYHA 2NPSB 2M5AB 1EDIA 2E42A 1N73B 4DOJA 3H1JG 1UIIA 1OIPA 2XU6A 5CMZA 2Q3EA 2J5UA 3MP7B 1YJ9P 1FU1A 1VQPP 1WT6A 1OXZA 3KPEA 3BVHA 3O6QB 1X8YA 2R44A 4C7NA 2M3BA 1YITP 1Q2NA 2QJYB 5EFWB 3CCQP 2A06G 3A0HE 1VQNP 3I56P 2XKMA 5CCGC 3Q3DA 3M9QA 1KILB 2O01H 1FZCC 3AEEC 3HRNA 2JJLA 1AVYA 3L73D 1LT1A 1EZVI 5KAIH 3CX5D 2BCCD 3N7NA 1OX3A 5AVUB 5APUA 5CBOA 5CCGA 2B87B 3Q1MA 2LR2A 3T97A 1N2DC 3TGUG 3H1KG 3OJAB 1S9KD 2ZXXA 1NAYA 1D7MA 3OAKA 1RQUA 2XV5A 2YKOA 1SQXD 3PP5A 1Z56A 4YXWH 1N7SA 1AQTA 2H88C 5KJ7C 1KQFB 2M3EA 5AVRB 1HGVA 1GZLA 1RE4C 1BCCJ 1DEEG 1SQBD 4GOFA 2KLUA 1YJWP 2KS1A 5AW2B 1FZAA 2XNXA 3PTZA 1L0LK 2WPSA 5AW9B 1BDCA 2AXCA 5CCGD 3U1CA 3CCSP 5KJ7A 4IL6H 2KK7A 1IFNA 1VF5C 2YMKA 3CPWO 3VN0A 2QJKB 2A45G 1SFCC 3AEFC 1RE4A 1M57D 2WSFJ 3BCCG 5APVA 3CWBG 5CBNA 1BCCE 4PD4H 2QJPB 2Y0EA 4Z1MH 3R2PA 1QL1A 4ZMDA 1H88A 1Y8AA 1FZFA 2FYZA 1SFCA 3UIAA 3HUSC 3H1JD 1J1EC 1NO4A 1K04A 1GL2A 2E75C 3SFDC 4TLFA 1M7LA 3L74J 3WMM0 3A0BE 3S4RA 1QVGO 1OVVA 2QRXA 3AECC 2O1JA 1JB0J 3KYQA 4WB4A 1Q7YQ 1AJYA 2AEFA 5KJ7D 2MKVA 2E76C 1N7LA 5AW3B 2W6BA 2D2CB 1IFPA 3AE2C 4WY4C 1S2EA 3L74E 1LWUC 1ZRTE 1S3JA 3L73J 1BDDA 1T3UA 1VF5D 2IDBA 2V4HA 4BRYA 1SFCD 5BU8B 3D71A 1T8ZA 5GTIE 2BCCJ
chains in the Genus database with same CATH topology
1E5WA 4IFMA 2POHA 1JTHA 1JY3P 4W80A 3TNUA 4RESB 3HE4A 5AVQB 1LTBC 3NTNA 3MIWA 3M9BA 2O1KA 2YKQA 4C7NB 3KDPB 1GK6A 1AFOA 1MUUA 2C9NY 3KQGA 1CZQA 1LWUA 2HODA 2VRSA 2I1KA 3A3YB 4N78D 5CCHA 5AW1B 1JY2P 3L35A 5AVVB 2HPCB 1CW5A 4DZOA 3M9HA 4AQRD 1RY3A 3HD7C 1LTGC 2WSCH 2Z4EA 1CI6A 2WSEH 1SFCB 1N86A 2QM7A 3CI9A 1M1JB 2N9BA 1GK4A 1JY3O 1URQB 2HG5D 2NPSC 4HYTB 2CPBA 2R3CA 3VP8A 1GL2C 2MJZA 1N73C 1HGZA 2H43A 3EFGA 3HE5A 4N3YB 3V2NA 4WBAA 1LTJB 3VMZA 2YO3A 1GDTA 1NU1K 3GHGB 3V4WA 1KFMA 5KTBA 1IO4A 2KP8A 1FBMA 1T3JA 2GUSA 1JY2O 1N7SD 1S9KE 1G2CA 3HD7A 3V2RA 1OWAA 3B5NC 3V2PA 1A02F 4EIJA 3VTPC 2WTYA 3HUSB 1A02J 5APWA 3TK1A 3C9IA 1NHLA 1J1EB 2XZRA 3P8MC 1WRGA 2W6AA 1H8AA 1N73A 1YYCA 2PAJA 2CPSA 2H7HA 4EOTA 4XE5B 2Q5UA 3I5CA 3EQ2A 1KILC 3VMYA 5AW4B 2WZ7A 2OYIB 2WWWA 3MD0A 5CCHD 1JY3N 5CJ4A 5AW8B 2KLVA 1HUCA 1X9VA 3NMDA 5AW5B 1DH3A 4C46A 1JUNA 3VOPA 3RL0C 1KFNA 1ZLLA 1N7SB 2R5BA 3B5NA 3O8ZA 1L4AC 2WT7A 3M0DC 1YTZI 2C0WA 1JY2N 5BU5A 4KHXA 1FOSE 3TNUB 1LTTC 1RF0C 2KSJA 3HE4B 4N78E 2E43A 1L0NK 1AQ5A 4Y99B 2WPRA 2WITA 3M91A 4N6JA 1HJBA 3L36A 1MFZA 3MUDA 1KILA 3LIDA 3M06A 4WY4B 1JCDA 3SWFA 1FDMA 2A45H 1FZCA 3HTKA 1LWUB 1IFIA 5AVSB 1GD2E 4ZKPA 5AW0B 3HD7D 3II6A 3VMXA 4HH2A 1L4AA 3V5BA 3M0DA 3P8CE 1VPCA 1CI6B 1LGHB 2NPSD 1NTKK 1GL2D 1IFMA 1SQXK 3BATA 1GW3A 2R32A 2OYHC 1RF0A 3IR9A 1NAFA 1DX7A 2P7JA 2ZFCA 3NXSA 3A7OA 1MV8A 5APSA 5APXA 4JYBA 3OA7A 3HE5B 3L37A 2C0XA 4LGDE 1ZV8A 3MGNA 2JEEA 1SQBK 3BRTB 3B5ND 3V4QA 2FFDA 3HD7B 3LIEA 2J59M 1NWQA 3TSIA 2BASA 3LW5H 2N1TA 3P32A 1GTWA 2IFNA 3M0AA 1HH0A 2OYHA 2NPSB 4I6MC 2XDJA 1GL2B 2E42A 1N73B 1IC2A 5AVWB 4DOJA 1FJKA 2QM8A 1KILD 2XU6A 2FKWB 2A45I 5CMZA 1X79B 4C7RA 1SLQA 2WSFH 2KYVA 1FU1A 1WT6A 1OXZA 2Q7CA 1IFJA 1NKNA 3KPEA 1LTSC 3BVHA 3RL0D 2ZXEB 1L4AD 2IX7C 1X8YA 4C7NA 4M3LA 3B5NB 2M3BA 1IK9A 2WT7B 5AW7B 1RE3C 3H6PA 2HPCA 2XKMA 4GKGA 1JCCA 1LT9C 5CCGC 3CL3D 2WPQA 2GM4A 3M9QA 1XTCC 2Z5HA 1KILB 2O01H 1FZCC 3VYIA 3HRNA 2JJLA 3RK2C 1ZN5A 1HVVA 1T2KC 3L4FA 3P7KA 1MZ9A 1J1DC 3RL0B 5APQA 1FZBA 1LTJA 1L4AB 2N1TD 1KQLA 1RF1C 1GU4A 2KOGA 1JTHB 3N7NA 1FAVA 1RE3A 1NKZB 2IFMA 5AVUB 5APUA 3H32A 1LT9A 5CCGA 2Q3IA 1FZGA 2PP6A 3T97A 1H89A 5AVXB 3N4XA 3HUSA 3RK3C 1XTGB 1N2DC 2HODB 1JOCA 4GT1A 3OJAB 5APYA 1S9KD 4JYCA 4LLHA 2I1JA 1JO5A 5CJ0A 2FFDC 1ZR4A 1EQ7A 2N1TC 3MTUE 3OAKA 1RF1A 2R5DA 2XV5A 2YKOA 3PP5A 2YKPA 1G1IA 2OYHB 2YNYA 1Z56A 1IFDA 1N7SA 2M8RA 4W7YA 1ZR2A 4IFDK 5KJ7C 1LTAC 3A5TA 4JF7A 2P67A 5AVRB 1HGVA 1GZLA 1RE4C 3U59A 1G1JA 3V2QA 3BRVB 1G2CB 1QL2A 2P1JA 3VP9A 3G3ZA 5AW2B 5KLVK 1FZEA 1FZAA 4AYCA 2XNXA 4WY4A 1HBWA 3A2AA 1SQPK 1L0LK 2WPSA 2H8PD 5AW9B 3SWYA 5CCGD 3U1CA 2GUVA 3NFQA 5KJ7A 1SVFA 1IFNA 1SQVK 3VN0A 3CLQA 2A45G 1SFCC 1M1JC 1GW4A 1RE4A 4XA4A 3RK2D 1URQC 5APVA 1T2KD 5AVZB 1JMMA 2L5GB 4O9BA 3E1IA 5CHXA 1NH4A 4IFFA 5AVTB 2HYNA 3P8CD 1LTJC 5AVYB 1FJPA 5AW6B 4OH8B 3GHGC 3U1AA 3R2PA 1PFIA 1J2JB 1QL1A 2J58A 1H88A 3H32B 1LT9B 1FZFA 1FOSF 2FYZA 3RK3D 1SFCA 3UIAA 3HUSC 4ZKUA 2HLOA 1M1JA 1VDFA 1GU5A 1YTZT 1W2EA 3B8EB 1URQA 1FZCB 1J1EC 1NO4A 3HTKB 2FYUK 2NPSA 3RK2B 1GL2A 4I2LC 2IPPA 1M7LA 1J1DB 2YMYA 3WMM0 4WY4D 5BVZA 2OYIC 3GHGA 2W27A 1KZUB 1RF1B 2HFED 2O1JA 3KYQA 4WB4A 2Q9IA 3IFMA 5KJ7D 1N7SC 2Z5IA 4AUWA 1IJDB 1SQQK 3BASA 3TYYA 1N7LA 3RK3B 2OARA 5AW3B 1NTMK 4I1LA 2P2UA 2W6BA 1HWTC 5APTA 1HTLC 4Y99C 1NTZK 1LTIC 2FFDB 1CSBA 1NOHA 2FXMA 1JNMA 4WY4C 2OYIA 4LC1A 2LKMA 2N1TB 2KB7P 1LWUC 5CCHC 1SP4A 4GIFA 4W7ZA 1T3UA 4B86A 1SFCD 5BU8B 1T8ZA 2YO2A 1DEBA 2C9LY 1URQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RY3 A;  1CW5 A; 
#chains in the Genus database with same CATH topology
 4JPZ B;  2POH A;  1JY3 P;  4RES B;  4U3F J;  2LXB A;  4DT0 A;  3NTN A;  3M9B A;  2O1K A;  4C7N B;  3AE1 C;  3H1K D;  1AFO A;  1SS1 A;  1QX8 A;  1R8E A;  3KQG A;  2VRS A;  1LWU A;  3FWN A;  4BXL A;  5GTH H;  4AQR D;  3L73 E;  1PGJ A;  2OYO A;  2WSE H;  3CX5 E;  1M1J B;  4BWN A;  1JY3 O;  2BCC E;  2E75 D;  2N9Y B;  2NPS C;  2LXC B;  1N73 C;  4U3F E;  1W2B O;  4N3Y B;  3V2N A;  4H44 B;  3VMZ A;  1NU1 K;  1NU1 D;  1OFC X;  1KFM A;  2QEX P;  2KP8 A;  1T3J A;  2GUS A;  1S9K E;  1UIX A;  2E76 D;  1BCC G;  3V2P A;  3GLM A;  4EIJ A;  1MKM A;  5APW A;  2QJY C;  1OVR A;  2IBZ D;  1L0L J;  1NHL A;  2M5A A;  1N73 A;  3BCC D;  3I5C A;  3GF3 A;  3CWB D;  1KIL C;  2OYI B;  2ZAE B;  2KLV A;  1QVF O;  1HUC A;  1X9V A;  4WWI A;  1KB9 E;  2H89 C;  2WVR A;  2Y0C A;  1N7S B;  2HR3 A;  3B71 A;  1YTZ I;  3WU2 E;  1YIJ P;  1L0L E;  1RF0 C;  2KSJ A;  3HE4 B;  4N78 E;  1AQ5 A;  2WIT A;  2V7Q H;  3L36 A;  1MFZ A;  3MUD A;  1KIL A;  3M06 A;  1AV1 A;  4L73 A;  1FDM A;  1KD1 Q;  3V6I A;  3HTK A;  3D6Y A;  4ZKP A;  5AW0 B;  3II6 A;  4PJ0 E;  1PPJ G;  1LP1 B;  1BGY D;  2NPS D;  3E7K A;  3L74 G;  2ZJS E;  1RF0 A;  4NPE A;  2B88 A;  2ZFC A;  5K5G B;  4JYB A;  3HE5 B;  4LGD E;  1YBK A;  1PP9 D;  1YI2 P;  2UWJ E;  2FFD A;  2N1T A;  1KOR A;  2KZJ A;  1VQO P;  1GL2 B;  4GOE A;  2KI7 B;  2AEJ A;  2RH0 A;  2QM8 A;  1KIL D;  2QJK C;  2A45 I;  1X79 B;  1SLQ A;  2WSF H;  3L73 G;  1ZME C;  2Q7C A;  5TJH A;  5KLI B;  4UB8 E;  2WPV B;  2BCC G;  2QJP C;  3H1K J;  3CCE P;  4U3F G;  3G4S P;  1IK9 A;  2WT7 B;  1DD3 A;  2WMM A;  5AW7 B;  1PGP A;  1RE3 C;  2ZVO B;  3H6P A;  3AE6 C;  1JCC A;  1M1K Q;  2K88 A;  3AEA C;  2ITA A;  3VYI A;  1T2K C;  4OWF A;  3RL0 B;  5APQ A;  2N1T D;  3L70 D;  3H1K E;  4H13 B;  1NU1 J;  4TT3 H;  3AE4 C;  1GU4 A;  1RE3 A;  1NKZ B;  1VL2 A;  3JC2 2;  5GTI H;  4L75 A;  2Q3I A;  3R4Y A;  1PL5 A;  5AVX B;  1JOC A;  3I55 P;  2D2C C;  4GT1 A;  2QVA A;  4LLH A;  3BCC J;  1JO5 A;  1L0L G;  1NJI Q;  4KJM A;  3CCJ P;  1NU1 E;  2IZ1 A;  1IFD A;  3CX5 H;  3U59 A;  2IBZ E;  4DJG A;  2P1J A;  1OW7 A;  1DIP A;  3TDK A;  3CXH D;  1FZE A;  3BCC E;  5KKZ B;  1HBW A;  3A2A A;  1KQS O;  1PPJ D;  1H0T B;  2H8P D;  2JO1 A;  3SWY A;  2GUV A;  1KC8 Q;  3NFQ A;  3L74 D;  1BGY J;  3G71 P;  1ZRT D;  1M1J C;  4XA4 A;  1T2K D;  3E1I A;  2HYN A;  4H44 C;  1KMI Z;  1N8R Q;  4K3A A;  5AW6 B;  4OH8 B;  1PP9 J;  1PFI A;  1LNQ A;  2KUB A;  1MFT A;  2J58 A;  3H32 B;  1LT9 B;  4ZKU A;  1BGY E;  2HLO A;  1M1J A;  1LJ2 A;  2D2C D;  3OW2 O;  4XFJ A;  3HTK B;  3RK2 B;  1RQV A;  3MZW B;  2IPP A;  1J1D B;  3FWL A;  4GDO A;  2OYI C;  1KZU B;  4L74 A;  2YXQ B;  4PJ0 H;  3CC2 P;  1NGM B;  4U3F D;  1PP9 E;  2GA1 A;  2QSI A;  1N7S C;  1NTK G;  4AUW A;  2OAR A;  2KZI A;  1NTM K;  1NTM D;  2XND H;  3QWO C;  1RH5 B;  1HTL C;  1NTZ K;  2FFD B;  1CSB A;  1NOH A;  2FXM A;  1JNM A;  5B66 E;  1KIL E;  2OYI A;  2L91 A;  2N1T B;  3E1R A;  1SP4 A;  3FXD A;  2NZ2 A;  4W7Z A;  1BSN A;  1NVO A;  3L70 J;  5KAF E;  1FDO A;  3CCL P;  1JTH A;  1KB9 D;  1W5C E;  3HE4 A;  1NU1 G;  1WMK A;  4H44 D;  2YKQ A;  3AE7 C;  3KDP B;  4UB8 H;  1CZQ A;  2HOD A;  3A3Y B;  1L0L D;  3Q5S A;  4N78 D;  4YPC A;  4R4M A;  1JY2 P;  3RL0 g;  1CW5 A;  2IBZ G;  1RY3 A;  1LP1 A;  2G3A A;  2Z4E A;  3L70 E;  3CI9 A;  1URQ B;  1GL2 C;  2MJZ A;  1M8O B;  1R5S A;  3HE5 A;  2W83 C;  5E79 H;  1YQ3 C;  1GDT A;  3GHG B;  3KXD A;  3V4W A;  5KLI C;  3CX5 I;  2W6J H;  1JY2 O;  3EWK A;  1N7S D;  1G2C A;  2FYN B;  1OWA A;  1A02 F;  1A02 J;  3TK1 A;  3H1L J;  2QIW A;  3P8M C;  1FC2 C;  1YYC A;  2CPS A;  2SPZ A;  3RBX A;  3EQ2 A;  3VMY A;  3CCR P;  4EI2 A;  2WWW A;  1JY3 N;  5AW8 B;  4GOD A;  2FBW C;  1BGY G;  2B9B A;  3RL0 C;  4H13 C;  2WT7 A;  3CXH E;  5TIS E;  1KYO D;  3Q5P A;  3Q5R A;  4KHX A;  1PPJ E;  4I7Z B;  3H1L E;  1PP9 G;  1KB9 I;  4Y99 B;  2WPR A;  2E74 B;  2PRR A;  3AE3 C;  1EDK A;  4D6T J;  2JWA A;  2A45 H;  2G8Y A;  5KLV G;  1IFI A;  5AVS B;  1GD2 E;  2KIK A;  3V5B A;  1CI6 B;  1NTK K;  1GL2 D;  1NTK D;  3IR9 A;  3CD6 P;  5APX A;  4UB6 E;  2ZYA A;  1IK7 A;  3L37 A;  2C0X A;  3AED C;  1NTM J;  1Q82 Q;  1FDI A;  2KSE A;  3MGN A;  1NTZ J;  1L0N J;  3V4Q A;  3HD7 B;  2J59 M;  3A0H H;  2BAS A;  5KKZ C;  2WSC J;  3P32 A;  1HH0 A;  4ASV A;  3USS A;  3PRJ A;  1IC2 A;  1FJK A;  2FKW B;  2RKL A;  1NKN A;  3L70 G;  1NTM E;  1P84 D;  3RL0 D;  2ZXE B;  4H13 D;  2IX7 C;  1NTZ E;  1QEX A;  1H0T A;  3GF7 A;  4RKU J;  4GKG A;  1LT9 C;  4K35 A;  3CL3 D;  2WPQ A;  3MUD C;  3L71 J;  4H0L B;  3RK2 C;  1HVV A;  2K9J B;  3P7K A;  1MZ9 A;  1J1D C;  1FZB A;  1LTJ A;  1L4A B;  2JR8 A;  3H1I J;  1JTH B;  1FAV A;  3JSV C;  1R5L A;  1VQ7 P;  2B89 A;  3H32 A;  1LT9 A;  2PP6 A;  3D70 A;  1Q81 Q;  2PGD A;  3N4X A;  4NPF X;  2HOD B;  3L71 E;  1ZOY C;  1S5L X;  5APY A;  4JYC A;  2I1J A;  5CJ0 A;  2FFD C;  3H1L G;  2O01 N;  1EQ7 A;  1HF9 A;  2N1T C;  2NRG A;  2R5D A;  2ZYD A;  2AXT E;  1VQM P;  5B5E E;  3H1I E;  1G1I A;  1VQ4 P;  2YNY A;  4EDF A;  2M8R A;  4IFD K;  1LTA C;  2ZT9 B;  1QGK B;  1L2P A;  1G1J A;  4RJT A;  1U7M A;  3BRV B;  1G2C B;  3G3Z A;  5KLV D;  5KLV K;  1VQL P;  2M0B A;  3LW5 J;  1SQP K;  1SQP D;  4Y28 J;  3CME P;  4D6T G;  2IBZ I;  1HJ0 A;  2K1A A;  1SQV K;  1SQV D;  3CLQ A;  1NTK J;  1GW4 A;  3RK2 D;  1KYO E;  1URQ C;  1JMM A;  4O9B A;  3A0B H;  5CHX A;  1NH4 A;  4IFF A;  3P8C D;  5AVY B;  3GHG C;  1S4X A;  2Y0D A;  2QE7 H;  4ZNC A;  1BE3 D;  1J2J B;  3CXH H;  5TIS H;  1OW6 A;  2FYN C;  1NTM G;  3L75 J;  4JQ0 D;  2KNC B;  1FOS F;  5DJT B;  1NTZ G;  1GU5 A;  1L0N G;  5DJU B;  3EFF K;  1URQ A;  3CC4 P;  4IL6 E;  2P58 A;  1NTK E;  2FYU K;  4I2L C;  2YXR B;  4EYY Q;  3WUV A;  1PZQ A;  3PJS K;  5BVZ A;  4PD4 E;  3GHG A;  3C8V A;  3FXE A;  1RF1 B;  4YXD C;  1RHZ B;  3IFM A;  2Z5I A;  1IJD B;  1SQQ K;  3L75 E;  2Y9Z A;  3KZI E;  3RK3 B;  3IN6 A;  2P2U A;  4I7Z C;  4PV1 D;  1HWT C;  4OGQ B;  4Y99 C;  1VQ5 P;  1LTI C;  2KXP B;  2E74 C;  2QA4 P;  4L76 A;  1YJN P;  1AVO A;  2KB7 P;  1M56 D;  5CCH C;  3VMA A;  3L71 G;  1P84 E;  4A7P A;  1DEB A;  1URQ D;  1E5W A;  4W80 A;  5AVQ B;  5L8R J;  1LTB C;  3H1I G;  2IYP A;  5C39 A;  2C9N Y;  3RK3 E;  3C1L A;  5CCH A;  3H1L D;  2Y9Y A;  5AW1 B;  1JEK A;  3IAO A;  5AVV B;  1S72 P;  1IZN B;  4DZO A;  3M9H A;  3HD7 C;  2WSC H;  1CI6 A;  2FY8 A;  2QM7 A;  1K73 Q;  1M90 Q;  1GK4 A;  3VP8 A;  2R3C A;  2H43 A;  1S5L E;  3B4S A;  1LTJ B;  1KB9 H;  2YO3 A;  3WUU A;  3K5B A;  3SFE C;  1IO4 A;  1FBM A;  3W67 A;  1VQ8 P;  2ZVN B;  5KLV J;  3HD7 A;  2W8Z A;  3V2R A;  3CCV P;  3WU2 H;  2PFX A;  4D6T D;  5GTH E;  1SQP J;  3C9I A;  2XZR A;  1WRG A;  2E74 D;  4EOT A;  1JM0 A;  1SQV J;  2Q5U A;  1FS0 E;  5AW4 B;  3F89 A;  2WZ7 A;  4H0L C;  3L72 G;  5CCH D;  5CJ4 A;  3SWK A;  1GMJ A;  3GMA A;  1DH3 A;  3ABV C;  1KFN A;  2R5B A;  2AXT H;  5KLV E;  1L4A C;  5B5E H;  1KN7 A;  1U7J A;  1BE3 J;  1QLE D;  1JY2 N;  5BU5 A;  1SQP E;  3TNU B;  2E43 A;  1NTZ D;  1L0N K;  1L0N D;  3M91 A;  4WVZ A;  2RMZ A;  1SQV E;  1KTM A;  3SWF A;  2V7Q J;  3CXH I;  1FZC A;  2FYU J;  3L75 G;  2K9J A;  1PGQ A;  4R4L A;  3HD7 D;  2K37 A;  4HH2 A;  2O3J A;  1L4A A;  3P8C E;  3D6Z A;  1LGH B;  1IFM A;  1SQX K;  3CCM P;  1EDL A;  2R32 A;  4ASW A;  3RBZ A;  1NAF A;  1BE3 E;  4PV1 B;  1X0T A;  2P7J A;  3NXS A;  1MV8 A;  1SQQ J;  1KYO H;  3OA7 A;  2ZT9 C;  1OW8 A;  2W90 A;  1USE A;  2ZYG A;  2P10 A;  2JEE A;  1SQB K;  2FYU E;  3BRT B;  4CPG A;  1NWQ A;  1ZXG A;  4QMA A;  3LW5 H;  3L71 D;  2IFN A;  4I6M C;  1ZP0 C;  2XDJ A;  4IOI H;  5AVW B;  4C7R A;  1SQQ E;  4H0L D;  2KYV A;  3H1I D;  1BSH A;  3CC7 P;  1IFJ A;  1LTS C;  2FXP A;  2CK3 H;  1ZW0 A;  2YIU B;  1L4A D;  4M3L A;  3B5N B;  1VQ6 P;  3H1H D;  3TF5 A;  2HPC A;  1EZV E;  3G9R A;  3KZI H;  2GM4 A;  3G6E P;  1XTC C;  2Z5H A;  2OTJ P;  2RN0 A;  1ZN5 A;  3L4F A;  4KT0 J;  4RO0 A;  3AE8 C;  2WSS H;  4YTP C;  1KQL A;  1RF1 C;  1P84 H;  2KOG A;  2QG4 A;  2IFM A;  2JWD A;  1K05 A;  2KNC A;  2ZT9 D;  3FGA D;  1FZG A;  1H89 A;  2A06 D;  3AE5 C;  5H2F E;  3HUS A;  2DW3 A;  3RK3 C;  1XTG B;  3AE9 C;  3MHV A;  4OGQ C;  1EC5 A;  1SQP G;  3L72 D;  1ZR4 A;  2AEM A;  3MTU E;  1RF1 A;  1SQV G;  2YKP A;  3ZDM A;  2OYH B;  2OGU A;  4W7Y A;  4IL6 X;  4PD4 D;  1ZR2 A;  4JBZ A;  3A5T A;  4JF7 A;  2P67 A;  4D6T E;  3JCU E;  3V2Q A;  1S5L H;  2OTK E;  1Q90 D;  1QL2 A;  3VP9 A;  1BE3 G;  3L75 D;  4U7J A;  3TGU D;  4AYC A;  3PHL A;  2E5Y A;  4WY4 A;  1FE6 A;  2FYU G;  1SVF A;  2Q1K A;  3CCU P;  1SQX J;  5AVZ B;  2L5G B;  2IZ0 A;  2JP3 A;  1L0N E;  4HKZ H;  5AVT B;  1VQ9 P;  1LTJ C;  1FJP A;  1Q86 Q;  3U1A A;  1SQQ G;  2BEZ F;  1SQB J;  1KYO I;  3S1K A;  3RK3 D;  3T97 B;  1VDF A;  1YTZ T;  1W2E A;  3B8E B;  1FZC B;  4OGQ D;  2O01 J;  5B66 H;  1SQX E;  2NPS A;  1KQG B;  2YMY A;  3S9O A;  1EZV G;  4WY4 D;  3KHU A;  2W27 A;  2HFE D;  5KAF H;  3AEB C;  3QH9 A;  3O6Q A;  2Q9I A;  1OMI A;  1SQB E;  1DD4 A;  4DCK A;  3BAS A;  2BEQ D;  1JMB A;  3TYY A;  3H1H J;  4PD4 I;  1T6A A;  3PH0 A;  4I1L A;  5APT A;  2KS1 B;  1Y9B A;  4LC1 A;  2LKM A;  3H1J J;  5KAI E;  4GIF A;  3CMA P;  1YHQ P;  4B86 A;  1E79 H;  1OZH A;  2YO2 A;  2C9L Y;  1TU3 F;  1PV3 A;  2FXO A;  4IFM A;  3TNU A;  3H1H E;  3ITK A;  4PV1 C;  3AEG C;  3MIW A;  2B87 A;  2WQY C;  1P84 I;  1GK6 A;  1S1C X;  1MUU A;  1Y47 A;  1USD A;  2I1K A;  3H1J E;  3L35 A;  2K9Y A;  1U57 A;  3H25 A;  2HPC B;  3L72 J;  2R3S A;  3IF4 A;  1LTG C;  1VF5 B;  1PGO A;  1SFC B;  1X22 A;  1N86 A;  3Q2Y A;  2N9B A;  2HG5 D;  4HYT B;  2CPB A;  1HGZ A;  3EFG A;  3FX0 A;  4WBA A;  2I8D A;  2OTL P;  2A06 E;  2JDI H;  5KTB A;  4HB1 A;  1PIX A;  3GG2 A;  2YIU C;  1YQ4 C;  3RGU A;  1KV4 A;  3TGU J;  3B5N C;  3L72 E;  4OVN F;  3VTP C;  2WTY A;  3HUS B;  1EXJ A;  5M1B A;  2FYU D;  1J1E B;  2W6A A;  1H8A A;  2K3R A;  2PAJ A;  2E75 B;  5H2F H;  2H7H A;  4XE5 B;  2OQQ A;  3SSU A;  2IYO A;  3MD0 A;  2Q6Q A;  3NMD A;  5AW5 B;  5E79 E;  4C46 A;  1JUN A;  3VOP A;  1SQX G;  1SQQ D;  3B5N A;  1ZLL A;  3O8Z A;  4BRY B;  3WUT A;  4NPD A;  3TGU E;  2E76 B;  3M0D C;  4UB6 H;  1AA0 A;  2C0W A;  1BCC D;  1FOS E;  1LTT C;  3JCU H;  1OVU A;  4N6J A;  1HJB A;  1SQB G;  3LID A;  1NYH A;  3GW6 A;  4WY4 B;  1JCD A;  1EZV D;  1LWU B;  3W68 A;  3VMX A;  1EXI A;  1VQK P;  3PLN A;  1K8A Q;  3CWB J;  3M0D A;  1VPC A;  4MN4 C;  3BAT A;  1GW3 A;  2OYH C;  1DX7 A;  3A7O A;  5APS A;  2E5T A;  1K9M Q;  4HJG H;  1ZV8 A;  2JKV A;  3B5N D;  3H1H G;  3LIE A;  3TSI A;  3CWB E;  3F5H A;  1GTW A;  2WSE J;  1EDJ A;  3M0A A;  2OYH A;  2NPS B;  2M5A B;  1EDI A;  2E42 A;  1N73 B;  4DOJ A;  3H1J G;  1UII A;  1OIP A;  2XU6 A;  5CMZ A;  2Q3E A;  2J5U A;  3MP7 B;  1YJ9 P;  1FU1 A;  1VQP P;  1WT6 A;  1OXZ A;  3KPE A;  3BVH A;  3O6Q B;  1X8Y A;  2R44 A;  4C7N A;  2M3B A;  1YIT P;  1Q2N A;  2QJY B;  5EFW B;  3CCQ P;  2A06 G;  3A0H E;  1VQN P;  3I56 P;  2XKM A;  5CCG C;  3Q3D A;  3M9Q A;  1KIL B;  2O01 H;  1FZC C;  3AEE C;  3HRN A;  2JJL A;  1AVY A;  3L73 D;  1LT1 A;  1EZV I;  5KAI H;  3CX5 D;  2BCC D;  3N7N A;  1OX3 A;  5AVU B;  5APU A;  5CBO A;  5CCG A;  2B87 B;  3Q1M A;  2LR2 A;  3T97 A;  1N2D C;  3TGU G;  3H1K G;  3OJA B;  1S9K D;  2ZXX A;  1NAY A;  1D7M A;  3OAK A;  1RQU A;  2XV5 A;  2YKO A;  1SQX D;  3PP5 A;  1Z56 A;  4YXW H;  1N7S A;  1AQT A;  2H88 C;  5KJ7 C;  1KQF B;  2M3E A;  5AVR B;  1HGV A;  1GZL A;  1RE4 C;  1BCC J;  1DEE G;  1SQB D;  4GOF A;  2KLU A;  1YJW P;  2KS1 A;  5AW2 B;  1FZA A;  2XNX A;  3PTZ A;  1L0L K;  2WPS A;  5AW9 B;  1BDC A;  2AXC A;  5CCG D;  3U1C A;  3CCS P;  5KJ7 A;  4IL6 H;  2KK7 A;  1IFN A;  1VF5 C;  2YMK A;  3CPW O;  3VN0 A;  2QJK B;  2A45 G;  1SFC C;  3AEF C;  1RE4 A;  1M57 D;  2WSF J;  3BCC G;  5APV A;  3CWB G;  5CBN A;  1BCC E;  4PD4 H;  2QJP B;  2Y0E A;  4Z1M H;  3R2P A;  1QL1 A;  4ZMD A;  1H88 A;  1Y8A A;  1FZF A;  2FYZ A;  1SFC A;  3UIA A;  3HUS C;  3H1J D;  1J1E C;  1NO4 A;  1K04 A;  1GL2 A;  2E75 C;  3SFD C;  4TLF A;  1M7L A;  3L74 J;  3WMM 0;  3A0B E;  3S4R A;  1QVG O;  1OVV A;  2QRX A;  3AEC C;  2O1J A;  1JB0 J;  3KYQ A;  4WB4 A;  1Q7Y Q;  1AJY A;  2AEF A;  5KJ7 D;  2MKV A;  2E76 C;  1N7L A;  5AW3 B;  2W6B A;  2D2C B;  1IFP A;  3AE2 C;  4WY4 C;  1S2E A;  3L74 E;  1LWU C;  1ZRT E;  1S3J A;  3L73 J;  1BDD A;  1T3U A;  1VF5 D;  2IDB A;  2V4H A;  4BRY A;  1SFC D;  5BU8 B;  3D71 A;  1T8Z A;  5GTI E;  2BCC J; 
#chains in the Genus database with same CATH homology
 1E5W A;  4IFM A;  2POH A;  1JTH A;  1JY3 P;  4W80 A;  3TNU A;  4RES B;  3HE4 A;  5AVQ B;  1LTB C;  3NTN A;  3MIW A;  3M9B A;  2O1K A;  2YKQ A;  4C7N B;  3KDP B;  1GK6 A;  1AFO A;  1MUU A;  2C9N Y;  3KQG A;  1CZQ A;  1LWU A;  2HOD A;  2VRS A;  2I1K A;  3A3Y B;  4N78 D;  5CCH A;  5AW1 B;  1JY2 P;  3L35 A;  5AVV B;  2HPC B;  1CW5 A;  4DZO A;  3M9H A;  4AQR D;  1RY3 A;  3HD7 C;  1LTG C;  2WSC H;  2Z4E A;  1CI6 A;  2WSE H;  1SFC B;  1N86 A;  2QM7 A;  3CI9 A;  1M1J B;  2N9B A;  1GK4 A;  1JY3 O;  1URQ B;  2HG5 D;  2NPS C;  4HYT B;  2CPB A;  2R3C A;  3VP8 A;  1GL2 C;  2MJZ A;  1N73 C;  1HGZ A;  2H43 A;  3EFG A;  3HE5 A;  4N3Y B;  3V2N A;  4WBA A;  1LTJ B;  3VMZ A;  2YO3 A;  1GDT A;  1NU1 K;  3GHG B;  3V4W A;  1KFM A;  5KTB A;  1IO4 A;  2KP8 A;  1FBM A;  1T3J A;  2GUS A;  1JY2 O;  1N7S D;  1S9K E;  1G2C A;  3HD7 A;  3V2R A;  1OWA A;  3B5N C;  3V2P A;  1A02 F;  4EIJ A;  3VTP C;  2WTY A;  3HUS B;  1A02 J;  5APW A;  3TK1 A;  3C9I A;  1NHL A;  1J1E B;  2XZR A;  3P8M C;  1WRG A;  2W6A A;  1H8A A;  1N73 A;  1YYC A;  2PAJ A;  2CPS A;  2H7H A;  4EOT A;  4XE5 B;  2Q5U A;  3I5C A;  3EQ2 A;  1KIL C;  3VMY A;  5AW4 B;  2WZ7 A;  2OYI B;  2WWW A;  3MD0 A;  5CCH D;  1JY3 N;  5CJ4 A;  5AW8 B;  2KLV A;  1HUC A;  1X9V A;  3NMD A;  5AW5 B;  1DH3 A;  4C46 A;  1JUN A;  3VOP A;  3RL0 C;  1KFN A;  1ZLL A;  1N7S B;  2R5B A;  3B5N A;  3O8Z A;  1L4A C;  2WT7 A;  3M0D C;  1YTZ I;  2C0W A;  1JY2 N;  5BU5 A;  4KHX A;  1FOS E;  3TNU B;  1LTT C;  1RF0 C;  2KSJ A;  3HE4 B;  4N78 E;  2E43 A;  1L0N K;  1AQ5 A;  4Y99 B;  2WPR A;  2WIT A;  3M91 A;  4N6J A;  1HJB A;  3L36 A;  1MFZ A;  3MUD A;  1KIL A;  3LID A;  3M06 A;  4WY4 B;  1JCD A;  3SWF A;  1FDM A;  2A45 H;  1FZC A;  3HTK A;  1LWU B;  1IFI A;  5AVS B;  1GD2 E;  4ZKP A;  5AW0 B;  3HD7 D;  3II6 A;  3VMX A;  4HH2 A;  1L4A A;  3V5B A;  3M0D A;  3P8C E;  1VPC A;  1CI6 B;  1LGH B;  2NPS D;  1NTK K;  1GL2 D;  1IFM A;  1SQX K;  3BAT A;  1GW3 A;  2R32 A;  2OYH C;  1RF0 A;  3IR9 A;  1NAF A;  1DX7 A;  2P7J A;  2ZFC A;  3NXS A;  3A7O A;  1MV8 A;  5APS A;  5APX A;  4JYB A;  3OA7 A;  3HE5 B;  3L37 A;  2C0X A;  4LGD E;  1ZV8 A;  3MGN A;  2JEE A;  1SQB K;  3BRT B;  3B5N D;  3V4Q A;  2FFD A;  3HD7 B;  3LIE A;  2J59 M;  1NWQ A;  3TSI A;  2BAS A;  3LW5 H;  2N1T A;  3P32 A;  1GTW A;  2IFN A;  3M0A A;  1HH0 A;  2OYH A;  2NPS B;  4I6M C;  2XDJ A;  1GL2 B;  2E42 A;  1N73 B;  1IC2 A;  5AVW B;  4DOJ A;  1FJK A;  2QM8 A;  1KIL D;  2XU6 A;  2FKW B;  2A45 I;  5CMZ A;  1X79 B;  4C7R A;  1SLQ A;  2WSF H;  2KYV A;  1FU1 A;  1WT6 A;  1OXZ A;  2Q7C A;  1IFJ A;  1NKN A;  3KPE A;  1LTS C;  3BVH A;  3RL0 D;  2ZXE B;  1L4A D;  2IX7 C;  1X8Y A;  4C7N A;  4M3L A;  3B5N B;  2M3B A;  1IK9 A;  2WT7 B;  5AW7 B;  1RE3 C;  3H6P A;  2HPC A;  2XKM A;  4GKG A;  1JCC A;  1LT9 C;  5CCG C;  3CL3 D;  2WPQ A;  2GM4 A;  3M9Q A;  1XTC C;  2Z5H A;  1KIL B;  2O01 H;  1FZC C;  3VYI A;  3HRN A;  2JJL A;  3RK2 C;  1ZN5 A;  1HVV A;  1T2K C;  3L4F A;  3P7K A;  1MZ9 A;  1J1D C;  3RL0 B;  5APQ A;  1FZB A;  1LTJ A;  1L4A B;  2N1T D;  1KQL A;  1RF1 C;  1GU4 A;  2KOG A;  1JTH B;  3N7N A;  1FAV A;  1RE3 A;  1NKZ B;  2IFM A;  5AVU B;  5APU A;  3H32 A;  1LT9 A;  5CCG A;  2Q3I A;  1FZG A;  2PP6 A;  3T97 A;  1H89 A;  5AVX B;  3N4X A;  3HUS A;  3RK3 C;  1XTG B;  1N2D C;  2HOD B;  1JOC A;  4GT1 A;  3OJA B;  5APY A;  1S9K D;  4JYC A;  4LLH A;  2I1J A;  1JO5 A;  5CJ0 A;  2FFD C;  1ZR4 A;  1EQ7 A;  2N1T C;  3MTU E;  3OAK A;  1RF1 A;  2R5D A;  2XV5 A;  2YKO A;  3PP5 A;  2YKP A;  1G1I A;  2OYH B;  2YNY A;  1Z56 A;  1IFD A;  1N7S A;  2M8R A;  4W7Y A;  1ZR2 A;  4IFD K;  5KJ7 C;  1LTA C;  3A5T A;  4JF7 A;  2P67 A;  5AVR B;  1HGV A;  1GZL A;  1RE4 C;  3U59 A;  1G1J A;  3V2Q A;  3BRV B;  1G2C B;  1QL2 A;  2P1J A;  3VP9 A;  3G3Z A;  5AW2 B;  5KLV K;  1FZE A;  1FZA A;  4AYC A;  2XNX A;  4WY4 A;  1HBW A;  3A2A A;  1SQP K;  1L0L K;  2WPS A;  2H8P D;  5AW9 B;  3SWY A;  5CCG D;  3U1C A;  2GUV A;  3NFQ A;  5KJ7 A;  1SVF A;  1IFN A;  1SQV K;  3VN0 A;  3CLQ A;  2A45 G;  1SFC C;  1M1J C;  1GW4 A;  1RE4 A;  4XA4 A;  3RK2 D;  1URQ C;  5APV A;  1T2K D;  5AVZ B;  1JMM A;  2L5G B;  4O9B A;  3E1I A;  5CHX A;  1NH4 A;  4IFF A;  5AVT B;  2HYN A;  3P8C D;  1LTJ C;  5AVY B;  1FJP A;  5AW6 B;  4OH8 B;  3GHG C;  3U1A A;  3R2P A;  1PFI A;  1J2J B;  1QL1 A;  2J58 A;  1H88 A;  3H32 B;  1LT9 B;  1FZF A;  1FOS F;  2FYZ A;  3RK3 D;  1SFC A;  3UIA A;  3HUS C;  4ZKU A;  2HLO A;  1M1J A;  1VDF A;  1GU5 A;  1YTZ T;  1W2E A;  3B8E B;  1URQ A;  1FZC B;  1J1E C;  1NO4 A;  3HTK B;  2FYU K;  2NPS A;  3RK2 B;  1GL2 A;  4I2L C;  2IPP A;  1M7L A;  1J1D B;  2YMY A;  3WMM 0;  4WY4 D;  5BVZ A;  2OYI C;  3GHG A;  2W27 A;  1KZU B;  1RF1 B;  2HFE D;  2O1J A;  3KYQ A;  4WB4 A;  2Q9I A;  3IFM A;  5KJ7 D;  1N7S C;  2Z5I A;  4AUW A;  1IJD B;  1SQQ K;  3BAS A;  3TYY A;  1N7L A;  3RK3 B;  2OAR A;  5AW3 B;  1NTM K;  4I1L A;  2P2U A;  2W6B A;  1HWT C;  5APT A;  1HTL C;  4Y99 C;  1NTZ K;  1LTI C;  2FFD B;  1CSB A;  1NOH A;  2FXM A;  1JNM A;  4WY4 C;  2OYI A;  4LC1 A;  2LKM A;  2N1T B;  2KB7 P;  1LWU C;  5CCH C;  1SP4 A;  4GIF A;  4W7Z A;  1T3U A;  4B86 A;  1SFC D;  5BU8 B;  1T8Z A;  2YO2 A;  1DEB A;  2C9L Y;  1URQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...