2AXTH

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
b'ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
molecule tags Electron transport
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
total genus 14
structure length 64
sequence length 64
chains with identical sequence h
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 2axtH01
5TISH 5E79H 5H2FH 4UB8H 3JCUH 1S5LH 3WU2H 5B5EH 5KAFH 3A0HH 5GTHH 2AXTH 4UB6H 4IL6H 4PJ0H 5KAIH 5B66H 3KZIH 3A0BH 5GTIH
chains in the Genus database with same CATH superfamily
1JY2P 1KB9E 4M3LA 1K9MQ 5AVUB 1KILE 1DH3A 2A06G 1DIPA 3WUTA 4ZMDA 4DJGA 1VF5D 5H2FE 5APYA 4BWNA 3LIDA 1FJPA 2B9BA 5KKZC 5APTA 1SQXG 3AE4C 5KLIC 2MKVA 1GU5A 5AW7B 2H43A 1EDJA 2IBZD 4R4LA 4W7ZA 3H1ID 3CX5D 4H44B 2ZXEB 3H1KE 4ASVA 4K35A 5B66H 1DD3A 1LTGC 3CX5H 2FXMA 1BSNA 1PP9J 1JM0A 1AVOA 1VQPP 1EZVG 3G3ZA 2FY8A 1L4AA 1M57D 4GDOA 1ZV8A 3L71E 3SWYA 4BRYA 3GHGB 1NU1E 2IFMA 5CJ0A 1PGJA 3KZIE 1JCDA 1SFCC 2A45I 4Y28J 2WTYA 3RL0D 4GOFA 1GU4A 1ZRTE 1LTJC 4RESB 1OZHA 1JB0J 1PGOA 2BEQD 2E76C 2KZIA 3HE5A 3E1RA 1VQ7P 4OWFA 4PJ0E 3VOPA 2D2CD 1KQLA 3L72D 1PL5A 1IC2A 5AVYB 1CW5A 2Z4EA 1HVVA 1L4AD 3MTUE 3PH0A 5APSA 2QE7H 5KAIH 1CI6B 4H13B 3D70A 1NAFA 2C9LY 2WSSH 5CCHC 1IJDB 1IFIA 1S5LH 4KT0J 4WY4D 5GTHE 3HD7D 3U59A 1T2KD 4HKZH 1H0TA 2KLVA 4I6MC 4PD4H 3H1KJ 2GM4A 4PD4D 4WBAA 1SFCD 1KZUB 3AECC 5CBOA 1FZCA 1LT1A 2D2CB 3CXHH 3OW2O 1BE3J 3L72J 2G3AA 2OTKE 1KN7A 3K5BA 3L74J 1SQBE 2W8ZA 5CCGC 4IFMA 1OVVA 2R32A 1S3JA 3H1IE 3QH9A 4LGDE 2E75C 4I2LC 1AJYA 4JF7A 1MV8A 1PGQA 4H44C 1R8EA 1J2JB 2G8YA 3HD7A 1YIJP 3M0DC 5AW3B 3V2PA 1Z56A 1H0TB 1NTZD 1IFPA 1LNQA 1E79H 1NTMG 2ZVOB 3H1JE 2JO1A 3MZWB 2QEXP 4EI2A 5KJ7C 3IFMA 3U1CA 1PV3A 1BE3G 1KYOI 2R5DA 3CCMP 3PJSK 2AXTH 1SQVE 2E76D 2A06D 1N8RQ 2VRSA 4N78D 1SS1A 2QRXA 2WWWA 4Y99C 2NPSB 3RL0C 4EDFA 3NXSA 1GD2E 2Q1KA 4PD4I 3PP5A 3CMEP 3HD7C 4C7RA 1T2KC 2O01N 1N7SA 3L73D 1HGZA 5CCHD 1W2BO 2R44A 4LC1A 1KC8Q 3BASA 2FXOA 4BRYB 5KJ7A 1L4AB 1USDA 2K3RA 4B86A 1L0NJ 2KNCB 3V2RA 1RQUA 3HUSC 1HJBA 1MFZA 1LWUA 1EC5A 3A0HE 1BDDA 2IDBA 2QG4A 3EWKA 3SFDC 1GDTA 1VQ9P 1N73C 1FU1A 1EDIA 1LTTC 1X79B 2XDJA 5GTIE 1VF5C 1AQ5A 1SQQE 4WWIA 3GG2A 3H6PA 3FXDA 4Z1MH 5KAFH 1IFDA 1Q2NA 1FAVA 2P10A 2ZT9C 3ITKA 4XE5B 1L0NK 3H1KG 1KB9D 1KILC 1BGYG 1N7SB 3F5HA 3TGUE 1PIXA 3VMZA 2YXQB 3N4XA 2E75B 3CCLP 4WY4A 2FYUE 4QMAA 1SQXJ 1JTHA 3M06A 2NPSA 2E74C 1RF0C 2W27A 1RE4A 1DEEG 2WZ7A 2B88A 1MKMA 1L0LK 2ZT9D 1SQVG 2IPPA 2GA1A 3A2AA 4JYCA 5AW0B 1VQ4P 2WVRA 5AVTB 3PHLA 4IOIH 1GK6A 3B5NC 1ZLLA 4ZKPA 3HD7B 2AXCA 1OW6A 2M5AB 3H1HE 4KJMA 1M1JB 2FYNC 2V7QH 1Y47A 3MHVA 1SQXD 2RMZA 2HG5D 1S4XA 2HLOA 3L73E 4IFDK 2Q3EA 3H32B 2OTJP 1BGYE 1L0LJ 1L4AC 3FX0A 3L70J 5CHXA 1FOSF 1GZLA 1M7LA 1S5LX 2Q3IA 1IK7A 5DJTB 2OYIC 2J5UA 2PP6A 3LIEA 2W6JH 2BEZF 3L73G 1KYOE 4IFFA 1OMIA 1ZW0A 1YITP 4IL6X 1A02J 2FFDC 1QX8A 1SVFA 3V6IA 4R4MA 2WT7B 4UB6H 1GL2C 3RK3D 2KB7P 2HPCB 2Z5HA 2GUSA 1T3JA 4AUWA 5EFWB 1KV4A 4DCKA 3TGUD 2ZXXA 2N1TA 5KJ7D 1Q81Q 5KLVK 3BCCG 4L73A 2AEMA 2JEEA 1YJ9P 1W2EA 1RH5B 1K04A 1EDLA 3USSA 2FYUG 1JMBA 2WSFJ 3P7KA 2B87B 4H44D 1N73A 1VQ6P 2CK3H 1PGPA 2H89C 5AVWB 3ZDMA 1KORA 1NTZK 2YO3A 3BCCE 1RE3A 3N7NA 4IL6E 5DJUB 1DEBA 3W67A 4D6TD 3SWKA 1ZR4A 1HBWA 4L76A 1JNMA 2WPQA 1ZN5A 2OYHB 2N1TC 2IBZE 5E79E 3S1KA 3S4RA 4MN4C 3EFFK 1JOCA 3NFQA 1NTKG 1GW4A 1NTKK 1NTME 2O01J 3B5NB 1FZEA 5TJHA 1S9KD 1SQXK 2KS1B 1GL2A 2QJKC 3FGAD 1NTZJ 1IFJA 2KNCA 3L71D 1BE3E 4OGQB 3S9OA 1KFMA 2ZYGA 1IZNB 3H1JG 1BCCJ 2K9JA 2KUBA 2HODA 3U1AA 4HB1A 3V5BA 4D6TG 2H7HA 1P84I 3CCVP 2I1JA 5E79H 3I55P 2RN0A 4CPGA 1KMIZ 1NAYA 2KIKA 2P58A 2YKPA 2CPSA 3AE7C 1X8YA 4N6JA 3RK3B 2YO2A 2WPRA 3UIAA 1PFIA 1IFMA 5APVA 2YKQA 4UB6E 2K88A 2JWAA 2C0XA 1QLED 1SLQA 3P8CD 1J1DC 4PV1B 3RK2B 2N9YB 3V4QA 1K05A 1YTZI 5KLVD 1KTMA 1LTJB 1HH0A 1L0ND 5CCGA 1BDCA 4TLFA 2OYIA 3WUUA 4WVZA 1M1KQ 2QA4P 4JBZA 2QJPC 3Q2YA 1OWAA 3FXEA 4NPFX 1KQSO 3II6A 3AEGC 3GW6A 1RE3C 1OFCX 1LP1A 3HTKA 3NMDA 2FKWB 1FBMA 3AE9C 4TT3H 1G1JA 1MZ9A 3Q1MA 1YJNP 3MUDA 1BCCE 3RK2D 1E5WA 1NKZB 3HTKB 5KLVJ 3TNUB 1DX7A 1SQQG 1UIXA 2AEFA 2KSEA 2W6BA 3LW5J 1JUNA 1IK9A 3L36A 4GT1A 1RF0A 3M9QA 1LTJA 4YXDC 2FXPA 1J1DB 2A45G 1L0LE 3L70E 3L35A 4PV1C 4YPCA 3TDKA 5KTBA 1U7MA 1OW7A 3O8ZA 5TISE 3H1JJ 1G1IA 1K73Q 1H8AA 3HE5B 2KLUA 2Y0EA 3C8VA 1D7MA 1KILA 2ZVNB 3KXDA 1NTKJ 1M8OB 1UIIA 1QL1A 1N7LA 1NU1D 2K1AA 2J59M 2O1KA 1JMMA 3M9HA 1CSBA 1QL2A 1SQBG 1ZOYC 4HJGH 3CCEP 5GTIH 3L73J 3MIWA 3R2PA 3KYQA 5B66E 3HE4A 2K9JB 5AW8B 1JY2O 4PV1D 4I7ZC 2YKOA 1WRGA 1VF5B 5AVXB 2R5BA 4H13D 2Y9ZA 3HUSA 4GODA 3G71P 1KD1Q 1RY3A 2B89A 3AEBC 2QJPB 1PP9D 4GIFA 2LXCB 3AE6C 4OGQD 2I1KA 3WMM0 2AEJA 1SQVJ 3FWLA 3HE4B 3V2NA 1AQTA 1EDKA 3PLNA 1XTGB 1H89A 5B5EE 2HR3A 1VQOP 2P1JA 3A7OA 1JY3O 4YXWH 3L74D 2P67A 1QVGO 3BCCD 3CL3D 5AW9B 4AYCA 3CCSP 3B71A 1A02F 1RF1B 1NTZE 1JCCA 2E5TA 2RH0A 4IL6H 4D6TE 4NPEA 1RF1A 2IZ0A 3L71J 3JC22 1LT9A 3CWBJ 1G2CA 1L0LG 3L70G 1SQVK 3M9BA 1LT9C 4W7YA 3CXHI 3HRNA 4I7ZB 2HYNA 2FFDB 1QEXA 4W80A 4N78E 2DW3A 1OXZA 2OYOA 5BU5A 2QIWA 2LKMA 3AEFC 3E7KA 1JO5A 3VMAA 2QJKB 1OW8A 1SQXE 1TU3F 3OAKA 3CC4P 3BCCJ 1SQQJ 2WQYC 1YI2P 2K9YA 2LXBA 3CCJP 2WSFH 1Q7YQ 1XTCC 2PFXA 4PD4E 2ZJSE 4C7NA 3V4WA 1U7JA 3L37A 1PZQA 2OYHC 2IX7C 3CWBG 3RL0g 1KYOH 3L71G 1EZVI 1S1CX 2XNDH 3L75G 4H0LD 1SQBD 1ZR2A 5APQA 1KYOD 1NO4A 3GLMA 1SQPG 1M56D 2K37A 4ZKUA 1FDIA 1NGMB 1U57A 1SQQK 3CXHE 3PRJA 3VP8A 3CX5I 1LJ2A 1SQPK 2C0WA 1OIPA 5TISH 1S2EA 2QVAA 1PPJD 1KILB 1EXIA 1L0NE 5APXA 1GK4A 2Q6QA 1X9VA 3KHUA 4O9BA 1S5LE 2XNXA 5GTHH 2QJYB 2HFED 2A06E 3BRTB 1SFCA 3Q5RA 1JTHB 1NTMJ 1YTZT 2FYUK 4UB8H 1LTBC 2BCCJ 5AW6B 3L74E 4WY4B 1X22A 3SSUA 2R3SA 3CC2P 1MFTA 2XZRA 4PJ0H 3CX5E 4H0LC 1HTLC 1L2PA 2M3BA 1OX3A 4U7JA 4EYYQ 2NPSC 1S72P 1MUUA 1JY2N 3IAOA 4C46A 4K3AA 3BATA 3G4SP 2MJZA 3H1LG 1NJIQ 1FOSE 1Q90D 5AW4B 3JSVC 1Q82Q 1GL2B 1HGVA 1ZMEC 1FDMA 1P84H 1FS0E 2IYPA 5AW1B 1LP1B 3B5NA 5CCHA 1URQD 2M0BA 5KAFE 1P84D 2BCCD 2IBZG 1KB9H 2PRRA 2IYOA 2WPSA 3B8EB 4L74A 3Q5PA 4RKUJ 1RHZB 3CCRP 1JY3P 1IO4A 2O1JA 4JYBA 2JWDA 4Y99B 5AVZB 3GF7A 2OTLP 2OYIB 1RE4C 2FBWC 2QM8A 2YIUB 1J1EC 5AVRB 2PAJA 3WU2E 1DD4A 1SQVD 3A0HH 3ABVC 2C9NY 3TF5A 1HF9A 1QVFO 1JY3N 4U3FD 1PPJG 5H2FH 5CBNA 2XKMA 3B5ND 1GMJA 3SWFA 4L75A 4OVNF 1FE6A 1NU1G 1URQC 5K5GB 5KLVG 1HWTC 4ZNCA 1NHLA 1N7SC 3M0AA 1N2DC 1SQPD 1LTSC 2OQQA 2R3CA 1BGYD 3MGNA 1YQ3C 2L5GB 2W6AA 2Y9YA 1KFNA 2XV5A 1BCCG 2Z5IA 4YTPC 3AE3C 3WUVA 1NTZG 5BU8B 1PP9G 4JQ0D 5KLVE 3M91A 1AV1A 2JKVA 3P8CE 2AXTE 1SQBK 1NH4A 3AEDC 1LWUC 3TNUA 4AQRD 1KB9I 1YYCA 2GUVA 3RK3E 2KS1A 4H13C 3H1KD 1R5LA 3A0BE 4GKGA 3D6YA 3H1JD 4C7NB 3HUSB 1VPCA 2RKLA 2JR8A 1CZQA 1BCCD 2KK7A 3CWBD 3H1LE 2OYHA 2E76B 2KYVA 4DZOA 1M1JA 1N7SD 1NTMK 2FYUJ 2WITA 3G9RA 1AFOA 2YMYA 2H88C 1T3UA 1URQB 2V4HA 3IF4A 3KQGA 3JCUE 1KQFB 1RF1C 4NPDA 2FFDA 3GHGC 3A3YB 3LW5H 5AVVB 3L74G 4U3FG 1CI6A 1AA0A 1SFCB 1G2CB 3L72G 2Y0CA 1J1EB 1LT9B 5AVQB 2Q7CA 3TGUG 1M90Q 2IZ1A 2OGUA 1VQKP 1VQMP 1USEA 1WT6A 2N9BA 2A45H 1N86A 2KI7B 3BRVB 3P32A 1YQ4C 4BXLA 3VMYA 1AVYA 5KAIE 3L72E 1GTWA 2IFNA 5C39A 2QM7A 2ZFCA 1URQA 2CPBA 1SQPJ 2WSCJ 2N1TD 2WT7A 1FDOA 1NVOA 2O3JA 4DT0A 3RBZA 3RK2C 1VQ5P 1FZCC 2WSCH 1NYHA 3L75E 3CC7P 3TGUJ 2Y0DA 4U3FJ 3KZIH 1FZFA 1EXJA 3CXHD 2NPSD 3AE1C 2NRGA 2POHA 3KDPB 2H8PD 3TSIA 1NU1J 5KLIB 2E75D 3KPEA 3CCUP 1R5SA 5APWA 4I1LA 2M8RA 2P7JA 2QSIA 2ZYDA 4N3YB 3CWBE 3H1LD 3L4FA 3SFEC 4XA4A 3P8MC 1NOHA 2SPZA 3BVHA 3CPWO 3Q3DA 2E74B 1T6AA 4HYTB 1YJWP 1N73B 5APUA 1EZVE 1ZXGA 2JDIH 3H1HJ 1EQ7A 1LTAC 4KHXA 4JPZB 4OGQC 1KQGB 1NU1K 1OVUA 2OARA 1FZAA 1T8ZA 4WY4C 3G6EP 2KZJA 1Q86Q 4LLHA 2L91A 1GW3A 4OH8B 4RO0A 3I56P 1BGYJ 1LTIC 2O01H 1RQVA 5AW2B 2D2CC 1NWQA 1VQLP 2ZYAA 5M1BA 2WSEH 1EZVD 1P84E 2BCCE 2HPCA 1ZP0C 1OVRA 5AW5B 1YHQP 3D71A 3VYIA 3IN6A 3TYYA 1SQQD 1S9KE 3H1IG 1WMKA 3OA7A 3L75D 2BCCG 1BSHA 2BASA 3QWOC 2UWJE 3H32A 1L0NG 3OJAB 3EQ2A 5CMZA 1FZCB 3MUDC 3O6QA 2JP3A 2IBZI 4UB8E 3CMAP 1SQBJ 2FYUD 3MP7B 1K8AQ 3F89A 3VN0A 5CJ4A 3C1LA 5AVSB 1H88A 2JJLA 3AE5C 3VP9A 1PPJE 1QGKB 2ZAEB 2FYZA 3RBXA 4XFJA 3RL0B 4GOEA 4RJTA 3A5TA 3MD0A 4A7PA 5CCGD 3T97B 2Q5UA 3GF3A 1BE3D 3L75J 1L0LD 2YIUC 1PP9E 3JCUH 3L70D 3RGUA 2YXRB 2ITAA 2V7QJ 2W90A 5L8RJ 3VMXA 4H0LB 1NTMD 3T97A 1GL2D 3RK3C 3VTPC 2WSEJ 4WB4A 2PGDA 3C9IA 4ASWA 4EIJA 3D6ZA 2E43A 2I8DA 3I5CA 1Y8AA 5KKZB 1VQ8P 1FC2C 2KSJA 2E42A 3CI9A 1JEKA 2HODB 2P2UA 1NTKE 3AE2C 3W68A 2QJYC 3GHGA 1YBKA 1VL2A 1VDFA 2YNYA 3AEAC 4EOTA 2WMMA 3E1IA 1KILD 2NZ2A 3O6QB 4D6TJ 2YMKA 2ZT9B 1W5CE 3AE8C 3PTZA 1M1JC 2E5YA 2FYNB 2KXPB 3CLQA 3EFGA 3H1HD 4HH2A 3B4SA 3GMAA 1LWUB 2W83C 2M5AA 1IFNA 1NTKD 2KOGA 3H1HG 1Y9BA 2J58A 3IR9A 3A0BH 3R4YA 3H1LJ 1FZGA 1VQNP 1X0TA 3FWNA 1LGHB 1FJKA 4U3FE 3CD6P 2B87A 1FZBA 2E74D 1HJ0A 4DOJA 3H25A 3AEEC 3NTNA 3H1IJ 2WPVB 5BVZA 3V2QA 5B5EH 2Q9IA 3CCQP 3M0DA 2M3EA 3WU2H 1SP4A 3Q5SA 1SQPE 1ZRTD 1HUCA 3TK1A 2KP8A 2N1TB 2XU6A 2LR2A 1NKNA
chains in the Genus database with same CATH topology
5TISH 5E79H 5H2FH 4UB8H 3JCUH 1S5LH 3WU2H 5B5EH 5KAFH 3A0HH 5GTHH 2AXTH 4UB6H 4IL6H 4PJ0H 5KAIH 5B66H 3KZIH 3A0BH 5GTIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS H;  5E79 H;  5H2F H;  4UB8 H;  3JCU H;  1S5L H;  3WU2 H;  5B5E H;  5KAF H;  3A0H H;  5GTH H;  2AXT H;  4UB6 H;  4IL6 H;  4PJ0 H;  5KAI H;  5B66 H;  3KZI H;  3A0B H;  5GTI H; 
#chains in the Genus database with same CATH topology
 1JY2 P;  1KB9 E;  4M3L A;  1K9M Q;  5AVU B;  1KIL E;  1DH3 A;  2A06 G;  1DIP A;  3WUT A;  4ZMD A;  4DJG A;  1VF5 D;  5H2F E;  5APY A;  4BWN A;  3LID A;  1FJP A;  2B9B A;  5KKZ C;  5APT A;  1SQX G;  3AE4 C;  5KLI C;  2MKV A;  1GU5 A;  5AW7 B;  2H43 A;  1EDJ A;  2IBZ D;  4R4L A;  4W7Z A;  3H1I D;  3CX5 D;  4H44 B;  2ZXE B;  3H1K E;  4ASV A;  4K35 A;  5B66 H;  1DD3 A;  1LTG C;  3CX5 H;  2FXM A;  1BSN A;  1PP9 J;  1JM0 A;  1AVO A;  1VQP P;  1EZV G;  3G3Z A;  2FY8 A;  1L4A A;  1M57 D;  4GDO A;  1ZV8 A;  3L71 E;  3SWY A;  4BRY A;  3GHG B;  1NU1 E;  2IFM A;  5CJ0 A;  1PGJ A;  3KZI E;  1JCD A;  1SFC C;  2A45 I;  4Y28 J;  2WTY A;  3RL0 D;  4GOF A;  1GU4 A;  1ZRT E;  1LTJ C;  4RES B;  1OZH A;  1JB0 J;  1PGO A;  2BEQ D;  2E76 C;  2KZI A;  3HE5 A;  3E1R A;  1VQ7 P;  4OWF A;  4PJ0 E;  3VOP A;  2D2C D;  1KQL A;  3L72 D;  1PL5 A;  1IC2 A;  5AVY B;  1CW5 A;  2Z4E A;  1HVV A;  1L4A D;  3MTU E;  3PH0 A;  5APS A;  2QE7 H;  5KAI H;  1CI6 B;  4H13 B;  3D70 A;  1NAF A;  2C9L Y;  2WSS H;  5CCH C;  1IJD B;  1IFI A;  1S5L H;  4KT0 J;  4WY4 D;  5GTH E;  3HD7 D;  3U59 A;  1T2K D;  4HKZ H;  1H0T A;  2KLV A;  4I6M C;  4PD4 H;  3H1K J;  2GM4 A;  4PD4 D;  4WBA A;  1SFC D;  1KZU B;  3AEC C;  5CBO A;  1FZC A;  1LT1 A;  2D2C B;  3CXH H;  3OW2 O;  1BE3 J;  3L72 J;  2G3A A;  2OTK E;  1KN7 A;  3K5B A;  3L74 J;  1SQB E;  2W8Z A;  5CCG C;  4IFM A;  1OVV A;  2R32 A;  1S3J A;  3H1I E;  3QH9 A;  4LGD E;  2E75 C;  4I2L C;  1AJY A;  4JF7 A;  1MV8 A;  1PGQ A;  4H44 C;  1R8E A;  1J2J B;  2G8Y A;  3HD7 A;  1YIJ P;  3M0D C;  5AW3 B;  3V2P A;  1Z56 A;  1H0T B;  1NTZ D;  1IFP A;  1LNQ A;  1E79 H;  1NTM G;  2ZVO B;  3H1J E;  2JO1 A;  3MZW B;  2QEX P;  4EI2 A;  5KJ7 C;  3IFM A;  3U1C A;  1PV3 A;  1BE3 G;  1KYO I;  2R5D A;  3CCM P;  3PJS K;  2AXT H;  1SQV E;  2E76 D;  2A06 D;  1N8R Q;  2VRS A;  4N78 D;  1SS1 A;  2QRX A;  2WWW A;  4Y99 C;  2NPS B;  3RL0 C;  4EDF A;  3NXS A;  1GD2 E;  2Q1K A;  4PD4 I;  3PP5 A;  3CME P;  3HD7 C;  4C7R A;  1T2K C;  2O01 N;  1N7S A;  3L73 D;  1HGZ A;  5CCH D;  1W2B O;  2R44 A;  4LC1 A;  1KC8 Q;  3BAS A;  2FXO A;  4BRY B;  5KJ7 A;  1L4A B;  1USD A;  2K3R A;  4B86 A;  1L0N J;  2KNC B;  3V2R A;  1RQU A;  3HUS C;  1HJB A;  1MFZ A;  1LWU A;  1EC5 A;  3A0H E;  1BDD A;  2IDB A;  2QG4 A;  3EWK A;  3SFD C;  1GDT A;  1VQ9 P;  1N73 C;  1FU1 A;  1EDI A;  1LTT C;  1X79 B;  2XDJ A;  5GTI E;  1VF5 C;  1AQ5 A;  1SQQ E;  4WWI A;  3GG2 A;  3H6P A;  3FXD A;  4Z1M H;  5KAF H;  1IFD A;  1Q2N A;  1FAV A;  2P10 A;  2ZT9 C;  3ITK A;  4XE5 B;  1L0N K;  3H1K G;  1KB9 D;  1KIL C;  1BGY G;  1N7S B;  3F5H A;  3TGU E;  1PIX A;  3VMZ A;  2YXQ B;  3N4X A;  2E75 B;  3CCL P;  4WY4 A;  2FYU E;  4QMA A;  1SQX J;  1JTH A;  3M06 A;  2NPS A;  2E74 C;  1RF0 C;  2W27 A;  1RE4 A;  1DEE G;  2WZ7 A;  2B88 A;  1MKM A;  1L0L K;  2ZT9 D;  1SQV G;  2IPP A;  2GA1 A;  3A2A A;  4JYC A;  5AW0 B;  1VQ4 P;  2WVR A;  5AVT B;  3PHL A;  4IOI H;  1GK6 A;  3B5N C;  1ZLL A;  4ZKP A;  3HD7 B;  2AXC A;  1OW6 A;  2M5A B;  3H1H E;  4KJM A;  1M1J B;  2FYN C;  2V7Q H;  1Y47 A;  3MHV A;  1SQX D;  2RMZ A;  2HG5 D;  1S4X A;  2HLO A;  3L73 E;  4IFD K;  2Q3E A;  3H32 B;  2OTJ P;  1BGY E;  1L0L J;  1L4A C;  3FX0 A;  3L70 J;  5CHX A;  1FOS F;  1GZL A;  1M7L A;  1S5L X;  2Q3I A;  1IK7 A;  5DJT B;  2OYI C;  2J5U A;  2PP6 A;  3LIE A;  2W6J H;  2BEZ F;  3L73 G;  1KYO E;  4IFF A;  1OMI A;  1ZW0 A;  1YIT P;  4IL6 X;  1A02 J;  2FFD C;  1QX8 A;  1SVF A;  3V6I A;  4R4M A;  2WT7 B;  4UB6 H;  1GL2 C;  3RK3 D;  2KB7 P;  2HPC B;  2Z5H A;  2GUS A;  1T3J A;  4AUW A;  5EFW B;  1KV4 A;  4DCK A;  3TGU D;  2ZXX A;  2N1T A;  5KJ7 D;  1Q81 Q;  5KLV K;  3BCC G;  4L73 A;  2AEM A;  2JEE A;  1YJ9 P;  1W2E A;  1RH5 B;  1K04 A;  1EDL A;  3USS A;  2FYU G;  1JMB A;  2WSF J;  3P7K A;  2B87 B;  4H44 D;  1N73 A;  1VQ6 P;  2CK3 H;  1PGP A;  2H89 C;  5AVW B;  3ZDM A;  1KOR A;  1NTZ K;  2YO3 A;  3BCC E;  1RE3 A;  3N7N A;  4IL6 E;  5DJU B;  1DEB A;  3W67 A;  4D6T D;  3SWK A;  1ZR4 A;  1HBW A;  4L76 A;  1JNM A;  2WPQ A;  1ZN5 A;  2OYH B;  2N1T C;  2IBZ E;  5E79 E;  3S1K A;  3S4R A;  4MN4 C;  3EFF K;  1JOC A;  3NFQ A;  1NTK G;  1GW4 A;  1NTK K;  1NTM E;  2O01 J;  3B5N B;  1FZE A;  5TJH A;  1S9K D;  1SQX K;  2KS1 B;  1GL2 A;  2QJK C;  3FGA D;  1NTZ J;  1IFJ A;  2KNC A;  3L71 D;  1BE3 E;  4OGQ B;  3S9O A;  1KFM A;  2ZYG A;  1IZN B;  3H1J G;  1BCC J;  2K9J A;  2KUB A;  2HOD A;  3U1A A;  4HB1 A;  3V5B A;  4D6T G;  2H7H A;  1P84 I;  3CCV P;  2I1J A;  5E79 H;  3I55 P;  2RN0 A;  4CPG A;  1KMI Z;  1NAY A;  2KIK A;  2P58 A;  2YKP A;  2CPS A;  3AE7 C;  1X8Y A;  4N6J A;  3RK3 B;  2YO2 A;  2WPR A;  3UIA A;  1PFI A;  1IFM A;  5APV A;  2YKQ A;  4UB6 E;  2K88 A;  2JWA A;  2C0X A;  1QLE D;  1SLQ A;  3P8C D;  1J1D C;  4PV1 B;  3RK2 B;  2N9Y B;  3V4Q A;  1K05 A;  1YTZ I;  5KLV D;  1KTM A;  1LTJ B;  1HH0 A;  1L0N D;  5CCG A;  1BDC A;  4TLF A;  2OYI A;  3WUU A;  4WVZ A;  1M1K Q;  2QA4 P;  4JBZ A;  2QJP C;  3Q2Y A;  1OWA A;  3FXE A;  4NPF X;  1KQS O;  3II6 A;  3AEG C;  3GW6 A;  1RE3 C;  1OFC X;  1LP1 A;  3HTK A;  3NMD A;  2FKW B;  1FBM A;  3AE9 C;  4TT3 H;  1G1J A;  1MZ9 A;  3Q1M A;  1YJN P;  3MUD A;  1BCC E;  3RK2 D;  1E5W A;  1NKZ B;  3HTK B;  5KLV J;  3TNU B;  1DX7 A;  1SQQ G;  1UIX A;  2AEF A;  2KSE A;  2W6B A;  3LW5 J;  1JUN A;  1IK9 A;  3L36 A;  4GT1 A;  1RF0 A;  3M9Q A;  1LTJ A;  4YXD C;  2FXP A;  1J1D B;  2A45 G;  1L0L E;  3L70 E;  3L35 A;  4PV1 C;  4YPC A;  3TDK A;  5KTB A;  1U7M A;  1OW7 A;  3O8Z A;  5TIS E;  3H1J J;  1G1I A;  1K73 Q;  1H8A A;  3HE5 B;  2KLU A;  2Y0E A;  3C8V A;  1D7M A;  1KIL A;  2ZVN B;  3KXD A;  1NTK J;  1M8O B;  1UII A;  1QL1 A;  1N7L A;  1NU1 D;  2K1A A;  2J59 M;  2O1K A;  1JMM A;  3M9H A;  1CSB A;  1QL2 A;  1SQB G;  1ZOY C;  4HJG H;  3CCE P;  5GTI H;  3L73 J;  3MIW A;  3R2P A;  3KYQ A;  5B66 E;  3HE4 A;  2K9J B;  5AW8 B;  1JY2 O;  4PV1 D;  4I7Z C;  2YKO A;  1WRG A;  1VF5 B;  5AVX B;  2R5B A;  4H13 D;  2Y9Z A;  3HUS A;  4GOD A;  3G71 P;  1KD1 Q;  1RY3 A;  2B89 A;  3AEB C;  2QJP B;  1PP9 D;  4GIF A;  2LXC B;  3AE6 C;  4OGQ D;  2I1K A;  3WMM 0;  2AEJ A;  1SQV J;  3FWL A;  3HE4 B;  3V2N A;  1AQT A;  1EDK A;  3PLN A;  1XTG B;  1H89 A;  5B5E E;  2HR3 A;  1VQO P;  2P1J A;  3A7O A;  1JY3 O;  4YXW H;  3L74 D;  2P67 A;  1QVG O;  3BCC D;  3CL3 D;  5AW9 B;  4AYC A;  3CCS P;  3B71 A;  1A02 F;  1RF1 B;  1NTZ E;  1JCC A;  2E5T A;  2RH0 A;  4IL6 H;  4D6T E;  4NPE A;  1RF1 A;  2IZ0 A;  3L71 J;  3JC2 2;  1LT9 A;  3CWB J;  1G2C A;  1L0L G;  3L70 G;  1SQV K;  3M9B A;  1LT9 C;  4W7Y A;  3CXH I;  3HRN A;  4I7Z B;  2HYN A;  2FFD B;  1QEX A;  4W80 A;  4N78 E;  2DW3 A;  1OXZ A;  2OYO A;  5BU5 A;  2QIW A;  2LKM A;  3AEF C;  3E7K A;  1JO5 A;  3VMA A;  2QJK B;  1OW8 A;  1SQX E;  1TU3 F;  3OAK A;  3CC4 P;  3BCC J;  1SQQ J;  2WQY C;  1YI2 P;  2K9Y A;  2LXB A;  3CCJ P;  2WSF H;  1Q7Y Q;  1XTC C;  2PFX A;  4PD4 E;  2ZJS E;  4C7N A;  3V4W A;  1U7J A;  3L37 A;  1PZQ A;  2OYH C;  2IX7 C;  3CWB G;  3RL0 g;  1KYO H;  3L71 G;  1EZV I;  1S1C X;  2XND H;  3L75 G;  4H0L D;  1SQB D;  1ZR2 A;  5APQ A;  1KYO D;  1NO4 A;  3GLM A;  1SQP G;  1M56 D;  2K37 A;  4ZKU A;  1FDI A;  1NGM B;  1U57 A;  1SQQ K;  3CXH E;  3PRJ A;  3VP8 A;  3CX5 I;  1LJ2 A;  1SQP K;  2C0W A;  1OIP A;  5TIS H;  1S2E A;  2QVA A;  1PPJ D;  1KIL B;  1EXI A;  1L0N E;  5APX A;  1GK4 A;  2Q6Q A;  1X9V A;  3KHU A;  4O9B A;  1S5L E;  2XNX A;  5GTH H;  2QJY B;  2HFE D;  2A06 E;  3BRT B;  1SFC A;  3Q5R A;  1JTH B;  1NTM J;  1YTZ T;  2FYU K;  4UB8 H;  1LTB C;  2BCC J;  5AW6 B;  3L74 E;  4WY4 B;  1X22 A;  3SSU A;  2R3S A;  3CC2 P;  1MFT A;  2XZR A;  4PJ0 H;  3CX5 E;  4H0L C;  1HTL C;  1L2P A;  2M3B A;  1OX3 A;  4U7J A;  4EYY Q;  2NPS C;  1S72 P;  1MUU A;  1JY2 N;  3IAO A;  4C46 A;  4K3A A;  3BAT A;  3G4S P;  2MJZ A;  3H1L G;  1NJI Q;  1FOS E;  1Q90 D;  5AW4 B;  3JSV C;  1Q82 Q;  1GL2 B;  1HGV A;  1ZME C;  1FDM A;  1P84 H;  1FS0 E;  2IYP A;  5AW1 B;  1LP1 B;  3B5N A;  5CCH A;  1URQ D;  2M0B A;  5KAF E;  1P84 D;  2BCC D;  2IBZ G;  1KB9 H;  2PRR A;  2IYO A;  2WPS A;  3B8E B;  4L74 A;  3Q5P A;  4RKU J;  1RHZ B;  3CCR P;  1JY3 P;  1IO4 A;  2O1J A;  4JYB A;  2JWD A;  4Y99 B;  5AVZ B;  3GF7 A;  2OTL P;  2OYI B;  1RE4 C;  2FBW C;  2QM8 A;  2YIU B;  1J1E C;  5AVR B;  2PAJ A;  3WU2 E;  1DD4 A;  1SQV D;  3A0H H;  3ABV C;  2C9N Y;  3TF5 A;  1HF9 A;  1QVF O;  1JY3 N;  4U3F D;  1PPJ G;  5H2F H;  5CBN A;  2XKM A;  3B5N D;  1GMJ A;  3SWF A;  4L75 A;  4OVN F;  1FE6 A;  1NU1 G;  1URQ C;  5K5G B;  5KLV G;  1HWT C;  4ZNC A;  1NHL A;  1N7S C;  3M0A A;  1N2D C;  1SQP D;  1LTS C;  2OQQ A;  2R3C A;  1BGY D;  3MGN A;  1YQ3 C;  2L5G B;  2W6A A;  2Y9Y A;  1KFN A;  2XV5 A;  1BCC G;  2Z5I A;  4YTP C;  3AE3 C;  3WUV A;  1NTZ G;  5BU8 B;  1PP9 G;  4JQ0 D;  5KLV E;  3M91 A;  1AV1 A;  2JKV A;  3P8C E;  2AXT E;  1SQB K;  1NH4 A;  3AED C;  1LWU C;  3TNU A;  4AQR D;  1KB9 I;  1YYC A;  2GUV A;  3RK3 E;  2KS1 A;  4H13 C;  3H1K D;  1R5L A;  3A0B E;  4GKG A;  3D6Y A;  3H1J D;  4C7N B;  3HUS B;  1VPC A;  2RKL A;  2JR8 A;  1CZQ A;  1BCC D;  2KK7 A;  3CWB D;  3H1L E;  2OYH A;  2E76 B;  2KYV A;  4DZO A;  1M1J A;  1N7S D;  1NTM K;  2FYU J;  2WIT A;  3G9R A;  1AFO A;  2YMY A;  2H88 C;  1T3U A;  1URQ B;  2V4H A;  3IF4 A;  3KQG A;  3JCU E;  1KQF B;  1RF1 C;  4NPD A;  2FFD A;  3GHG C;  3A3Y B;  3LW5 H;  5AVV B;  3L74 G;  4U3F G;  1CI6 A;  1AA0 A;  1SFC B;  1G2C B;  3L72 G;  2Y0C A;  1J1E B;  1LT9 B;  5AVQ B;  2Q7C A;  3TGU G;  1M90 Q;  2IZ1 A;  2OGU A;  1VQK P;  1VQM P;  1USE A;  1WT6 A;  2N9B A;  2A45 H;  1N86 A;  2KI7 B;  3BRV B;  3P32 A;  1YQ4 C;  4BXL A;  3VMY A;  1AVY A;  5KAI E;  3L72 E;  1GTW A;  2IFN A;  5C39 A;  2QM7 A;  2ZFC A;  1URQ A;  2CPB A;  1SQP J;  2WSC J;  2N1T D;  2WT7 A;  1FDO A;  1NVO A;  2O3J A;  4DT0 A;  3RBZ A;  3RK2 C;  1VQ5 P;  1FZC C;  2WSC H;  1NYH A;  3L75 E;  3CC7 P;  3TGU J;  2Y0D A;  4U3F J;  3KZI H;  1FZF A;  1EXJ A;  3CXH D;  2NPS D;  3AE1 C;  2NRG A;  2POH A;  3KDP B;  2H8P D;  3TSI A;  1NU1 J;  5KLI B;  2E75 D;  3KPE A;  3CCU P;  1R5S A;  5APW A;  4I1L A;  2M8R A;  2P7J A;  2QSI A;  2ZYD A;  4N3Y B;  3CWB E;  3H1L D;  3L4F A;  3SFE C;  4XA4 A;  3P8M C;  1NOH A;  2SPZ A;  3BVH A;  3CPW O;  3Q3D A;  2E74 B;  1T6A A;  4HYT B;  1YJW P;  1N73 B;  5APU A;  1EZV E;  1ZXG A;  2JDI H;  3H1H J;  1EQ7 A;  1LTA C;  4KHX A;  4JPZ B;  4OGQ C;  1KQG B;  1NU1 K;  1OVU A;  2OAR A;  1FZA A;  1T8Z A;  4WY4 C;  3G6E P;  2KZJ A;  1Q86 Q;  4LLH A;  2L91 A;  1GW3 A;  4OH8 B;  4RO0 A;  3I56 P;  1BGY J;  1LTI C;  2O01 H;  1RQV A;  5AW2 B;  2D2C C;  1NWQ A;  1VQL P;  2ZYA A;  5M1B A;  2WSE H;  1EZV D;  1P84 E;  2BCC E;  2HPC A;  1ZP0 C;  1OVR A;  5AW5 B;  1YHQ P;  3D71 A;  3VYI A;  3IN6 A;  3TYY A;  1SQQ D;  1S9K E;  3H1I G;  1WMK A;  3OA7 A;  3L75 D;  2BCC G;  1BSH A;  2BAS A;  3QWO C;  2UWJ E;  3H32 A;  1L0N G;  3OJA B;  3EQ2 A;  5CMZ A;  1FZC B;  3MUD C;  3O6Q A;  2JP3 A;  2IBZ I;  4UB8 E;  3CMA P;  1SQB J;  2FYU D;  3MP7 B;  1K8A Q;  3F89 A;  3VN0 A;  5CJ4 A;  3C1L A;  5AVS B;  1H88 A;  2JJL A;  3AE5 C;  3VP9 A;  1PPJ E;  1QGK B;  2ZAE B;  2FYZ A;  3RBX A;  4XFJ A;  3RL0 B;  4GOE A;  4RJT A;  3A5T A;  3MD0 A;  4A7P A;  5CCG D;  3T97 B;  2Q5U A;  3GF3 A;  1BE3 D;  3L75 J;  1L0L D;  2YIU C;  1PP9 E;  3JCU H;  3L70 D;  3RGU A;  2YXR B;  2ITA A;  2V7Q J;  2W90 A;  5L8R J;  3VMX A;  4H0L B;  1NTM D;  3T97 A;  1GL2 D;  3RK3 C;  3VTP C;  2WSE J;  4WB4 A;  2PGD A;  3C9I A;  4ASW A;  4EIJ A;  3D6Z A;  2E43 A;  2I8D A;  3I5C A;  1Y8A A;  5KKZ B;  1VQ8 P;  1FC2 C;  2KSJ A;  2E42 A;  3CI9 A;  1JEK A;  2HOD B;  2P2U A;  1NTK E;  3AE2 C;  3W68 A;  2QJY C;  3GHG A;  1YBK A;  1VL2 A;  1VDF A;  2YNY A;  3AEA C;  4EOT A;  2WMM A;  3E1I A;  1KIL D;  2NZ2 A;  3O6Q B;  4D6T J;  2YMK A;  2ZT9 B;  1W5C E;  3AE8 C;  3PTZ A;  1M1J C;  2E5Y A;  2FYN B;  2KXP B;  3CLQ A;  3EFG A;  3H1H D;  4HH2 A;  3B4S A;  3GMA A;  1LWU B;  2W83 C;  2M5A A;  1IFN A;  1NTK D;  2KOG A;  3H1H G;  1Y9B A;  2J58 A;  3IR9 A;  3A0B H;  3R4Y A;  3H1L J;  1FZG A;  1VQN P;  1X0T A;  3FWN A;  1LGH B;  1FJK A;  4U3F E;  3CD6 P;  2B87 A;  1FZB A;  2E74 D;  1HJ0 A;  4DOJ A;  3H25 A;  3AEE C;  3NTN A;  3H1I J;  2WPV B;  5BVZ A;  3V2Q A;  5B5E H;  2Q9I A;  3CCQ P;  3M0D A;  2M3E A;  3WU2 H;  1SP4 A;  3Q5S A;  1SQP E;  1ZRT D;  1HUC A;  3TK1 A;  2KP8 A;  2N1T B;  2XU6 A;  2LR2 A;  1NKN A; 
#chains in the Genus database with same CATH homology
 5TIS H;  5E79 H;  5H2F H;  4UB8 H;  3JCU H;  1S5L H;  3WU2 H;  5B5E H;  5KAF H;  3A0H H;  5GTH H;  2AXT H;  4UB6 H;  4IL6 H;  4PJ0 H;  5KAI H;  5B66 H;  3KZI H;  3A0B H;  5GTI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...