1GZLA

Crystal structure of c14linkmid/iqn17: a cross-linked inhibitor of hiv-1 entry bound to the gp41 hydrophobic pocket
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Short Constrained Peptides that Inhibit HIV-1 Entry
pubmed doi rcsb
molecule tags Glycoprotein
molecule keywords FUSION PROTEIN BETWEEN THE HYDROPHOBIC POCKET OF HIV GP41 AN
total genus 20
structure length 45
sequence length 45
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gzlA00
5AW8B 3KQGA 5CMZA 2Q3IA 1CSBA 3HE4B 3NMDA 5APXA 3M06A 2E42A 4B86A 4KHXA 2H7HA 1FAVA 2Z5IA 1GD2E 5APVA 1H8AA 3P8MC 3NTNA 3A5TA 1GTWA 2Z5HA 3A3YB 3P7KA 5AVWB 5AVTB 3VMZA 4LC1A 2P7JA 1S9KD 5AW3B 2YO2A 4GKGA 4I6MC 1MUUA 3VYIA 1OWAA 1HWTC 5AW0B 2C9NY 2R3CA 2N9BA 2R5DA 3TNUB 1YYCA 3M0DA 5AW9B 2WT7A 3KDPB 3O8ZA 3M0AA 1S9KE 1OXZA 2YNYA 3LIEA 3MGNA 3A7OA 5APSA 1FOSF 2R5BA 5AVQB 1JNMA 2XV5A 1CZQA 3L36A 4RESB 2R32A 3M91A 3OAKA 4I2LC 3HE5A 5AW2B 3VMXA 2WPQA 3TNUA 3HTKA 1T2KC 2WPSA 1KQLA 3TYYA 4XE5B 1NWQA 2W27A 3V5BA 2WT7B 3LIDA 2ZFCA 2Q5UA 4AUWA 4JYBA 2IPPA 1X8YA 3A2AA 4DZOA 5AVVB 1SP4A 5AVZB 3TK1A 3VN0A 4M3LA 5APQA 5AW1B 5APUA 2JJLA 5AVSB 3VMYA 4C7NB 2Q7CA 2VRSA 4AQRD 5AW5B 3M9HA 2YO3A 3VTPC 5APTA 3IR9A 3HE5B 3MD0A 3V4WA 1SLQA 3T97A 1HBWA 5APWA 5AVXB 1CI6A 1H88A 1MV8A 1GU4A 1JUNA 1DH3A 2C9LY 2W6AA 2KP8A 1IO4A 1GK4A 1H89A 3UIAA 1GZLA 2E43A 2BASA 3V4QA 3P32A 3M9BA 4C7NA 2XU6A 2XZRA 2WPRA 1G2CB 1HUCA 2QM7A 3NXSA 1GU5A 4HYTB 2WTYA 3L35A 2P67A 4GT1A 4JYCA 5AVUB 3SWFA 5AW7B 1CI6B 1GK6A 5APYA 4AYCA 1MFZA 3HE4A 2WWWA 2P2UA 1HJBA 3B8EB 1J2JB 2ZXEB 5AVRB 5AW4B 1A02J 1FOSE 1A02F 2QM8A 4C46A 3NFQA 1NAFA 1T2KD 3I5CA 4EOTA 5AW6B 5AVYB 3L37A
chains in the Genus database with same CATH superfamily
1E79H 2E76B 2K9JB 5CBNA 2W6JH 3Q5SA 1ZRTD 2KSJA 3CD6P 3PP5A 2I1KA 3CXHI 2O3JA 1H0TA 3HE4B 1SFCD 4JPZB 4DT0A 2KI7B 3NMDA 1MZ9A 4TT3H 3RK2B 3HUSB 3H1KG 2QEXP 3V2RA 4KHXA 4N78E 4B86A 2Q3EA 2BEZF 1UIXA 1FJPA 3P8MC 3NTNA 2BCCJ 2FKWB 1N7LA 3HD7D 1NU1G 3PTZA 5KLVD 2Z5HA 4D6TG 1KILA 3PJSK 3HUSC 3P7KA 5AVWB 5AVTB 3JSVC 4LC1A 3S4RA 2NZ2A 4K3AA 4H44B 2J5UA 1BGYJ 5BU8B 5KAFE 2SPZA 1OWAA 3VN0A 1LJ2A 1YTZT 2R3CA 1Q7YQ 3TNUB 1YYCA 2FYUJ 1YJ9P 1SQBG 3MUDC 5E79H 5CCGC 5B5EH 2O1KA 1FZCC 2YNYA 3LIEA 1LWUB 1VQ9P 1K73Q 1NTME 3E1RA 4W80A 1KQGB 5APSA 2HFED 2E74C 5KLIC 2G3AA 5KKZB 3AE5C 2D2CB 1JNMA 1EDKA 2M3BA 2BCCD 4A7PA 5KLVJ 3EFGA 1OW7A 1T8ZA 1U7MA 3KZIH 1PIXA 3L70E 4H44D 3TGUD 1J1EC 3L36A 4RESB 4Y99C 3M91A 3TF5A 5AW2B 4IFMA 1PP9J 1S5LE 1SFCC 1RQUA 1SQBJ 3RL0D 3VMXA 1K05A 1OX3A 4HJGH 1S5LH 4D6TJ 1M90Q 2Y0EA 2D2CD 2W27A 1NWQA 3H1JD 2WT7B 1FJKA 1USEA 2ZFCA 3H1KD 2Q5UA 2Q9IA 4AUWA 2IZ1A 2OYIA 3AECC 2PAJA 5CCHC 2XNDH 5AVZB 2IX7C 4UB6E 1X0TA 3RL0B 1NU1D 2Y9YA 2M8RA 5AVSB 5KLIB 1E5WA 4PV1B 4D6TE 2H8PD 1PGQA 1MKMA 4IL6X 2AXCA 3FGAD 3HRNA 1BE3E 2RMZA 1S9KD 2C0WA 1S1CX 1SQPE 3IF4A 5APTA 2IBZD 4H13C 2FXPA 1SQXG 3BRTB 1Q82Q 1XTCC 3V2QA 1YHQP 1SQPG 1CI6A 4BRYB 2L5GB 3EWKA 1JMBA 1H88A 2YKOA 1P84D 1ZP0C 3F89A 3RL0g 2B87A 1GU4A 1NTMJ 3L70G 1W5CE 1GW3A 2KP8A 1GK4A 2XDJA 3RBXA 4WY4B 1NTZE 1GZLA 1M1JB 2A06G 1ZRTE 1LTGC 1RH5B 1NTKD 3GHGC 4KJMA 4EI2A 1OFCX 3AE1C 4C7NA 2XU6A 1OZHA 4RJTA 2HPCB 3WMM0 1T6AA 1RE3A 2QM7A 3T97B 3A0BE 3OJAB 5GTIH 2Z4EA 5EFWB 5GTIE 2WTYA 2D2CC 1L0NK 1FE6A 1SQVD 3RK3E 2E74B 5KKZC 2K9JA 4N3YB 1S4XA 3LW5J 4ASWA 5AVUB 5B5EE 1PZQA 1VQ8P 1URQB 1EZVI 2FYNB 1PP9G 5APYA 4AYCA 3QWOC 2MJZA 1FZCA 3KPEA 2K1AA 1L2PA 2FXOA 1EXIA 1FU1A 4KT0J 2YXRB 2WWWA 5B66E 2P2UA 5KLVE 3FX0A 2K88A 1J2JB 1R5SA 1IFIA 2R44A 4H44C 4CPGA 1GL2C 3W67A 4DCKA 1K8AQ 1FOSE 2E76D 3A0HE 2QM8A 1Z56A 1VDFA 2WSSH 3O6QA 3D6YA 3M9QA 2QJPC 3I5CA 3PRJA 1VF5B 1OVVA 3L37A 1G2CA 3HUSA 2KYVA 1L4AB 2ZVOB 1KILD 3QH9A 3KQGA 1SQQK 1SQXD 1BE3J 2C0XA 2JKVA 1GW4A 2H88C 2KUBA 2E75B 1KZUB 1CSBA 5C39A 2QJKB 1SQPD 2N1TA 5KJ7C 3CC2P 2RKLA 1RY3A 3CXHH 4Y28J 1SFCA 2N9YB 1AQ5A 2B87B 1EDJA 3L70D 2J58A 2IYOA 2H7HA 1L0LK 1YBKA 1GD2E 1H8AA 3WUTA 2IFNA 1JOCA 1LWUA 1PPJD 2A06D 2P1JA 3U59A 1NTKE 4RKUJ 3L73D 4H0LD 4OGQB 3V6IA 1LTBC 5GTHH 3VMZA 1KC8Q 3D70A 1S5LX 4U3FG 3L72D 5GTHE 2I1JA 4ZNCA 2QA4P 2AEJA 1PGOA 1PP9E 3AE7C 3P8CE 3PLNA 1IC2A 3CWBJ 3SFEC 4GKGA 1PFIA 2GM4A 1S72P 3B5NC 3H1IJ 1HWTC 1VQOP 4LLHA 2KNCA 2R5DA 1SQPJ 1N7SC 1NOHA 1NAYA 4BRYA 4ZKUA 1Q2NA 3IFMA 4OVNF 2OYIC 2C9NY 3H1JE 1OXZA 1TU3F 2I8DA 3RK3B 3CX5H 1NU1E 3AE4C 1FOSF 1SQBK 2XKMA 5AVQB 5CHXA 3RK2C 2JP3A 2OARA 2M5AA 2FXMA 1VQPP 1KYOI 5BU5A 2W8ZA 1LP1B 1NTMK 2KSEA 1WT6A 2HPCA 1ZLLA 4PD4I 2AXTH 4I2LC 1EZVG 1L0NJ 2CK3H 1BGYE 4BXLA 3Q5PA 3U1AA 4GOFA 2HG5D 3FWLA 1KQLA 1SQBE 4XFJA 3L75J 3TYYA 4XE5B 1YIJP 1P84E 2Q6QA 4IFDK 2Y9ZA 3Q3DA 3LIDA 3CCUP 1EDIA 1FS0E 3ABVC 1DX7A 2LXCB 2E76C 3B4SA 3GG2A 4JYBA 2A45H 4NPFX 4R4LA 4U7JA 4JQ0D 1Y8AA 5CJ0A 3A2AA 4H0LC 3GMAA 4DZOA 4Z1MH 1NTZG 2K9YA 3KYQA 4M3LA 3CWBE 4HH2A 3H25A 2IFMA 3CCQP 1VQ4P 3L73G 1LTTC 3IAOA 1KILC 2WMMA 3O6QB 2Q7CA 2VRSA 1JCCA 2O01J 4U3FD 4GODA 3M9HA 4YTPC 2QRXA 2YO3A 1VQLP 3H1JG 2HODA 3HE5B 3L71J 1KYOE 1NJIQ 3FXEA 4IFFA 3RK3D 5APWA 4EYYQ 3P8CD 3V2NA 2FYZA 2XNXA 4PD4H 1FZGA 3AE3C 2B9BA 1VQKP 3CCLP 2PP6A 4PD4E 3TDKA 1DH3A 2C9LY 1LTJC 1DEEG 2QIWA 1IO4A 3C8VA 4WY4C 1GL2A 1JM0A 5TJHA 4R4MA 4L75A 3RBZA 1Q81Q 2E43A 1HTLC 4W7ZA 3CCRP 1NU1K 1L0LG 3P32A 2YKQA 2OTKE 1NTKK 2FY8A 1JY2P 3H6PA 4N78D 1GDTA 1N7SB 2OQQA 3B5ND 2A45I 1KB9H 2ITAA 2WPRA 1HUCA 4H0LB 4I1LA 2WPVB 4OGQD 1L0LE 5KAFH 1GU5A 2O01H 2O1JA 4GT1A 4JYCA 1H0TB 4UB8E 1SQPK 2QE7H 1SQQG 1FC2C 1CI6B 4YXDC 2QJYB 2E5YA 1MFZA 3HE4A 1NGMB 2OYHA 1HVVA 1DD4A 1SFCB 2E75D 2A06E 3CXHD 1JTHA 1LGHB 4NPEA 1HH0A 1G1JA 3BCCE 2FBWC 2YIUB 1M56D 1A02J 3CC4P 2BEQD 4PV1C 3OW2O 2E5TA 1KFMA 1AVOA 2M0BA 1RE4C 4U3FE 1ZXGA 4L74A 1JB0J 1FBMA 1RF1B 1N73B 4W7YA 1BCCJ 1U7JA 1PGPA 2OYOA 2PGDA 1HF9A 1PP9D 1P84H 2CPSA 2Y0CA 1ZV8A 2LXBA 1LT9B 1OW8A 3H1HE 4JF7A 3RGUA 1JY3P 5KAIH 3H1HJ 5H2FE 4WY4D 3JC22 2N1TD 2WQYC 1X9VA 3H1JJ 3H32B 5APXA 2E42A 1ZMEC 4UB6H 1URQC 5KTBA 2FFDA 1FAVA 3AEDC 4WVZA 2FFDB 3AEFC 4ASVA 3G9RA 3SFDC 2KB7P 1GTWA 3CX5D 3USSA 3KZIE 5KLVK 5CCHD 2RN0A 1G1IA 4DOJA 1OVRA 5CJ4A 1KFNA 1LTIC 1M8OB 1RQVA 2P7JA 3H1LJ 5AW3B 2H89C 2G8YA 1DEBA 2IZ0A 3IN6A 3S1KA 3VP8A 1VQ5P 3GHGB 3GF7A 2KNCB 3M0DC 1SQXK 1KD1Q 2IDBA 3KHUA 1LT1A 5AW0B 3U1CA 3Q1MA 1RF1C 1RF0C 1KB9D 1X22A 2WSFJ 2WVRA 2N1TB 3F5HA 3L73E 2YMYA 3CX5I 3JCUE 3M0AA 3WU2E 3L72E 2QJKC 1S9KE 2HLOA 2OYIB 1ZN5A 4HB1A 2KLUA 5KAIE 1S2EA 3A7OA 2KLVA 1JTHB 3CXHE 1U57A 3CWBD 3L72G 1OIPA 4PJ0E 2B88A 2M5AB 3CCEP 1LNQA 1KORA 1NH4A 2OYHB 1AJYA 3N7NA 1ZOYC 1CZQA 2FFDC 1N73A 3R2PA 3OAKA 2M3EA 1IFJA 2QVAA 3HTKB 1HJ0A 2WPQA 1VPCA 3PHLA 3TNUA 3HTKA 5BVZA 5CCHA 1T2KC 2WPSA 3AEBC 1YQ4C 3B71A 3GF3A 3CCSP 3H1IG 2POHA 3H1HD 3MP7B 1BSHA 1GMJA 2RH0A 1NTZK 1AFOA 3CL3D 1N73C 3KXDA 2WSFH 1SQVE 3EFFK 3H1LG 2ZXXA 3MZWB 3ITKA 1BSNA 2P10A 2ZT9B 3L71D 2JEEA 3MIWA 3TK1A 1SP4A 1AVYA 4NPDA 5AW1B 2KK7A 2WSEJ 1X79B 2JJLA 3CX5E 2DW3A 1EZVD 4WY4A 5L8RJ 4C7NB 1LP1A 4QMAA 5AW5B 3BCCJ 4AQRD 1KV4A 1ZR2A 1IFNA 1N7SA 2AXTE 2V4HA 3IR9A 1SQVJ 2K3RA 3AE9C 1YITP 3V4WA 1SLQA 3T97A 1BE3D 3B5NA 4WBAA 1HGZA 1EQ7A 1J1EB 1L0NG 2FYUD 4Y99B 1EXJA 1EDLA 1NTZD 1OW6A 2OYHC 1JUNA 1FDIA 1KILE 3BASA 2LR2A 1L0LJ 3R4YA 1L0NE 3EQ2A 3I56P 2O01N 1K9MQ 1RHZB 1H89A 3BCCG 2ZYAA 1WRGA 4JBZA 1YJWP 2BASA 2V7QJ 3V4QA 3M9BA 4DJGA 3OA7A 3RL0C 1NHLA 1PV3A 1YJNP 1YI2P 2XZRA 3D71A 3SWYA 3NXSA 3L75E 1JCDA 1LT9C 2W90A 4HYTB 3L35A 3S9OA 1QVFO 1HGVA 1SQXJ 2P67A 2JWDA 4IL6H 5CCGD 1KYOH 1JY3N 3SWFA 1RF0A 3H1ID 3H1HG 3L75G 3WU2H 5KJ7A 2ZJSE 4TLFA 1QVGO 1KTMA 3G3ZA 2KZJA 2NPSA 2HR3A 4U3FJ 3ZDMA 2V7QH 4EDFA 3Q5RA 3H1LD 1BCCD 2NPSB 1L0LD 1M1JA 2KZIA 4YPCA 1ZR4A 5TISH 1OMIA 1M1KQ 1YQ3C 1NU1J 2ZYGA 1JMMA 5AVRB 1FZFA 2YMKA 1Q86Q 1A02F 1L4AD 1IFMA 4C46A 3V2PA 1T3JA 1NAFA 2QJPB 3NFQA 4GIFA 3G4SP 3G6EP 1USDA 3LW5H 3WUVA 1T2KD 4EOTA 2YKPA 1VQNP 1SQQD 3PH0A 1Q90D 5AW8B 2HYNA 4HKZH 4BWNA 5CMZA 2YXQB 1BE3G 1LWUC 2KS1B 2Q3IA 2WZ7A 2WITA 5H2FH 4UB8H 1FZCB 1K04A 3H32A 1LTAC 1URQA 1KB9I 3AE2C 4RO0A 1RE3C 3L74D 3C9IA 3M06A 3TGUJ 1BGYD 4ZMDA 1KN7A 2FYUE 2Z5IA 5APVA 2P58A 1SQBD 1QGKB 2OTJP 3AEEC 2IYPA 3A0HH 3A3YB 3Q2YA 2NPSC 5K5GB 3GW6A 4H13D 4WB4A 1PGJA 2WSCH 2GA1A 1IJDB 1FDOA 1PPJE 1DD3A 1AQTA 1LTJB 1QL1A 1SS1A 1JY2N 1Y9BA 1ZW0A 2NRGA 2UWJE 2YO2A 1SQQJ 1AV1A 2Y0DA 3GHGA 1WMKA 1L4AA 3MHVA 1W2BO 4I6MC 1MUUA 2QSIA 3AE6C 3VYIA 1VQMP 3L71E 1CW5A 1M7LA 3B5NB 3L75D 1SVFA 1VF5C 2N9BA 4O9BA 1VQ7P 3M0DA 3E1IA 5AW9B 1J1DB 3HD7B 1LTSC 2WT7A 1FZEA 2ZT9C 3AE8C 3KDPB 3O8ZA 3K5BA 3A5TA 1S3JA 3RK3C 3VOPA 1BCCG 1MFTA 1QL2A 3CI9A 3MGNA 2WSEH 3MUDA 4LGDE 5CCGA 1DIPA 1KILB 2K37A 1JO5A 2R5BA 1EZVE 4I7ZC 1XTGB 3W68A 5B66H 2XV5A 1BDCA 1KB9E 1W2EA 4EIJA 3L73J 1N2DC 1IZNB 3H1KJ 2FYNC 2JO1A 1JY2O 1NTZJ 3H1KE 4WWIA 3BATA 4YXWH 1NO4A 2R32A 1R8EA 1SQQE 2HODB 3HE5A 2R3SA 1KQSO 1QX8A 5KJ7D 1FDMA 2IBZI 5M1BA 4OGQC 1Y47A 3SWKA 3CMAP 2KIKA 3G71P 2YIUC 1YTZI 4ZKPA 1FZBA 3BRVB 2IBZG 3CWBG 3N4XA 3V5BA 1KMIZ 3C1LA 3L74G 1GL2D 3JCUH 5TISE 1BGYG 3CC7P 1L4AC 2IPPA 1EC5A 2JWAA 1RE4A 2KOGA 1X8YA 2NPSD 3CCJP 2N1TC 4N6JA 3L74E 2ZYDA 2Q1KA 5AVVB 5APQA 3VP9A 5APUA 3E7KA 3TGUG 2ZAEB 4K35A 2E75C 1URQD 2A45G 3A0BH 3VMYA 3WUUA 2L91A 2J59M 3L72J 3D6ZA 1NTMD 1NTKG 4I7ZB 4PV1D 3VTPC 1NVOA 1PL5A 1QEXA 1UIIA 2BCCE 3MD0A 1N7SD 3H1IE 3MTUE 4H13B 4PD4D 1IFPA 3SSUA 1IK9A 2KS1A 5CBOA 1N86A 5DJTB 1HBWA 1D7MA 3FWNA 4GOEA 5AVXB 3TGUE 2AEFA 2LKMA 3L71G 1JY3O 1SQVG 2FYUK 1FZAA 2CPBA 3H1LE 1KYOD 1MV8A 2OGUA 1T3UA 2QG4A 4C7RA 4GDOA 2W6AA 5E79E 2W6BA 2H43A 3UIAA 2PRRA 5KLVG 1P84I 1M1JC 2GUVA 4D6TD 2PFXA 4L76A 1JEKA 3FXDA 1VQ6P 4L73A 3CLQA 1J1DC 3HD7C 1KQFB 1RF1A 2ZVNB 1LTJA 1G2CB 5DJUB 1VF5D 1L0ND 1NYHA 1SQVK 2FYUG 2JDIH 2MKVA 4IL6E 5AW6B 3CPWO 3CCVP 1BDDA 1NKZB 1NKNA 2ZT9D 3AEGC 3I55P 1LT9A 1M57D 3II6A 5AW7B 1NTKJ 4OWFA 2KXPB 1GK6A 1OVUA 1QLED 3BCCD 3GLMA 3HD7A 3RK2D 2QJYC 2W83C 2IBZE 4MN4C 4XA4A 1R5LA 2GUSA 3L4FA 3VMAA 4PJ0H 3B8EB 2AEMA 1HJBA 2OTLP 1GL2B 1SQXE 2ZXEB 5AW4B 2BCCG 2JR8A 2WSCJ 3CMEP 1VL2A 1IK7A 4IOIH 2B89A 2E74D 4OH8B 3BVHA 3L74J 1N8RQ 1AA0A 3TSIA 1NTMG 1PPJG 1IFDA 3L70J 5AVYB 3AEAC 1BCCE 3CCMP
chains in the Genus database with same CATH topology
2KSJA 3PP5A 2I1KA 3HE4B 1SFCD 3NMDA 1MZ9A 3RK2B 3V2RA 4KHXA 4N78E 4B86A 1FJPA 3P8MC 3NTNA 3A5TA 2FKWB 1N7LA 3HD7D 2Z5HA 1KILA 3HUSC 3P7KA 5AVWB 5AVTB 4LC1A 5BU8B 1OWAA 1YTZT 2R3CA 3TNUB 1YYCA 5CCGC 2O1KA 1FZCC 2YNYA 3LIEA 1LWUB 4W80A 5APSA 2HFED 1JNMA 2M3BA 3EFGA 1T8ZA 1J1EC 3L36A 4RESB 4Y99C 3M91A 5AW2B 4IFMA 3RL0D 1SFCC 3VMXA 1NWQA 2W27A 2WT7B 1FJKA 2ZFCA 2Q5UA 2Q9IA 4AUWA 2OYIA 2PAJA 5CCHC 5AVZB 2IX7C 3RL0B 2M8RA 5AVSB 1E5WA 2H8PD 3HRNA 2C0WA 5APTA 3BRTB 1XTCC 1CI6A 2L5GB 1H88A 2YKOA 1GU4A 1GW3A 2KP8A 1GK4A 2XDJA 4WY4B 1GZLA 1M1JB 3GHGC 1LTGC 4C7NA 2XU6A 2HPCB 3WMM0 1RE3A 2QM7A 2Z4EA 3OJAB 2WTYA 1L0NK 4N3YB 5AVUB 1URQB 5APYA 4AYCA 1FZCA 2MJZA 3KPEA 1AQ5A 1FU1A 2WWWA 2P2UA 2OYHB 1J2JB 1IFIA 1GL2C 1FOSE 2QM8A 1Z56A 1VDFA 3M9QA 3I5CA 3L37A 1G2CA 3HUSA 2KYVA 1L4AB 1KILD 3KQGA 1SQQK 2C0XA 1GW4A 1KZUB 1CSBA 2N1TA 5KJ7C 1RY3A 1SFCA 2J58A 2H7HA 1L0LK 1GD2E 1H8AA 2IFNA 1JOCA 1LWUA 2P1JA 3U59A 1LTBC 3VMZA 1S9KD 2I1JA 1PFIA 2GM4A 3P8CE 1IC2A 4GKGA 3B5NC 1HWTC 4LLHA 2R5DA 1N7SC 1NOHA 4ZKUA 3IFMA 2OYIC 1OXZA 3RK3B 1FOSF 1SQBK 2XKMA 5AVQB 5CHXA 3RK2C 2OARA 2FXMA 5BU5A 1NTMK 1WT6A 2HPCA 1ZLLA 4I2LC 3U1AA 2HG5D 1KQLA 3TYYA 4IFDK 4XE5B 3LIDA 1DX7A 4JYBA 2A45H 5CJ0A 3A2AA 4DZOA 4M3LA 3KYQA 4HH2A 2IFMA 1LTTC 1KILC 2Q7CA 2VRSA 1JCCA 3M9HA 2YO3A 2HODA 3HE5B 4IFFA 3RK3D 5APWA 3P8CD 3V2NA 2FYZA 2XNXA 1FZGA 2PP6A 1DH3A 2C9LY 1LTJC 1IO4A 4WY4C 1GL2A 2E43A 1HTLC 4W7ZA 1NU1K 3P32A 2YKQA 1NTKK 3H6PA 1JY2P 4N78D 1GDTA 1N7SB 3B5ND 2A45I 4I1LA 2WPRA 1HUCA 1GU5A 2O01H 2O1JA 4GT1A 4JYCA 1SQPK 1CI6B 1MFZA 3HE4A 2OYHA 1HVVA 1SFCB 3BVHA 1JTHA 1LGHB 1HH0A 1G1JA 1A02J 1KFMA 1RE4C 1RF1B 1FBMA 1N73B 4W7YA 2CPSA 1ZV8A 1LT9B 4JF7A 1JY3P 4WY4D 5APXA 2N1TD 1X9VA 3H32B 2E42A 1URQC 5KTBA 2FFDA 1FAVA 2FFDB 2KB7P 1GTWA 5KLVK 5CCHD 1G1IA 4DOJA 5CJ4A 1KFNA 1LTIC 2P7JA 5AW3B 1DEBA 3VP8A 3GHGB 3M0DC 1SQXK 3U1CA 5AW0B 2C9NY 1RF1C 1RF0C 2N1TB 2YMYA 3M0AA 1S9KE 2HLOA 2OYIB 1ZN5A 3A7OA 2KLVA 1JTHB 1NH4A 3N7NA 1CZQA 2FFDC 1N73A 3R2PA 3OAKA 1IFJA 3HTKB 2WPQA 1VPCA 3TNUA 5CCHA 3HTKA 5BVZA 1T2KC 2WPSA 2POHA 1NTZK 1AFOA 3CL3D 1N73C 2WSFH 2JEEA 3MIWA 3TK1A 1SP4A 5AW1B 1X79B 2JJLA 4WY4A 4C7NB 4AQRD 5AW5B 1ZR2A 1IFNA 1N7SA 3IR9A 3V4WA 1SLQA 3T97A 3B5NA 4WBAA 1EQ7A 1HGZA 1J1EB 4Y99B 2OYHC 1JUNA 3BASA 3EQ2A 1H89A 1WRGA 2BASA 3V4QA 3M9BA 3OA7A 3RL0C 1NHLA 2XZRA 3SWYA 3NXSA 1JCDA 1LT9C 4HYTB 3L35A 1HGVA 2P67A 5CCGD 1JY3N 3SWFA 1RF0A 3G3ZA 2NPSA 2NPSB 1ZR4A 1M1JA 5AVRB 1JMMA 1FZFA 1A02F 1L4AD 1IFMA 4C46A 3V2PA 1T3JA 1NAFA 3NFQA 4GIFA 3LW5H 1T2KD 4EOTA 2YKPA 5AW8B 2HYNA 5CMZA 2WZ7A 1LWUC 2Q3IA 2WITA 1FZCB 3H32A 1LTAC 1URQA 1RE3C 3C9IA 3M06A 2Z5IA 5APVA 3A3YB 2NPSC 4WB4A 3HUSB 2WSCH 1IJDB 1QL1A 1LTJB 3V2QA 1JY2N 2YO2A 3GHGA 1L4AA 4I6MC 1MUUA 3VYIA 1CW5A 1M7LA 3B5NB 1SVFA 2N9BA 4O9BA 3M0DA 3E1IA 5AW9B 1J1DB 3HD7B 1LTSC 2WT7A 1FZEA 3KDPB 3O8ZA 3RK3C 3VOPA 1QL2A 3CI9A 3MGNA 4LGDE 2WSEH 3MUDA 5CCGA 1KILB 1JO5A 2R5BA 1XTGB 2XV5A 1W2EA 4EIJA 1N2DC 1JY2O 3BATA 1NO4A 2R32A 2HODB 3HE5A 1FDMA 5KJ7D 1YTZI 4ZKPA 1FZBA 3BRVB 3N4XA 3V5BA 1GL2D 1L4AC 2IPPA 1RE4A 2KOGA 1X8YA 2NPSD 2N1TC 4N6JA 5AVVB 3VN0A 5KJ7A 5APQA 3VP9A 5APUA 1URQD 2A45G 3VMYA 2J59M 3VTPC 3MD0A 1N7SD 3MTUE 1IK9A 1N86A 1HBWA 5AVXB 2LKMA 1JY3O 2FYUK 1FZAA 2CPBA 1MV8A 4C7RA 1T3UA 2W6AA 2W6BA 2H43A 3UIAA 1M1JC 2GUVA 3CLQA 3HD7C 1J1DC 1RF1A 1LTJA 1G2CB 1SQVK 1NKZB 1NKNA 1LT9A 3II6A 5AW7B 1GK6A 3HD7A 3RK2D 4XA4A 2GUSA 3L4FA 1HJBA 3B8EB 1GL2B 2ZXEB 5AW4B 4OH8B 3TSIA 1IFDA 5AW6B 5AVYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AW8 B;  3KQG A;  5CMZ A;  2Q3I A;  1CSB A;  3HE4 B;  3NMD A;  5APX A;  3M06 A;  2E42 A;  4B86 A;  4KHX A;  2H7H A;  1FAV A;  2Z5I A;  1GD2 E;  5APV A;  1H8A A;  3P8M C;  3NTN A;  3A5T A;  1GTW A;  2Z5H A;  3A3Y B;  3P7K A;  5AVW B;  5AVT B;  3VMZ A;  4LC1 A;  2P7J A;  1S9K D;  5AW3 B;  2YO2 A;  4GKG A;  4I6M C;  1MUU A;  3VYI A;  1OWA A;  1HWT C;  5AW0 B;  2C9N Y;  2R3C A;  2N9B A;  2R5D A;  3TNU B;  1YYC A;  3M0D A;  5AW9 B;  2WT7 A;  3KDP B;  3O8Z A;  3M0A A;  1S9K E;  1OXZ A;  2YNY A;  3LIE A;  3MGN A;  3A7O A;  5APS A;  1FOS F;  2R5B A;  5AVQ B;  1JNM A;  2XV5 A;  1CZQ A;  3L36 A;  4RES B;  2R32 A;  3M91 A;  3OAK A;  4I2L C;  3HE5 A;  5AW2 B;  3VMX A;  2WPQ A;  3TNU A;  3HTK A;  1T2K C;  2WPS A;  1KQL A;  3TYY A;  4XE5 B;  1NWQ A;  2W27 A;  3V5B A;  2WT7 B;  3LID A;  2ZFC A;  2Q5U A;  4AUW A;  4JYB A;  2IPP A;  1X8Y A;  3A2A A;  4DZO A;  5AVV B;  1SP4 A;  5AVZ B;  3TK1 A;  3VN0 A;  4M3L A;  5APQ A;  5AW1 B;  5APU A;  2JJL A;  5AVS B;  3VMY A;  4C7N B;  2Q7C A;  2VRS A;  4AQR D;  5AW5 B;  3M9H A;  2YO3 A;  3VTP C;  5APT A;  3IR9 A;  3HE5 B;  3MD0 A;  3V4W A;  1SLQ A;  3T97 A;  1HBW A;  5APW A;  5AVX B;  1CI6 A;  1H88 A;  1MV8 A;  1GU4 A;  1JUN A;  1DH3 A;  2C9L Y;  2W6A A;  2KP8 A;  1IO4 A;  1GK4 A;  1H89 A;  3UIA A;  1GZL A;  2E43 A;  2BAS A;  3V4Q A;  3P32 A;  3M9B A;  4C7N A;  2XU6 A;  2XZR A;  2WPR A;  1G2C B;  1HUC A;  2QM7 A;  3NXS A;  1GU5 A;  4HYT B;  2WTY A;  3L35 A;  2P67 A;  4GT1 A;  4JYC A;  5AVU B;  3SWF A;  5AW7 B;  1CI6 B;  1GK6 A;  5APY A;  4AYC A;  1MFZ A;  3HE4 A;  2WWW A;  2P2U A;  1HJB A;  3B8E B;  1J2J B;  2ZXE B;  5AVR B;  5AW4 B;  1A02 J;  1FOS E;  1A02 F;  2QM8 A;  4C46 A;  3NFQ A;  1NAF A;  1T2K D;  3I5C A;  4EOT A;  5AW6 B;  5AVY B;  3L37 A; 
#chains in the Genus database with same CATH topology
 1E79 H;  2E76 B;  2K9J B;  5CBN A;  2W6J H;  3Q5S A;  1ZRT D;  2KSJ A;  3CD6 P;  3PP5 A;  2I1K A;  3CXH I;  2O3J A;  1H0T A;  3HE4 B;  1SFC D;  4JPZ B;  4DT0 A;  2KI7 B;  3NMD A;  1MZ9 A;  4TT3 H;  3RK2 B;  3HUS B;  3H1K G;  2QEX P;  3V2R A;  4KHX A;  4N78 E;  4B86 A;  2Q3E A;  2BEZ F;  1UIX A;  1FJP A;  3P8M C;  3NTN A;  2BCC J;  2FKW B;  1N7L A;  3HD7 D;  1NU1 G;  3PTZ A;  5KLV D;  2Z5H A;  4D6T G;  1KIL A;  3PJS K;  3HUS C;  3P7K A;  5AVW B;  5AVT B;  3JSV C;  4LC1 A;  3S4R A;  2NZ2 A;  4K3A A;  4H44 B;  2J5U A;  1BGY J;  5BU8 B;  5KAF E;  2SPZ A;  1OWA A;  3VN0 A;  1LJ2 A;  1YTZ T;  2R3C A;  1Q7Y Q;  3TNU B;  1YYC A;  2FYU J;  1YJ9 P;  1SQB G;  3MUD C;  5E79 H;  5CCG C;  5B5E H;  2O1K A;  1FZC C;  2YNY A;  3LIE A;  1LWU B;  1VQ9 P;  1K73 Q;  1NTM E;  3E1R A;  4W80 A;  1KQG B;  5APS A;  2HFE D;  2E74 C;  5KLI C;  2G3A A;  5KKZ B;  3AE5 C;  2D2C B;  1JNM A;  1EDK A;  2M3B A;  2BCC D;  4A7P A;  5KLV J;  3EFG A;  1OW7 A;  1T8Z A;  1U7M A;  3KZI H;  1PIX A;  3L70 E;  4H44 D;  3TGU D;  1J1E C;  3L36 A;  4RES B;  4Y99 C;  3M91 A;  3TF5 A;  5AW2 B;  4IFM A;  1PP9 J;  1S5L E;  1SFC C;  1RQU A;  1SQB J;  3RL0 D;  3VMX A;  1K05 A;  1OX3 A;  4HJG H;  1S5L H;  4D6T J;  1M90 Q;  2Y0E A;  2D2C D;  2W27 A;  1NWQ A;  3H1J D;  2WT7 B;  1FJK A;  1USE A;  2ZFC A;  3H1K D;  2Q5U A;  2Q9I A;  4AUW A;  2IZ1 A;  2OYI A;  3AEC C;  2PAJ A;  5CCH C;  2XND H;  5AVZ B;  2IX7 C;  4UB6 E;  1X0T A;  3RL0 B;  1NU1 D;  2Y9Y A;  2M8R A;  5AVS B;  5KLI B;  1E5W A;  4PV1 B;  4D6T E;  2H8P D;  1PGQ A;  1MKM A;  4IL6 X;  2AXC A;  3FGA D;  3HRN A;  1BE3 E;  2RMZ A;  1S9K D;  2C0W A;  1S1C X;  1SQP E;  3IF4 A;  5APT A;  2IBZ D;  4H13 C;  2FXP A;  1SQX G;  3BRT B;  1Q82 Q;  1XTC C;  3V2Q A;  1YHQ P;  1SQP G;  1CI6 A;  4BRY B;  2L5G B;  3EWK A;  1JMB A;  1H88 A;  2YKO A;  1P84 D;  1ZP0 C;  3F89 A;  3RL0 g;  2B87 A;  1GU4 A;  1NTM J;  3L70 G;  1W5C E;  1GW3 A;  2KP8 A;  1GK4 A;  2XDJ A;  3RBX A;  4WY4 B;  1NTZ E;  1GZL A;  1M1J B;  2A06 G;  1ZRT E;  1LTG C;  1RH5 B;  1NTK D;  3GHG C;  4KJM A;  4EI2 A;  1OFC X;  3AE1 C;  4C7N A;  2XU6 A;  1OZH A;  4RJT A;  2HPC B;  3WMM 0;  1T6A A;  1RE3 A;  2QM7 A;  3T97 B;  3A0B E;  3OJA B;  5GTI H;  2Z4E A;  5EFW B;  5GTI E;  2WTY A;  2D2C C;  1L0N K;  1FE6 A;  1SQV D;  3RK3 E;  2E74 B;  5KKZ C;  2K9J A;  4N3Y B;  1S4X A;  3LW5 J;  4ASW A;  5AVU B;  5B5E E;  1PZQ A;  1VQ8 P;  1URQ B;  1EZV I;  2FYN B;  1PP9 G;  5APY A;  4AYC A;  3QWO C;  2MJZ A;  1FZC A;  3KPE A;  2K1A A;  1L2P A;  2FXO A;  1EXI A;  1FU1 A;  4KT0 J;  2YXR B;  2WWW A;  5B66 E;  2P2U A;  5KLV E;  3FX0 A;  2K88 A;  1J2J B;  1R5S A;  1IFI A;  2R44 A;  4H44 C;  4CPG A;  1GL2 C;  3W67 A;  4DCK A;  1K8A Q;  1FOS E;  2E76 D;  3A0H E;  2QM8 A;  1Z56 A;  1VDF A;  2WSS H;  3O6Q A;  3D6Y A;  3M9Q A;  2QJP C;  3I5C A;  3PRJ A;  1VF5 B;  1OVV A;  3L37 A;  1G2C A;  3HUS A;  2KYV A;  1L4A B;  2ZVO B;  1KIL D;  3QH9 A;  3KQG A;  1SQQ K;  1SQX D;  1BE3 J;  2C0X A;  2JKV A;  1GW4 A;  2H88 C;  2KUB A;  2E75 B;  1KZU B;  1CSB A;  5C39 A;  2QJK B;  1SQP D;  2N1T A;  5KJ7 C;  3CC2 P;  2RKL A;  1RY3 A;  3CXH H;  4Y28 J;  1SFC A;  2N9Y B;  1AQ5 A;  2B87 B;  1EDJ A;  3L70 D;  2J58 A;  2IYO A;  2H7H A;  1L0L K;  1YBK A;  1GD2 E;  1H8A A;  3WUT A;  2IFN A;  1JOC A;  1LWU A;  1PPJ D;  2A06 D;  2P1J A;  3U59 A;  1NTK E;  4RKU J;  3L73 D;  4H0L D;  4OGQ B;  3V6I A;  1LTB C;  5GTH H;  3VMZ A;  1KC8 Q;  3D70 A;  1S5L X;  4U3F G;  3L72 D;  5GTH E;  2I1J A;  4ZNC A;  2QA4 P;  2AEJ A;  1PGO A;  1PP9 E;  3AE7 C;  3P8C E;  3PLN A;  1IC2 A;  3CWB J;  3SFE C;  4GKG A;  1PFI A;  2GM4 A;  1S72 P;  3B5N C;  3H1I J;  1HWT C;  1VQO P;  4LLH A;  2KNC A;  2R5D A;  1SQP J;  1N7S C;  1NOH A;  1NAY A;  4BRY A;  4ZKU A;  1Q2N A;  3IFM A;  4OVN F;  2OYI C;  2C9N Y;  3H1J E;  1OXZ A;  1TU3 F;  2I8D A;  3RK3 B;  3CX5 H;  1NU1 E;  3AE4 C;  1FOS F;  1SQB K;  2XKM A;  5AVQ B;  5CHX A;  3RK2 C;  2JP3 A;  2OAR A;  2M5A A;  2FXM A;  1VQP P;  1KYO I;  5BU5 A;  2W8Z A;  1LP1 B;  1NTM K;  2KSE A;  1WT6 A;  2HPC A;  1ZLL A;  4PD4 I;  2AXT H;  4I2L C;  1EZV G;  1L0N J;  2CK3 H;  1BGY E;  4BXL A;  3Q5P A;  3U1A A;  4GOF A;  2HG5 D;  3FWL A;  1KQL A;  1SQB E;  4XFJ A;  3L75 J;  3TYY A;  4XE5 B;  1YIJ P;  1P84 E;  2Q6Q A;  4IFD K;  2Y9Z A;  3Q3D A;  3LID A;  3CCU P;  1EDI A;  1FS0 E;  3ABV C;  1DX7 A;  2LXC B;  2E76 C;  3B4S A;  3GG2 A;  4JYB A;  2A45 H;  4NPF X;  4R4L A;  4U7J A;  4JQ0 D;  1Y8A A;  5CJ0 A;  3A2A A;  4H0L C;  3GMA A;  4DZO A;  4Z1M H;  1NTZ G;  2K9Y A;  3KYQ A;  4M3L A;  3CWB E;  4HH2 A;  3H25 A;  2IFM A;  3CCQ P;  1VQ4 P;  3L73 G;  1LTT C;  3IAO A;  1KIL C;  2WMM A;  3O6Q B;  2Q7C A;  2VRS A;  1JCC A;  2O01 J;  4U3F D;  4GOD A;  3M9H A;  4YTP C;  2QRX A;  2YO3 A;  1VQL P;  3H1J G;  2HOD A;  3HE5 B;  3L71 J;  1KYO E;  1NJI Q;  3FXE A;  4IFF A;  3RK3 D;  5APW A;  4EYY Q;  3P8C D;  3V2N A;  2FYZ A;  2XNX A;  4PD4 H;  1FZG A;  3AE3 C;  2B9B A;  1VQK P;  3CCL P;  2PP6 A;  4PD4 E;  3TDK A;  1DH3 A;  2C9L Y;  1LTJ C;  1DEE G;  2QIW A;  1IO4 A;  3C8V A;  4WY4 C;  1GL2 A;  1JM0 A;  5TJH A;  4R4M A;  4L75 A;  3RBZ A;  1Q81 Q;  2E43 A;  1HTL C;  4W7Z A;  3CCR P;  1NU1 K;  1L0L G;  3P32 A;  2YKQ A;  2OTK E;  1NTK K;  2FY8 A;  1JY2 P;  3H6P A;  4N78 D;  1GDT A;  1N7S B;  2OQQ A;  3B5N D;  2A45 I;  1KB9 H;  2ITA A;  2WPR A;  1HUC A;  4H0L B;  4I1L A;  2WPV B;  4OGQ D;  1L0L E;  5KAF H;  1GU5 A;  2O01 H;  2O1J A;  4GT1 A;  4JYC A;  1H0T B;  4UB8 E;  1SQP K;  2QE7 H;  1SQQ G;  1FC2 C;  1CI6 B;  4YXD C;  2QJY B;  2E5Y A;  1MFZ A;  3HE4 A;  1NGM B;  2OYH A;  1HVV A;  1DD4 A;  1SFC B;  2E75 D;  2A06 E;  3CXH D;  1JTH A;  1LGH B;  4NPE A;  1HH0 A;  1G1J A;  3BCC E;  2FBW C;  2YIU B;  1M56 D;  1A02 J;  3CC4 P;  2BEQ D;  4PV1 C;  3OW2 O;  2E5T A;  1KFM A;  1AVO A;  2M0B A;  1RE4 C;  4U3F E;  1ZXG A;  4L74 A;  1JB0 J;  1FBM A;  1RF1 B;  1N73 B;  4W7Y A;  1BCC J;  1U7J A;  1PGP A;  2OYO A;  2PGD A;  1HF9 A;  1PP9 D;  1P84 H;  2CPS A;  2Y0C A;  1ZV8 A;  2LXB A;  1LT9 B;  1OW8 A;  3H1H E;  4JF7 A;  3RGU A;  1JY3 P;  5KAI H;  3H1H J;  5H2F E;  4WY4 D;  3JC2 2;  2N1T D;  2WQY C;  1X9V A;  3H1J J;  3H32 B;  5APX A;  2E42 A;  1ZME C;  4UB6 H;  1URQ C;  5KTB A;  2FFD A;  1FAV A;  3AED C;  4WVZ A;  2FFD B;  3AEF C;  4ASV A;  3G9R A;  3SFD C;  2KB7 P;  1GTW A;  3CX5 D;  3USS A;  3KZI E;  5KLV K;  5CCH D;  2RN0 A;  1G1I A;  4DOJ A;  1OVR A;  5CJ4 A;  1KFN A;  1LTI C;  1M8O B;  1RQV A;  2P7J A;  3H1L J;  5AW3 B;  2H89 C;  2G8Y A;  1DEB A;  2IZ0 A;  3IN6 A;  3S1K A;  3VP8 A;  1VQ5 P;  3GHG B;  3GF7 A;  2KNC B;  3M0D C;  1SQX K;  1KD1 Q;  2IDB A;  3KHU A;  1LT1 A;  5AW0 B;  3U1C A;  3Q1M A;  1RF1 C;  1RF0 C;  1KB9 D;  1X22 A;  2WSF J;  2WVR A;  2N1T B;  3F5H A;  3L73 E;  2YMY A;  3CX5 I;  3JCU E;  3M0A A;  3WU2 E;  3L72 E;  2QJK C;  1S9K E;  2HLO A;  2OYI B;  1ZN5 A;  4HB1 A;  2KLU A;  5KAI E;  1S2E A;  3A7O A;  2KLV A;  1JTH B;  3CXH E;  1U57 A;  3CWB D;  3L72 G;  1OIP A;  4PJ0 E;  2B88 A;  2M5A B;  3CCE P;  1LNQ A;  1KOR A;  1NH4 A;  2OYH B;  1AJY A;  3N7N A;  1ZOY C;  1CZQ A;  2FFD C;  1N73 A;  3R2P A;  3OAK A;  2M3E A;  1IFJ A;  2QVA A;  3HTK B;  1HJ0 A;  2WPQ A;  1VPC A;  3PHL A;  3TNU A;  3HTK A;  5BVZ A;  5CCH A;  1T2K C;  2WPS A;  3AEB C;  1YQ4 C;  3B71 A;  3GF3 A;  3CCS P;  3H1I G;  2POH A;  3H1H D;  3MP7 B;  1BSH A;  1GMJ A;  2RH0 A;  1NTZ K;  1AFO A;  3CL3 D;  1N73 C;  3KXD A;  2WSF H;  1SQV E;  3EFF K;  3H1L G;  2ZXX A;  3MZW B;  3ITK A;  1BSN A;  2P10 A;  2ZT9 B;  3L71 D;  2JEE A;  3MIW A;  3TK1 A;  1SP4 A;  1AVY A;  4NPD A;  5AW1 B;  2KK7 A;  2WSE J;  1X79 B;  2JJL A;  3CX5 E;  2DW3 A;  1EZV D;  4WY4 A;  5L8R J;  4C7N B;  1LP1 A;  4QMA A;  5AW5 B;  3BCC J;  4AQR D;  1KV4 A;  1ZR2 A;  1IFN A;  1N7S A;  2AXT E;  2V4H A;  3IR9 A;  1SQV J;  2K3R A;  3AE9 C;  1YIT P;  3V4W A;  1SLQ A;  3T97 A;  1BE3 D;  3B5N A;  4WBA A;  1HGZ A;  1EQ7 A;  1J1E B;  1L0N G;  2FYU D;  4Y99 B;  1EXJ A;  1EDL A;  1NTZ D;  1OW6 A;  2OYH C;  1JUN A;  1FDI A;  1KIL E;  3BAS A;  2LR2 A;  1L0L J;  3R4Y A;  1L0N E;  3EQ2 A;  3I56 P;  2O01 N;  1K9M Q;  1RHZ B;  1H89 A;  3BCC G;  2ZYA A;  1WRG A;  4JBZ A;  1YJW P;  2BAS A;  2V7Q J;  3V4Q A;  3M9B A;  4DJG A;  3OA7 A;  3RL0 C;  1NHL A;  1PV3 A;  1YJN P;  1YI2 P;  2XZR A;  3D71 A;  3SWY A;  3NXS A;  3L75 E;  1JCD A;  1LT9 C;  2W90 A;  4HYT B;  3L35 A;  3S9O A;  1QVF O;  1HGV A;  1SQX J;  2P67 A;  2JWD A;  4IL6 H;  5CCG D;  1KYO H;  1JY3 N;  3SWF A;  1RF0 A;  3H1I D;  3H1H G;  3L75 G;  3WU2 H;  5KJ7 A;  2ZJS E;  4TLF A;  1QVG O;  1KTM A;  3G3Z A;  2KZJ A;  2NPS A;  2HR3 A;  4U3F J;  3ZDM A;  2V7Q H;  4EDF A;  3Q5R A;  3H1L D;  1BCC D;  2NPS B;  1L0L D;  1M1J A;  2KZI A;  4YPC A;  1ZR4 A;  5TIS H;  1OMI A;  1M1K Q;  1YQ3 C;  1NU1 J;  2ZYG A;  1JMM A;  5AVR B;  1FZF A;  2YMK A;  1Q86 Q;  1A02 F;  1L4A D;  1IFM A;  4C46 A;  3V2P A;  1T3J A;  1NAF A;  2QJP B;  3NFQ A;  4GIF A;  3G4S P;  3G6E P;  1USD A;  3LW5 H;  3WUV A;  1T2K D;  4EOT A;  2YKP A;  1VQN P;  1SQQ D;  3PH0 A;  1Q90 D;  5AW8 B;  2HYN A;  4HKZ H;  4BWN A;  5CMZ A;  2YXQ B;  1BE3 G;  1LWU C;  2KS1 B;  2Q3I A;  2WZ7 A;  2WIT A;  5H2F H;  4UB8 H;  1FZC B;  1K04 A;  3H32 A;  1LTA C;  1URQ A;  1KB9 I;  3AE2 C;  4RO0 A;  1RE3 C;  3L74 D;  3C9I A;  3M06 A;  3TGU J;  1BGY D;  4ZMD A;  1KN7 A;  2FYU E;  2Z5I A;  5APV A;  2P58 A;  1SQB D;  1QGK B;  2OTJ P;  3AEE C;  2IYP A;  3A0H H;  3A3Y B;  3Q2Y A;  2NPS C;  5K5G B;  3GW6 A;  4H13 D;  4WB4 A;  1PGJ A;  2WSC H;  2GA1 A;  1IJD B;  1FDO A;  1PPJ E;  1DD3 A;  1AQT A;  1LTJ B;  1QL1 A;  1SS1 A;  1JY2 N;  1Y9B A;  1ZW0 A;  2NRG A;  2UWJ E;  2YO2 A;  1SQQ J;  1AV1 A;  2Y0D A;  3GHG A;  1WMK A;  1L4A A;  3MHV A;  1W2B O;  4I6M C;  1MUU A;  2QSI A;  3AE6 C;  3VYI A;  1VQM P;  3L71 E;  1CW5 A;  1M7L A;  3B5N B;  3L75 D;  1SVF A;  1VF5 C;  2N9B A;  4O9B A;  1VQ7 P;  3M0D A;  3E1I A;  5AW9 B;  1J1D B;  3HD7 B;  1LTS C;  2WT7 A;  1FZE A;  2ZT9 C;  3AE8 C;  3KDP B;  3O8Z A;  3K5B A;  3A5T A;  1S3J A;  3RK3 C;  3VOP A;  1BCC G;  1MFT A;  1QL2 A;  3CI9 A;  3MGN A;  2WSE H;  3MUD A;  4LGD E;  5CCG A;  1DIP A;  1KIL B;  2K37 A;  1JO5 A;  2R5B A;  1EZV E;  4I7Z C;  1XTG B;  3W68 A;  5B66 H;  2XV5 A;  1BDC A;  1KB9 E;  1W2E A;  4EIJ A;  3L73 J;  1N2D C;  1IZN B;  3H1K J;  2FYN C;  2JO1 A;  1JY2 O;  1NTZ J;  3H1K E;  4WWI A;  3BAT A;  4YXW H;  1NO4 A;  2R32 A;  1R8E A;  1SQQ E;  2HOD B;  3HE5 A;  2R3S A;  1KQS O;  1QX8 A;  5KJ7 D;  1FDM A;  2IBZ I;  5M1B A;  4OGQ C;  1Y47 A;  3SWK A;  3CMA P;  2KIK A;  3G71 P;  2YIU C;  1YTZ I;  4ZKP A;  1FZB A;  3BRV B;  2IBZ G;  3CWB G;  3N4X A;  3V5B A;  1KMI Z;  3C1L A;  3L74 G;  1GL2 D;  3JCU H;  5TIS E;  1BGY G;  3CC7 P;  1L4A C;  2IPP A;  1EC5 A;  2JWA A;  1RE4 A;  2KOG A;  1X8Y A;  2NPS D;  3CCJ P;  2N1T C;  4N6J A;  3L74 E;  2ZYD A;  2Q1K A;  5AVV B;  5APQ A;  3VP9 A;  5APU A;  3E7K A;  3TGU G;  2ZAE B;  4K35 A;  2E75 C;  1URQ D;  2A45 G;  3A0B H;  3VMY A;  3WUU A;  2L91 A;  2J59 M;  3L72 J;  3D6Z A;  1NTM D;  1NTK G;  4I7Z B;  4PV1 D;  3VTP C;  1NVO A;  1PL5 A;  1QEX A;  1UII A;  2BCC E;  3MD0 A;  1N7S D;  3H1I E;  3MTU E;  4H13 B;  4PD4 D;  1IFP A;  3SSU A;  1IK9 A;  2KS1 A;  5CBO A;  1N86 A;  5DJT B;  1HBW A;  1D7M A;  3FWN A;  4GOE A;  5AVX B;  3TGU E;  2AEF A;  2LKM A;  3L71 G;  1JY3 O;  1SQV G;  2FYU K;  1FZA A;  2CPB A;  3H1L E;  1KYO D;  1MV8 A;  2OGU A;  1T3U A;  2QG4 A;  4C7R A;  4GDO A;  2W6A A;  5E79 E;  2W6B A;  2H43 A;  3UIA A;  2PRR A;  5KLV G;  1P84 I;  1M1J C;  2GUV A;  4D6T D;  2PFX A;  4L76 A;  1JEK A;  3FXD A;  1VQ6 P;  4L73 A;  3CLQ A;  1J1D C;  3HD7 C;  1KQF B;  1RF1 A;  2ZVN B;  1LTJ A;  1G2C B;  5DJU B;  1VF5 D;  1L0N D;  1NYH A;  1SQV K;  2FYU G;  2JDI H;  2MKV A;  4IL6 E;  5AW6 B;  3CPW O;  3CCV P;  1BDD A;  1NKZ B;  1NKN A;  2ZT9 D;  3AEG C;  3I55 P;  1LT9 A;  1M57 D;  3II6 A;  5AW7 B;  1NTK J;  4OWF A;  2KXP B;  1GK6 A;  1OVU A;  1QLE D;  3BCC D;  3GLM A;  3HD7 A;  3RK2 D;  2QJY C;  2W83 C;  2IBZ E;  4MN4 C;  4XA4 A;  1R5L A;  2GUS A;  3L4F A;  3VMA A;  4PJ0 H;  3B8E B;  2AEM A;  1HJB A;  2OTL P;  1GL2 B;  1SQX E;  2ZXE B;  5AW4 B;  2BCC G;  2JR8 A;  2WSC J;  3CME P;  1VL2 A;  1IK7 A;  4IOI H;  2B89 A;  2E74 D;  4OH8 B;  3BVH A;  3L74 J;  1N8R Q;  1AA0 A;  3TSI A;  1NTM G;  1PPJ G;  1IFD A;  3L70 J;  5AVY B;  3AEA C;  1BCC E;  3CCM P; 
#chains in the Genus database with same CATH homology
 2KSJ A;  3PP5 A;  2I1K A;  3HE4 B;  1SFC D;  3NMD A;  1MZ9 A;  3RK2 B;  3V2R A;  4KHX A;  4N78 E;  4B86 A;  1FJP A;  3P8M C;  3NTN A;  3A5T A;  2FKW B;  1N7L A;  3HD7 D;  2Z5H A;  1KIL A;  3HUS C;  3P7K A;  5AVW B;  5AVT B;  4LC1 A;  5BU8 B;  1OWA A;  1YTZ T;  2R3C A;  3TNU B;  1YYC A;  5CCG C;  2O1K A;  1FZC C;  2YNY A;  3LIE A;  1LWU B;  4W80 A;  5APS A;  2HFE D;  1JNM A;  2M3B A;  3EFG A;  1T8Z A;  1J1E C;  3L36 A;  4RES B;  4Y99 C;  3M91 A;  5AW2 B;  4IFM A;  3RL0 D;  1SFC C;  3VMX A;  1NWQ A;  2W27 A;  2WT7 B;  1FJK A;  2ZFC A;  2Q5U A;  2Q9I A;  4AUW A;  2OYI A;  2PAJ A;  5CCH C;  5AVZ B;  2IX7 C;  3RL0 B;  2M8R A;  5AVS B;  1E5W A;  2H8P D;  3HRN A;  2C0W A;  5APT A;  3BRT B;  1XTC C;  1CI6 A;  2L5G B;  1H88 A;  2YKO A;  1GU4 A;  1GW3 A;  2KP8 A;  1GK4 A;  2XDJ A;  4WY4 B;  1GZL A;  1M1J B;  3GHG C;  1LTG C;  4C7N A;  2XU6 A;  2HPC B;  3WMM 0;  1RE3 A;  2QM7 A;  2Z4E A;  3OJA B;  2WTY A;  1L0N K;  4N3Y B;  5AVU B;  1URQ B;  5APY A;  4AYC A;  1FZC A;  2MJZ A;  3KPE A;  1AQ5 A;  1FU1 A;  2WWW A;  2P2U A;  2OYH B;  1J2J B;  1IFI A;  1GL2 C;  1FOS E;  2QM8 A;  1Z56 A;  1VDF A;  3M9Q A;  3I5C A;  3L37 A;  1G2C A;  3HUS A;  2KYV A;  1L4A B;  1KIL D;  3KQG A;  1SQQ K;  2C0X A;  1GW4 A;  1KZU B;  1CSB A;  2N1T A;  5KJ7 C;  1RY3 A;  1SFC A;  2J58 A;  2H7H A;  1L0L K;  1GD2 E;  1H8A A;  2IFN A;  1JOC A;  1LWU A;  2P1J A;  3U59 A;  1LTB C;  3VMZ A;  1S9K D;  2I1J A;  1PFI A;  2GM4 A;  3P8C E;  1IC2 A;  4GKG A;  3B5N C;  1HWT C;  4LLH A;  2R5D A;  1N7S C;  1NOH A;  4ZKU A;  3IFM A;  2OYI C;  1OXZ A;  3RK3 B;  1FOS F;  1SQB K;  2XKM A;  5AVQ B;  5CHX A;  3RK2 C;  2OAR A;  2FXM A;  5BU5 A;  1NTM K;  1WT6 A;  2HPC A;  1ZLL A;  4I2L C;  3U1A A;  2HG5 D;  1KQL A;  3TYY A;  4IFD K;  4XE5 B;  3LID A;  1DX7 A;  4JYB A;  2A45 H;  5CJ0 A;  3A2A A;  4DZO A;  4M3L A;  3KYQ A;  4HH2 A;  2IFM A;  1LTT C;  1KIL C;  2Q7C A;  2VRS A;  1JCC A;  3M9H A;  2YO3 A;  2HOD A;  3HE5 B;  4IFF A;  3RK3 D;  5APW A;  3P8C D;  3V2N A;  2FYZ A;  2XNX A;  1FZG A;  2PP6 A;  1DH3 A;  2C9L Y;  1LTJ C;  1IO4 A;  4WY4 C;  1GL2 A;  2E43 A;  1HTL C;  4W7Z A;  1NU1 K;  3P32 A;  2YKQ A;  1NTK K;  3H6P A;  1JY2 P;  4N78 D;  1GDT A;  1N7S B;  3B5N D;  2A45 I;  4I1L A;  2WPR A;  1HUC A;  1GU5 A;  2O01 H;  2O1J A;  4GT1 A;  4JYC A;  1SQP K;  1CI6 B;  1MFZ A;  3HE4 A;  2OYH A;  1HVV A;  1SFC B;  3BVH A;  1JTH A;  1LGH B;  1HH0 A;  1G1J A;  1A02 J;  1KFM A;  1RE4 C;  1RF1 B;  1FBM A;  1N73 B;  4W7Y A;  2CPS A;  1ZV8 A;  1LT9 B;  4JF7 A;  1JY3 P;  4WY4 D;  5APX A;  2N1T D;  1X9V A;  3H32 B;  2E42 A;  1URQ C;  5KTB A;  2FFD A;  1FAV A;  2FFD B;  2KB7 P;  1GTW A;  5KLV K;  5CCH D;  1G1I A;  4DOJ A;  5CJ4 A;  1KFN A;  1LTI C;  2P7J A;  5AW3 B;  1DEB A;  3VP8 A;  3GHG B;  3M0D C;  1SQX K;  3U1C A;  5AW0 B;  2C9N Y;  1RF1 C;  1RF0 C;  2N1T B;  2YMY A;  3M0A A;  1S9K E;  2HLO A;  2OYI B;  1ZN5 A;  3A7O A;  2KLV A;  1JTH B;  1NH4 A;  3N7N A;  1CZQ A;  2FFD C;  1N73 A;  3R2P A;  3OAK A;  1IFJ A;  3HTK B;  2WPQ A;  1VPC A;  3TNU A;  5CCH A;  3HTK A;  5BVZ A;  1T2K C;  2WPS A;  2POH A;  1NTZ K;  1AFO A;  3CL3 D;  1N73 C;  2WSF H;  2JEE A;  3MIW A;  3TK1 A;  1SP4 A;  5AW1 B;  1X79 B;  2JJL A;  4WY4 A;  4C7N B;  4AQR D;  5AW5 B;  1ZR2 A;  1IFN A;  1N7S A;  3IR9 A;  3V4W A;  1SLQ A;  3T97 A;  3B5N A;  4WBA A;  1EQ7 A;  1HGZ A;  1J1E B;  4Y99 B;  2OYH C;  1JUN A;  3BAS A;  3EQ2 A;  1H89 A;  1WRG A;  2BAS A;  3V4Q A;  3M9B A;  3OA7 A;  3RL0 C;  1NHL A;  2XZR A;  3SWY A;  3NXS A;  1JCD A;  1LT9 C;  4HYT B;  3L35 A;  1HGV A;  2P67 A;  5CCG D;  1JY3 N;  3SWF A;  1RF0 A;  3G3Z A;  2NPS A;  2NPS B;  1ZR4 A;  1M1J A;  5AVR B;  1JMM A;  1FZF A;  1A02 F;  1L4A D;  1IFM A;  4C46 A;  3V2P A;  1T3J A;  1NAF A;  3NFQ A;  4GIF A;  3LW5 H;  1T2K D;  4EOT A;  2YKP A;  5AW8 B;  2HYN A;  5CMZ A;  2WZ7 A;  1LWU C;  2Q3I A;  2WIT A;  1FZC B;  3H32 A;  1LTA C;  1URQ A;  1RE3 C;  3C9I A;  3M06 A;  2Z5I A;  5APV A;  3A3Y B;  2NPS C;  4WB4 A;  3HUS B;  2WSC H;  1IJD B;  1QL1 A;  1LTJ B;  3V2Q A;  1JY2 N;  2YO2 A;  3GHG A;  1L4A A;  4I6M C;  1MUU A;  3VYI A;  1CW5 A;  1M7L A;  3B5N B;  1SVF A;  2N9B A;  4O9B A;  3M0D A;  3E1I A;  5AW9 B;  1J1D B;  3HD7 B;  1LTS C;  2WT7 A;  1FZE A;  3KDP B;  3O8Z A;  3RK3 C;  3VOP A;  1QL2 A;  3CI9 A;  3MGN A;  4LGD E;  2WSE H;  3MUD A;  5CCG A;  1KIL B;  1JO5 A;  2R5B A;  1XTG B;  2XV5 A;  1W2E A;  4EIJ A;  1N2D C;  1JY2 O;  3BAT A;  1NO4 A;  2R32 A;  2HOD B;  3HE5 A;  1FDM A;  5KJ7 D;  1YTZ I;  4ZKP A;  1FZB A;  3BRV B;  3N4X A;  3V5B A;  1GL2 D;  1L4A C;  2IPP A;  1RE4 A;  2KOG A;  1X8Y A;  2NPS D;  2N1T C;  4N6J A;  5AVV B;  3VN0 A;  5KJ7 A;  5APQ A;  3VP9 A;  5APU A;  1URQ D;  2A45 G;  3VMY A;  2J59 M;  3VTP C;  3MD0 A;  1N7S D;  3MTU E;  1IK9 A;  1N86 A;  1HBW A;  5AVX B;  2LKM A;  1JY3 O;  2FYU K;  1FZA A;  2CPB A;  1MV8 A;  4C7R A;  1T3U A;  2W6A A;  2W6B A;  2H43 A;  3UIA A;  1M1J C;  2GUV A;  3CLQ A;  3HD7 C;  1J1D C;  1RF1 A;  1LTJ A;  1G2C B;  1SQV K;  1NKZ B;  1NKN A;  1LT9 A;  3II6 A;  5AW7 B;  1GK6 A;  3HD7 A;  3RK2 D;  4XA4 A;  2GUS A;  3L4F A;  1HJB A;  3B8E B;  1GL2 B;  2ZXE B;  5AW4 B;  4OH8 B;  3TSI A;  1IFD A;  5AW6 B;  5AVY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...