1IO4A

Crystal structure of runx-1/aml1/cbfalpha runt domain-cbfbeta core domain heterodimer and c/ebpbeta bzip homodimer bound to a dna fragment from the csf-1r promoter
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
63
structure length
63
Chain Sequence
KHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CSF-1R PROMOTER
publication title Structural analyses of DNA recognition by the AML1/Runx-1 Runt domain and its allosteric control by CBFbeta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 30
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1io4A00
3LIDA 5AVYB 1JNMA 1A02J 1MFZA 3HE5A 2Q3IA 1HJBA 5APSA 1J2JB 1CSBA 3VMYA 2VRSA 1FAVA 1OXZA 5APTA 2Z5HA 3L37A 3O8ZA 5APVA 4JYBA 3M0DA 3IR9A 3P32A 2C9NY 4RESB 1S9KD 5AVTB 3SWFA 3KDPB 4AQRD 2JJLA 1X8YA 2E43A 1OWAA 3HE4A 1A02F 4M3LA 3MD0A 2BASA 3P7KA 4EOTA 3I5CA 1T2KC 2R5DA 3M9BA 5AVZB 3OAKA 2WT7B 5AW9B 2QM7A 2WPRA 3A5TA 3TNUB 4B86A 3VYIA 4AUWA 2R32A 1HUCA 3L35A 2R3CA 2ZFCA 3V4QA 5AW8B 2C9LY 1FOSF 2YNYA 2XZRA 2XU6A 5AW2B 2YO2A 1GZLA 2KP8A 4I6MC 1H8AA 3A3YB 1CI6B 1SP4A 5AW1B 2XV5A 4JYCA 5AW7B 1GU4A 2P67A 2YO3A 3LIEA 3A2AA 5AW5B 2N9BA 5AW0B 2Q7CA 4AYCA 1GK6A 1T2KD 5AVQB 4C7NB 3KQGA 2QM8A 2WT7A 1KQLA 3M9HA 3TK1A 1GU5A 2WPQA 4HYTB 4LC1A 3TNUA 1H88A 1HWTC 1JUNA 2IPPA 4XE5B 2WPSA 4GKGA 5AW3B 2R5BA 5AW4B 3V4WA 3V5BA 5AVRB 3VTPC 4C46A 2P2UA 1NWQA 1CI6A 5AVXB 5AW6B 3UIAA 1GTWA 5AVWB 3VN0A 2WTYA 1S9KE 5AVVB 1GK4A 2Q5UA 2WWWA 3VMXA 3M0AA 1G2CB 3HE5B 2P7JA 3VMZA 1CZQA 1DH3A 1GD2E 3NXSA 3P8MC 4GT1A 3TYYA 4I2LC 4C7NA 1YYCA 5APQA 3B8EB 5AVSB 3M91A 1IO4A 3MGNA 1NAFA 2ZXEB 4DZOA 2W6AA 1FOSE 3M06A 2E42A 1HBWA 5APUA 5APWA 3NFQA 3T97A 2W27A 3HE4B 5AVUB 3HTKA 3NMDA 2Z5IA 5APYA 3L36A 3A7OA 5CMZA 1SLQA 1MUUA 1MV8A 4KHXA 3NTNA 2H7HA 1H89A 5APXA
chains in the Genus database with same CATH superfamily
3L71J 1LTBC 2RMZA 1OXZA 1W2EA 2QJKC 5AVTB 3A0BE 3MZWB 4YPCA 3AE3C 3BCCJ 3JSVC 4I7ZC 2QM7A 5BU8B 1KFMA 1FZAA 3G6EP 2WITA 1EXJA 2YKOA 2E76C 3L4FA 1ZW0A 3CWBE 3L72E 5AW1B 2B87B 1GW4A 1IFMA 4L73A 2HYNA 1T2KD 4C7NB 1EXIA 1URQB 1AA0A 2B88A 3H1JD 3MIWA 2KYVA 3S9OA 1QEXA 5EFWB 2B87A 5KAIE 2HG5D 4H0LB 3CC2P 3FWNA 2YXRB 4C7NA 1FDIA 1URQA 1FZBA 2ZT9D 3M91A 1RE3A 2W6AA 4GOEA 1W5CE 1QL1A 5CCHC 2MKVA 5TISE 3Q5RA 3H1JG 3RK2B 2N1TD 1JY3O 2FFDB 2VRSA 3S1KA 1BDCA 4WY4B 1KFNA 4AQRD 1J1EB 1X8YA 1Q90D 1EDIA 4TT3H 1S5LH 5AVZB 3OAKA 2Q3EA 3FGAD 1LTSC 3QWOC 3TNUB 2FFDA 1HUCA 2Y0EA 1JMMA 1N7SB 1SQVD 5AW2B 1H8AA 3VOPA 3L75E 1Q81Q 4EI2A 1CI6B 2UWJE 1IFJA 2IBZE 2HPCB 3RK3C 3L70E 1VF5D 1L0NG 1Q2NA 2E74D 1HTLC 1FZCC 2R3SA 3BATA 2FYNC 3TNUA 3KHUA 2C0WA 2KZIA 3BCCD 1N7SA 1RE4A 4I7ZB 1OW7A 5AVRB 3OJAB 3CCMP 1SQVG 1CI6A 2A06D 2E76B 1Q7YQ 2HPCA 1GDTA 4OGQD 5KLVK 3P8MC 2O01J 2H89C 3B8EB 1HBWA 4LGDE 4D6TD 4GDOA 1BSNA 2RH0A 1IFNA 4JBZA 3TGUG 4KHXA 1H89A 1SQBD 1M7LA 3B71A 5KAFE 2A06G 2QJYC 1J2JB 2Q6QA 1IK7A 1PFIA 1IFPA 1AVOA 3GHGC 2JJLA 2HFED 1VQKP 1EDKA 4MN4C 4D6TG 3H25A 2IFMA 2PP6A 2RKLA 4BWNA 3F89A 3VYIA 1TU3F 2R32A 2BCCE 1L0LD 1N73C 1SQBG 1GZLA 2XNDH 3P8CE 4L74A 1SQPD 1SVFA 5AW7B 3CWBJ 3L72J 3CX5D 2N9BA 4U3FJ 3C1LA 1LTAC 1NTKE 2W83C 2YKPA 4GODA 2Q1KA 2SPZA 1NO4A 5CCHA 4W80A 5AW3B 2QE7H 1GW3A 4ZNCA 3CCVP 1N8RQ 4UB6H 1L0LG 5AVWB 4ASVA 3G4SP 3CXHD 1S9KE 4PV1C 1EZVD 1DH3A 1GD2E 1SQPG 3H1KE 1G1JA 4YXDC 3MUDC 1NTME 1FDMA 3RK3B 3BASA 1ZP0C 4IFDK 3M06A 1KC8Q 1FZCB 2FYNB 4I1LA 2Z5IA 5APYA 1VL2A 1YQ3C 2KIKA 4HKZH 3A0HH 1VQ4P 4W7ZA 4JYBA 1S1CX 4O9BA 1JY2N 3KDPB 1FZCA 2E43A 3AEFC 5DJTB 2LR2A 1JMBA 2A45G 1NOHA 2KZJA 5AW8B 2JR8A 1LJ2A 2OGUA 2JDIH 2QJYB 1SP4A 2Y0DA 2XV5A 1PIXA 2P67A 2YO3A 1KQFB 3L75J 2CPSA 3GHGB 2V7QH 4OWFA 3L70J 2WPQA 2ZYGA 4LC1A 2Y0CA 2IPPA 5CCGD 3WUUA 3W68A 1K8AQ 5AW4B 1GL2C 1BDDA 1AQTA 1GTWA 2OYIB 3VN0A 1G1IA 1N73B 4DJGA 2WWWA 2K37A 4PD4E 1BE3E 2KSJA 3GHGA 2FBWC 3H1HE 1NAFA 2QIWA 1MKMA 1UIIA 3F5HA 3CCRP 5AVUB 2I1JA 1N2DC 3CX5H 1MV8A 3GF3A 1N73A 4UB8E 1DEBA 1KILC 3KYQA 3L73E 2RN0A 2PFXA 4H44D 1ZRTE 4PV1B 2K3RA 3L37A 1PV3A 3IF4A 3IR9A 3SSUA 1FZEA 3SWFA 3AEDC 3II6A 3WUTA 1OWAA 1E79H 3H1ID 2KOGA 1T2KC 4HB1A 2WT7B 4B86A 2ZXXA 1OMIA 1KMIZ 4C7RA 2IYOA 1QGKB 1FOSF 2BCCJ 2FYUE 2WSEJ 2ZAEB 3RGUA 2A45H 1LP1B 3LIEA 3G3ZA 3EFGA 3MUDA 2WQYC 2WT7A 1NTKJ 3H1IG 3TK1A 2QJPC 1PP9G 3HD7D 1SQXD 1Q86Q 1IK9A 3VP8A 1OVVA 1LP1A 2WTYA 2N1TC 3CCJP 1DD3A 3AE9C 1OVUA 5APQA 2AXTH 3EQ2A 3H1KJ 5AVSB 2KS1B 3EWKA 1KYOD 3W67A 2IX7C 1NTMJ 1S5LX 3V2QA 3L36A 1K05A 1SQVK 1BCCE 4PJ0H 1SQXG 1WT6A 1NTZJ 4N78E 4WY4C 1GL2B 1LTTC 2FXPA 3B5ND 3RK3E 1FAVA 1Y9BA 2KS1A 1BGYD 4HJGH 5GTHE 3GG2A 1ZOYC 2NPSD 4M3LA 3I5CA 4TLFA 1KORA 3CI9A 1GL2A 1ZN5A 1S3JA 1KILB 3AEBC 1PPJE 3TDKA 5KLVE 1BGYG 2Y9YA 5KJ7C 2OYHC 3OA7A 4XFJA 3AE2C 3M9QA 2WSCJ 3H1LJ 1AQ5A 1GU5A 1HWTC 3WU2H 1NU1E 3PLNA 2O3JA 1QL2A 4GKGA 2R44A 1R8EA 3V4WA 3RL0C 1SQBK 1KILA 4U3FE 3UIAA 2PGDA 1IJDB 2WSFH 5H2FH 4GT1A 4I2LC 2W6BA 1HH0A 3P8CD 3CCLP 1BE3J 1J1DB 3H1HJ 2H43A 1RH5B 1SQQE 4NPDA 3CCQP 2W27A 1NTKD 2O1KA 1VQMP 2QJPB 2Z4EA 1L0LK 2KXPB 3SFEC 1YIJP 1HJBA 2E75C 4L75A 1SQPK 3CL3D 3L73J 2N1TB 2YIUC 1OIPA 1R5SA 1VQ6P 1S9KD 1EDLA 1IFIA 5AW9B 3Q5SA 4H13D 1KQSO 3MHVA 2N1TA 1FU1A 1KYOH 4H0LD 2YMYA 2FYUJ 4KT0J 1LTIC 3CCSP 1H88A 3LW5H 4XE5B 2R5BA 2E74B 4CPGA 1FBMA 2Y9ZA 4WY4A 3L71D 1KQGB 2QA4P 2NZ2A 4Y28J 5GTIH 2OYHB 1P84D 3MTUE 4DOJA 1D7MA 3E1IA 2H8PD 1EQ7A 1JCDA 3L74J 3U1CA 2FYZA 1N7SD 1LTGC 2JWDA 3RL0B 2V4HA 2NRGA 3L71G 1A02J 1S5LE 1BCCJ 2GA1A 1RY3A 2OTKE 1KTMA 5KJ7A 2OYHA 3B4SA 5APVA 2XNXA 3P32A 2OTLP 1N7LA 5BVZA 4PD4D 3BCCG 1PGPA 3P7KA 2I1KA 1VQ5P 1JY3P 2KSEA 5CCGC 3ABVC 4YXWH 2YO2A 2E75B 3VMAA 1GU4A 3A2AA 1JY3N 2YIUB 2K9YA 3L73D 4A7PA 3M0DC 5KLVJ 3AE1C 2KNCB 3G71P 1E5WA 1LGHB 2OYIC 2D2CC 1KILE 1YI2P 2H88C 1NU1J 3PHLA 3HTKB 1KB9D 5AVXB 1DIPA 3SWKA 1JB0J 1KYOI 3HE5B 2MJZA 3NXSA 2IZ1A 2KNCA 1KN7A 1JEKA 4H44C 3TSIA 2L91A 2AEFA 3JCUH 3H1JE 1RF0C 3HTKA 2YXQB 1SQQJ 2KUBA 2FXOA 2P1JA 5B5EH 4EYYQ 5APXA 3HE5A 2Q3IA 4WVZA 1AJYA 3Q5PA 1YJ9P 2ZVOB 2Q9IA 5CHXA 1H0TB 3KZIH 2BASA 2QEXP 3N4XA 2R5DA 1L2PA 1NTZE 2BEZF 3RBXA 3QH9A 5K5GB 1SQXK 1USDA 2ZVNB 2QRXA 4W7YA 1P84H 3PP5A 1EZVG 2OARA 2KP8A 4I6MC 1H0TA 1PGJA 2FKWB 1BCCD 3USSA 1QVGO 1PGQA 1L0NE 4UB6E 1EC5A 2N9YB 1K9MQ 1DX7A 2WZ7A 1YTZI 4XA4A 1AV1A 1VQOP 2P2UA 1HGVA 4IFMA 2KK7A 4KJMA 3H1LE 3KZIE 2GM4A 3V2RA 2C0XA 1LWUC 1RQUA 3MGNA 3A0HE 2E42A 2IFNA 3TGUE 1ZR4A 1VDFA 5CCGA 2D2CB 3BRTB 4BXLA 2K9JB 2A06E 3PH0A 1NU1D 1WRGA 3FXDA 1IZNB 2IDBA 1JTHB 1OVRA 5E79H 2HLOA 3CWBD 4WB4A 3L72D 4YTPC 1LT1A 3O8ZA 1W2BO 4U3FD 3M0DA 5CBNA 1KV4A 3C8VA 1DEEG 2JWAA 4H44B 1A02F 1KB9H 4RO0A 3Q3DA 4K3AA 5KLIC 4EOTA 2OYIA 2K9JA 1M1KQ 2O1JA 1M8OB 2W8ZA 3PTZA 1VQ8P 1SQBE 1SQQD 1JTHA 2R3CA 3V4QA 3VP9A 2YNYA 3T97B 3D6YA 3I55P 4JYCA 3CWBG 3L72G 4U3FG 5AW0B 3O6QB 3CXHH 4EDFA 1NTKK 1RF0A 1T3JA 2ITAA 2KLVA 2WPSA 2ZJSE 4WBAA 2PRRA 3V5BA 3D70A 4DT0A 2OQQA 1P84I 1SQPE 2P10A 3R4YA 1J1DC 3O6QA 1G2CB 2IYPA 3CX5E 2ZT9C 3Q2YA 1BSHA 3AEAC 1FE6A 1R5LA 4DZOA 1S72P 3ZDMA 3R2PA 3NMDA 2CPBA 1M57D 2O01H 2I8DA 3H1JJ 5CMZA 1JNMA 1G2CA 2G3AA 1MFZA 4ZMDA 4BRYB 5B66H 4H13C 5APSA 3IN6A 3VMYA 3SFDC 1L4AD 2Z5HA 3L75D 3L74E 2IBZD 4R4MA 1LWUB 3L70D 3SWYA 4IOIH 1SFCD 1OW6A 4BRYA 3L35A 1MFTA 4R4LA 3A0BH 2QSIA 1JO5A 2E5YA 4Z1MH 1LWUA 3L75G 5AW5B 1VF5C 2IBZG 2E74C 1L0NJ 4JPZB 3RBZA 2AEJA 3L70G 2J59M 1KB9I 1VQ9P 1JUNA 3I56P 5KLIB 2AXTE 4GIFA 3CX5I 1HF9A 1NJIQ 4N3YB 1GL2D 2KI7B 1SQVJ 5AVVB 1GK4A 4OGQC 4PJ0E 1FZGA 1JOCA 1T8ZA 2L5GB 2WVRA 1U7JA 3CXHI 2ZXEB 4L76A 1FOSE 1EZVI 5APWA 3PJSK 1VQ7P 5KAIH 1FZFA 3TGUJ 3AE6C 1VPCA 2H7HA 4JF7A 1KILD 2BCCD 2A45I 2ZYAA 3AECC 1U7MA 5TISH 2PAJA 2ZT9B 1VQPP 3AE5C 3V2NA 2P58A 3M9BA 3CLQA 4D6TJ 3FWLA 2JEEA 2ZYDA 4AUWA 2ZFCA 1KZUB 5L8RJ 2V7QJ 2XU6A 1SQBJ 2M8RA 3WU2E 3U1AA 1FJKA 3GF7A 1X79B 2BCCG 3EFFK 2M5AB 1OZHA 4H13B 4ZKUA 1URQD 1QLED 2FYUK 3H1KD 2B89A 5BU5A 3H1IE 1FJPA 3HUSC 5AVQB 3IFMA 5H2FE 1NTKG 4OH8B 1NTMD 4HYTB 1PP9E 1QX8A 1Y47A 1T6AA 1HVVA 2M5AA 1NTZD 1K04A 1L0LJ 1NVOA 3PRJA 3VMXA 1AVYA 1CZQA 1SQPJ 2K88A 4U7JA 1RHZB 3H1KG 1NKNA 2POHA 4IL6H 1VF5B 3CCEP 3Q1MA 3KXDA 5APUA 2LXBA 3RK2D 1NTMG 5M1BA 1L0ND 1NAYA 3HE4B 5KKZC 3A7OA 1CW5A 1SQXE 1X0TA 2DW3A 3OW2O 1NTZG 4WY4D 2J58A 2JKVA 1VQNP 1NKZB 4OGQB 2AXCA 3H1LD 3HE4A 1KYOE 3MD0A 1YBKA 1X22A 2QJKB 5KAFH 1EDJA 1M56D 1XTGB 2FY8A 1YHQP 3TGUD 2XZRA 3GW6A 4IL6E 1LTJC 1LNQA 1GMJA 4ASWA 1BGYE 5KJ7D 2Q7CA 1BE3D 1N86A 4AYCA 1GK6A 2O01N 3H1HD 1PZQA 1YTZT 3RL0g 3AE7C 3H1LG 3KQGA 1NH4A 3M9HA 1SS1A 2WSEH 3JC22 1JCCA 4K35A 2E76D 4RJTA 2WMMA 1HJ0A 5GTIE 3RL0D 4RKUJ 1NU1K 4C46A 4LLHA 1JY2O 3ITKA 1UIXA 1ZR2A 3VMZA 3TYYA 1ZRTD 3K5BA 4QMAA 1IO4A 1BE3G 4GOFA 1X9VA 3H1HG 3HUSB 1ZMEC 1SQQK 2CK3H 1MUUA 5TJHA 3D6ZA 2WSSH 1NYHA 2IBZI 1YITP 2E75D 3L73G 5APTA 2FYUD 3WUVA 3FXEA 3HUSA 1FDOA 2M3EA 4IFFA 3CC7P 5CCHD 1S2EA 3G9RA 2WPRA 5KKZB 3TF5A 1FC2C 3CPWO 3GMAA 3S4RA 2C9LY 2YMKA 3CD6P 1DD4A 1RQVA 2WPVB 2FYUG 1S4XA 4HH2A 5C39A 4ZKPA 3H1IJ 3WMM0 2WSFJ 3L74D 2KLUA 1PP9J 2QVAA 3HD7C 3H32B 2YKQA 2WSCH 3JCUE 1VQLP 2JP3A 4N78D 1HGZA 3IAOA 1JY2P 1IC2A 3M0AA 3RK3D 1LTJB 1YYCA 5B5EE 4OVNF 3KPEA 1L4AC 1FS0E 3H32A 1SQVE 3L74G 4PD4H 1SLQA 3L71E 5CJ0A 1RF1C 2JO1A 1SFCC 1SQXJ 4Y99C 3LIDA 2OYOA 5AVYB 1LTJA 1BCCG 3B5NC 1PPJD 1WMKA 4DCKA 5KLVD 1P84E 3BCCE 2NPSC 3CCUP 1LT9C 4UB8H 2M0BA 3A5TA 2G8YA 1XTCC 4NPEA 1Q82Q 3U59A 1M1JC 2QG4A 2HODB 3LW5J 3A3YB 1PL5A 2GUSA 4D6TE 1BGYJ 1PPJG 5KLVG 3AEEC 3AE4C 1KQLA 2XDJA 1ZV8A 3N7NA 1IFDA 1JM0A 2D2CD 2LKMA 1NU1G 2W6JH 3VTPC 2HODA 4WWIA 3V6IA 1NWQA 5AW6B 1M90Q 1OFCX 3AEGC 2Q5UA 5KTBA 2P7JA 4JQ0D 1QVFO 1MZ9A 3FX0A 5E79E 1NHLA 3NFQA 3T97A 2AEMA 1L0LE 4N6JA 3GLMA 1SQQG 2KB7P 2GUVA 2LXCB 3HD7B 1KB9E 3NTNA 4PV1D 3H6PA 1PP9D 1YJNP 2K1AA 3CMEP 2HR3A 3E1RA 3MP7B 1K73Q 1CSBA 2BEQD 2C9NY 4RESB 1KD1Q 1URQC 1NTMK 5CBOA 1L4AB 1T3UA 1RE3C 5CJ4A 3HD7A 1PGOA 3AE8C 3CXHE 2W90A 3CC4P 1NTZK 3E7KA 2IZ0A 4PD4I 1EZVE 1NGMB 5GTHH 1RF1B 1SFCB 4Y99B 4H0LC 3B5NB 2B9BA 2OTJP 3HRNA 1L4AA 1U57A 2M3BA 2QM8A 3V2PA 1L0NK 2NPSB 4IL6X 1LT9B 3D71A 1OW8A 3BRVB 3C9IA 3RK2C 1RF1A 1SFCA 2FFDC 3B5NA 1ZXGA 1M1JB 1YQ4C 3BVHA 3CMAP 1Y8AA 1J1EC 2XKMA 2NPSA 1LT9A 2J5UA 5B66E 4NPFX 1OX3A 1YJWP 1AFOA 4EIJA 2E5TA 1Z56A 2FXMA 1N7SC 1RE4C 1USEA 1ZLLA 5DJUB 1M1JA
chains in the Genus database with same CATH topology
1DEBA 3HE5A 1KILC 2Q3IA 4WY4D 3KYQA 1LTBC 2J58A 1OXZA 1W2EA 3L37A 1NKZB 3IR9A 2Q9IA 5CHXA 1FZEA 5AVTB 3SWFA 3II6A 1OWAA 3HE4A 3MD0A 2KOGA 2BASA 3N4XA 1T2KC 2R5DA 2WT7B 2QM7A 5BU8B 1SQXK 1KFMA 1FZAA 4B86A 1XTGB 2WITA 2YKOA 4C7RA 4W7YA 3L4FA 1FOSF 3PP5A 2XZRA 2OARA 2KP8A 4I6MC 1LTJC 2FKWB 5AW1B 2A45H 3LIEA 3G3ZA 3EFGA 1GW4A 5KJ7D 1IFMA 2Q7CA 3MUDA 1N86A 4AYCA 1GK6A 2HYNA 1YTZT 1T2KD 4C7NB 3KQGA 2WT7A 1NH4A 1DX7A 1URQB 3M9HA 3TK1A 2WSEH 2WZ7A 1JCCA 1YTZI 4XA4A 3HD7D 3MIWA 3RL0D 1NU1K 4C46A 2KYVA 2P2UA 1HGVA 4IFMA 1IK9A 3VP8A 4LLHA 1JY2O 2WTYA 2N1TC 2HG5D 2GM4A 1ZR2A 3VMZA 3TYYA 3V2RA 4C7NA 5APQA 2C0XA 1URQA 1LWUC 1FZBA 3EQ2A 5AVSB 3M91A 1IO4A 3MGNA 1RE3A 1X9VA 2W6AA 3HUSB 2E42A 2IFNA 1QL1A 2IX7C 5CCHC 1ZR4A 1VDFA 3V2QA 5CCGA 1SQQK 3L36A 3BRTB 1MUUA 1SQVK 3RK2B 2N1TD 1JY3O 1WT6A 1WRGA 4WY4C 4N78E 1GL2B 1LTTC 2FFDB 3B5ND 1JTHB 2VRSA 1FAVA 2HLOA 5APTA 4WB4A 3O8ZA 3M0DA 4WY4B 3HUSA 4IFFA 1KFNA 4AQRD 1J1EB 1X8YA 2NPSD 5CCHD 1A02F 4M3LA 4EOTA 2OYIA 3I5CA 5AVZB 3OAKA 2O1JA 2WPRA 1LTSC 3CI9A 3TNUB 1GL2A 2FFDA 1ZN5A 1HUCA 1JTHA 2R3CA 1JMMA 1N7SB 3V4QA 3VP9A 2C9LY 2YNYA 5AW2B 1H8AA 1KILB 3VOPA 1CI6B 4JYCA 1IFJA 5KJ7C 2HPCB 2OYHC 5AW0B 3OA7A 4HH2A 3RK3C 3M9QA 1HTLC 1FZCC 3BATA 1AQ5A 4ZKPA 1NTKK 1GU5A 1RF0A 3TNUA 3WMM0 2C0WA 1HWTC 1T3JA 2KLVA 1QL2A 2WPSA 4GKGA 1N7SA 1RE4A 4WBAA 3V4WA 3HD7C 3V5BA 3RL0C 3H32B 5AVRB 2YKQA 1SQBK 1KILA 3OJAB 2WSCH 1CI6A 3UIAA 1IJDB 2WSFH 1HGZA 4N78D 2HPCA 1JY2P 1J1DC 1IC2A 3M0AA 1GDTA 1G2CB 3RK3D 5KLVK 1LTJB 3P8MC 4GT1A 4I2LC 2W6BA 1YYCA 3KPEA 1HH0A 3B8EB 3P8CD 1L4AC 1J1DB 2H43A 4DZOA 1HBWA 4LGDE 3H32A 2W27A 3R2PA 3NMDA 2O1KA 1IFNA 2CPBA 2O01H 2Z4EA 5CMZA 1SLQA 1L0LK 5CJ0A 4KHXA 1RF1C 1SFCC 1H89A 4Y99C 3LIDA 5AVYB 1JNMA 1G2CA 1M7LA 1MFZA 1LTJA 1HJBA 5APSA 3B5NC 1SQPK 3CL3D 1J2JB 3VMYA 2N1TB 1L4AD 2Z5HA 1PFIA 3GHGC 1S9KD 2NPSC 2JJLA 1LWUB 1LT9C 2HFED 1IFIA 3SWYA 5AW9B 2IFMA 2PP6A 1SFCD 3A5TA 3VYIA 1XTCC 2R32A 3L35A 2N1TA 3U59A 1N73C 1M1JC 1FU1A 1GZLA 2HODB 3P8CE 1JO5A 3A3YB 2YMYA 1SVFA 5AW7B 2GUSA 1LWUA 5AW5B 2N9BA 1LTAC 2YKPA 1NO4A 1KQLA 1LTIC 2XDJA 5CCHA 2J59M 1H88A 1JUNA 3LW5H 1ZV8A 4W80A 4XE5B 3N7NA 1IFDA 4GIFA 5AW3B 2R5BA 2LKMA 1FBMA 3VTPC 1GW3A 4N3YB 2HODA 4WY4A 1NWQA 1GL2D 5AW6B 5AVWB 1S9KE 5AVVB 1GK4A 2Q5UA 5KTBA 2P7JA 1DH3A 1GD2E 1FZGA 1JOCA 1T8ZA 2L5GB 1MZ9A 1G1JA 2OYHB 2ZXEB 1FDMA 3RK3B 3BASA 4IFDK 1FOSE 3M06A 3MTUE 4DOJA 1NHLA 5APWA 3NFQA 3E1IA 1FZCB 3T97A 2H8PD 1EQ7A 1JCDA 4N6JA 4I1LA 2Z5IA 1FZFA 2KB7P 5APYA 3U1CA 2FYZA 2GUVA 1N7SD 1LTGC 1VPCA 3HD7B 3NTNA 3RL0B 2H7HA 3H6PA 4JF7A 1A02J 1KILD 1RY3A 1CSBA 2A45I 4W7ZA 5KJ7A 2OYHA 5APVA 2XNXA 4JYBA 3P32A 4O9BA 2C9NY 2PAJA 4RESB 1JY2N 3KDPB 1URQC 1FZCA 1NTMK 2E43A 1N7LA 5BVZA 1L4AB 1T3UA 1RE3C 3V2NA 3P7KA 5CJ4A 3M9BA 2I1KA 3CLQA 3HD7A 2A45G 1JY3P 1NTZK 5CCGC 2JEEA 4AUWA 1NOHA 2ZFCA 1KZUB 5AW8B 1RF1B 1SFCB 2XU6A 2M8RA 2YO2A 4Y99B 1FJKA 3U1AA 1X79B 4ZKUA 3B5NB 1SP4A 2XV5A 1URQD 1GU4A 2P67A 2YO3A 3A2AA 1JY3N 2FYUK 3HRNA 1L4AA 2M3BA 5BU5A 3M0DC 2CPSA 1FJPA 3HUSC 5AVQB 3GHGB 2QM8A 3IFMA 3V2PA 1L0NK 2NPSB 4OH8B 1LT9B 2WPQA 1E5WA 4HYTB 4LC1A 1LGHB 2IPPA 5CCGD 2OYIC 3BRVB 3C9IA 5AW4B 3RK2C 1RF1A 1SFCA 3HTKB 1HVVA 1GL2C 2FFDC 3B5NA 1GTWA 5AVXB 2OYIB 3VN0A 1G1IA 1N73B 1M1JB 2WWWA 3VMXA 3HE5B 1CZQA 2MJZA 3NXSA 3BVHA 2KSJA 3GHGA 1J1EC 2XKMA 2NPSA 1LT9A 1NKNA 1NAFA 2POHA 1AFOA 3TSIA 5APUA 3RK2D 4EIJA 3HE4B 5AVUB 1RF0C 3HTKA 1Z56A 2FXMA 3A7OA 1CW5A 2I1JA 1N7SC 1RE4C 1N2DC 1MV8A 2P1JA 1ZLLA 1N73A 1M1JA 5APXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LID A;  5AVY B;  1JNM A;  1A02 J;  1MFZ A;  3HE5 A;  2Q3I A;  1HJB A;  5APS A;  1J2J B;  1CSB A;  3VMY A;  2VRS A;  1FAV A;  1OXZ A;  5APT A;  2Z5H A;  3L37 A;  3O8Z A;  5APV A;  4JYB A;  3M0D A;  3IR9 A;  3P32 A;  2C9N Y;  4RES B;  1S9K D;  5AVT B;  3SWF A;  3KDP B;  4AQR D;  2JJL A;  1X8Y A;  2E43 A;  1OWA A;  3HE4 A;  1A02 F;  4M3L A;  3MD0 A;  2BAS A;  3P7K A;  4EOT A;  3I5C A;  1T2K C;  2R5D A;  3M9B A;  5AVZ B;  3OAK A;  2WT7 B;  5AW9 B;  2QM7 A;  2WPR A;  3A5T A;  3TNU B;  4B86 A;  3VYI A;  4AUW A;  2R32 A;  1HUC A;  3L35 A;  2R3C A;  2ZFC A;  3V4Q A;  5AW8 B;  2C9L Y;  1FOS F;  2YNY A;  2XZR A;  2XU6 A;  5AW2 B;  2YO2 A;  1GZL A;  2KP8 A;  4I6M C;  1H8A A;  3A3Y B;  1CI6 B;  1SP4 A;  5AW1 B;  2XV5 A;  4JYC A;  5AW7 B;  1GU4 A;  2P67 A;  2YO3 A;  3LIE A;  3A2A A;  5AW5 B;  2N9B A;  5AW0 B;  2Q7C A;  4AYC A;  1GK6 A;  1T2K D;  5AVQ B;  4C7N B;  3KQG A;  2QM8 A;  2WT7 A;  1KQL A;  3M9H A;  3TK1 A;  1GU5 A;  2WPQ A;  4HYT B;  4LC1 A;  3TNU A;  1H88 A;  1HWT C;  1JUN A;  2IPP A;  4XE5 B;  2WPS A;  4GKG A;  5AW3 B;  2R5B A;  5AW4 B;  3V4W A;  3V5B A;  5AVR B;  3VTP C;  4C46 A;  2P2U A;  1NWQ A;  1CI6 A;  5AVX B;  5AW6 B;  3UIA A;  1GTW A;  5AVW B;  3VN0 A;  2WTY A;  1S9K E;  5AVV B;  1GK4 A;  2Q5U A;  2WWW A;  3VMX A;  3M0A A;  1G2C B;  3HE5 B;  2P7J A;  3VMZ A;  1CZQ A;  1DH3 A;  1GD2 E;  3NXS A;  3P8M C;  4GT1 A;  3TYY A;  4I2L C;  4C7N A;  1YYC A;  5APQ A;  3B8E B;  5AVS B;  3M91 A;  1IO4 A;  3MGN A;  1NAF A;  2ZXE B;  4DZO A;  2W6A A;  1FOS E;  3M06 A;  2E42 A;  1HBW A;  5APU A;  5APW A;  3NFQ A;  3T97 A;  2W27 A;  3HE4 B;  5AVU B;  3HTK A;  3NMD A;  2Z5I A;  5APY A;  3L36 A;  3A7O A;  5CMZ A;  1SLQ A;  1MUU A;  1MV8 A;  4KHX A;  3NTN A;  2H7H A;  1H89 A;  5APX A; 
#chains in the Genus database with same CATH topology
 3L71 J;  1LTB C;  2RMZ A;  1OXZ A;  1W2E A;  2QJK C;  5AVT B;  3A0B E;  3MZW B;  4YPC A;  3AE3 C;  3BCC J;  3JSV C;  4I7Z C;  2QM7 A;  5BU8 B;  1KFM A;  1FZA A;  3G6E P;  2WIT A;  1EXJ A;  2YKO A;  2E76 C;  3L4F A;  1ZW0 A;  3CWB E;  3L72 E;  5AW1 B;  2B87 B;  1GW4 A;  1IFM A;  4L73 A;  2HYN A;  1T2K D;  4C7N B;  1EXI A;  1URQ B;  1AA0 A;  2B88 A;  3H1J D;  3MIW A;  2KYV A;  3S9O A;  1QEX A;  5EFW B;  2B87 A;  5KAI E;  2HG5 D;  4H0L B;  3CC2 P;  3FWN A;  2YXR B;  4C7N A;  1FDI A;  1URQ A;  1FZB A;  2ZT9 D;  3M91 A;  1RE3 A;  2W6A A;  4GOE A;  1W5C E;  1QL1 A;  5CCH C;  2MKV A;  5TIS E;  3Q5R A;  3H1J G;  3RK2 B;  2N1T D;  1JY3 O;  2FFD B;  2VRS A;  3S1K A;  1BDC A;  4WY4 B;  1KFN A;  4AQR D;  1J1E B;  1X8Y A;  1Q90 D;  1EDI A;  4TT3 H;  1S5L H;  5AVZ B;  3OAK A;  2Q3E A;  3FGA D;  1LTS C;  3QWO C;  3TNU B;  2FFD A;  1HUC A;  2Y0E A;  1JMM A;  1N7S B;  1SQV D;  5AW2 B;  1H8A A;  3VOP A;  3L75 E;  1Q81 Q;  4EI2 A;  1CI6 B;  2UWJ E;  1IFJ A;  2IBZ E;  2HPC B;  3RK3 C;  3L70 E;  1VF5 D;  1L0N G;  1Q2N A;  2E74 D;  1HTL C;  1FZC C;  2R3S A;  3BAT A;  2FYN C;  3TNU A;  3KHU A;  2C0W A;  2KZI A;  3BCC D;  1N7S A;  1RE4 A;  4I7Z B;  1OW7 A;  5AVR B;  3OJA B;  3CCM P;  1SQV G;  1CI6 A;  2A06 D;  2E76 B;  1Q7Y Q;  2HPC A;  1GDT A;  4OGQ D;  5KLV K;  3P8M C;  2O01 J;  2H89 C;  3B8E B;  1HBW A;  4LGD E;  4D6T D;  4GDO A;  1BSN A;  2RH0 A;  1IFN A;  4JBZ A;  3TGU G;  4KHX A;  1H89 A;  1SQB D;  1M7L A;  3B71 A;  5KAF E;  2A06 G;  2QJY C;  1J2J B;  2Q6Q A;  1IK7 A;  1PFI A;  1IFP A;  1AVO A;  3GHG C;  2JJL A;  2HFE D;  1VQK P;  1EDK A;  4MN4 C;  4D6T G;  3H25 A;  2IFM A;  2PP6 A;  2RKL A;  4BWN A;  3F89 A;  3VYI A;  1TU3 F;  2R32 A;  2BCC E;  1L0L D;  1N73 C;  1SQB G;  1GZL A;  2XND H;  3P8C E;  4L74 A;  1SQP D;  1SVF A;  5AW7 B;  3CWB J;  3L72 J;  3CX5 D;  2N9B A;  4U3F J;  3C1L A;  1LTA C;  1NTK E;  2W83 C;  2YKP A;  4GOD A;  2Q1K A;  2SPZ A;  1NO4 A;  5CCH A;  4W80 A;  5AW3 B;  2QE7 H;  1GW3 A;  4ZNC A;  3CCV P;  1N8R Q;  4UB6 H;  1L0L G;  5AVW B;  4ASV A;  3G4S P;  3CXH D;  1S9K E;  4PV1 C;  1EZV D;  1DH3 A;  1GD2 E;  1SQP G;  3H1K E;  1G1J A;  4YXD C;  3MUD C;  1NTM E;  1FDM A;  3RK3 B;  3BAS A;  1ZP0 C;  4IFD K;  3M06 A;  1KC8 Q;  1FZC B;  2FYN B;  4I1L A;  2Z5I A;  5APY A;  1VL2 A;  1YQ3 C;  2KIK A;  4HKZ H;  3A0H H;  1VQ4 P;  4W7Z A;  4JYB A;  1S1C X;  4O9B A;  1JY2 N;  3KDP B;  1FZC A;  2E43 A;  3AEF C;  5DJT B;  2LR2 A;  1JMB A;  2A45 G;  1NOH A;  2KZJ A;  5AW8 B;  2JR8 A;  1LJ2 A;  2OGU A;  2JDI H;  2QJY B;  1SP4 A;  2Y0D A;  2XV5 A;  1PIX A;  2P67 A;  2YO3 A;  1KQF B;  3L75 J;  2CPS A;  3GHG B;  2V7Q H;  4OWF A;  3L70 J;  2WPQ A;  2ZYG A;  4LC1 A;  2Y0C A;  2IPP A;  5CCG D;  3WUU A;  3W68 A;  1K8A Q;  5AW4 B;  1GL2 C;  1BDD A;  1AQT A;  1GTW A;  2OYI B;  3VN0 A;  1G1I A;  1N73 B;  4DJG A;  2WWW A;  2K37 A;  4PD4 E;  1BE3 E;  2KSJ A;  3GHG A;  2FBW C;  3H1H E;  1NAF A;  2QIW A;  1MKM A;  1UII A;  3F5H A;  3CCR P;  5AVU B;  2I1J A;  1N2D C;  3CX5 H;  1MV8 A;  3GF3 A;  1N73 A;  4UB8 E;  1DEB A;  1KIL C;  3KYQ A;  3L73 E;  2RN0 A;  2PFX A;  4H44 D;  1ZRT E;  4PV1 B;  2K3R A;  3L37 A;  1PV3 A;  3IF4 A;  3IR9 A;  3SSU A;  1FZE A;  3SWF A;  3AED C;  3II6 A;  3WUT A;  1OWA A;  1E79 H;  3H1I D;  2KOG A;  1T2K C;  4HB1 A;  2WT7 B;  4B86 A;  2ZXX A;  1OMI A;  1KMI Z;  4C7R A;  2IYO A;  1QGK B;  1FOS F;  2BCC J;  2FYU E;  2WSE J;  2ZAE B;  3RGU A;  2A45 H;  1LP1 B;  3LIE A;  3G3Z A;  3EFG A;  3MUD A;  2WQY C;  2WT7 A;  1NTK J;  3H1I G;  3TK1 A;  2QJP C;  1PP9 G;  3HD7 D;  1SQX D;  1Q86 Q;  1IK9 A;  3VP8 A;  1OVV A;  1LP1 A;  2WTY A;  2N1T C;  3CCJ P;  1DD3 A;  3AE9 C;  1OVU A;  5APQ A;  2AXT H;  3EQ2 A;  3H1K J;  5AVS B;  2KS1 B;  3EWK A;  1KYO D;  3W67 A;  2IX7 C;  1NTM J;  1S5L X;  3V2Q A;  3L36 A;  1K05 A;  1SQV K;  1BCC E;  4PJ0 H;  1SQX G;  1WT6 A;  1NTZ J;  4N78 E;  4WY4 C;  1GL2 B;  1LTT C;  2FXP A;  3B5N D;  3RK3 E;  1FAV A;  1Y9B A;  2KS1 A;  1BGY D;  4HJG H;  5GTH E;  3GG2 A;  1ZOY C;  2NPS D;  4M3L A;  3I5C A;  4TLF A;  1KOR A;  3CI9 A;  1GL2 A;  1ZN5 A;  1S3J A;  1KIL B;  3AEB C;  1PPJ E;  3TDK A;  5KLV E;  1BGY G;  2Y9Y A;  5KJ7 C;  2OYH C;  3OA7 A;  4XFJ A;  3AE2 C;  3M9Q A;  2WSC J;  3H1L J;  1AQ5 A;  1GU5 A;  1HWT C;  3WU2 H;  1NU1 E;  3PLN A;  2O3J A;  1QL2 A;  4GKG A;  2R44 A;  1R8E A;  3V4W A;  3RL0 C;  1SQB K;  1KIL A;  4U3F E;  3UIA A;  2PGD A;  1IJD B;  2WSF H;  5H2F H;  4GT1 A;  4I2L C;  2W6B A;  1HH0 A;  3P8C D;  3CCL P;  1BE3 J;  1J1D B;  3H1H J;  2H43 A;  1RH5 B;  1SQQ E;  4NPD A;  3CCQ P;  2W27 A;  1NTK D;  2O1K A;  1VQM P;  2QJP B;  2Z4E A;  1L0L K;  2KXP B;  3SFE C;  1YIJ P;  1HJB A;  2E75 C;  4L75 A;  1SQP K;  3CL3 D;  3L73 J;  2N1T B;  2YIU C;  1OIP A;  1R5S A;  1VQ6 P;  1S9K D;  1EDL A;  1IFI A;  5AW9 B;  3Q5S A;  4H13 D;  1KQS O;  3MHV A;  2N1T A;  1FU1 A;  1KYO H;  4H0L D;  2YMY A;  2FYU J;  4KT0 J;  1LTI C;  3CCS P;  1H88 A;  3LW5 H;  4XE5 B;  2R5B A;  2E74 B;  4CPG A;  1FBM A;  2Y9Z A;  4WY4 A;  3L71 D;  1KQG B;  2QA4 P;  2NZ2 A;  4Y28 J;  5GTI H;  2OYH B;  1P84 D;  3MTU E;  4DOJ A;  1D7M A;  3E1I A;  2H8P D;  1EQ7 A;  1JCD A;  3L74 J;  3U1C A;  2FYZ A;  1N7S D;  1LTG C;  2JWD A;  3RL0 B;  2V4H A;  2NRG A;  3L71 G;  1A02 J;  1S5L E;  1BCC J;  2GA1 A;  1RY3 A;  2OTK E;  1KTM A;  5KJ7 A;  2OYH A;  3B4S A;  5APV A;  2XNX A;  3P32 A;  2OTL P;  1N7L A;  5BVZ A;  4PD4 D;  3BCC G;  1PGP A;  3P7K A;  2I1K A;  1VQ5 P;  1JY3 P;  2KSE A;  5CCG C;  3ABV C;  4YXW H;  2YO2 A;  2E75 B;  3VMA A;  1GU4 A;  3A2A A;  1JY3 N;  2YIU B;  2K9Y A;  3L73 D;  4A7P A;  3M0D C;  5KLV J;  3AE1 C;  2KNC B;  3G71 P;  1E5W A;  1LGH B;  2OYI C;  2D2C C;  1KIL E;  1YI2 P;  2H88 C;  1NU1 J;  3PHL A;  3HTK B;  1KB9 D;  5AVX B;  1DIP A;  3SWK A;  1JB0 J;  1KYO I;  3HE5 B;  2MJZ A;  3NXS A;  2IZ1 A;  2KNC A;  1KN7 A;  1JEK A;  4H44 C;  3TSI A;  2L91 A;  2AEF A;  3JCU H;  3H1J E;  1RF0 C;  3HTK A;  2YXQ B;  1SQQ J;  2KUB A;  2FXO A;  2P1J A;  5B5E H;  4EYY Q;  5APX A;  3HE5 A;  2Q3I A;  4WVZ A;  1AJY A;  3Q5P A;  1YJ9 P;  2ZVO B;  2Q9I A;  5CHX A;  1H0T B;  3KZI H;  2BAS A;  2QEX P;  3N4X A;  2R5D A;  1L2P A;  1NTZ E;  2BEZ F;  3RBX A;  3QH9 A;  5K5G B;  1SQX K;  1USD A;  2ZVN B;  2QRX A;  4W7Y A;  1P84 H;  3PP5 A;  1EZV G;  2OAR A;  2KP8 A;  4I6M C;  1H0T A;  1PGJ A;  2FKW B;  1BCC D;  3USS A;  1QVG O;  1PGQ A;  1L0N E;  4UB6 E;  1EC5 A;  2N9Y B;  1K9M Q;  1DX7 A;  2WZ7 A;  1YTZ I;  4XA4 A;  1AV1 A;  1VQO P;  2P2U A;  1HGV A;  4IFM A;  2KK7 A;  4KJM A;  3H1L E;  3KZI E;  2GM4 A;  3V2R A;  2C0X A;  1LWU C;  1RQU A;  3MGN A;  3A0H E;  2E42 A;  2IFN A;  3TGU E;  1ZR4 A;  1VDF A;  5CCG A;  2D2C B;  3BRT B;  4BXL A;  2K9J B;  2A06 E;  3PH0 A;  1NU1 D;  1WRG A;  3FXD A;  1IZN B;  2IDB A;  1JTH B;  1OVR A;  5E79 H;  2HLO A;  3CWB D;  4WB4 A;  3L72 D;  4YTP C;  1LT1 A;  3O8Z A;  1W2B O;  4U3F D;  3M0D A;  5CBN A;  1KV4 A;  3C8V A;  1DEE G;  2JWA A;  4H44 B;  1A02 F;  1KB9 H;  4RO0 A;  3Q3D A;  4K3A A;  5KLI C;  4EOT A;  2OYI A;  2K9J A;  1M1K Q;  2O1J A;  1M8O B;  2W8Z A;  3PTZ A;  1VQ8 P;  1SQB E;  1SQQ D;  1JTH A;  2R3C A;  3V4Q A;  3VP9 A;  2YNY A;  3T97 B;  3D6Y A;  3I55 P;  4JYC A;  3CWB G;  3L72 G;  4U3F G;  5AW0 B;  3O6Q B;  3CXH H;  4EDF A;  1NTK K;  1RF0 A;  1T3J A;  2ITA A;  2KLV A;  2WPS A;  2ZJS E;  4WBA A;  2PRR A;  3V5B A;  3D70 A;  4DT0 A;  2OQQ A;  1P84 I;  1SQP E;  2P10 A;  3R4Y A;  1J1D C;  3O6Q A;  1G2C B;  2IYP A;  3CX5 E;  2ZT9 C;  3Q2Y A;  1BSH A;  3AEA C;  1FE6 A;  1R5L A;  4DZO A;  1S72 P;  3ZDM A;  3R2P A;  3NMD A;  2CPB A;  1M57 D;  2O01 H;  2I8D A;  3H1J J;  5CMZ A;  1JNM A;  1G2C A;  2G3A A;  1MFZ A;  4ZMD A;  4BRY B;  5B66 H;  4H13 C;  5APS A;  3IN6 A;  3VMY A;  3SFD C;  1L4A D;  2Z5H A;  3L75 D;  3L74 E;  2IBZ D;  4R4M A;  1LWU B;  3L70 D;  3SWY A;  4IOI H;  1SFC D;  1OW6 A;  4BRY A;  3L35 A;  1MFT A;  4R4L A;  3A0B H;  2QSI A;  1JO5 A;  2E5Y A;  4Z1M H;  1LWU A;  3L75 G;  5AW5 B;  1VF5 C;  2IBZ G;  2E74 C;  1L0N J;  4JPZ B;  3RBZ A;  2AEJ A;  3L70 G;  2J59 M;  1KB9 I;  1VQ9 P;  1JUN A;  3I56 P;  5KLI B;  2AXT E;  4GIF A;  3CX5 I;  1HF9 A;  1NJI Q;  4N3Y B;  1GL2 D;  2KI7 B;  1SQV J;  5AVV B;  1GK4 A;  4OGQ C;  4PJ0 E;  1FZG A;  1JOC A;  1T8Z A;  2L5G B;  2WVR A;  1U7J A;  3CXH I;  2ZXE B;  4L76 A;  1FOS E;  1EZV I;  5APW A;  3PJS K;  1VQ7 P;  5KAI H;  1FZF A;  3TGU J;  3AE6 C;  1VPC A;  2H7H A;  4JF7 A;  1KIL D;  2BCC D;  2A45 I;  2ZYA A;  3AEC C;  1U7M A;  5TIS H;  2PAJ A;  2ZT9 B;  1VQP P;  3AE5 C;  3V2N A;  2P58 A;  3M9B A;  3CLQ A;  4D6T J;  3FWL A;  2JEE A;  2ZYD A;  4AUW A;  2ZFC A;  1KZU B;  5L8R J;  2V7Q J;  2XU6 A;  1SQB J;  2M8R A;  3WU2 E;  3U1A A;  1FJK A;  3GF7 A;  1X79 B;  2BCC G;  3EFF K;  2M5A B;  1OZH A;  4H13 B;  4ZKU A;  1URQ D;  1QLE D;  2FYU K;  3H1K D;  2B89 A;  5BU5 A;  3H1I E;  1FJP A;  3HUS C;  5AVQ B;  3IFM A;  5H2F E;  1NTK G;  4OH8 B;  1NTM D;  4HYT B;  1PP9 E;  1QX8 A;  1Y47 A;  1T6A A;  1HVV A;  2M5A A;  1NTZ D;  1K04 A;  1L0L J;  1NVO A;  3PRJ A;  3VMX A;  1AVY A;  1CZQ A;  1SQP J;  2K88 A;  4U7J A;  1RHZ B;  3H1K G;  1NKN A;  2POH A;  4IL6 H;  1VF5 B;  3CCE P;  3Q1M A;  3KXD A;  5APU A;  2LXB A;  3RK2 D;  1NTM G;  5M1B A;  1L0N D;  1NAY A;  3HE4 B;  5KKZ C;  3A7O A;  1CW5 A;  1SQX E;  1X0T A;  2DW3 A;  3OW2 O;  1NTZ G;  4WY4 D;  2J58 A;  2JKV A;  1VQN P;  1NKZ B;  4OGQ B;  2AXC A;  3H1L D;  3HE4 A;  1KYO E;  3MD0 A;  1YBK A;  1X22 A;  2QJK B;  5KAF H;  1EDJ A;  1M56 D;  1XTG B;  2FY8 A;  1YHQ P;  3TGU D;  2XZR A;  3GW6 A;  4IL6 E;  1LTJ C;  1LNQ A;  1GMJ A;  4ASW A;  1BGY E;  5KJ7 D;  2Q7C A;  1BE3 D;  1N86 A;  4AYC A;  1GK6 A;  2O01 N;  3H1H D;  1PZQ A;  1YTZ T;  3RL0 g;  3AE7 C;  3H1L G;  3KQG A;  1NH4 A;  3M9H A;  1SS1 A;  2WSE H;  3JC2 2;  1JCC A;  4K35 A;  2E76 D;  4RJT A;  2WMM A;  1HJ0 A;  5GTI E;  3RL0 D;  4RKU J;  1NU1 K;  4C46 A;  4LLH A;  1JY2 O;  3ITK A;  1UIX A;  1ZR2 A;  3VMZ A;  3TYY A;  1ZRT D;  3K5B A;  4QMA A;  1IO4 A;  1BE3 G;  4GOF A;  1X9V A;  3H1H G;  3HUS B;  1ZME C;  1SQQ K;  2CK3 H;  1MUU A;  5TJH A;  3D6Z A;  2WSS H;  1NYH A;  2IBZ I;  1YIT P;  2E75 D;  3L73 G;  5APT A;  2FYU D;  3WUV A;  3FXE A;  3HUS A;  1FDO A;  2M3E A;  4IFF A;  3CC7 P;  5CCH D;  1S2E A;  3G9R A;  2WPR A;  5KKZ B;  3TF5 A;  1FC2 C;  3CPW O;  3GMA A;  3S4R A;  2C9L Y;  2YMK A;  3CD6 P;  1DD4 A;  1RQV A;  2WPV B;  2FYU G;  1S4X A;  4HH2 A;  5C39 A;  4ZKP A;  3H1I J;  3WMM 0;  2WSF J;  3L74 D;  2KLU A;  1PP9 J;  2QVA A;  3HD7 C;  3H32 B;  2YKQ A;  2WSC H;  3JCU E;  1VQL P;  2JP3 A;  4N78 D;  1HGZ A;  3IAO A;  1JY2 P;  1IC2 A;  3M0A A;  3RK3 D;  1LTJ B;  1YYC A;  5B5E E;  4OVN F;  3KPE A;  1L4A C;  1FS0 E;  3H32 A;  1SQV E;  3L74 G;  4PD4 H;  1SLQ A;  3L71 E;  5CJ0 A;  1RF1 C;  2JO1 A;  1SFC C;  1SQX J;  4Y99 C;  3LID A;  2OYO A;  5AVY B;  1LTJ A;  1BCC G;  3B5N C;  1PPJ D;  1WMK A;  4DCK A;  5KLV D;  1P84 E;  3BCC E;  2NPS C;  3CCU P;  1LT9 C;  4UB8 H;  2M0B A;  3A5T A;  2G8Y A;  1XTC C;  4NPE A;  1Q82 Q;  3U59 A;  1M1J C;  2QG4 A;  2HOD B;  3LW5 J;  3A3Y B;  1PL5 A;  2GUS A;  4D6T E;  1BGY J;  1PPJ G;  5KLV G;  3AEE C;  3AE4 C;  1KQL A;  2XDJ A;  1ZV8 A;  3N7N A;  1IFD A;  1JM0 A;  2D2C D;  2LKM A;  1NU1 G;  2W6J H;  3VTP C;  2HOD A;  4WWI A;  3V6I A;  1NWQ A;  5AW6 B;  1M90 Q;  1OFC X;  3AEG C;  2Q5U A;  5KTB A;  2P7J A;  4JQ0 D;  1QVF O;  1MZ9 A;  3FX0 A;  5E79 E;  1NHL A;  3NFQ A;  3T97 A;  2AEM A;  1L0L E;  4N6J A;  3GLM A;  1SQQ G;  2KB7 P;  2GUV A;  2LXC B;  3HD7 B;  1KB9 E;  3NTN A;  4PV1 D;  3H6P A;  1PP9 D;  1YJN P;  2K1A A;  3CME P;  2HR3 A;  3E1R A;  3MP7 B;  1K73 Q;  1CSB A;  2BEQ D;  2C9N Y;  4RES B;  1KD1 Q;  1URQ C;  1NTM K;  5CBO A;  1L4A B;  1T3U A;  1RE3 C;  5CJ4 A;  3HD7 A;  1PGO A;  3AE8 C;  3CXH E;  2W90 A;  3CC4 P;  1NTZ K;  3E7K A;  2IZ0 A;  4PD4 I;  1EZV E;  1NGM B;  5GTH H;  1RF1 B;  1SFC B;  4Y99 B;  4H0L C;  3B5N B;  2B9B A;  2OTJ P;  3HRN A;  1L4A A;  1U57 A;  2M3B A;  2QM8 A;  3V2P A;  1L0N K;  2NPS B;  4IL6 X;  1LT9 B;  3D71 A;  1OW8 A;  3BRV B;  3C9I A;  3RK2 C;  1RF1 A;  1SFC A;  2FFD C;  3B5N A;  1ZXG A;  1M1J B;  1YQ4 C;  3BVH A;  3CMA P;  1Y8A A;  1J1E C;  2XKM A;  2NPS A;  1LT9 A;  2J5U A;  5B66 E;  4NPF X;  1OX3 A;  1YJW P;  1AFO A;  4EIJ A;  2E5T A;  1Z56 A;  2FXM A;  1N7S C;  1RE4 C;  1USE A;  1ZLL A;  5DJU B;  1M1J A; 
#chains in the Genus database with same CATH homology
 1DEB A;  3HE5 A;  1KIL C;  2Q3I A;  4WY4 D;  3KYQ A;  1LTB C;  2J58 A;  1OXZ A;  1W2E A;  3L37 A;  1NKZ B;  3IR9 A;  2Q9I A;  5CHX A;  1FZE A;  5AVT B;  3SWF A;  3II6 A;  1OWA A;  3HE4 A;  3MD0 A;  2KOG A;  2BAS A;  3N4X A;  1T2K C;  2R5D A;  2WT7 B;  2QM7 A;  5BU8 B;  1SQX K;  1KFM A;  1FZA A;  4B86 A;  1XTG B;  2WIT A;  2YKO A;  4C7R A;  4W7Y A;  3L4F A;  1FOS F;  3PP5 A;  2XZR A;  2OAR A;  2KP8 A;  4I6M C;  1LTJ C;  2FKW B;  5AW1 B;  2A45 H;  3LIE A;  3G3Z A;  3EFG A;  1GW4 A;  5KJ7 D;  1IFM A;  2Q7C A;  3MUD A;  1N86 A;  4AYC A;  1GK6 A;  2HYN A;  1YTZ T;  1T2K D;  4C7N B;  3KQG A;  2WT7 A;  1NH4 A;  1DX7 A;  1URQ B;  3M9H A;  3TK1 A;  2WSE H;  2WZ7 A;  1JCC A;  1YTZ I;  4XA4 A;  3HD7 D;  3MIW A;  3RL0 D;  1NU1 K;  4C46 A;  2KYV A;  2P2U A;  1HGV A;  4IFM A;  1IK9 A;  3VP8 A;  4LLH A;  1JY2 O;  2WTY A;  2N1T C;  2HG5 D;  2GM4 A;  1ZR2 A;  3VMZ A;  3TYY A;  3V2R A;  4C7N A;  5APQ A;  2C0X A;  1URQ A;  1LWU C;  1FZB A;  3EQ2 A;  5AVS B;  3M91 A;  1IO4 A;  3MGN A;  1RE3 A;  1X9V A;  2W6A A;  3HUS B;  2E42 A;  2IFN A;  1QL1 A;  2IX7 C;  5CCH C;  1ZR4 A;  1VDF A;  3V2Q A;  5CCG A;  1SQQ K;  3L36 A;  3BRT B;  1MUU A;  1SQV K;  3RK2 B;  2N1T D;  1JY3 O;  1WT6 A;  1WRG A;  4WY4 C;  4N78 E;  1GL2 B;  1LTT C;  2FFD B;  3B5N D;  1JTH B;  2VRS A;  1FAV A;  2HLO A;  5APT A;  4WB4 A;  3O8Z A;  3M0D A;  4WY4 B;  3HUS A;  4IFF A;  1KFN A;  4AQR D;  1J1E B;  1X8Y A;  2NPS D;  5CCH D;  1A02 F;  4M3L A;  4EOT A;  2OYI A;  3I5C A;  5AVZ B;  3OAK A;  2O1J A;  2WPR A;  1LTS C;  3CI9 A;  3TNU B;  1GL2 A;  2FFD A;  1ZN5 A;  1HUC A;  1JTH A;  2R3C A;  1JMM A;  1N7S B;  3V4Q A;  3VP9 A;  2C9L Y;  2YNY A;  5AW2 B;  1H8A A;  1KIL B;  3VOP A;  1CI6 B;  4JYC A;  1IFJ A;  5KJ7 C;  2HPC B;  2OYH C;  5AW0 B;  3OA7 A;  4HH2 A;  3RK3 C;  3M9Q A;  1HTL C;  1FZC C;  3BAT A;  1AQ5 A;  4ZKP A;  1NTK K;  1GU5 A;  1RF0 A;  3TNU A;  3WMM 0;  2C0W A;  1HWT C;  1T3J A;  2KLV A;  1QL2 A;  2WPS A;  4GKG A;  1N7S A;  1RE4 A;  4WBA A;  3V4W A;  3HD7 C;  3V5B A;  3RL0 C;  3H32 B;  5AVR B;  2YKQ A;  1SQB K;  1KIL A;  3OJA B;  2WSC H;  1CI6 A;  3UIA A;  1IJD B;  2WSF H;  1HGZ A;  4N78 D;  2HPC A;  1JY2 P;  1J1D C;  1IC2 A;  3M0A A;  1GDT A;  1G2C B;  3RK3 D;  5KLV K;  1LTJ B;  3P8M C;  4GT1 A;  4I2L C;  2W6B A;  1YYC A;  3KPE A;  1HH0 A;  3B8E B;  3P8C D;  1L4A C;  1J1D B;  2H43 A;  4DZO A;  1HBW A;  4LGD E;  3H32 A;  2W27 A;  3R2P A;  3NMD A;  2O1K A;  1IFN A;  2CPB A;  2O01 H;  2Z4E A;  5CMZ A;  1SLQ A;  1L0L K;  5CJ0 A;  4KHX A;  1RF1 C;  1SFC C;  1H89 A;  4Y99 C;  3LID A;  5AVY B;  1JNM A;  1G2C A;  1M7L A;  1MFZ A;  1LTJ A;  1HJB A;  5APS A;  3B5N C;  1SQP K;  3CL3 D;  1J2J B;  3VMY A;  2N1T B;  1L4A D;  2Z5H A;  1PFI A;  3GHG C;  1S9K D;  2NPS C;  2JJL A;  1LWU B;  1LT9 C;  2HFE D;  1IFI A;  3SWY A;  5AW9 B;  2IFM A;  2PP6 A;  1SFC D;  3A5T A;  3VYI A;  1XTC C;  2R32 A;  3L35 A;  2N1T A;  3U59 A;  1N73 C;  1M1J C;  1FU1 A;  1GZL A;  2HOD B;  3P8C E;  1JO5 A;  3A3Y B;  2YMY A;  1SVF A;  5AW7 B;  2GUS A;  1LWU A;  5AW5 B;  2N9B A;  1LTA C;  2YKP A;  1NO4 A;  1KQL A;  1LTI C;  2XDJ A;  5CCH A;  2J59 M;  1H88 A;  1JUN A;  3LW5 H;  1ZV8 A;  4W80 A;  4XE5 B;  3N7N A;  1IFD A;  4GIF A;  5AW3 B;  2R5B A;  2LKM A;  1FBM A;  3VTP C;  1GW3 A;  4N3Y B;  2HOD A;  4WY4 A;  1NWQ A;  1GL2 D;  5AW6 B;  5AVW B;  1S9K E;  5AVV B;  1GK4 A;  2Q5U A;  5KTB A;  2P7J A;  1DH3 A;  1GD2 E;  1FZG A;  1JOC A;  1T8Z A;  2L5G B;  1MZ9 A;  1G1J A;  2OYH B;  2ZXE B;  1FDM A;  3RK3 B;  3BAS A;  4IFD K;  1FOS E;  3M06 A;  3MTU E;  4DOJ A;  1NHL A;  5APW A;  3NFQ A;  3E1I A;  1FZC B;  3T97 A;  2H8P D;  1EQ7 A;  1JCD A;  4N6J A;  4I1L A;  2Z5I A;  1FZF A;  2KB7 P;  5APY A;  3U1C A;  2FYZ A;  2GUV A;  1N7S D;  1LTG C;  1VPC A;  3HD7 B;  3NTN A;  3RL0 B;  2H7H A;  3H6P A;  4JF7 A;  1A02 J;  1KIL D;  1RY3 A;  1CSB A;  2A45 I;  4W7Z A;  5KJ7 A;  2OYH A;  5APV A;  2XNX A;  4JYB A;  3P32 A;  4O9B A;  2C9N Y;  2PAJ A;  4RES B;  1JY2 N;  3KDP B;  1URQ C;  1FZC A;  1NTM K;  2E43 A;  1N7L A;  5BVZ A;  1L4A B;  1T3U A;  1RE3 C;  3V2N A;  3P7K A;  5CJ4 A;  3M9B A;  2I1K A;  3CLQ A;  3HD7 A;  2A45 G;  1JY3 P;  1NTZ K;  5CCG C;  2JEE A;  4AUW A;  1NOH A;  2ZFC A;  1KZU B;  5AW8 B;  1RF1 B;  1SFC B;  2XU6 A;  2M8R A;  2YO2 A;  4Y99 B;  1FJK A;  3U1A A;  1X79 B;  4ZKU A;  3B5N B;  1SP4 A;  2XV5 A;  1URQ D;  1GU4 A;  2P67 A;  2YO3 A;  3A2A A;  1JY3 N;  2FYU K;  3HRN A;  1L4A A;  2M3B A;  5BU5 A;  3M0D C;  2CPS A;  1FJP A;  3HUS C;  5AVQ B;  3GHG B;  2QM8 A;  3IFM A;  3V2P A;  1L0N K;  2NPS B;  4OH8 B;  1LT9 B;  2WPQ A;  1E5W A;  4HYT B;  4LC1 A;  1LGH B;  2IPP A;  5CCG D;  2OYI C;  3BRV B;  3C9I A;  5AW4 B;  3RK2 C;  1RF1 A;  1SFC A;  3HTK B;  1HVV A;  1GL2 C;  2FFD C;  3B5N A;  1GTW A;  5AVX B;  2OYI B;  3VN0 A;  1G1I A;  1N73 B;  1M1J B;  2WWW A;  3VMX A;  3HE5 B;  1CZQ A;  2MJZ A;  3NXS A;  3BVH A;  2KSJ A;  3GHG A;  1J1E C;  2XKM A;  2NPS A;  1LT9 A;  1NKN A;  1NAF A;  2POH A;  1AFO A;  3TSI A;  5APU A;  3RK2 D;  4EIJ A;  3HE4 B;  5AVU B;  1RF0 C;  3HTK A;  1Z56 A;  2FXM A;  3A7O A;  1CW5 A;  2I1J A;  1N7S C;  1RE4 C;  1N2D C;  1MV8 A;  2P1J A;  1ZLL A;  1N73 A;  1M1J A;  5APX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...