2AXTH

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
molecule tags Electron transport
total genus 14
structure length 64
sequence length 64
chains with identical sequence h
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 2axtH01
4UB6H 3A0BH 5TISH 5KAFH 3A0HH 5B5EH 4IL6H 5B66H 5H2FH 2AXTH 5E79H 1S5LH 3JCUH 4UB8H 5KAIH 5GTHH 5GTIH 3WU2H 4PJ0H 3KZIH
chains in the Genus database with same CATH superfamily
1NU1G 2Z5IA 1BGYJ 1OWAA 3E1IA 3HTKA 3W67A 1AVYA 4H0LC 2Q1KA 4W80A 1PFIA 2Y0EA 4ZKPA 4I7ZB 3M91A 2CPBA 4H44C 3H1IG 5DJTB 1P84H 2FYUK 5APYA 1HVVA 3RL0g 3CCUP 3CMEP 1LWUB 4Y99C 3OW2O 1ZV8A 4WBAA 1NTZK 2A06G 1KILA 1UIXA 1JNMA 1J1EC 2M5AB 4Y28J 4JYBA 2IZ1A 4ASVA 2BCCJ 2JP3A 1AA0A 3EFGA 1Q7YQ 2KYVA 3H1JG 1MFTA 2Y0DA 2QM7A 1FZCB 1KB9D 3V4WA 3M9HA 1JMMA 3D71A 1EDLA 3F89A 2E43A 1KYOD 2XNXA 3AEEC 2SPZA 1SQVG 5AW2B 4DJGA 3V2NA 3CCMP 3B5NA 1KV4A 3VYIA 2H43A 4C7NA 4WVZA 3HE4A 1QVGO 5CMZA 1NTKJ 1L4AA 1HJ0A 4Z1MH 1LP1A 3HD7A 1SQXG 3GHGC 5H2FE 3BATA 1K73Q 4RJTA 3P8CD 1NYHA 3E1RA 1KB9E 3BASA 1N73C 1S72P 1Q86Q 3BRVB 3MD0A 1GU5A 4M3LA 1IFJA 3HRNA 1KYOE 1P84I 1NAFA 3VP9A 3AE3C 4ZMDA 1NTMG 3RK2B 5AVSB 4PD4H 2LXCB 1NH4A 1BDCA 2P67A 3AE7C 1QX8A 3M0DC 1S5LH 2Z4EA 2L5GB 1OVVA 3GLMA 1LT9C 3HE5B 4OGQC 3HUSC 2QJYB 3CWBD 1W5CE 1OXZA 3F5HA 3CWBJ 2ZT9C 3RK2D 1T2KC 4U3FD 2JDIH 2YKQA 3MUDC 3NXSA 3P8CE 1FC2C 2JJLA 4IOIH 1SQQG 5CCHD 1KZUB 3SFDC 1SLQA 3LW5H 3CCEP 2FFDB 4K3AA 3FGAD 1EZVG 1LTBC 2H89C 1NHLA 2FXPA 5AVVB 2ZJSE 2NPSC 5BU5A 3MGNA 3WUTA 2GUVA 4N3YB 4N78D 2OYOA 1FAVA 3GMAA 2WPSA 3IAOA 3G4SP 5K5GB 2K1AA 2V7QH 3CWBE 4C7RA 4DZOA 3PJSK 3L71D 1Y9BA 5C39A 4U3FE 1LTJB 3L75G 2K88A 1BGYG 2QJKB 1RF1A 3C9IA 4L73A 1URQA 2QVAA 4IFFA 1BCCG 3EQ2A 4PD4I 4KHXA 3RGUA 1HJBA 2ZFCA 1NU1D 3ZDMA 1FBMA 1DIPA 1KQLA 1GTWA 3AE5C 2A45G 3R2PA 1ZXGA 2ZYAA 1DEBA 1S4XA 1XTCC 2KNCB 4N78E 1YBKA 2YIUC 3EWKA 4RO0A 2WPRA 4LLHA 2H88C 3RBXA 2D2CC 3D6ZA 1YYCA 2KZJA 4PV1C 1WT6A 3H1IJ 3I5CA 3TNUA 3L71E 1A02J 3OJAB 5H2FH 2O01N 1YTZI 2BEZF 2O3JA 3H1KG 3WU2E 3S1KA 1DH3A 2BCCG 1R8EA 1JY3O 1KB9H 3PP5A 3AE2C 4WY4B 2WSCJ 2A06D 1KYOH 2Q5UA 4I1LA 3ITKA 1NU1E 2K9JA 1SFCA 3VMAA 3CCQP 5AW0B 2R3CA 3H1JJ 2E74B 3BVHA 3NTNA 3W68A 4ZKUA 2YKPA 3M06A 1W2EA 3ABVC 1NTKG 1SQBJ 1SQVJ 1EQ7A 2QG4A 2O01J 1KQGB 1Q81Q 5APXA 3B5NC 2POHA 1N7SB 1KORA 2RKLA 1GDTA 1LGHB 3VP8A 1CSBA 3A3YB 2WVRA 4HB1A 3AE1C 3MZWB 2IYOA 3SSUA 1S1CX 2E74D 3FWNA 2HLOA 2A06E 1L4AC 1JTHA 1GK4A 2CK3H 1EDKA 1SQXD 1JY3N 1FDOA 5AW5B 1JCCA 2KZIA 1JY2P 3RK3C 1HBWA 1AVOA 2OTJP 1CW5A 4BRYB 1A02F 3I55P 3WUUA 3O8ZA 1AQTA 1LT9A 1NTMD 1PGOA 3A0HE 1JY2O 4H13D 1NTMJ 2WZ7A 1M56D 4DCKA 1KB9I 2P2UA 4JF7A 1YITP 2W6AA 1M8OB 1RE3A 4H44B 1JOCA 2Y9ZA 1M90Q 1T3UA 2YNYA 2KIKA 1VPCA 1SQXE 3QWOC 4Y99B 3RBZA 3U1AA 3H1HG 1NVOA 2B89A 3D6YA 1Z56A 2NPSA 1SQQD 1NJIQ 1J1EB 1AFOA 5CJ4A 1SQQJ 3G71P 3O6QA 5APSA 1JM0A 4H44D 1G2CB 1ZLLA 2AXTE 3TGUJ 2HPCA 2QM8A 1IFMA 1PL5A 2XDJA 1NTME 2WSSH 2N1TA 4YTPC 3WU2H 2WQYC 1JY2N 4HKZH 2H8PD 3CL3D 1FJKA 3L35A 1L0LJ 1L0NG 4LC1A 5KJ7D 2MKVA 4EOTA 3V2RA 3JSVC 2P58A 1ZR2A 3L75D 2J58A 1K05A 1VQMP 1EDIA 1VQ8P 1BGYD 1SQQE 2FKWB 3L75J 1U7MA 2C9LY 5KLIC 1GD2E 5KAIE 4QMAA 3KPEA 1LTGC 1RF1C 3GHGB 2RN0A 1BCCD 2W27A 3AEFC 1MZ9A 1URQC 1BCCJ 3AE4C 2IDBA 3VTPC 3L36A 1N73B 4D6TJ 2Y9YA 3PHLA 1L2PA 3CI9A 2Y0CA 4XFJA 3CCLP 1GL2A 3CC2P 4GOFA 2WSEJ 4EI2A 3A0BE 3G6EP 2YXRB 5KAFE 4YPCA 2AEJA 4ASWA 2R5DA 3H1KD 1NKNA 5CBNA 4OGQB 3L75E 2BCCD 3HUSB 3H1KJ 1LTTC 1BGYE 1NU1K 4PJ0E 2PGDA 1FDIA 3H32B 2ZT9B 4IL6E 1BCCE 5BVZA 1Q2NA 2KS1B 2YMKA 2ZXEB 1QLED 5AVRB 2IX7C 1CI6B 3A0HH 1OZHA 1QEXA 1SQBG 5GTIE 2PAJA 1SFCC 2E75C 3BCCJ 5KLVJ 1YIJP 1YTZT 1RF0C 3P8MC 2WSFH 4AUWA 1NTKD 2HR3A 2ZT9D 4KJMA 2AEFA 5APUA 4UB6E 3H1KE 2BCCE 3A5TA 1FOSF 2R32A 1BE3G 3CXHD 1S3JA 2AXTH 2HFED 2WT7B 1SS1A 4RESB 3Q3DA 3G9RA 3B8EB 1GW3A 2BEQD 3C1LA 1LTIC 3L4FA 2FYNC 2JWDA 4LGDE 1HWTC 4EIJA 1NTKE 3V5BA 3N4XA 2IZ0A 4EDFA 1MKMA 2KLUA 2KLVA 3HTKB 4HH2A 2D2CB 5AVZB 4RKUJ 1HUCA 3PTZA 1FDMA 1SQXK 4PV1B 3PRJA 4NPDA 1RE3C 3CXHE 5KAIH 1SQPJ 1ZOYC 4HYTB 2HODA 1OIPA 5AW7B 3H1HD 3TGUG 2OYHA 1U7JA 3K5BA 3Q2YA 3H1HJ 1ZRTD 2I1KA 1M57D 1NTMK 2K9YA 1T3JA 2B87A 1KILB 2FXOA 4PV1D 5DJUB 3AE6C 3A0BH 5KAFH 5B5EH 2IPPA 4AQRD 3JCUE 1GMJA 2W90A 1L0LG 1X22A 3VMXA 2M3BA 2OTLP 1Y8AA 2N1TC 2E5YA 3IN6A 2GM4A 1H89A 4GKGA 4JQ0D 4PJ0H 1OMIA 3R4YA 2RH0A 1L0ND 1H0TA 1VQ4P 3B5NB 1KILD 2KXPB 4IL6H 5AVWB 3TK1A 1SQQK 1L0NJ 1LTAC 3V4QA 4C7NB 4TT3H 3HE4B 2P10A 3KQGA 3MTUE 3KZIE 3H1HE 1BSHA 1IO4A 5APWA 5AW8B 5GTIH 2A45H 4ZNCA 1ZRTE 2FYUJ 5B66E 1L4AB 4BWNA 5AVTB 2WMMA 3AE8C 4D6TG 1SP4A 1LP1B 1QL1A 3HD7B 2IYPA 3RK3B 2W8ZA 5CCGD 1J2JB 1OFCX 3B5ND 1JY3P 4MN4C 2M3EA 1PV3A 3BRTB 4UB6H 3H1ID 3L74J 3A7OA 3IFMA 1VQKP 1GL2C 4L76A 4JPZB 1FU1A 1IFNA 2C9NY 1L0NE 1OVUA 3L37A 1KILE 3HD7D 2Q3IA 3RK3D 1AV1A 2XU6A 3FWLA 1GU4A 2OYIA 4I2LC 4GDOA 3Q1MA 2AXCA 2NZ2A 2YMYA 2H7HA 1EDJA 5KJ7A 3H1JD 3BCCG 2ZVNB 5KLVG 1RF0A 2K3RA 3RL0B 4B86A 1SQBD 4WY4D 1SQVD 4IL6X 2YKOA 2OQQA 5AVUB 3H1IE 4K35A 3L72G 1OW6A 2IBZG 1NGMB 1G1IA 1J1DC 1HGVA 2O1KA 3CXHH 1Q82Q 2LR2A 3CD6P 3T97A 3TDKA 5CJ0A 2DW3A 2P1JA 3MHVA 3RK3E 1M1JA 2A45I 2ZYGA 5CBOA 2KSJA 1DD4A 2P7JA 3RL0D 2I8DA 3M0AA 1BE3D 1ZMEC 3NFQA 4C46A 1KMIZ 1BE3J 1NO4A 3H1JE 2FBWC 1UIIA 3VOPA 1HF9A 3H1LG 3V2QA 1N7SD 1QVFO 1JMBA 3JCUH 3QH9A 2E76C 5KLIB 3CPWO 1SQBE 1SQVE 1RF1B 3GG2A 1NTKK 1RHZB 1VF5C 1LJ2A 2J5UA 3SWKA 4H0LB 1URQB 3CX5D 3IR9A 2CPSA 2GUSA 1LWUA 2Q3EA 3B4SA 3TSIA 1SQPG 1KYOI 3MP7B 2M5AA 3KZIH 1H8AA 1N7LA 4WB4A 5B66H 2M0BA 1BE3E 2ZYDA 4H0LD 3L73J 1FZCA 1URQD 1DD3A 2XZRA 1YHQP 3TNUB 2G3AA 1RQVA 1H88A 2QRXA 1FZAA 2WITA 3TGUD 1EZVD 2QJPC 1WMKA 4A7PA 3GF7A 3VMZA 3E7KA 2OYHC 1VQ7P 3CCJP 2E74C 3CXHI 3OA7A 3CX5E 1VQOP 1OVRA 1YJWP 2K9JB 4W7YA 2M8RA 1SFCB 2E75B 4WWIA 1KQSO 1L0LD 1HGZA 1KD1Q 4UB8E 1KC8Q 3EFFK 1QL2A 1FZFA 2OARA 4YXDC 2OTKE 1PPJG 1E79H 2FYUG 5AW3B 1RY3A 4H13C 2QE7H 2IFMA 3UIAA 3VN0A 2C0WA 2UWJE 1SFCD 3TGUE 1EZVE 2E75D 3Q5RA 1D7MA 3OAKA 3FX0A 1S2EA 1NTZG 3U1CA 2ZXXA 4D6TD 1GK6A 1MUUA 5CCHA 2E42A 2V7QJ 3KDPB 1JTHB 2BASA 4BXLA 1EXIA 3L74G 5AW9B 3HE5A 5AVQB 2QEXP 2WSCH 2FYNB 1AQ5A 2HYNA 3CCSP 1L0LE 1R5SA 3TYYA 1L0NK 1YQ4C 1K9MQ 4GIFA 2LXBA 5B5EE 3B71A 1PZQA 1LT9B 3L70G 2QIWA 1NOHA 1IFIA 2Q7CA 1T8ZA 2R3SA 2KSEA 2FFDA 1TU3F 2Z5HA 3N7NA 4DT0A 2WPVB 1IJDB 3M9BA 2O01H 2B9BA 3AEBC 1FE6A 1OW7A 2OYIC 1FOSE 5TJHA 4D6TE 1ZP0C 3BCCD 5KLVD 5KJ7C 3IF4A 3CCRP 1YQ3C 2PP6A 4OGQD 3KYQA 1KFMA 2NPSB 1K04A 2R5BA 1M1KQ 1PP9G 3O6QB 3L72D 5KKZC 2IBZD 3I56P 1T2KD 5CCGA 3L72J 2HPCB 2FYZA 1LTJA 1EXJA 2XV5A 2KOGA 3H25A 2N1TB 1VL2A 2XKMA 1GW4A 4AYCA 4HJGH 2NPSD 1M1JC 1OX3A 2JWAA 5TISE 1PIXA 1IFDA 1ZR4A 3CX5H 3H1LD 1SQBK 2R44A 1SQVK 1IK9A 3BCCE 5KLVE 2KNCA 1LTSC 3H1LJ 2V4HA 5CHXA 3LIDA 4GT1A 1OW8A 4I7ZC 2N1TD 3GF3A 4UB8H 3WUVA 5AVYB 2W6BA 3L72E 1IFPA 2IBZE 2KUBA 1W2BO 5AW4B 1VQPP 2YIUB 3A2AA 1VQLP 4EYYQ 4XE5B 2RMZA 4WY4A 1LWUC 1Y47A 3TF5A 1SQPD 3L73G 1NWQA 1IK7A 2HG5D 1GL2B 3S4RA 4OH8B 3SWYA 1R5LA 1WRGA 5L8RJ 4OWFA 3H1LE 1FZCC 2FXMA 2D2CD 2KK7A 2N9YB 1HH0A 4U3FJ 3P7KA 1M7LA 1RE4C 2JKVA 5M1BA 1VDFA 1GL2D 2W83C 4IFDK 4GOEA 1N7SA 3II6A 2QA4P 3Q5SA 2I1JA 3M9QA 1MFZA 2XNDH 1USDA 1SQPE 4JYCA 2MJZA 5AVXB 1J1DB 4L75A 5E79E 1VQ6P 3JC22 2IFNA 3PH0A 5GTHE 3CX5I 1U57A 1SVFA 1PPJD 3S9OA 2FYUD 2LKMA 4BRYA 3CC4P 1X8YA 3L71J 1ZN5A 1DX7A 1JEKA 1N86A 2WSEH 1NTZD 1S5LX 1NTZJ 3RK2C 5AW6B 1L0LK 1VQ5P 3L74D 2E76B 5CCHC 1VQNP 1AJYA 1NU1J 2J59M 3FXDA 3H6PA 4YXWH 1BDDA 3CLQA 1EZVI 2YXQB 3FXEA 2B88A 1VF5B 1L4AD 2FY8A 2O1JA 2QJYC 1X79B 2W6JH 1XTGB 4JBZA 2E5TA 3AECC 1PGJA 1LNQA 3L70D 5TISH 2L91A 1NAYA 2ZVOB 2YO2A 1RQUA 1PPJE 3L70J 2FYUE 1FS0E 1G1JA 3PLNA 3CMAP 2E76D 1G2CA 2ITAA 1X9VA 1P84D 4OVNF 2FFDC 1VF5D 1NTZE 2Q6QA 1PGPA 1BSNA 5APTA 2Q9IA 3D70A 2HODB 3AEDC 1FZGA 5EFWB 3V6IA 1KILC 2QJPB 3L74E 5APQA 1JUNA 2OYHB 2QSIA 4L74A 1PP9D 2B87B 4DOJA 1KQFB 3Q5PA 1PP9J 1PGQA 1GZLA 1X0TA 3SWFA 3L70E 5CCGC 4TLFA 1LTJC 4N6JA 2WWWA 2QJKC 3GHGA 3P32A 1E5WA 2K37A 1P84E 1KFNA 5KLVK 2G8YA 1YJNP 1HTLC 2WSFJ 3WMM0 1FZBA 2PFXA 3C8VA 4H13B 1N73A 1N2DC 1RH5B 1H0TB 4GODA 3AEAC 3MIWA 3HD7C 1SQXJ 4O9BA 1JCDA 1DEEG 1S9KD 2WTYA 1YI2P 1JB0J 5AW1B 3M0DA 2C0XA 1PP9E 5E79H 1YJ9P 5KTBA 2JO1A 5GTHH 1EC5A 3HUSA 3L73D 3H32A 1USEA 3SFEC 4WY4C 1NKZB 3CWBG 4PD4D 2JEEA 2KS1A 3MUDA 2WPQA 4R4LA 3USSA 4CPGA 2IBZI 1CI6A 3AE9C 4U3FG 1K8AQ 1IC2A 4NPEA 1KTMA 1ZW0A 3VMYA 1RE4A 4U7JA 3LIEA 4IFMA 1Q90D 1IZNB 2N9BA 1N8RQ 1S9KE 5BU8B 3KHUA 3RL0C 2OYIB 3U59A 2PRRA 3GW6A 4R4MA 4I6MC 1MV8A 2AEMA 4W7ZA 2JR8A 2YO3A 3CC7P 2GA1A 1CZQA 3KXDA 1SQPK 2VRSA 2KI7B 1VQ9P 1N7SC 2ZAEB 3LW5J 2KB7P 2NRGA 1FZEA 3V2PA 3L73E 5KKZB 4NPFX 1QGKB 1T6AA 1FJPA 4PD4E 1KN7A 3L71G 2WT7A 1S5LE 5APVA 3G3ZA 3AEGC 1LT1A 3T97B 3CCVP 3NMDA 1JO5A 2OGUA 1M1JB 4KT0J 2KP8A 4XA4A
chains in the Genus database with same CATH topology
4UB6H 3A0BH 5TISH 5KAFH 3A0HH 5B5EH 4IL6H 5B66H 5H2FH 2AXTH 5E79H 1S5LH 3JCUH 4UB8H 5KAIH 5GTHH 5GTIH 3WU2H 4PJ0H 3KZIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB6 H;  3A0B H;  5TIS H;  5KAF H;  3A0H H;  5B5E H;  4IL6 H;  5B66 H;  5H2F H;  2AXT H;  5E79 H;  1S5L H;  3JCU H;  4UB8 H;  5KAI H;  5GTH H;  5GTI H;  3WU2 H;  4PJ0 H;  3KZI H; 
#chains in the Genus database with same CATH topology
 1NU1 G;  2Z5I A;  1BGY J;  1OWA A;  3E1I A;  3HTK A;  3W67 A;  1AVY A;  4H0L C;  2Q1K A;  4W80 A;  1PFI A;  2Y0E A;  4ZKP A;  4I7Z B;  3M91 A;  2CPB A;  4H44 C;  3H1I G;  5DJT B;  1P84 H;  2FYU K;  5APY A;  1HVV A;  3RL0 g;  3CCU P;  3CME P;  1LWU B;  4Y99 C;  3OW2 O;  1ZV8 A;  4WBA A;  1NTZ K;  2A06 G;  1KIL A;  1UIX A;  1JNM A;  1J1E C;  2M5A B;  4Y28 J;  4JYB A;  2IZ1 A;  4ASV A;  2BCC J;  2JP3 A;  1AA0 A;  3EFG A;  1Q7Y Q;  2KYV A;  3H1J G;  1MFT A;  2Y0D A;  2QM7 A;  1FZC B;  1KB9 D;  3V4W A;  3M9H A;  1JMM A;  3D71 A;  1EDL A;  3F89 A;  2E43 A;  1KYO D;  2XNX A;  3AEE C;  2SPZ A;  1SQV G;  5AW2 B;  4DJG A;  3V2N A;  3CCM P;  3B5N A;  1KV4 A;  3VYI A;  2H43 A;  4C7N A;  4WVZ A;  3HE4 A;  1QVG O;  5CMZ A;  1NTK J;  1L4A A;  1HJ0 A;  4Z1M H;  1LP1 A;  3HD7 A;  1SQX G;  3GHG C;  5H2F E;  3BAT A;  1K73 Q;  4RJT A;  3P8C D;  1NYH A;  3E1R A;  1KB9 E;  3BAS A;  1N73 C;  1S72 P;  1Q86 Q;  3BRV B;  3MD0 A;  1GU5 A;  4M3L A;  1IFJ A;  3HRN A;  1KYO E;  1P84 I;  1NAF A;  3VP9 A;  3AE3 C;  4ZMD A;  1NTM G;  3RK2 B;  5AVS B;  4PD4 H;  2LXC B;  1NH4 A;  1BDC A;  2P67 A;  3AE7 C;  1QX8 A;  3M0D C;  1S5L H;  2Z4E A;  2L5G B;  1OVV A;  3GLM A;  1LT9 C;  3HE5 B;  4OGQ C;  3HUS C;  2QJY B;  3CWB D;  1W5C E;  1OXZ A;  3F5H A;  3CWB J;  2ZT9 C;  3RK2 D;  1T2K C;  4U3F D;  2JDI H;  2YKQ A;  3MUD C;  3NXS A;  3P8C E;  1FC2 C;  2JJL A;  4IOI H;  1SQQ G;  5CCH D;  1KZU B;  3SFD C;  1SLQ A;  3LW5 H;  3CCE P;  2FFD B;  4K3A A;  3FGA D;  1EZV G;  1LTB C;  2H89 C;  1NHL A;  2FXP A;  5AVV B;  2ZJS E;  2NPS C;  5BU5 A;  3MGN A;  3WUT A;  2GUV A;  4N3Y B;  4N78 D;  2OYO A;  1FAV A;  3GMA A;  2WPS A;  3IAO A;  3G4S P;  5K5G B;  2K1A A;  2V7Q H;  3CWB E;  4C7R A;  4DZO A;  3PJS K;  3L71 D;  1Y9B A;  5C39 A;  4U3F E;  1LTJ B;  3L75 G;  2K88 A;  1BGY G;  2QJK B;  1RF1 A;  3C9I A;  4L73 A;  1URQ A;  2QVA A;  4IFF A;  1BCC G;  3EQ2 A;  4PD4 I;  4KHX A;  3RGU A;  1HJB A;  2ZFC A;  1NU1 D;  3ZDM A;  1FBM A;  1DIP A;  1KQL A;  1GTW A;  3AE5 C;  2A45 G;  3R2P A;  1ZXG A;  2ZYA A;  1DEB A;  1S4X A;  1XTC C;  2KNC B;  4N78 E;  1YBK A;  2YIU C;  3EWK A;  4RO0 A;  2WPR A;  4LLH A;  2H88 C;  3RBX A;  2D2C C;  3D6Z A;  1YYC A;  2KZJ A;  4PV1 C;  1WT6 A;  3H1I J;  3I5C A;  3TNU A;  3L71 E;  1A02 J;  3OJA B;  5H2F H;  2O01 N;  1YTZ I;  2BEZ F;  2O3J A;  3H1K G;  3WU2 E;  3S1K A;  1DH3 A;  2BCC G;  1R8E A;  1JY3 O;  1KB9 H;  3PP5 A;  3AE2 C;  4WY4 B;  2WSC J;  2A06 D;  1KYO H;  2Q5U A;  4I1L A;  3ITK A;  1NU1 E;  2K9J A;  1SFC A;  3VMA A;  3CCQ P;  5AW0 B;  2R3C A;  3H1J J;  2E74 B;  3BVH A;  3NTN A;  3W68 A;  4ZKU A;  2YKP A;  3M06 A;  1W2E A;  3ABV C;  1NTK G;  1SQB J;  1SQV J;  1EQ7 A;  2QG4 A;  2O01 J;  1KQG B;  1Q81 Q;  5APX A;  3B5N C;  2POH A;  1N7S B;  1KOR A;  2RKL A;  1GDT A;  1LGH B;  3VP8 A;  1CSB A;  3A3Y B;  2WVR A;  4HB1 A;  3AE1 C;  3MZW B;  2IYO A;  3SSU A;  1S1C X;  2E74 D;  3FWN A;  2HLO A;  2A06 E;  1L4A C;  1JTH A;  1GK4 A;  2CK3 H;  1EDK A;  1SQX D;  1JY3 N;  1FDO A;  5AW5 B;  1JCC A;  2KZI A;  1JY2 P;  3RK3 C;  1HBW A;  1AVO A;  2OTJ P;  1CW5 A;  4BRY B;  1A02 F;  3I55 P;  3WUU A;  3O8Z A;  1AQT A;  1LT9 A;  1NTM D;  1PGO A;  3A0H E;  1JY2 O;  4H13 D;  1NTM J;  2WZ7 A;  1M56 D;  4DCK A;  1KB9 I;  2P2U A;  4JF7 A;  1YIT P;  2W6A A;  1M8O B;  1RE3 A;  4H44 B;  1JOC A;  2Y9Z A;  1M90 Q;  1T3U A;  2YNY A;  2KIK A;  1VPC A;  1SQX E;  3QWO C;  4Y99 B;  3RBZ A;  3U1A A;  3H1H G;  1NVO A;  2B89 A;  3D6Y A;  1Z56 A;  2NPS A;  1SQQ D;  1NJI Q;  1J1E B;  1AFO A;  5CJ4 A;  1SQQ J;  3G71 P;  3O6Q A;  5APS A;  1JM0 A;  4H44 D;  1G2C B;  1ZLL A;  2AXT E;  3TGU J;  2HPC A;  2QM8 A;  1IFM A;  1PL5 A;  2XDJ A;  1NTM E;  2WSS H;  2N1T A;  4YTP C;  3WU2 H;  2WQY C;  1JY2 N;  4HKZ H;  2H8P D;  3CL3 D;  1FJK A;  3L35 A;  1L0L J;  1L0N G;  4LC1 A;  5KJ7 D;  2MKV A;  4EOT A;  3V2R A;  3JSV C;  2P58 A;  1ZR2 A;  3L75 D;  2J58 A;  1K05 A;  1VQM P;  1EDI A;  1VQ8 P;  1BGY D;  1SQQ E;  2FKW B;  3L75 J;  1U7M A;  2C9L Y;  5KLI C;  1GD2 E;  5KAI E;  4QMA A;  3KPE A;  1LTG C;  1RF1 C;  3GHG B;  2RN0 A;  1BCC D;  2W27 A;  3AEF C;  1MZ9 A;  1URQ C;  1BCC J;  3AE4 C;  2IDB A;  3VTP C;  3L36 A;  1N73 B;  4D6T J;  2Y9Y A;  3PHL A;  1L2P A;  3CI9 A;  2Y0C A;  4XFJ A;  3CCL P;  1GL2 A;  3CC2 P;  4GOF A;  2WSE J;  4EI2 A;  3A0B E;  3G6E P;  2YXR B;  5KAF E;  4YPC A;  2AEJ A;  4ASW A;  2R5D A;  3H1K D;  1NKN A;  5CBN A;  4OGQ B;  3L75 E;  2BCC D;  3HUS B;  3H1K J;  1LTT C;  1BGY E;  1NU1 K;  4PJ0 E;  2PGD A;  1FDI A;  3H32 B;  2ZT9 B;  4IL6 E;  1BCC E;  5BVZ A;  1Q2N A;  2KS1 B;  2YMK A;  2ZXE B;  1QLE D;  5AVR B;  2IX7 C;  1CI6 B;  3A0H H;  1OZH A;  1QEX A;  1SQB G;  5GTI E;  2PAJ A;  1SFC C;  2E75 C;  3BCC J;  5KLV J;  1YIJ P;  1YTZ T;  1RF0 C;  3P8M C;  2WSF H;  4AUW A;  1NTK D;  2HR3 A;  2ZT9 D;  4KJM A;  2AEF A;  5APU A;  4UB6 E;  3H1K E;  2BCC E;  3A5T A;  1FOS F;  2R32 A;  1BE3 G;  3CXH D;  1S3J A;  2AXT H;  2HFE D;  2WT7 B;  1SS1 A;  4RES B;  3Q3D A;  3G9R A;  3B8E B;  1GW3 A;  2BEQ D;  3C1L A;  1LTI C;  3L4F A;  2FYN C;  2JWD A;  4LGD E;  1HWT C;  4EIJ A;  1NTK E;  3V5B A;  3N4X A;  2IZ0 A;  4EDF A;  1MKM A;  2KLU A;  2KLV A;  3HTK B;  4HH2 A;  2D2C B;  5AVZ B;  4RKU J;  1HUC A;  3PTZ A;  1FDM A;  1SQX K;  4PV1 B;  3PRJ A;  4NPD A;  1RE3 C;  3CXH E;  5KAI H;  1SQP J;  1ZOY C;  4HYT B;  2HOD A;  1OIP A;  5AW7 B;  3H1H D;  3TGU G;  2OYH A;  1U7J A;  3K5B A;  3Q2Y A;  3H1H J;  1ZRT D;  2I1K A;  1M57 D;  1NTM K;  2K9Y A;  1T3J A;  2B87 A;  1KIL B;  2FXO A;  4PV1 D;  5DJU B;  3AE6 C;  3A0B H;  5KAF H;  5B5E H;  2IPP A;  4AQR D;  3JCU E;  1GMJ A;  2W90 A;  1L0L G;  1X22 A;  3VMX A;  2M3B A;  2OTL P;  1Y8A A;  2N1T C;  2E5Y A;  3IN6 A;  2GM4 A;  1H89 A;  4GKG A;  4JQ0 D;  4PJ0 H;  1OMI A;  3R4Y A;  2RH0 A;  1L0N D;  1H0T A;  1VQ4 P;  3B5N B;  1KIL D;  2KXP B;  4IL6 H;  5AVW B;  3TK1 A;  1SQQ K;  1L0N J;  1LTA C;  3V4Q A;  4C7N B;  4TT3 H;  3HE4 B;  2P10 A;  3KQG A;  3MTU E;  3KZI E;  3H1H E;  1BSH A;  1IO4 A;  5APW A;  5AW8 B;  5GTI H;  2A45 H;  4ZNC A;  1ZRT E;  2FYU J;  5B66 E;  1L4A B;  4BWN A;  5AVT B;  2WMM A;  3AE8 C;  4D6T G;  1SP4 A;  1LP1 B;  1QL1 A;  3HD7 B;  2IYP A;  3RK3 B;  2W8Z A;  5CCG D;  1J2J B;  1OFC X;  3B5N D;  1JY3 P;  4MN4 C;  2M3E A;  1PV3 A;  3BRT B;  4UB6 H;  3H1I D;  3L74 J;  3A7O A;  3IFM A;  1VQK P;  1GL2 C;  4L76 A;  4JPZ B;  1FU1 A;  1IFN A;  2C9N Y;  1L0N E;  1OVU A;  3L37 A;  1KIL E;  3HD7 D;  2Q3I A;  3RK3 D;  1AV1 A;  2XU6 A;  3FWL A;  1GU4 A;  2OYI A;  4I2L C;  4GDO A;  3Q1M A;  2AXC A;  2NZ2 A;  2YMY A;  2H7H A;  1EDJ A;  5KJ7 A;  3H1J D;  3BCC G;  2ZVN B;  5KLV G;  1RF0 A;  2K3R A;  3RL0 B;  4B86 A;  1SQB D;  4WY4 D;  1SQV D;  4IL6 X;  2YKO A;  2OQQ A;  5AVU B;  3H1I E;  4K35 A;  3L72 G;  1OW6 A;  2IBZ G;  1NGM B;  1G1I A;  1J1D C;  1HGV A;  2O1K A;  3CXH H;  1Q82 Q;  2LR2 A;  3CD6 P;  3T97 A;  3TDK A;  5CJ0 A;  2DW3 A;  2P1J A;  3MHV A;  3RK3 E;  1M1J A;  2A45 I;  2ZYG A;  5CBO A;  2KSJ A;  1DD4 A;  2P7J A;  3RL0 D;  2I8D A;  3M0A A;  1BE3 D;  1ZME C;  3NFQ A;  4C46 A;  1KMI Z;  1BE3 J;  1NO4 A;  3H1J E;  2FBW C;  1UII A;  3VOP A;  1HF9 A;  3H1L G;  3V2Q A;  1N7S D;  1QVF O;  1JMB A;  3JCU H;  3QH9 A;  2E76 C;  5KLI B;  3CPW O;  1SQB E;  1SQV E;  1RF1 B;  3GG2 A;  1NTK K;  1RHZ B;  1VF5 C;  1LJ2 A;  2J5U A;  3SWK A;  4H0L B;  1URQ B;  3CX5 D;  3IR9 A;  2CPS A;  2GUS A;  1LWU A;  2Q3E A;  3B4S A;  3TSI A;  1SQP G;  1KYO I;  3MP7 B;  2M5A A;  3KZI H;  1H8A A;  1N7L A;  4WB4 A;  5B66 H;  2M0B A;  1BE3 E;  2ZYD A;  4H0L D;  3L73 J;  1FZC A;  1URQ D;  1DD3 A;  2XZR A;  1YHQ P;  3TNU B;  2G3A A;  1RQV A;  1H88 A;  2QRX A;  1FZA A;  2WIT A;  3TGU D;  1EZV D;  2QJP C;  1WMK A;  4A7P A;  3GF7 A;  3VMZ A;  3E7K A;  2OYH C;  1VQ7 P;  3CCJ P;  2E74 C;  3CXH I;  3OA7 A;  3CX5 E;  1VQO P;  1OVR A;  1YJW P;  2K9J B;  4W7Y A;  2M8R A;  1SFC B;  2E75 B;  4WWI A;  1KQS O;  1L0L D;  1HGZ A;  1KD1 Q;  4UB8 E;  1KC8 Q;  3EFF K;  1QL2 A;  1FZF A;  2OAR A;  4YXD C;  2OTK E;  1PPJ G;  1E79 H;  2FYU G;  5AW3 B;  1RY3 A;  4H13 C;  2QE7 H;  2IFM A;  3UIA A;  3VN0 A;  2C0W A;  2UWJ E;  1SFC D;  3TGU E;  1EZV E;  2E75 D;  3Q5R A;  1D7M A;  3OAK A;  3FX0 A;  1S2E A;  1NTZ G;  3U1C A;  2ZXX A;  4D6T D;  1GK6 A;  1MUU A;  5CCH A;  2E42 A;  2V7Q J;  3KDP B;  1JTH B;  2BAS A;  4BXL A;  1EXI A;  3L74 G;  5AW9 B;  3HE5 A;  5AVQ B;  2QEX P;  2WSC H;  2FYN B;  1AQ5 A;  2HYN A;  3CCS P;  1L0L E;  1R5S A;  3TYY A;  1L0N K;  1YQ4 C;  1K9M Q;  4GIF A;  2LXB A;  5B5E E;  3B71 A;  1PZQ A;  1LT9 B;  3L70 G;  2QIW A;  1NOH A;  1IFI A;  2Q7C A;  1T8Z A;  2R3S A;  2KSE A;  2FFD A;  1TU3 F;  2Z5H A;  3N7N A;  4DT0 A;  2WPV B;  1IJD B;  3M9B A;  2O01 H;  2B9B A;  3AEB C;  1FE6 A;  1OW7 A;  2OYI C;  1FOS E;  5TJH A;  4D6T E;  1ZP0 C;  3BCC D;  5KLV D;  5KJ7 C;  3IF4 A;  3CCR P;  1YQ3 C;  2PP6 A;  4OGQ D;  3KYQ A;  1KFM A;  2NPS B;  1K04 A;  2R5B A;  1M1K Q;  1PP9 G;  3O6Q B;  3L72 D;  5KKZ C;  2IBZ D;  3I56 P;  1T2K D;  5CCG A;  3L72 J;  2HPC B;  2FYZ A;  1LTJ A;  1EXJ A;  2XV5 A;  2KOG A;  3H25 A;  2N1T B;  1VL2 A;  2XKM A;  1GW4 A;  4AYC A;  4HJG H;  2NPS D;  1M1J C;  1OX3 A;  2JWA A;  5TIS E;  1PIX A;  1IFD A;  1ZR4 A;  3CX5 H;  3H1L D;  1SQB K;  2R44 A;  1SQV K;  1IK9 A;  3BCC E;  5KLV E;  2KNC A;  1LTS C;  3H1L J;  2V4H A;  5CHX A;  3LID A;  4GT1 A;  1OW8 A;  4I7Z C;  2N1T D;  3GF3 A;  4UB8 H;  3WUV A;  5AVY B;  2W6B A;  3L72 E;  1IFP A;  2IBZ E;  2KUB A;  1W2B O;  5AW4 B;  1VQP P;  2YIU B;  3A2A A;  1VQL P;  4EYY Q;  4XE5 B;  2RMZ A;  4WY4 A;  1LWU C;  1Y47 A;  3TF5 A;  1SQP D;  3L73 G;  1NWQ A;  1IK7 A;  2HG5 D;  1GL2 B;  3S4R A;  4OH8 B;  3SWY A;  1R5L A;  1WRG A;  5L8R J;  4OWF A;  3H1L E;  1FZC C;  2FXM A;  2D2C D;  2KK7 A;  2N9Y B;  1HH0 A;  4U3F J;  3P7K A;  1M7L A;  1RE4 C;  2JKV A;  5M1B A;  1VDF A;  1GL2 D;  2W83 C;  4IFD K;  4GOE A;  1N7S A;  3II6 A;  2QA4 P;  3Q5S A;  2I1J A;  3M9Q A;  1MFZ A;  2XND H;  1USD A;  1SQP E;  4JYC A;  2MJZ A;  5AVX B;  1J1D B;  4L75 A;  5E79 E;  1VQ6 P;  3JC2 2;  2IFN A;  3PH0 A;  5GTH E;  3CX5 I;  1U57 A;  1SVF A;  1PPJ D;  3S9O A;  2FYU D;  2LKM A;  4BRY A;  3CC4 P;  1X8Y A;  3L71 J;  1ZN5 A;  1DX7 A;  1JEK A;  1N86 A;  2WSE H;  1NTZ D;  1S5L X;  1NTZ J;  3RK2 C;  5AW6 B;  1L0L K;  1VQ5 P;  3L74 D;  2E76 B;  5CCH C;  1VQN P;  1AJY A;  1NU1 J;  2J59 M;  3FXD A;  3H6P A;  4YXW H;  1BDD A;  3CLQ A;  1EZV I;  2YXQ B;  3FXE A;  2B88 A;  1VF5 B;  1L4A D;  2FY8 A;  2O1J A;  2QJY C;  1X79 B;  2W6J H;  1XTG B;  4JBZ A;  2E5T A;  3AEC C;  1PGJ A;  1LNQ A;  3L70 D;  5TIS H;  2L91 A;  1NAY A;  2ZVO B;  2YO2 A;  1RQU A;  1PPJ E;  3L70 J;  2FYU E;  1FS0 E;  1G1J A;  3PLN A;  3CMA P;  2E76 D;  1G2C A;  2ITA A;  1X9V A;  1P84 D;  4OVN F;  2FFD C;  1VF5 D;  1NTZ E;  2Q6Q A;  1PGP A;  1BSN A;  5APT A;  2Q9I A;  3D70 A;  2HOD B;  3AED C;  1FZG A;  5EFW B;  3V6I A;  1KIL C;  2QJP B;  3L74 E;  5APQ A;  1JUN A;  2OYH B;  2QSI A;  4L74 A;  1PP9 D;  2B87 B;  4DOJ A;  1KQF B;  3Q5P A;  1PP9 J;  1PGQ A;  1GZL A;  1X0T A;  3SWF A;  3L70 E;  5CCG C;  4TLF A;  1LTJ C;  4N6J A;  2WWW A;  2QJK C;  3GHG A;  3P32 A;  1E5W A;  2K37 A;  1P84 E;  1KFN A;  5KLV K;  2G8Y A;  1YJN P;  1HTL C;  2WSF J;  3WMM 0;  1FZB A;  2PFX A;  3C8V A;  4H13 B;  1N73 A;  1N2D C;  1RH5 B;  1H0T B;  4GOD A;  3AEA C;  3MIW A;  3HD7 C;  1SQX J;  4O9B A;  1JCD A;  1DEE G;  1S9K D;  2WTY A;  1YI2 P;  1JB0 J;  5AW1 B;  3M0D A;  2C0X A;  1PP9 E;  5E79 H;  1YJ9 P;  5KTB A;  2JO1 A;  5GTH H;  1EC5 A;  3HUS A;  3L73 D;  3H32 A;  1USE A;  3SFE C;  4WY4 C;  1NKZ B;  3CWB G;  4PD4 D;  2JEE A;  2KS1 A;  3MUD A;  2WPQ A;  4R4L A;  3USS A;  4CPG A;  2IBZ I;  1CI6 A;  3AE9 C;  4U3F G;  1K8A Q;  1IC2 A;  4NPE A;  1KTM A;  1ZW0 A;  3VMY A;  1RE4 A;  4U7J A;  3LIE A;  4IFM A;  1Q90 D;  1IZN B;  2N9B A;  1N8R Q;  1S9K E;  5BU8 B;  3KHU A;  3RL0 C;  2OYI B;  3U59 A;  2PRR A;  3GW6 A;  4R4M A;  4I6M C;  1MV8 A;  2AEM A;  4W7Z A;  2JR8 A;  2YO3 A;  3CC7 P;  2GA1 A;  1CZQ A;  3KXD A;  1SQP K;  2VRS A;  2KI7 B;  1VQ9 P;  1N7S C;  2ZAE B;  3LW5 J;  2KB7 P;  2NRG A;  1FZE A;  3V2P A;  3L73 E;  5KKZ B;  4NPF X;  1QGK B;  1T6A A;  1FJP A;  4PD4 E;  1KN7 A;  3L71 G;  2WT7 A;  1S5L E;  5APV A;  3G3Z A;  3AEG C;  1LT1 A;  3T97 B;  3CCV P;  3NMD A;  1JO5 A;  2OGU A;  1M1J B;  4KT0 J;  2KP8 A;  4XA4 A; 
#chains in the Genus database with same CATH homology
 4UB6 H;  3A0B H;  5TIS H;  5KAF H;  3A0H H;  5B5E H;  4IL6 H;  5B66 H;  5H2F H;  2AXT H;  5E79 H;  1S5L H;  3JCU H;  4UB8 H;  5KAI H;  5GTH H;  5GTI H;  3WU2 H;  4PJ0 H;  3KZI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...