2AXTH

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
total genus 14
structure length 64
sequence length 64
chains with identical sequence h
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 2axtH01
3JCUH 4PJ0H 3A0HH 3KZIH 3A0BH 5TISH 1S5LH 4IL6H 5B5EH 5B66H 5KAFH 5H2FH 5KAIH 2AXTH 4UB6H 5GTHH 4UB8H 3WU2H 5GTIH 5E79H
chains in the Genus database with same CATH superfamily
2N1TB 1J1EC 1PP9J 3L74E 1VF5D 1SQPD 2FXOA 5AW0B 3O6QA 3U1AA 3AEGC 1LTBC 4PV1D 1YJWP 2A45I 1L0NG 3IR9A 4M3LA 3H1LD 1YTZI 2HPCA 4U3FE 1FDMA 4GDOA 2IBZI 4IL6X 1VQ8P 1W5CE 3P8CE 5AVYB 3II6A 1W2EA 4H44D 3LW5J 1VQOP 4NPEA 3V6IA 3WU2H 2N1TA 1NTZG 1FAVA 3SFDC 3P32A 3S1KA 1OVVA 3B8EB 2WSEJ 1DD4A 1RF1A 1RF0C 3HE5B 1IK7A 1IFIA 1EZVG 3T97A 1VQ5P 1OVUA 2P1JA 2YO2A 5KJ7D 1BE3J 2ZFCA 2FFDB 3AEFC 5APXA 2C9LY 3L75J 1Z56A 4R4LA 4I7ZC 2NPSC 5KLVK 1L0NK 2IFNA 1RQVA 1MV8A 5H2FE 4OWFA 5KAIH 5KLVE 1KV4A 1LP1B 1GU4A 5GTIH 1BGYE 1L0LK 5CCGD 4JYCA 2FYUK 3PRJA 3HE5A 3O8ZA 1M56D 4KJMA 3E1IA 1L0LE 3V2NA 1SQQK 1FZEA 2IPPA 2YKOA 3G3ZA 1NWQA 4WY4B 4DZOA 1RQUA 1VQMP 2FFDA 1P84E 1SQQE 3RK2C 4XFJA 3TNUB 3CWBD 4DOJA 2E74B 1ZR4A 4IL6H 3GHGB 2FBWC 1SQBJ 1LP1A 3TGUE 1H88A 3SSUA 2YNYA 3L74D 4RESB 1NU1E 1NTKK 4EYYQ 1HJ0A 2WT7B 3V2RA 2WQYC 2FYNC 1L4AC 3M91A 5BU8B 1FU1A 1NTKE 1KB9E 2LXBA 3M0AA 5KLIB 3LIEA 3BRVB 3RL0D 1SP4A 1GU5A 2XZRA 3P8CD 1JMMA 5BU5A 2WPRA 3TNUA 3H1JJ 1BE3G 4L76A 1KN7A 3L75G 1HF9A 3GHGA 1KILB 1NYHA 2JDIH 1QX8A 4H0LB 2QJKC 1SQPJ 2GA1A 4IFDK 1S4XA 2WTYA 2P58A 3B5NB 4GOFA 3H1LJ 5KKZC 3EWKA 3G9RA 3CC2P 1MZ9A 1S2EA 1JTHA 2LXCB 4NPFX 2QJPB 1X8YA 2ZXEB 3AE4C 3MIWA 1VPCA 2W8ZA 2BEQD 2P67A 1JCCA 3V4WA 2ZAEB 3H1HE 5KLVD 1EC5A 1LT9A 1R8EA 4RO0A 3VYIA 4HJGH 1SQBG 1LWUC 2B87A 5AW7B 3RK3B 1N73B 1RHZB 1GL2D 2D2CD 2A45G 1L0LD 4BXLA 2OGUA 3H1IE 2FYUD 5TISH 5DJUB 1PGJA 3RBXA 3G6EP 2XKMA 1SQQD 2QRXA 3VP8A 5CBNA 2IBZG 3BCCE 1L2PA 1VQ6P 3HTKB 5APSA 1A02F 4HKZH 1X0TA 3H1JG 1USEA 3H1KD 2ZT9B 2SPZA 4WBAA 1KYOE 2WPQA 1SQPG 1FC2C 3VTPC 1CI6B 3CX5H 1NTKD 1KB9D 1IZNB 1IC2A 1USDA 2KK7A 3H1LG 1P84I 3L73E 1JMBA 1DX7A 2E43A 2K88A 3CWBJ 3CL3D 4PD4D 1FZCB 3BVHA 1SFCC 1KZUB 1N7SC 3L72D 3N7NA 3GG2A 1LTGC 3L74J 3BRTB 2YMYA 3H32B 1H0TA 1PP9D 2HODB 2CPSA 5GTHE 1E5WA 2K3RA 1QL1A 1EDJA 1OW7A 5CHXA 1RY3A 4WVZA 3A0HH 4U3FJ 2Z5IA 3B4SA 1S72P 1VL2A 2WSCH 1N8RQ 3QH9A 3U59A 4ZKPA 1LTJA 3H25A 2NPSD 1YJ9P 4KT0J 3RL0g 1VF5B 3AECC 3HUSB 4PV1B 3H32A 3P8MC 3CMEP 3P7KA 2PGDA 2ZYGA 4GT1A 2QM7A 1H89A 1OX3A 4D6TE 2WSFH 2WSSH 1SS1A 2N1TC 1DIPA 4H44B 3MP7B 2WSFJ 3OJAB 3RK2D 1CW5A 1QVFO 1RF1C 1YQ4C 3BCCD 3RGUA 3L37A 2O01H 1KFNA 1K05A 4W7YA 5KLVJ 2A06D 1BGYJ 2OYOA 3VN0A 4I1LA 2H8PD 2KOGA 2Z4EA 2B89A 1DH3A 1H8AA 2OTJP 1L0LJ 2M5AB 1L4AD 2CPBA 2GM4A 2FYUJ 3TF5A 1JY3N 1SQQJ 3L73D 4GIFA 4NPDA 2P10A 1RE3A 2JWDA 3V5BA 1S5LX 1NH4A 3Q5SA 1ZV8A 1ZRTE 1URQB 4HB1A 2KIKA 3L70E 2RKLA 1GW4A 1FDIA 1KB9H 1NU1J 4GOEA 1HWTC 2FFDC 1FZGA 1KYOI 2HLOA 4Y99C 5KAFH 2M5AA 4I6MC 3GF3A 3MD0A 1UIXA 4AYCA 1NTKJ 1QL2A 3N4XA 2HR3A 3KPEA 4PD4H 4H13C 2K37A 4QMAA 1RH5B 1EDLA 5B66H 3WUTA 3L72J 4EI2A 1URQA 3MTUE 1JY3O 1N7LA 2JKVA 5KLVG 1PIXA 2XNXA 1AVOA 3FWLA 4UB6H 3RL0B 3GW6A 1JUNA 3AE1C 3GHGC 1KD1Q 2J58A 1L0LG 3LW5H 2C0WA 1N86A 2W6BA 1DEBA 2B9BA 2N9YB 2FYUG 2IFMA 3A0BH 1GK4A 5EFWB 1SQQG 2PRRA 1GW3A 1ZR2A 3MZWB 3KYQA 2WSEH 1G1JA 3H1HJ 1G2CB 1S9KE 1YI2P 5AW4B 3PHLA 1OZHA 3H1KG 5AVUB 1PGOA 3EQ2A 5K5GB 1GMJA 3SWFA 1VQPP 1GD2E 1S5LH 2LKMA 2IZ0A 3FGAD 3CXHH 4OGQD 4ZNCA 2AXTE 1JEKA 1NTMK 1OW8A 1NTKG 4GKGA 5AW1B 1VDFA 1LT9C 2KS1B 3A5TA 1K9MQ 1NTME 1PPJE 1Q90D 1W2BO 5APQA 3BCCJ 5B5EE 2OYHB 5C39A 1SFCD 4JBZA 2W27A 1N7SD 1AQ5A 1ZRTD 1BSHA 2QJPC 1IFJA 3PLNA 3TYYA 2K9JB 3L72G 3L70D 5CCHA 1JM0A 1GL2B 3USSA 2I1JA 1NKZB 1EXJA 1PP9G 2QG4A 4DT0A 3AEDC 2FY8A 5APWA 3CC4P 4UB8H 4RKUJ 3L73J 5AW6B 1LT1A 4CPGA 3NXSA 3RK3C 3OAKA 2O01N 3JC22 2UWJE 2OYHA 1GK6A 3VMAA 1J1DB 1NU1K 1AVYA 2A45H 1J1EB 3KHUA 4YXDC 2K9JA 1AJYA 1HGZA 2WVRA 1GL2A 1FDOA 3KQGA 2GUVA 3CCSP 4YPCA 4WY4A 3TDKA 3GLMA 4U3FD 2O3JA 2N1TD 5E79H 4ASWA 1XTCC 2RN0A 1PGQA 2YXRB 2QA4P 3VMZA 2ITAA 5DJTB 3IFMA 3BCCG 4I2LC 3VP9A 2YIUB 1DD3A 1RE4A 3HRNA 2WT7A 1LGHB 1KQGB 2P2UA 2A06G 3Q2YA 5AVZB 4D6TJ 2OARA 1LTJC 3TK1A 1VQLP 1M1KQ 2Q6QA 2XNDH 3CCQP 2E5YA 1KFMA 3MGNA 1KC8Q 2NPSB 3ITKA 5APTA 2CK3H 1KORA 1NTMD 1PPJD 3L73G 3PP5A 2H88C 2M3BA 1KILA 4PJ0E 1YJNP 2E75B 1LJ2A 3ZDMA 3D6ZA 1U57A 1BGYD 4AQRD 5AVVB 3B5NA 1JNMA 1XTGB 1R5LA 3CCEP 5AW8B 1VQNP 1GDTA 4H13D 3L71E 2IX7C 1P84D 1SQVE 3M0DC 3CCRP 4Z1MH 3WU2E 2ZJSE 2IYPA 1OFCX 3RK3E 2Y9ZA 1IK9A 2HFED 3JCUH 3KZIH 1AV1A 4DCKA 2MJZA 1BE3E 3TGUD 3L70J 5CBOA 3M9QA 5AW9B 1NU1D 1L4AB 1N73A 1E79H 5KTBA 3NTNA 3RBZA 2QVAA 1RE3C 1FOSE 3MUDA 3AE9C 3VMYA 1KQLA 4WWIA 3AE8C 1SVFA 3IN6A 3VOPA 1M1JB 1WRGA 2O1JA 5KAIE 4EDFA 1GZLA 3HTKA 5GTIE 2E76C 4B86A 5BVZA 2QM8A 1VQ7P 3HD7B 1MKMA 1SQXE 4W80A 1IO4A 2QJYC 2R5BA 2W83C 3CCVP 2KXPB 1T3UA 5KKZB 3G71P 1CI6A 1NHLA 3M9BA 1JO5A 3C9IA 3AE6C 2KNCB 3CMAP 2WWWA 2FYZA 1URQC 1M1JA 1M57D 5M1BA 4IL6E 3CCLP 1PZQA 1FZBA 2KLVA 2AEMA 1FZCA 2H89C 3GF7A 2RMZA 3C8VA 3HD7A 1MUUA 3FXEA 2WITA 2KI7B 4ZKUA 2DW3A 1R5SA 1AFOA 5AVXB 4MN4C 3H1HD 1ZMEC 3AE3C 2HODA 3I5CA 1NAFA 4WB4A 4JYBA 3L4FA 3FX0A 3V4QA 2Q1KA 1QLED 1LNQA 3H1ID 2XDJA 3HE4B 1HGVA 1SQPE 1T8ZA 2OYIB 4C7NB 3I55P 3L71D 1SQVD 5H2FH 3G4SP 1NTMJ 3AE5C 4A7PA 2O1KA 3MHVA 3RK3D 3BATA 1KQSO 1X79B 2PAJA 3CWBG 3HUSA 3FWNA 1Y47A 1YITP 5L8RJ 1YIJP 2IDBA 1KYOD 3D70A 2KB7P 3AEBC 3L74G 4OGQB 2AXCA 1P84H 2M0BA 2OQQA 1IJDB 2OYIA 4C7NA 2C0XA 2QE7H 3E1RA 4U3FG 5CCHC 3CLQA 1SFCB 3NMDA 5AVTB 2L91A 4L74A 1N7SB 1Q82Q 4C7RA 1HBWA 2H7HA 3TGUJ 1SQXD 1BDDA 2KLUA 2XV5A 5TISE 2R3CA 2KYVA 1MFTA 1MFZA 1Q86Q 5AW2B 2Q7CA 5KJ7A 4EIJA 1VQKP 2OYHC 3AEAC 2I8DA 3EFGA 4TT3H 1T3JA 1CSBA 2BCCE 4TLFA 2FXMA 2N9BA 1Q7YQ 1GL2C 2KP8A 3AEEC 3K5BA 1LTTC 1NTMG 1PPJG 5CMZA 5CCGA 3AE2C 4WY4C 1TU3F 1CZQA 1ZN5A 3Q5PA 3CX5E 4N78E 4C46A 4HYTB 3TSIA 1BGYG 3A7OA 2E74C 4D6TD 3SFEC 1JOCA 1NVOA 1RE4C 4PJ0H 4XA4A 1RF1B 3QWOC 1ZXGA 2GUSA 3T97B 3CI9A 1BCCE 5KLIC 1M7LA 2VRSA 2KUBA 4IOIH 1NKNA 3V2PA 1AQTA 4K3AA 1YHQP 1NOHA 2E5TA 1M8OB 3A0HE 3TGUG 3CCJP 1HH0A 1NU1G 2JP3A 1KMIZ 3H1IJ 1FS0E 3NFQA 1KILC 1PFIA 1U7JA 2YIUC 4H0LC 3GMAA 1ZW0A 4OH8B 3L71J 1U7MA 1SQVJ 3CC7P 3IF4A 1IFPA 1M90Q 1YBKA 3B5NC 1PV3A 2E76D 1ZP0C 2G8YA 1KYOH 1G2CA 4LLHA 1ZLLA 2Y9YA 4IFMA 2R32A 2YMKA 4Y99B 2D2CB 2I1KA 3SWYA 3PTZA 4H13B 3W67A 2KSJA 5APUA 1L0NE 2E75C 1URQD 2KS1A 2BCCD 2PFXA 4K35A 2HYNA 3D6YA 2YKPA 1WMKA 1JCDA 1LTAC 5AVSB 1N73C 2FYUE 1Q2NA 2POHA 2NRGA 1Q81Q 4YTPC 5GTHH 1SQXJ 2K1AA 3MUDC 1NTZK 1YYCA 3CX5D 4N78D 1OW6A 3H1HG 4IFFA 3UIAA 1NTZE 2V4HA 4JQ0D 1Y9BA 3H1KE 2W6AA 3B71A 2Q3IA 4L73A 2ZT9C 3H1IG 1EZVE 2ZYAA 1K8AQ 1HUCA 3L71G 3CCUP 4W7ZA 2RH0A 2XU6A 1SQVG 1NAYA 5KAFE 1BCCD 1JTHB 4JPZB 3I56P 4OVNF 1S9KD 2Q5UA 1EQ7A 3CX5I 1M1JC 3AE7C 1AA0A 4PD4E 2IZ1A 2Z5HA 4R4MA 2QIWA 4LC1A 1FZCC 1GTWA 3L72E 5AW5B 1FZAA 2G3AA 2MKVA 1FE6A 5B66E 3HD7C 1KILE 1SLQA 1LTSC 2WPSA 1KQFB 1NJIQ 1PP9E 1LT9B 3H6PA 3PJSK 2JR8A 2J5UA 3KDPB 4I7ZB 1X22A 2B87B 4BRYB 5CCHD 4AUWA 4BWNA 4N3YB 1T2KC 2R5DA 2R3SA 5APVA 1RF0A 4UB6E 4LGDE 3Q1MA 1OIPA 5CJ0A 1SQXG 1QVGO 3LIDA 1JB0J 4JF7A 1BSNA 1NO4A 4ASVA 3FXDA 2Q9IA 3A0BE 1SQVK 1PGPA 4ZMDA 3IAOA 1VF5C 3HUSC 1L0ND 4PV1C 3RK2B 1S1CX 3C1LA 2NPSA 2ZVOB 3CD6P 1EDIA 4BRYA 3V2QA 1DEEG 3KXDA 2PP6A 1YTZT 1JY2P 3F89A 2R44A 5AVRB 2Y0EA 5TJHA 2E42A 3SWKA 1FJKA 1S5LE 4WY4D 4U7JA 2OYIC 2KZJA 1FZFA 3CXHE 4H44C 3L75E 2FYNB 3CCMP 3L36A 1K73Q 2NZ2A 4RJTA 1N2DC 1NTZD 1EXIA 2E74D 3R2PA 2A06E 4D6TG 2BCCJ 1X9VA 1H0TB 1OXZA 1EZVD 2M3EA 4HH2A 1SQXK 4OGQC 2C9NY 3F5HA 5KJ7C 3WUVA 2QJKB 1FJPA 2V7QH 4GODA 1HVVA 1OWAA 1L4AA 1SQBK 4UB8E 2QSIA 1LTJB 3A3YB 2V7QJ 2ZVNB 1EDKA 1JY3P 1SQBE 1YQ3C 5CCGC 1KILD 2FKWB 4H0LD 1EZVI 3S4RA 1NGMB 2KSEA 2P7JA 2IYOA 1KB9I 4Y28J 3B5ND 1LTIC 3EFFK 1BCCJ 2YKQA 1OVRA 1VQ4P 2WZ7A 2IBZE 1WT6A 4O9BA 3E7KA 1LWUB 1FBMA 4PD4I 2AXTH 3H1JE 3L35A 1HJBA 1SQPK 3L70G 2WSCJ 2B88A 1PL5A 3M06A 2YXQB 5E79E 1KTMA 1D7MA 2L5GB 1JY2N 2KNCA 2FXPA 2HG5D 1HTLC 1IFNA 5B5EH 2E75D 2YO3A 1G1IA 1T6AA 2Y0CA 1QEXA 1VQ9P 2BCCG 2KZIA 3H1LE 2J59M 1S3JA 2LR2A 2JEEA 2OTKE 3RL0C 3JSVC 1BE3D 1LWUA 2WMMA 4KHXA 2W90A 3CXHD 3L75D 1FOSF 2OTLP 1Y8AA 2AEJA 3ABVC 4YXWH 2Q3EA 4EOTA 3Q5RA 4L75A 3HE4A 1L0NJ 1QGKB 5AVQB 2ZYDA 3M0DA 3D71A 2WPVB 2ZXXA 2O01J 3WMM0 3OW2O 2ZT9D 2QEXP 2E76B 1BDCA 3M9HA 2H43A 2BASA 3CPWO 1J2JB 1JY2O 2QJYB 3CXHI 5CJ4A 1BCCG 1K04A 2JJLA 4XE5B 3R4YA 1NTZJ 3WUUA 1IFDA 2JWAA 3H1KJ 3U1CA 2K9YA 3W68A 1SQBD 3HD7D 1A02J 3JCUE 2W6JH 3KZIE 2Y0DA 3O6QB 3Q3DA 4N6JA 3S9OA 2D2CC 1SFCA 2JO1A 2BEZF 1N7SA 3PH0A 1ZOYC 3VMXA 2HPCB 1T2KD 3BASA 2IBZD 5AW3B 5APYA 1UIIA 3CWBE 1IFMA 3H1JD 3OA7A 3A2AA 2AEFA 2M8RA 1OMIA 4DJGA 5AVWB 1J1DC
chains in the Genus database with same CATH topology
3JCUH 4PJ0H 3A0HH 3KZIH 3A0BH 5TISH 1S5LH 4IL6H 5B5EH 5B66H 5KAFH 5H2FH 5KAIH 2AXTH 4UB6H 5GTHH 4UB8H 3WU2H 5GTIH 5E79H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCU H;  4PJ0 H;  3A0H H;  3KZI H;  3A0B H;  5TIS H;  1S5L H;  4IL6 H;  5B5E H;  5B66 H;  5KAF H;  5H2F H;  5KAI H;  2AXT H;  4UB6 H;  5GTH H;  4UB8 H;  3WU2 H;  5GTI H;  5E79 H; 
#chains in the Genus database with same CATH topology
 2N1T B;  1J1E C;  1PP9 J;  3L74 E;  1VF5 D;  1SQP D;  2FXO A;  5AW0 B;  3O6Q A;  3U1A A;  3AEG C;  1LTB C;  4PV1 D;  1YJW P;  2A45 I;  1L0N G;  3IR9 A;  4M3L A;  3H1L D;  1YTZ I;  2HPC A;  4U3F E;  1FDM A;  4GDO A;  2IBZ I;  4IL6 X;  1VQ8 P;  1W5C E;  3P8C E;  5AVY B;  3II6 A;  1W2E A;  4H44 D;  3LW5 J;  1VQO P;  4NPE A;  3V6I A;  3WU2 H;  2N1T A;  1NTZ G;  1FAV A;  3SFD C;  3P32 A;  3S1K A;  1OVV A;  3B8E B;  2WSE J;  1DD4 A;  1RF1 A;  1RF0 C;  3HE5 B;  1IK7 A;  1IFI A;  1EZV G;  3T97 A;  1VQ5 P;  1OVU A;  2P1J A;  2YO2 A;  5KJ7 D;  1BE3 J;  2ZFC A;  2FFD B;  3AEF C;  5APX A;  2C9L Y;  3L75 J;  1Z56 A;  4R4L A;  4I7Z C;  2NPS C;  5KLV K;  1L0N K;  2IFN A;  1RQV A;  1MV8 A;  5H2F E;  4OWF A;  5KAI H;  5KLV E;  1KV4 A;  1LP1 B;  1GU4 A;  5GTI H;  1BGY E;  1L0L K;  5CCG D;  4JYC A;  2FYU K;  3PRJ A;  3HE5 A;  3O8Z A;  1M56 D;  4KJM A;  3E1I A;  1L0L E;  3V2N A;  1SQQ K;  1FZE A;  2IPP A;  2YKO A;  3G3Z A;  1NWQ A;  4WY4 B;  4DZO A;  1RQU A;  1VQM P;  2FFD A;  1P84 E;  1SQQ E;  3RK2 C;  4XFJ A;  3TNU B;  3CWB D;  4DOJ A;  2E74 B;  1ZR4 A;  4IL6 H;  3GHG B;  2FBW C;  1SQB J;  1LP1 A;  3TGU E;  1H88 A;  3SSU A;  2YNY A;  3L74 D;  4RES B;  1NU1 E;  1NTK K;  4EYY Q;  1HJ0 A;  2WT7 B;  3V2R A;  2WQY C;  2FYN C;  1L4A C;  3M91 A;  5BU8 B;  1FU1 A;  1NTK E;  1KB9 E;  2LXB A;  3M0A A;  5KLI B;  3LIE A;  3BRV B;  3RL0 D;  1SP4 A;  1GU5 A;  2XZR A;  3P8C D;  1JMM A;  5BU5 A;  2WPR A;  3TNU A;  3H1J J;  1BE3 G;  4L76 A;  1KN7 A;  3L75 G;  1HF9 A;  3GHG A;  1KIL B;  1NYH A;  2JDI H;  1QX8 A;  4H0L B;  2QJK C;  1SQP J;  2GA1 A;  4IFD K;  1S4X A;  2WTY A;  2P58 A;  3B5N B;  4GOF A;  3H1L J;  5KKZ C;  3EWK A;  3G9R A;  3CC2 P;  1MZ9 A;  1S2E A;  1JTH A;  2LXC B;  4NPF X;  2QJP B;  1X8Y A;  2ZXE B;  3AE4 C;  3MIW A;  1VPC A;  2W8Z A;  2BEQ D;  2P67 A;  1JCC A;  3V4W A;  2ZAE B;  3H1H E;  5KLV D;  1EC5 A;  1LT9 A;  1R8E A;  4RO0 A;  3VYI A;  4HJG H;  1SQB G;  1LWU C;  2B87 A;  5AW7 B;  3RK3 B;  1N73 B;  1RHZ B;  1GL2 D;  2D2C D;  2A45 G;  1L0L D;  4BXL A;  2OGU A;  3H1I E;  2FYU D;  5TIS H;  5DJU B;  1PGJ A;  3RBX A;  3G6E P;  2XKM A;  1SQQ D;  2QRX A;  3VP8 A;  5CBN A;  2IBZ G;  3BCC E;  1L2P A;  1VQ6 P;  3HTK B;  5APS A;  1A02 F;  4HKZ H;  1X0T A;  3H1J G;  1USE A;  3H1K D;  2ZT9 B;  2SPZ A;  4WBA A;  1KYO E;  2WPQ A;  1SQP G;  1FC2 C;  3VTP C;  1CI6 B;  3CX5 H;  1NTK D;  1KB9 D;  1IZN B;  1IC2 A;  1USD A;  2KK7 A;  3H1L G;  1P84 I;  3L73 E;  1JMB A;  1DX7 A;  2E43 A;  2K88 A;  3CWB J;  3CL3 D;  4PD4 D;  1FZC B;  3BVH A;  1SFC C;  1KZU B;  1N7S C;  3L72 D;  3N7N A;  3GG2 A;  1LTG C;  3L74 J;  3BRT B;  2YMY A;  3H32 B;  1H0T A;  1PP9 D;  2HOD B;  2CPS A;  5GTH E;  1E5W A;  2K3R A;  1QL1 A;  1EDJ A;  1OW7 A;  5CHX A;  1RY3 A;  4WVZ A;  3A0H H;  4U3F J;  2Z5I A;  3B4S A;  1S72 P;  1VL2 A;  2WSC H;  1N8R Q;  3QH9 A;  3U59 A;  4ZKP A;  1LTJ A;  3H25 A;  2NPS D;  1YJ9 P;  4KT0 J;  3RL0 g;  1VF5 B;  3AEC C;  3HUS B;  4PV1 B;  3H32 A;  3P8M C;  3CME P;  3P7K A;  2PGD A;  2ZYG A;  4GT1 A;  2QM7 A;  1H89 A;  1OX3 A;  4D6T E;  2WSF H;  2WSS H;  1SS1 A;  2N1T C;  1DIP A;  4H44 B;  3MP7 B;  2WSF J;  3OJA B;  3RK2 D;  1CW5 A;  1QVF O;  1RF1 C;  1YQ4 C;  3BCC D;  3RGU A;  3L37 A;  2O01 H;  1KFN A;  1K05 A;  4W7Y A;  5KLV J;  2A06 D;  1BGY J;  2OYO A;  3VN0 A;  4I1L A;  2H8P D;  2KOG A;  2Z4E A;  2B89 A;  1DH3 A;  1H8A A;  2OTJ P;  1L0L J;  2M5A B;  1L4A D;  2CPB A;  2GM4 A;  2FYU J;  3TF5 A;  1JY3 N;  1SQQ J;  3L73 D;  4GIF A;  4NPD A;  2P10 A;  1RE3 A;  2JWD A;  3V5B A;  1S5L X;  1NH4 A;  3Q5S A;  1ZV8 A;  1ZRT E;  1URQ B;  4HB1 A;  2KIK A;  3L70 E;  2RKL A;  1GW4 A;  1FDI A;  1KB9 H;  1NU1 J;  4GOE A;  1HWT C;  2FFD C;  1FZG A;  1KYO I;  2HLO A;  4Y99 C;  5KAF H;  2M5A A;  4I6M C;  3GF3 A;  3MD0 A;  1UIX A;  4AYC A;  1NTK J;  1QL2 A;  3N4X A;  2HR3 A;  3KPE A;  4PD4 H;  4H13 C;  2K37 A;  4QMA A;  1RH5 B;  1EDL A;  5B66 H;  3WUT A;  3L72 J;  4EI2 A;  1URQ A;  3MTU E;  1JY3 O;  1N7L A;  2JKV A;  5KLV G;  1PIX A;  2XNX A;  1AVO A;  3FWL A;  4UB6 H;  3RL0 B;  3GW6 A;  1JUN A;  3AE1 C;  3GHG C;  1KD1 Q;  2J58 A;  1L0L G;  3LW5 H;  2C0W A;  1N86 A;  2W6B A;  1DEB A;  2B9B A;  2N9Y B;  2FYU G;  2IFM A;  3A0B H;  1GK4 A;  5EFW B;  1SQQ G;  2PRR A;  1GW3 A;  1ZR2 A;  3MZW B;  3KYQ A;  2WSE H;  1G1J A;  3H1H J;  1G2C B;  1S9K E;  1YI2 P;  5AW4 B;  3PHL A;  1OZH A;  3H1K G;  5AVU B;  1PGO A;  3EQ2 A;  5K5G B;  1GMJ A;  3SWF A;  1VQP P;  1GD2 E;  1S5L H;  2LKM A;  2IZ0 A;  3FGA D;  3CXH H;  4OGQ D;  4ZNC A;  2AXT E;  1JEK A;  1NTM K;  1OW8 A;  1NTK G;  4GKG A;  5AW1 B;  1VDF A;  1LT9 C;  2KS1 B;  3A5T A;  1K9M Q;  1NTM E;  1PPJ E;  1Q90 D;  1W2B O;  5APQ A;  3BCC J;  5B5E E;  2OYH B;  5C39 A;  1SFC D;  4JBZ A;  2W27 A;  1N7S D;  1AQ5 A;  1ZRT D;  1BSH A;  2QJP C;  1IFJ A;  3PLN A;  3TYY A;  2K9J B;  3L72 G;  3L70 D;  5CCH A;  1JM0 A;  1GL2 B;  3USS A;  2I1J A;  1NKZ B;  1EXJ A;  1PP9 G;  2QG4 A;  4DT0 A;  3AED C;  2FY8 A;  5APW A;  3CC4 P;  4UB8 H;  4RKU J;  3L73 J;  5AW6 B;  1LT1 A;  4CPG A;  3NXS A;  3RK3 C;  3OAK A;  2O01 N;  3JC2 2;  2UWJ E;  2OYH A;  1GK6 A;  3VMA A;  1J1D B;  1NU1 K;  1AVY A;  2A45 H;  1J1E B;  3KHU A;  4YXD C;  2K9J A;  1AJY A;  1HGZ A;  2WVR A;  1GL2 A;  1FDO A;  3KQG A;  2GUV A;  3CCS P;  4YPC A;  4WY4 A;  3TDK A;  3GLM A;  4U3F D;  2O3J A;  2N1T D;  5E79 H;  4ASW A;  1XTC C;  2RN0 A;  1PGQ A;  2YXR B;  2QA4 P;  3VMZ A;  2ITA A;  5DJT B;  3IFM A;  3BCC G;  4I2L C;  3VP9 A;  2YIU B;  1DD3 A;  1RE4 A;  3HRN A;  2WT7 A;  1LGH B;  1KQG B;  2P2U A;  2A06 G;  3Q2Y A;  5AVZ B;  4D6T J;  2OAR A;  1LTJ C;  3TK1 A;  1VQL P;  1M1K Q;  2Q6Q A;  2XND H;  3CCQ P;  2E5Y A;  1KFM A;  3MGN A;  1KC8 Q;  2NPS B;  3ITK A;  5APT A;  2CK3 H;  1KOR A;  1NTM D;  1PPJ D;  3L73 G;  3PP5 A;  2H88 C;  2M3B A;  1KIL A;  4PJ0 E;  1YJN P;  2E75 B;  1LJ2 A;  3ZDM A;  3D6Z A;  1U57 A;  1BGY D;  4AQR D;  5AVV B;  3B5N A;  1JNM A;  1XTG B;  1R5L A;  3CCE P;  5AW8 B;  1VQN P;  1GDT A;  4H13 D;  3L71 E;  2IX7 C;  1P84 D;  1SQV E;  3M0D C;  3CCR P;  4Z1M H;  3WU2 E;  2ZJS E;  2IYP A;  1OFC X;  3RK3 E;  2Y9Z A;  1IK9 A;  2HFE D;  3JCU H;  3KZI H;  1AV1 A;  4DCK A;  2MJZ A;  1BE3 E;  3TGU D;  3L70 J;  5CBO A;  3M9Q A;  5AW9 B;  1NU1 D;  1L4A B;  1N73 A;  1E79 H;  5KTB A;  3NTN A;  3RBZ A;  2QVA A;  1RE3 C;  1FOS E;  3MUD A;  3AE9 C;  3VMY A;  1KQL A;  4WWI A;  3AE8 C;  1SVF A;  3IN6 A;  3VOP A;  1M1J B;  1WRG A;  2O1J A;  5KAI E;  4EDF A;  1GZL A;  3HTK A;  5GTI E;  2E76 C;  4B86 A;  5BVZ A;  2QM8 A;  1VQ7 P;  3HD7 B;  1MKM A;  1SQX E;  4W80 A;  1IO4 A;  2QJY C;  2R5B A;  2W83 C;  3CCV P;  2KXP B;  1T3U A;  5KKZ B;  3G71 P;  1CI6 A;  1NHL A;  3M9B A;  1JO5 A;  3C9I A;  3AE6 C;  2KNC B;  3CMA P;  2WWW A;  2FYZ A;  1URQ C;  1M1J A;  1M57 D;  5M1B A;  4IL6 E;  3CCL P;  1PZQ A;  1FZB A;  2KLV A;  2AEM A;  1FZC A;  2H89 C;  3GF7 A;  2RMZ A;  3C8V A;  3HD7 A;  1MUU A;  3FXE A;  2WIT A;  2KI7 B;  4ZKU A;  2DW3 A;  1R5S A;  1AFO A;  5AVX B;  4MN4 C;  3H1H D;  1ZME C;  3AE3 C;  2HOD A;  3I5C A;  1NAF A;  4WB4 A;  4JYB A;  3L4F A;  3FX0 A;  3V4Q A;  2Q1K A;  1QLE D;  1LNQ A;  3H1I D;  2XDJ A;  3HE4 B;  1HGV A;  1SQP E;  1T8Z A;  2OYI B;  4C7N B;  3I55 P;  3L71 D;  1SQV D;  5H2F H;  3G4S P;  1NTM J;  3AE5 C;  4A7P A;  2O1K A;  3MHV A;  3RK3 D;  3BAT A;  1KQS O;  1X79 B;  2PAJ A;  3CWB G;  3HUS A;  3FWN A;  1Y47 A;  1YIT P;  5L8R J;  1YIJ P;  2IDB A;  1KYO D;  3D70 A;  2KB7 P;  3AEB C;  3L74 G;  4OGQ B;  2AXC A;  1P84 H;  2M0B A;  2OQQ A;  1IJD B;  2OYI A;  4C7N A;  2C0X A;  2QE7 H;  3E1R A;  4U3F G;  5CCH C;  3CLQ A;  1SFC B;  3NMD A;  5AVT B;  2L91 A;  4L74 A;  1N7S B;  1Q82 Q;  4C7R A;  1HBW A;  2H7H A;  3TGU J;  1SQX D;  1BDD A;  2KLU A;  2XV5 A;  5TIS E;  2R3C A;  2KYV A;  1MFT A;  1MFZ A;  1Q86 Q;  5AW2 B;  2Q7C A;  5KJ7 A;  4EIJ A;  1VQK P;  2OYH C;  3AEA C;  2I8D A;  3EFG A;  4TT3 H;  1T3J A;  1CSB A;  2BCC E;  4TLF A;  2FXM A;  2N9B A;  1Q7Y Q;  1GL2 C;  2KP8 A;  3AEE C;  3K5B A;  1LTT C;  1NTM G;  1PPJ G;  5CMZ A;  5CCG A;  3AE2 C;  4WY4 C;  1TU3 F;  1CZQ A;  1ZN5 A;  3Q5P A;  3CX5 E;  4N78 E;  4C46 A;  4HYT B;  3TSI A;  1BGY G;  3A7O A;  2E74 C;  4D6T D;  3SFE C;  1JOC A;  1NVO A;  1RE4 C;  4PJ0 H;  4XA4 A;  1RF1 B;  3QWO C;  1ZXG A;  2GUS A;  3T97 B;  3CI9 A;  1BCC E;  5KLI C;  1M7L A;  2VRS A;  2KUB A;  4IOI H;  1NKN A;  3V2P A;  1AQT A;  4K3A A;  1YHQ P;  1NOH A;  2E5T A;  1M8O B;  3A0H E;  3TGU G;  3CCJ P;  1HH0 A;  1NU1 G;  2JP3 A;  1KMI Z;  3H1I J;  1FS0 E;  3NFQ A;  1KIL C;  1PFI A;  1U7J A;  2YIU C;  4H0L C;  3GMA A;  1ZW0 A;  4OH8 B;  3L71 J;  1U7M A;  1SQV J;  3CC7 P;  3IF4 A;  1IFP A;  1M90 Q;  1YBK A;  3B5N C;  1PV3 A;  2E76 D;  1ZP0 C;  2G8Y A;  1KYO H;  1G2C A;  4LLH A;  1ZLL A;  2Y9Y A;  4IFM A;  2R32 A;  2YMK A;  4Y99 B;  2D2C B;  2I1K A;  3SWY A;  3PTZ A;  4H13 B;  3W67 A;  2KSJ A;  5APU A;  1L0N E;  2E75 C;  1URQ D;  2KS1 A;  2BCC D;  2PFX A;  4K35 A;  2HYN A;  3D6Y A;  2YKP A;  1WMK A;  1JCD A;  1LTA C;  5AVS B;  1N73 C;  2FYU E;  1Q2N A;  2POH A;  2NRG A;  1Q81 Q;  4YTP C;  5GTH H;  1SQX J;  2K1A A;  3MUD C;  1NTZ K;  1YYC A;  3CX5 D;  4N78 D;  1OW6 A;  3H1H G;  4IFF A;  3UIA A;  1NTZ E;  2V4H A;  4JQ0 D;  1Y9B A;  3H1K E;  2W6A A;  3B71 A;  2Q3I A;  4L73 A;  2ZT9 C;  3H1I G;  1EZV E;  2ZYA A;  1K8A Q;  1HUC A;  3L71 G;  3CCU P;  4W7Z A;  2RH0 A;  2XU6 A;  1SQV G;  1NAY A;  5KAF E;  1BCC D;  1JTH B;  4JPZ B;  3I56 P;  4OVN F;  1S9K D;  2Q5U A;  1EQ7 A;  3CX5 I;  1M1J C;  3AE7 C;  1AA0 A;  4PD4 E;  2IZ1 A;  2Z5H A;  4R4M A;  2QIW A;  4LC1 A;  1FZC C;  1GTW A;  3L72 E;  5AW5 B;  1FZA A;  2G3A A;  2MKV A;  1FE6 A;  5B66 E;  3HD7 C;  1KIL E;  1SLQ A;  1LTS C;  2WPS A;  1KQF B;  1NJI Q;  1PP9 E;  1LT9 B;  3H6P A;  3PJS K;  2JR8 A;  2J5U A;  3KDP B;  4I7Z B;  1X22 A;  2B87 B;  4BRY B;  5CCH D;  4AUW A;  4BWN A;  4N3Y B;  1T2K C;  2R5D A;  2R3S A;  5APV A;  1RF0 A;  4UB6 E;  4LGD E;  3Q1M A;  1OIP A;  5CJ0 A;  1SQX G;  1QVG O;  3LID A;  1JB0 J;  4JF7 A;  1BSN A;  1NO4 A;  4ASV A;  3FXD A;  2Q9I A;  3A0B E;  1SQV K;  1PGP A;  4ZMD A;  3IAO A;  1VF5 C;  3HUS C;  1L0N D;  4PV1 C;  3RK2 B;  1S1C X;  3C1L A;  2NPS A;  2ZVO B;  3CD6 P;  1EDI A;  4BRY A;  3V2Q A;  1DEE G;  3KXD A;  2PP6 A;  1YTZ T;  1JY2 P;  3F89 A;  2R44 A;  5AVR B;  2Y0E A;  5TJH A;  2E42 A;  3SWK A;  1FJK A;  1S5L E;  4WY4 D;  4U7J A;  2OYI C;  2KZJ A;  1FZF A;  3CXH E;  4H44 C;  3L75 E;  2FYN B;  3CCM P;  3L36 A;  1K73 Q;  2NZ2 A;  4RJT A;  1N2D C;  1NTZ D;  1EXI A;  2E74 D;  3R2P A;  2A06 E;  4D6T G;  2BCC J;  1X9V A;  1H0T B;  1OXZ A;  1EZV D;  2M3E A;  4HH2 A;  1SQX K;  4OGQ C;  2C9N Y;  3F5H A;  5KJ7 C;  3WUV A;  2QJK B;  1FJP A;  2V7Q H;  4GOD A;  1HVV A;  1OWA A;  1L4A A;  1SQB K;  4UB8 E;  2QSI A;  1LTJ B;  3A3Y B;  2V7Q J;  2ZVN B;  1EDK A;  1JY3 P;  1SQB E;  1YQ3 C;  5CCG C;  1KIL D;  2FKW B;  4H0L D;  1EZV I;  3S4R A;  1NGM B;  2KSE A;  2P7J A;  2IYO A;  1KB9 I;  4Y28 J;  3B5N D;  1LTI C;  3EFF K;  1BCC J;  2YKQ A;  1OVR A;  1VQ4 P;  2WZ7 A;  2IBZ E;  1WT6 A;  4O9B A;  3E7K A;  1LWU B;  1FBM A;  4PD4 I;  2AXT H;  3H1J E;  3L35 A;  1HJB A;  1SQP K;  3L70 G;  2WSC J;  2B88 A;  1PL5 A;  3M06 A;  2YXQ B;  5E79 E;  1KTM A;  1D7M A;  2L5G B;  1JY2 N;  2KNC A;  2FXP A;  2HG5 D;  1HTL C;  1IFN A;  5B5E H;  2E75 D;  2YO3 A;  1G1I A;  1T6A A;  2Y0C A;  1QEX A;  1VQ9 P;  2BCC G;  2KZI A;  3H1L E;  2J59 M;  1S3J A;  2LR2 A;  2JEE A;  2OTK E;  3RL0 C;  3JSV C;  1BE3 D;  1LWU A;  2WMM A;  4KHX A;  2W90 A;  3CXH D;  3L75 D;  1FOS F;  2OTL P;  1Y8A A;  2AEJ A;  3ABV C;  4YXW H;  2Q3E A;  4EOT A;  3Q5R A;  4L75 A;  3HE4 A;  1L0N J;  1QGK B;  5AVQ B;  2ZYD A;  3M0D A;  3D71 A;  2WPV B;  2ZXX A;  2O01 J;  3WMM 0;  3OW2 O;  2ZT9 D;  2QEX P;  2E76 B;  1BDC A;  3M9H A;  2H43 A;  2BAS A;  3CPW O;  1J2J B;  1JY2 O;  2QJY B;  3CXH I;  5CJ4 A;  1BCC G;  1K04 A;  2JJL A;  4XE5 B;  3R4Y A;  1NTZ J;  3WUU A;  1IFD A;  2JWA A;  3H1K J;  3U1C A;  2K9Y A;  3W68 A;  1SQB D;  3HD7 D;  1A02 J;  3JCU E;  2W6J H;  3KZI E;  2Y0D A;  3O6Q B;  3Q3D A;  4N6J A;  3S9O A;  2D2C C;  1SFC A;  2JO1 A;  2BEZ F;  1N7S A;  3PH0 A;  1ZOY C;  3VMX A;  2HPC B;  1T2K D;  3BAS A;  2IBZ D;  5AW3 B;  5APY A;  1UII A;  3CWB E;  1IFM A;  3H1J D;  3OA7 A;  3A2A A;  2AEF A;  2M8R A;  1OMI A;  4DJG A;  5AVW B;  1J1D C; 
#chains in the Genus database with same CATH homology
 3JCU H;  4PJ0 H;  3A0H H;  3KZI H;  3A0B H;  5TIS H;  1S5L H;  4IL6 H;  5B5E H;  5B66 H;  5KAF H;  5H2F H;  5KAI H;  2AXT H;  4UB6 H;  5GTH H;  4UB8 H;  3WU2 H;  5GTI H;  5E79 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...