1GZLA

Crystal structure of c14linkmid/iqn17: a cross-linked inhibitor of hiv-1 entry bound to the gp41 hydrophobic pocket
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glycoprotein
molecule keywords FUSION PROTEIN BETWEEN THE HYDROPHOBIC POCKET OF HIV GP41 AN
publication title Short Constrained Peptides that Inhibit HIV-1 Entry
pubmed doi rcsb
total genus 20
structure length 45
sequence length 45
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gzlA00
3A3YB 5AW4B 2WT7B 1NWQA 2C9NY 2YNYA 1JNMA 2R3CA 5AW0B 5AW9B 4KHXA 3P7KA 3UIAA 1SLQA 1H8AA 3T97A 3SWFA 1HBWA 1MUUA 2N9BA 1GK6A 4JYBA 3A5TA 1JUNA 5APSA 4AQRD 1GTWA 1DH3A 3NTNA 2P7JA 3V4QA 1MFZA 3HTKA 1S9KE 2YO3A 1A02F 1G2CB 1KQLA 1YYCA 3VMZA 1HUCA 3VTPC 2Q5UA 2R32A 5AVSB 4B86A 4GKGA 3NXSA 2R5BA 3O8ZA 3HE5A 4HYTB 1FOSE 2XU6A 5AVTB 5AW1B 1T2KC 2VRSA 2ZXEB 5APWA 4C46A 4C7NA 1OXZA 1CI6B 3TK1A 1GK4A 2YO2A 1T2KD 3MGNA 3VYIA 3VMXA 1HJBA 2Q7CA 2XV5A 2R5DA 3NMDA 3MD0A 1CZQA 5CMZA 3HE4A 2WPRA 5AW3B 3M91A 3VMYA 2WTYA 2BASA 5AVWB 1A02J 2WPSA 3M9HA 2C9LY 1FOSF 1OWAA 2WPQA 5AW7B 4AUWA 3P8MC 1GU5A 1HWTC 1H89A 2QM7A 3HE5B 5AW8B 5AVRB 2QM8A 5AVVB 4XE5B 2KP8A 3NFQA 4LC1A 2P2UA 1H88A 3KDPB 3A7OA 3LIDA 3M06A 5AW5B 2Z5HA 5APUA 3LIEA 2E43A 3A2AA 3IR9A 3VN0A 3M0AA 1NAFA 1MV8A 2Z5IA 4GT1A 1J2JB 1GU4A 3TNUA 2E42A 1GD2E 1FAVA 3M9BA 2WT7A 3KQGA 3M0DA 3HE4B 1S9KD 3V4WA 1CI6A 4I6MC 5AVZB 2H7HA 3L37A 4DZOA 2JJLA 2Q3IA 3V5BA 1X8YA 5APQA 3OAKA 3I5CA 5APVA 2IPPA 3L35A 4I2LC 3TYYA 5APYA 4C7NB 4JYCA 4AYCA 4M3LA 5AVQB 2W6AA 5AVXB 5AVYB 2P67A 2W27A 5APXA 2XZRA 1GZLA 4RESB 1CSBA 5AVUB 2WWWA 2ZFCA 3P32A 5AW2B 3L36A 5APTA 4EOTA 1SP4A 5AW6B 3TNUB 3B8EB 1IO4A
chains in the Genus database with same CATH superfamily
5B66E 1YBKA 1L0LG 3Q3DA 1NTZK 1X9VA 1MZ9A 5KLIB 3VP9A 3L71D 1W5CE 1IFDA 1OW7A 3FXDA 1USEA 3VTPC 3MHVA 2N1TC 2WZ7A 1KILA 1PPJE 5CCGC 1KV4A 3JCUH 3D71A 2ITAA 1CI6B 3V2NA 2YXRB 3B5NB 2WSEH 3E1IA 5BU8B 2IDBA 3CXHH 3BRTB 5B66H 1NTMG 1HWTC 5AVRB 2Y0CA 3JC22 2O01N 1Q7YQ 2HODA 3HUSB 1JY3O 4D6TJ 5EFWB 3SFEC 3CC4P 1SQVE 1KFNA 1PGPA 3HUSC 5KJ7A 1L0NK 1X8YA 4NPFX 5APVA 2HFED 1PGQA 3TYYA 4I2LC 4O9BA 4JYCA 1N7SA 3VMAA 1HJ0A 2JKVA 1KTMA 2XZRA 1KB9D 1OX3A 2QA4P 3E7KA 1MFTA 2K9YA 4I7ZB 3WU2H 5GTIE 3IN6A 3AE5C 2V7QJ 1SFCC 2C9NY 3H1HG 3G3ZA 3H1IJ 1SLQA 5CHXA 5BU5A 3PLNA 4I7ZC 1ZR2A 2HG5D 3WMM0 2POHA 5GTHE 3CC2P 4IFFA 2B87A 1ZOYC 1JTHA 3OW2O 4WY4A 4N78E 1BSNA 1U57A 4Y99C 3Q2YA 2C0XA 1RF1A 1GK4A 1ZW0A 3VMXA 1HJBA 1GL2D 1BCCE 3RK3C 1OIPA 2R5DA 3H1JD 3TF5A 1SQXE 4PV1C 1GL2B 1URQA 4D6TD 5GTIH 4GIFA 1NTZJ 3D6ZA 3LW5J 1OWAA 1PP9E 3O6QB 3GW6A 1TU3F 2WITA 1IFJA 3Q5PA 5C39A 4RKUJ 2NPSB 4YPCA 1NAFA 2E74C 4OGQC 5GTHH 1L0LK 1G1IA 2E5YA 2K3RA 2Y9ZA 5KLVK 3L71G 2YMKA 1YTZT 4PD4E 2A45H 3CWBE 1PPJD 4IFMA 1YJWP 5M1BA 1G1JA 3G71P 3AEAC 1LTGC 2OYIA 1NWQA 3EFGA 1SVFA 1N7SC 1FJKA 2K88A 2K9JA 4LGDE 3CPWO 1KQGB 1DH3A 4Z1MH 1S9KE 3JSVC 1NTMK 1L0NJ 4H44B 2KS1B 1SQPE 2HPCB 2RMZA 1N73C 1VQLP 3GHGA 5AW1B 1PP9J 4ZNCA 5APWA 1SQVD 2ZYGA 1L4AC 3NMDA 1KC8Q 3EQ2A 4WY4C 3F5HA 1SQQE 3WUTA 1RF1C 2PAJA 1A02J 3AE7C 2FBWC 1VQ9P 3HE5B 3CCJP 2FYUG 2WQYC 1URQC 3C8VA 1VF5D 2Z5HA 2WPVB 3VN0A 1LWUA 1ZLLA 4ASVA 3AEBC 3HTKB 3M0DA 2WT7A 2CPBA 4DZOA 1KQSO 3V2PA 3AECC 3I5CA 4JF7A 5B5EH 4N78D 1UIIA 4UB8E 1R8EA 1PL5A 4HJGH 2GUVA 1BCCD 2Z4EA 3RL0D 3TNUB 1JOCA 1SQXD 3CMEP 3GLMA 3H1JG 2YIUC 4BWNA 2M0BA 1FDOA 1K05A 1PP9D 1YJNP 3CC7P 1U7MA 5KLVJ 3R2PA 1IJDB 3VMZA 1H0TB 1BE3G 5AVSB 1FU1A 1FOSE 1VQ8P 3RK2C 1J1EC 4PD4D 3H1KE 3CWBD 2BCCG 3H32B 4DOJA 1PPJG 4WWIA 2M3EA 1AVOA 2ZT9D 2XKMA 4U7JA 2IZ1A 1IFPA 1PIXA 3L75E 2ZT9B 2P10A 2E75C 4LC1A 5AW5B 5APUA 1Q82Q 4H0LD 3S1KA 3M0AA 1LJ2A 4H0LB 2Q9IA 4CPGA 3CCUP 1OVVA 1S9KD 2A06G 1LTSC 1HH0A 1CW5A 1BDDA 3A0BE 1SQPD 2IFMA 3M0DC 2FYNC 1G2CA 1LT9B 1SQVG 1M1JC 3A0HE 3L70E 3BCCG 3L73E 1SQQD 3BATA 4OWFA 3D6YA 4LLHA 3MZWB 1SQBE 3H1LG 3VOPA 2J5UA 3CD6P 4WVZA 4JYBA 3A5TA 4AQRD 1OW6A 1LNQA 5CCHD 4GOEA 1J1DB 2OTKE 1RQUA 4B86A 2FYUK 2FYZA 2XU6A 1YQ3C 2OYHC 3TK1A 3AEGC 4ZMDA 1LP1A 2Q7CA 2QJYB 3R4YA 5CMZA 4DCKA 5E79E 3RBZA 1LTTC 2A45G 5AVVB 2JO1A 1BCCG 2KP8A 2KB7P 1SQXG 3M06A 4H13D 2O1JA 3CX5I 4IL6X 1GW3A 4DT0A 4H13B 1X22A 3HE4B 1KFMA 3TSIA 1CI6A 3CCQP 3AE8C 3FXEA 5H2FH 1S1CX 1FZGA 3RK3E 3AE6C 2LKMA 1NJIQ 2ZAEB 3L74G 4JPZB 5AVXB 3MUDA 1GZLA 2SPZA 3H1KD 1ZN5A 1DIPA 1AVYA 2IZ0A 5TISE 3CWBG 1JNMA 2XNDH 4HKZH 1H8AA 2N9BA 3L75D 1MFZA 3PP5A 3I56P 1HUCA 4W7YA 2Q5UA 3L72J 4EDFA 1T2KC 2RH0A 1NTKK 2KLVA 2N1TD 2VRSA 1QVFO 3GG2A 2H8PD 2GM4A 3MGNA 3VYIA 1JO5A 1Q81Q 2N1TB 4PD4I 2WPRA 2WPSA 4EYYQ 1IO4A 2HLOA 1OZHA 5TJHA 2PRRA 3H1IE 4OVNF 3IFMA 1FZEA 3L70D 3B5ND 3L73D 1M90Q 1SQVK 1H88A 1SQQG 2E43A 1SQBD 1FAVA 2XDJA 1OVRA 4I6MC 2IBZE 2I8DA 1BGYE 3AEDC 5KTBA 1DEEG 1ZR4A 4JQ0D 5AVYB 2P67A 4BXLA 1NTZE 1L2PA 2QJKC 1NU1G 2YNYA 4KHXA 1AFOA 3MUDC 1SFCD 3T97A 1MUUA 1T8ZA 1AQ5A 3MP7B 3V4QA 1SFCB 3W68A 2WSEJ 2QE7H 3CL3D 1NKZB 2R44A 4PJ0E 2IFNA 3CX5E 2LXCB 4C46A 2AXTE 1IFIA 4C7RA 1IK7A 2FFDA 3S4RA 2YKOA 2KSJA 1VQPP 3LW5H 3RK3D 4Y99B 2L91A 3AE4C 5AVWB 3WUVA 4PV1D 1JCDA 2K1AA 3P8MC 3RK3B 1EZVD 2QJPC 4PV1B 1BGYJ 3H6PA 1FDMA 2Q3EA 3IR9A 1KQFB 1L0NE 1N8RQ 1KILC 1LTIC 3CCLP 1EQ7A 4ZKPA 1NTKJ 4OGQD 2H88C 2KK7A 4PJ0H 3CX5H 3L75G 4HB1A 1JMMA 1VQ5P 1QLED 3L37A 2E74B 4OGQB 2NPSD 2XNXA 3V6IA 2OTLP 2HODB 2WWWA 2AEFA 1JM0A 4EOTA 3G9RA 1RQVA 2KYVA 1ZRTE 3B4SA 1VQ7P 2AEJA 3G4SP 2JP3A 4YXWH 1DD3A 3H1ID 5APSA 2B88A 5KKZC 1IZNB 3HTKA 1N7SB 5KJ7C 3L70G 3L73G 4OH8B 4R4MA 1QL2A 3WUUA 2I1JA 2PFXA 1SQBG 5AVTB 3USSA 1VQ6P 3HD7A 2ZYAA 1QVGO 1S5LX 2IBZD 1BGYD 4H44D 1N73B 4GDOA 2O3JA 1K9MQ 1L4AD 2OTJP 1IK9A 2QSIA 2P1JA 2WPQA 1KYOE 1L4AB 1NTZD 2FFDC 2HYNA 4PD4H 1LTAC 4WY4B 4XE5B 2O01J 5KAIE 5KLVE 4I1LA 1RF1B 1LTJA 3LIDA 1H0TA 1LT1A 3A2AA 1FC2C 1NU1K 1URQB 5AVZB 5APQA 1GW4A 1AA0A 1PGOA 5KAFE 4U3FJ 3CX5D 1NYHA 4M3LA 3CCEP 3C9IA 3L74J 1JEKA 2WSFH 5K5GB 2W6BA 3P7KA 3TGUJ 1NTME 3PJSK 2KSEA 1NHLA 1UIXA 2YIUB 1YYCA 3HRNA 3GMAA 4GOFA 3G6EP 3ITKA 1L0ND 4K35A 3CCVP 1VF5C 2FY8A 1LT9A 3RK2D 2QG4A 4D6TG 2FXMA 1L0LJ 2JWDA 1Q2NA 2OYIC 3RK2B 3B71A 2KNCA 1J1EB 1FZCA 3HD7C 5AW3B 3TDKA 1YQ4C 1FOSF 1PV3A 1SS1A 2QM7A 3KYQA 1M1KQ 3FWLA 1EZVI 3KZIE 1ZRTD 1P84E 2W8ZA 4W7ZA 4UB8H 2HR3A 3RL0C 5CCHA 4GT1A 3GHGC 4NPDA 2MKVA 3M9BA 1N7LA 1NVOA 3H1IG 2E75B 2IX7C 2Q3IA 1FE6A 1E79H 2QVAA 1NTMJ 4AYCA 1DD4A 4KJMA 1SQBK 5AVUB 4EIJA 2G3AA 5CJ0A 2IBZG 2JEEA 3KHUA 4BRYB 1S72P 3A3YB 5AW4B 2WT7B 2FYNB 2AXCA 3KPEA 3CCRP 1ZV8A 2R3CA 1S4XA 1LWUC 2QRXA 1KYOD 1M1JB 1YI2P 2H89C 1YTZI 5KLVD 1XTCC 4GKGA 2W83C 1LGHB 3O8ZA 3MTUE 2Y0EA 1EDIA 1QEXA 3H1HJ 2D2CC 1QL1A 2IBZI 3BASA 4K3AA 2AEMA 2OYHB 2WTYA 1U7JA 1JY2P 1M7LA 3A0BH 1IC2A 2GUSA 1FZCC 2ZJSE 2MJZA 1XTGB 1NTMD 2KI7B 3L72E 2OGUA 3A0HH 2B89A 2YKQA 2WSCJ 2E76C 2N1TA 3AEFC 3SWKA 5APYA 1L0NG 3SWYA 4ASWA 2W27A 2QIWA 1PP9G 5DJTB 2M5AB 1Q90D 3L4FA 2WSSH 5AW9B 3L71J 2LXBA 3B5NA 1NGMB 1GTWA 2FYUE 1ZXGA 2FXOA 1KILE 1IFMA 1G2CB 1P84D 3CI9A 2R32A 1EZVE 2J58A 5E79H 2KZJA 1WT6A 1X79B 2YO2A 1T2KD 3HUSA 2GA1A 3AE2C 2M3BA 1QX8A 1LTBC 3MD0A 1PFIA 3S9OA 1RH5B 3PH0A 1EXIA 2BASA 4IOIH 2ZVNB 1D7MA 2BEQD 4AUWA 1VL2A 3JCUE 2QM8A 5CCGD 3MIWA 3NFQA 1SFCA 1GMJA 4N3YB 5CBNA 1LP1B 1MV8A 2Z5IA 1SQPG 1EDKA 3CXHE 1BE3E 1YJ9P 5TISH 1VPCA 2IYPA 1PGJA 1X0TA 1HGVA 5KLVG 2JJLA 3OAKA 1E5WA 4L76A 1EDLA 3L35A 1USDA 4C7NB 1FZFA 2W6AA 2FYUJ 5KLIC 1KD1Q 2BCCE 3P32A 3L36A 2N9YB 4YTPC 1PZQA 1T3UA 3GF7A 2P58A 3V2RA 1GK6A 3I55P 2QJKB 4KT0J 3BRVB 3AE3C 2PP6A 1KYOI 3NTNA 2P7JA 1GL2A 1NTKE 1KQLA 2B9BA 2V7QH 3WU2E 3O6QA 1Q86Q 4HYTB 3B5NC 2L5GB 3L72D 2WMMA 1JY3P 3BVHA 2A06E 1JY2N 2Y9YA 3H1JJ 2NPSA 1M8OB 3D70A 1FDIA 3U59A 4HH2A 1K04A 3N4XA 2RN0A 3M9HA 2CPSA 1SQXK 1BE3J 1GU5A 3PTZA 3BCCE 4DJGA 1R5LA 3KDPB 3H1LE 1KN7A 2Q6QA 1GU4A 2E42A 4WB4A 2FYUD 2QJPB 3KQGA 3CLQA 1KILD 2BCCJ 3FGAD 2NZ2A 2RKLA 1KILB 2UWJE 1BDCA 5CBOA 3H1KG 1NOHA 4JBZA 1YHQP 3AE1C 1N73A 2JDIH 5AVQB 2KS1A 2HPCA 2E5TA 4L74A 1S3JA 1L4AA 1SP4A 3Q1MA 2E74D 4RO0A 3U1CA 3RL0g 2AXTH 2BEZF 1JUNA 3C1LA 2KZIA 1FJPA 2W6JH 1A02F 3M9QA 2YMYA 1P84I 2R5BA 5KJ7D 3HE5A 3CXHD 4NPEA 1EC5A 5KKZB 1SQVJ 2FXPA 1GL2C 2ZXEB 1BE3D 3EFFK 4IL6E 4U3FE 1SQPK 3BCCJ 1N7SD 3T97B 3H1LJ 3RBXA 3E1RA 3L74E 3M91A 1VQOP 3ABVC 2NPSC 5AW7B 2BCCD 3TGUE 1H89A 2O01H 5AW8B 1HGZA 1SQQK 3EWKA 4TT3H 3A7OA 3LIEA 1R5SA 2FFDB 3TNUA 1GD2E 4WY4D 1NTKD 1OFCX 2B87B 1JTHB 4IL6H 4ZKUA 5BVZA 1DX7A 1VQ4P 1L0LE 2A06D 3L72G 2KUBA 1BCCJ 3FWNA 5APXA 4RESB 1URQD 1KMIZ 1SQXJ 3W67A 4TLFA 2JR8A 3B8EB 3SFDC 4QMAA 3P8CE 1JY3N 3UIAA 4H44C 3SWFA 1HBWA 5B5EE 4RJTA 3H32A 1QGKB 3BCCD 2DW3A 1NH4A 3FX0A 4YXDC 3H1LD 1Y47A 1Y8AA 1BSHA 1KYOH 1NAYA 1N2DC 4IFDK 1OXZA 4UB6E 5KAIH 3CWBJ 2XV5A 2IYOA 1EZVG 1W2BO 1CZQA 1VF5B 4BRYA 3VMYA 2C9LY 3CCMP 3HD7D 1T6AA 2WVRA 1RE4A 1M1JA 1WMKA 1NU1E 1VDFA 2OYIB 1RHZB 3HD7B 5KAFH 3H25A 2KOGA 2K9JB 2W90A 3CMAP 1HTLC 1DEBA 1KB9I 1FZBA 3QH9A 4XA4A 1SQPJ 3PHLA 1FBMA 2WSFJ 3RL0B 1RE3A 4UB6H 3GHGB 3H1HE 2IPPA 2ZXXA 2OYHA 1LTJB 4U3FD 2E75D 2OYOA 4Y28J 3RGUA 1FS0E 2YKPA 1SQQJ 5AW6B 1EDJA 1K73Q 1OMIA 1Y9BA 1LTJC 3L74D 5AW0B 5L8RJ 1Z56A 3TGUD 3VP8A 3OJAB 2YO3A 2YXQB 1HF9A 1LWUB 3NXSA 1BGYG 3AEEC 1IFNA 1YITP 3CXHI 3KZIH 1VQKP 1HVVA 1P84H 1NU1J 1NTKG 2H43A 1NTZG 1L0LD 2M5AA 2ZT9C 2D2CD 3HE4A 1MKMA 3QWOC 2I1KA 1RF0A 2D2CB 2CK3H 1OW8A 1ZMEC 3L71E 4H0LC 2LR2A 4EI2A 2G8YA 2C0WA 4L73A 3P8CD 1OVUA 4R4LA 5CJ4A 1RE4C 1W2EA 3PRJA 1J2JB 2KNCB 1FZCB 2J59M 1LT9C 2WSCH 3V4WA 1VQMP 3N7NA 4XFJA 3F89A 3V5BA 1T3JA 1AQTA 2E76D 1JY2O 3H1KJ 1N86A 2E76B 1RE3C 1WRGA 4WBAA 1EXJA 5AW2B 3IF4A 3Q5RA 3Q5SA 3U1AA 1S5LE 1J1DC 2M8RA 5H2FE 1NKNA 2PGDA 1RY3A 5CCHC 3L75J 5CCGA 3IAOA 3SSUA 1NU1D 1KORA 3II6A 2O1KA 2ZYDA 1GDTA 2Y0DA 4A7PA 2QJYC 1JB0J 1KZUB 1YIJP 2FKWB 4C7NA 4GODA 1FZAA 1KB9E 1ZP0C 2OARA 2V4HA 3H1HD 2KLUA 1S5LH 2QEXP 4U3FG 2JWAA 3L70J 2NRGA 3L73J 4H13C 1NO4A 5DJUB 2P2UA 1SQBJ 2Q1KA 1M57D 3ZDMA 1JCCA 1RF0C 2A45I 2ZVOB 1JMBA 3TGUG 4L75A 3K5BA 3KXDA 2OQQA 2H7HA 4MN4C 1AJYA 3OA7A 1M56D 3H1JE 1K8AQ 1KB9H 2KXPB 3V2QA 2K37A 4N6JA 4W80A 4D6TE 1S2EA 3AE9C 1AV1A 1CSBA 2ZFCA 3CCSP 1VQNP 5APTA 2R3SA 3GF3A 2KIKA
chains in the Genus database with same CATH topology
2W6BA 3U1CA 3BATA 4LLHA 3P7KA 1NTZK 1X9VA 1MZ9A 3VOPA 3VP9A 4JYBA 3A5TA 1JUNA 4AQRD 1IFDA 5CCHD 1FJPA 1J1DB 1NHLA 1A02F 1YYCA 3M9QA 2YMYA 3VTPC 3HRNA 4B86A 2N1TC 2FYUK 2WZ7A 2R5BA 5KJ7D 3HE5A 1KILA 2FYZA 2XU6A 5CCGC 1GL2C 2ZXEB 2OYHC 3TK1A 1CI6B 1LT9A 1SQPK 3RK2D 2FXMA 3V2NA 1N7SD 2Q7CA 3B5NB 2WSEH 3E1IA 2OYIC 3RK2B 5BU8B 1J1EB 5CMZA 1FZCA 3HD7C 5AW3B 3BRTB 3M91A 2NPSC 1FOSF 5AW7B 1LTTC 2A45G 1HWTC 1H89A 2QM7A 2O01H 5AW8B 3KYQA 1HGZA 1SQQK 5AVVB 5AVRB 2KP8A 2KB7P 3A7OA 3M06A 4W7ZA 2O1JA 3LIEA 3RL0C 2HODA 3HUSB 1JY3O 1GW3A 5CCHA 4GT1A 3GHGC 2FFDB 3TNUA 1GD2E 3M9BA 1N7LA 3HE4B 2IX7C 4WY4D 1KFMA 1KFNA 3TSIA 1CI6A 3HUSC 5KJ7A 1L0NK 1JTHB 2Q3IA 1X8YA 4ZKUA 5BVZA 1DX7A 1FZGA 5APVA 2HFED 3TYYA 4I2LC 4O9BA 4JYCA 4AYCA 2LKMA 1N7SA 5AVXB 1SQBK 3MUDA 5APXA 2XZRA 1GZLA 1URQD 4RESB 5AVUB 4EIJA 5CJ0A 2JEEA 3B8EB 1ZN5A 3A3YB 5AW4B 2WT7B 1SFCC 2C9NY 3KPEA 1JNMA 1ZV8A 2R3CA 3G3ZA 3P8CE 1JY3N 1LWUC 3UIAA 1SLQA 5CHXA 1H8AA 5BU5A 3SWFA 1HBWA 2N9BA 1M1JB 3H32A 1ZR2A 1NH4A 1MFZA 2HG5D 3WMM0 2POHA 1YTZI 3PP5A 1XTCC 1HUCA 4W7YA 2Q5UA 4IFFA 4GKGA 1JTHA 1LGHB 3O8ZA 4WY4A 4N78E 1T2KC 1N2DC 1NTKK 2KLVA 2N1TD 2VRSA 4IFDK 4Y99C 1RF1A 2C0XA 1OXZA 2H8PD 1GK4A 3MTUE 2GM4A 3MGNA 3VYIA 3VMXA 1HJBA 1JO5A 1GL2D 2N1TB 2XV5A 3RK3C 1QL1A 2R5DA 3BASA 1CZQA 1GL2B 2WPRA 2OYHB 3VMYA 2WTYA 1URQA 4GIFA 2WPSA 2C9LY 1OWAA 2HLOA 3HD7D 1RE4A 1JY2P 1M7LA 1FZEA 3IFMA 1IC2A 1M1JA 2OYIB 1VDFA 2WITA 1IFJA 2GUSA 3B5ND 3HD7B 1FZCC 1SQVK 1H88A 2KOGA 2NPSB 2E43A 2MJZA 1XTGB 1NAFA 1L0LK 1G1IA 1HTLC 1FAVA 5KLVK 1DEBA 1FZBA 4XA4A 1FBMA 1YTZT 2XDJA 4I6MC 3RL0B 2YKQA 5KTBA 2A45H 1RE3A 2N1TA 3GHGB 2IPPA 1ZR4A 4IFMA 5APYA 3SWYA 2OYHA 1LTJB 5AVYB 2P67A 2W27A 1G1JA 1LTGC 2YKPA 5AW6B 2OYIA 1NWQA 2YNYA 3EFGA 1LTJC 1SVFA 5AW0B 1N7SC 3L4FA 1FJKA 5AW9B 4KHXA 1AFOA 1SFCD 3T97A 1Z56A 1MUUA 4LGDE 3B5NA 1T8ZA 3VP8A 1AQ5A 1GTWA 1DH3A 3V4QA 1SFCB 3OJAB 2YO3A 1S9KE 1IFMA 1G2CB 3CI9A 1NTMK 1LWUB 2R32A 3CL3D 1NKZB 2J58A 2HPCB 3NXSA 1N73C 1WT6A 3GHGA 5AW1B 2IFNA 1IFNA 5APWA 4C46A 1X79B 2YO2A 1T2KD 1HVVA 3HUSA 1IFIA 2M3BA 4C7RA 1L4AC 2H43A 2FFDA 3NMDA 2YKOA 1LTBC 3EQ2A 4WY4C 2KSJA 3MD0A 3LW5H 3HE4A 3RK3D 1PFIA 4Y99B 2BASA 1RF1C 2PAJA 5AVWB 1A02J 2I1KA 1JCDA 4AUWA 1RF0A 3P8MC 3RK3B 3HE5B 2QM8A 5CCGD 3MIWA 3NFQA 3H6PA 2C0WA 1SFCA 1FDMA 1URQC 2Z5HA 4N3YB 3P8CD 5CJ4A 3IR9A 1LWUA 3VN0A 1RE4C 1MV8A 1W2EA 2Z5IA 1KILC 1LTIC 1J2JB 1EQ7A 1ZLLA 4ZKPA 3HTKB 3M0DA 2WT7A 1FZCB 2J59M 2CPBA 1LT9C 2WSCH 3V4WA 3N7NA 1VPCA 1JMMA 1HGVA 3L37A 4DZOA 2JJLA 3V5BA 1T3JA 2NPSD 3V2PA 3OAKA 1E5WA 3I5CA 4JF7A 2XNXA 3L35A 4N78D 4C7NB 1FZFA 2W6AA 1JY2O 2GUVA 1N86A 2HODB 2WWWA 1RE3C 1WRGA 3P32A 4WBAA 5AW2B 3L36A 3RL0D 4EOTA 2Z4EA 3TNUB 1JOCA 2KYVA 3U1AA 1J1DC 2M8RA 1T3UA 1NKNA 1RY3A 5CCHC 3V2RA 1GK6A 3BRVB 5CCGA 5APSA 2PP6A 3R2PA 3NTNA 2P7JA 1GL2A 1IJDB 3HTKA 1KQLA 3VMZA 1N7SB 5KJ7C 3II6A 2O1KA 4OH8B 5AVSB 1GDTA 1QL2A 1FU1A 2I1JA 4HYTB 3B5NC 1FOSE 5AVTB 2L5GB 3RK2C 1JY3P 1J1EC 3BVHA 3HD7A 1KZUB 2FKWB 1JY2N 4C7NA 2NPSA 1FZAA 2OARA 3U59A 1N73B 3H32B 4DOJA 4HH2A 1L4AD 1IK9A 3N4XA 3M9HA 2P1JA 2WPQA 2CPSA 1L4AB 1SQXK 1GU5A 2XKMA 2FFDC 2HYNA 1LTAC 4WY4B 1NO4A 4XE5B 4I1LA 2P2UA 4LC1A 1RF1B 3KDPB 1LTJA 3LIDA 5AW5B 5APUA 3A2AA 3M0AA 1JCCA 1RF0C 1NU1K 2A45I 1GU4A 2E42A 4WB4A 3KQGA 2Q9IA 3CLQA 1KILD 1S9KD 1URQB 1LTSC 1HH0A 1CW5A 5AVZB 2H7HA 3OA7A 5APQA 1KILB 1GW4A 1NOHA 2IFMA 1N73A 3V2QA 3M0DC 4N6JA 4W80A 4M3LA 1G2CA 5AVQB 1LT9B 3C9IA 1CSBA 2HPCA 2ZFCA 1M1JC 5APTA 1L4AA 1SP4A 2WSFH 1IO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A3Y B;  5AW4 B;  2WT7 B;  1NWQ A;  2C9N Y;  2YNY A;  1JNM A;  2R3C A;  5AW0 B;  5AW9 B;  4KHX A;  3P7K A;  3UIA A;  1SLQ A;  1H8A A;  3T97 A;  3SWF A;  1HBW A;  1MUU A;  2N9B A;  1GK6 A;  4JYB A;  3A5T A;  1JUN A;  5APS A;  4AQR D;  1GTW A;  1DH3 A;  3NTN A;  2P7J A;  3V4Q A;  1MFZ A;  3HTK A;  1S9K E;  2YO3 A;  1A02 F;  1G2C B;  1KQL A;  1YYC A;  3VMZ A;  1HUC A;  3VTP C;  2Q5U A;  2R32 A;  5AVS B;  4B86 A;  4GKG A;  3NXS A;  2R5B A;  3O8Z A;  3HE5 A;  4HYT B;  1FOS E;  2XU6 A;  5AVT B;  5AW1 B;  1T2K C;  2VRS A;  2ZXE B;  5APW A;  4C46 A;  4C7N A;  1OXZ A;  1CI6 B;  3TK1 A;  1GK4 A;  2YO2 A;  1T2K D;  3MGN A;  3VYI A;  3VMX A;  1HJB A;  2Q7C A;  2XV5 A;  2R5D A;  3NMD A;  3MD0 A;  1CZQ A;  5CMZ A;  3HE4 A;  2WPR A;  5AW3 B;  3M91 A;  3VMY A;  2WTY A;  2BAS A;  5AVW B;  1A02 J;  2WPS A;  3M9H A;  2C9L Y;  1FOS F;  1OWA A;  2WPQ A;  5AW7 B;  4AUW A;  3P8M C;  1GU5 A;  1HWT C;  1H89 A;  2QM7 A;  3HE5 B;  5AW8 B;  5AVR B;  2QM8 A;  5AVV B;  4XE5 B;  2KP8 A;  3NFQ A;  4LC1 A;  2P2U A;  1H88 A;  3KDP B;  3A7O A;  3LID A;  3M06 A;  5AW5 B;  2Z5H A;  5APU A;  3LIE A;  2E43 A;  3A2A A;  3IR9 A;  3VN0 A;  3M0A A;  1NAF A;  1MV8 A;  2Z5I A;  4GT1 A;  1J2J B;  1GU4 A;  3TNU A;  2E42 A;  1GD2 E;  1FAV A;  3M9B A;  2WT7 A;  3KQG A;  3M0D A;  3HE4 B;  1S9K D;  3V4W A;  1CI6 A;  4I6M C;  5AVZ B;  2H7H A;  3L37 A;  4DZO A;  2JJL A;  2Q3I A;  3V5B A;  1X8Y A;  5APQ A;  3OAK A;  3I5C A;  5APV A;  2IPP A;  3L35 A;  4I2L C;  3TYY A;  5APY A;  4C7N B;  4JYC A;  4AYC A;  4M3L A;  5AVQ B;  2W6A A;  5AVX B;  5AVY B;  2P67 A;  2W27 A;  5APX A;  2XZR A;  1GZL A;  4RES B;  1CSB A;  5AVU B;  2WWW A;  2ZFC A;  3P32 A;  5AW2 B;  3L36 A;  5APT A;  4EOT A;  1SP4 A;  5AW6 B;  3TNU B;  3B8E B;  1IO4 A; 
#chains in the Genus database with same CATH topology
 5B66 E;  1YBK A;  1L0L G;  3Q3D A;  1NTZ K;  1X9V A;  1MZ9 A;  5KLI B;  3VP9 A;  3L71 D;  1W5C E;  1IFD A;  1OW7 A;  3FXD A;  1USE A;  3VTP C;  3MHV A;  2N1T C;  2WZ7 A;  1KIL A;  1PPJ E;  5CCG C;  1KV4 A;  3JCU H;  3D71 A;  2ITA A;  1CI6 B;  3V2N A;  2YXR B;  3B5N B;  2WSE H;  3E1I A;  5BU8 B;  2IDB A;  3CXH H;  3BRT B;  5B66 H;  1NTM G;  1HWT C;  5AVR B;  2Y0C A;  3JC2 2;  2O01 N;  1Q7Y Q;  2HOD A;  3HUS B;  1JY3 O;  4D6T J;  5EFW B;  3SFE C;  3CC4 P;  1SQV E;  1KFN A;  1PGP A;  3HUS C;  5KJ7 A;  1L0N K;  1X8Y A;  4NPF X;  5APV A;  2HFE D;  1PGQ A;  3TYY A;  4I2L C;  4O9B A;  4JYC A;  1N7S A;  3VMA A;  1HJ0 A;  2JKV A;  1KTM A;  2XZR A;  1KB9 D;  1OX3 A;  2QA4 P;  3E7K A;  1MFT A;  2K9Y A;  4I7Z B;  3WU2 H;  5GTI E;  3IN6 A;  3AE5 C;  2V7Q J;  1SFC C;  2C9N Y;  3H1H G;  3G3Z A;  3H1I J;  1SLQ A;  5CHX A;  5BU5 A;  3PLN A;  4I7Z C;  1ZR2 A;  2HG5 D;  3WMM 0;  2POH A;  5GTH E;  3CC2 P;  4IFF A;  2B87 A;  1ZOY C;  1JTH A;  3OW2 O;  4WY4 A;  4N78 E;  1BSN A;  1U57 A;  4Y99 C;  3Q2Y A;  2C0X A;  1RF1 A;  1GK4 A;  1ZW0 A;  3VMX A;  1HJB A;  1GL2 D;  1BCC E;  3RK3 C;  1OIP A;  2R5D A;  3H1J D;  3TF5 A;  1SQX E;  4PV1 C;  1GL2 B;  1URQ A;  4D6T D;  5GTI H;  4GIF A;  1NTZ J;  3D6Z A;  3LW5 J;  1OWA A;  1PP9 E;  3O6Q B;  3GW6 A;  1TU3 F;  2WIT A;  1IFJ A;  3Q5P A;  5C39 A;  4RKU J;  2NPS B;  4YPC A;  1NAF A;  2E74 C;  4OGQ C;  5GTH H;  1L0L K;  1G1I A;  2E5Y A;  2K3R A;  2Y9Z A;  5KLV K;  3L71 G;  2YMK A;  1YTZ T;  4PD4 E;  2A45 H;  3CWB E;  1PPJ D;  4IFM A;  1YJW P;  5M1B A;  1G1J A;  3G71 P;  3AEA C;  1LTG C;  2OYI A;  1NWQ A;  3EFG A;  1SVF A;  1N7S C;  1FJK A;  2K88 A;  2K9J A;  4LGD E;  3CPW O;  1KQG B;  1DH3 A;  4Z1M H;  1S9K E;  3JSV C;  1NTM K;  1L0N J;  4H44 B;  2KS1 B;  1SQP E;  2HPC B;  2RMZ A;  1N73 C;  1VQL P;  3GHG A;  5AW1 B;  1PP9 J;  4ZNC A;  5APW A;  1SQV D;  2ZYG A;  1L4A C;  3NMD A;  1KC8 Q;  3EQ2 A;  4WY4 C;  3F5H A;  1SQQ E;  3WUT A;  1RF1 C;  2PAJ A;  1A02 J;  3AE7 C;  2FBW C;  1VQ9 P;  3HE5 B;  3CCJ P;  2FYU G;  2WQY C;  1URQ C;  3C8V A;  1VF5 D;  2Z5H A;  2WPV B;  3VN0 A;  1LWU A;  1ZLL A;  4ASV A;  3AEB C;  3HTK B;  3M0D A;  2WT7 A;  2CPB A;  4DZO A;  1KQS O;  3V2P A;  3AEC C;  3I5C A;  4JF7 A;  5B5E H;  4N78 D;  1UII A;  4UB8 E;  1R8E A;  1PL5 A;  4HJG H;  2GUV A;  1BCC D;  2Z4E A;  3RL0 D;  3TNU B;  1JOC A;  1SQX D;  3CME P;  3GLM A;  3H1J G;  2YIU C;  4BWN A;  2M0B A;  1FDO A;  1K05 A;  1PP9 D;  1YJN P;  3CC7 P;  1U7M A;  5KLV J;  3R2P A;  1IJD B;  3VMZ A;  1H0T B;  1BE3 G;  5AVS B;  1FU1 A;  1FOS E;  1VQ8 P;  3RK2 C;  1J1E C;  4PD4 D;  3H1K E;  3CWB D;  2BCC G;  3H32 B;  4DOJ A;  1PPJ G;  4WWI A;  2M3E A;  1AVO A;  2ZT9 D;  2XKM A;  4U7J A;  2IZ1 A;  1IFP A;  1PIX A;  3L75 E;  2ZT9 B;  2P10 A;  2E75 C;  4LC1 A;  5AW5 B;  5APU A;  1Q82 Q;  4H0L D;  3S1K A;  3M0A A;  1LJ2 A;  4H0L B;  2Q9I A;  4CPG A;  3CCU P;  1OVV A;  1S9K D;  2A06 G;  1LTS C;  1HH0 A;  1CW5 A;  1BDD A;  3A0B E;  1SQP D;  2IFM A;  3M0D C;  2FYN C;  1G2C A;  1LT9 B;  1SQV G;  1M1J C;  3A0H E;  3L70 E;  3BCC G;  3L73 E;  1SQQ D;  3BAT A;  4OWF A;  3D6Y A;  4LLH A;  3MZW B;  1SQB E;  3H1L G;  3VOP A;  2J5U A;  3CD6 P;  4WVZ A;  4JYB A;  3A5T A;  4AQR D;  1OW6 A;  1LNQ A;  5CCH D;  4GOE A;  1J1D B;  2OTK E;  1RQU A;  4B86 A;  2FYU K;  2FYZ A;  2XU6 A;  1YQ3 C;  2OYH C;  3TK1 A;  3AEG C;  4ZMD A;  1LP1 A;  2Q7C A;  2QJY B;  3R4Y A;  5CMZ A;  4DCK A;  5E79 E;  3RBZ A;  1LTT C;  2A45 G;  5AVV B;  2JO1 A;  1BCC G;  2KP8 A;  2KB7 P;  1SQX G;  3M06 A;  4H13 D;  2O1J A;  3CX5 I;  4IL6 X;  1GW3 A;  4DT0 A;  4H13 B;  1X22 A;  3HE4 B;  1KFM A;  3TSI A;  1CI6 A;  3CCQ P;  3AE8 C;  3FXE A;  5H2F H;  1S1C X;  1FZG A;  3RK3 E;  3AE6 C;  2LKM A;  1NJI Q;  2ZAE B;  3L74 G;  4JPZ B;  5AVX B;  3MUD A;  1GZL A;  2SPZ A;  3H1K D;  1ZN5 A;  1DIP A;  1AVY A;  2IZ0 A;  5TIS E;  3CWB G;  1JNM A;  2XND H;  4HKZ H;  1H8A A;  2N9B A;  3L75 D;  1MFZ A;  3PP5 A;  3I56 P;  1HUC A;  4W7Y A;  2Q5U A;  3L72 J;  4EDF A;  1T2K C;  2RH0 A;  1NTK K;  2KLV A;  2N1T D;  2VRS A;  1QVF O;  3GG2 A;  2H8P D;  2GM4 A;  3MGN A;  3VYI A;  1JO5 A;  1Q81 Q;  2N1T B;  4PD4 I;  2WPR A;  2WPS A;  4EYY Q;  1IO4 A;  2HLO A;  1OZH A;  5TJH A;  2PRR A;  3H1I E;  4OVN F;  3IFM A;  1FZE A;  3L70 D;  3B5N D;  3L73 D;  1M90 Q;  1SQV K;  1H88 A;  1SQQ G;  2E43 A;  1SQB D;  1FAV A;  2XDJ A;  1OVR A;  4I6M C;  2IBZ E;  2I8D A;  1BGY E;  3AED C;  5KTB A;  1DEE G;  1ZR4 A;  4JQ0 D;  5AVY B;  2P67 A;  4BXL A;  1NTZ E;  1L2P A;  2QJK C;  1NU1 G;  2YNY A;  4KHX A;  1AFO A;  3MUD C;  1SFC D;  3T97 A;  1MUU A;  1T8Z A;  1AQ5 A;  3MP7 B;  3V4Q A;  1SFC B;  3W68 A;  2WSE J;  2QE7 H;  3CL3 D;  1NKZ B;  2R44 A;  4PJ0 E;  2IFN A;  3CX5 E;  2LXC B;  4C46 A;  2AXT E;  1IFI A;  4C7R A;  1IK7 A;  2FFD A;  3S4R A;  2YKO A;  2KSJ A;  1VQP P;  3LW5 H;  3RK3 D;  4Y99 B;  2L91 A;  3AE4 C;  5AVW B;  3WUV A;  4PV1 D;  1JCD A;  2K1A A;  3P8M C;  3RK3 B;  1EZV D;  2QJP C;  4PV1 B;  1BGY J;  3H6P A;  1FDM A;  2Q3E A;  3IR9 A;  1KQF B;  1L0N E;  1N8R Q;  1KIL C;  1LTI C;  3CCL P;  1EQ7 A;  4ZKP A;  1NTK J;  4OGQ D;  2H88 C;  2KK7 A;  4PJ0 H;  3CX5 H;  3L75 G;  4HB1 A;  1JMM A;  1VQ5 P;  1QLE D;  3L37 A;  2E74 B;  4OGQ B;  2NPS D;  2XNX A;  3V6I A;  2OTL P;  2HOD B;  2WWW A;  2AEF A;  1JM0 A;  4EOT A;  3G9R A;  1RQV A;  2KYV A;  1ZRT E;  3B4S A;  1VQ7 P;  2AEJ A;  3G4S P;  2JP3 A;  4YXW H;  1DD3 A;  3H1I D;  5APS A;  2B88 A;  5KKZ C;  1IZN B;  3HTK A;  1N7S B;  5KJ7 C;  3L70 G;  3L73 G;  4OH8 B;  4R4M A;  1QL2 A;  3WUU A;  2I1J A;  2PFX A;  1SQB G;  5AVT B;  3USS A;  1VQ6 P;  3HD7 A;  2ZYA A;  1QVG O;  1S5L X;  2IBZ D;  1BGY D;  4H44 D;  1N73 B;  4GDO A;  2O3J A;  1K9M Q;  1L4A D;  2OTJ P;  1IK9 A;  2QSI A;  2P1J A;  2WPQ A;  1KYO E;  1L4A B;  1NTZ D;  2FFD C;  2HYN A;  4PD4 H;  1LTA C;  4WY4 B;  4XE5 B;  2O01 J;  5KAI E;  5KLV E;  4I1L A;  1RF1 B;  1LTJ A;  3LID A;  1H0T A;  1LT1 A;  3A2A A;  1FC2 C;  1NU1 K;  1URQ B;  5AVZ B;  5APQ A;  1GW4 A;  1AA0 A;  1PGO A;  5KAF E;  4U3F J;  3CX5 D;  1NYH A;  4M3L A;  3CCE P;  3C9I A;  3L74 J;  1JEK A;  2WSF H;  5K5G B;  2W6B A;  3P7K A;  3TGU J;  1NTM E;  3PJS K;  2KSE A;  1NHL A;  1UIX A;  2YIU B;  1YYC A;  3HRN A;  3GMA A;  4GOF A;  3G6E P;  3ITK A;  1L0N D;  4K35 A;  3CCV P;  1VF5 C;  2FY8 A;  1LT9 A;  3RK2 D;  2QG4 A;  4D6T G;  2FXM A;  1L0L J;  2JWD A;  1Q2N A;  2OYI C;  3RK2 B;  3B71 A;  2KNC A;  1J1E B;  1FZC A;  3HD7 C;  5AW3 B;  3TDK A;  1YQ4 C;  1FOS F;  1PV3 A;  1SS1 A;  2QM7 A;  3KYQ A;  1M1K Q;  3FWL A;  1EZV I;  3KZI E;  1ZRT D;  1P84 E;  2W8Z A;  4W7Z A;  4UB8 H;  2HR3 A;  3RL0 C;  5CCH A;  4GT1 A;  3GHG C;  4NPD A;  2MKV A;  3M9B A;  1N7L A;  1NVO A;  3H1I G;  2E75 B;  2IX7 C;  2Q3I A;  1FE6 A;  1E79 H;  2QVA A;  1NTM J;  4AYC A;  1DD4 A;  4KJM A;  1SQB K;  5AVU B;  4EIJ A;  2G3A A;  5CJ0 A;  2IBZ G;  2JEE A;  3KHU A;  4BRY B;  1S72 P;  3A3Y B;  5AW4 B;  2WT7 B;  2FYN B;  2AXC A;  3KPE A;  3CCR P;  1ZV8 A;  2R3C A;  1S4X A;  1LWU C;  2QRX A;  1KYO D;  1M1J B;  1YI2 P;  2H89 C;  1YTZ I;  5KLV D;  1XTC C;  4GKG A;  2W83 C;  1LGH B;  3O8Z A;  3MTU E;  2Y0E A;  1EDI A;  1QEX A;  3H1H J;  2D2C C;  1QL1 A;  2IBZ I;  3BAS A;  4K3A A;  2AEM A;  2OYH B;  2WTY A;  1U7J A;  1JY2 P;  1M7L A;  3A0B H;  1IC2 A;  2GUS A;  1FZC C;  2ZJS E;  2MJZ A;  1XTG B;  1NTM D;  2KI7 B;  3L72 E;  2OGU A;  3A0H H;  2B89 A;  2YKQ A;  2WSC J;  2E76 C;  2N1T A;  3AEF C;  3SWK A;  5APY A;  1L0N G;  3SWY A;  4ASW A;  2W27 A;  2QIW A;  1PP9 G;  5DJT B;  2M5A B;  1Q90 D;  3L4F A;  2WSS H;  5AW9 B;  3L71 J;  2LXB A;  3B5N A;  1NGM B;  1GTW A;  2FYU E;  1ZXG A;  2FXO A;  1KIL E;  1IFM A;  1G2C B;  1P84 D;  3CI9 A;  2R32 A;  1EZV E;  2J58 A;  5E79 H;  2KZJ A;  1WT6 A;  1X79 B;  2YO2 A;  1T2K D;  3HUS A;  2GA1 A;  3AE2 C;  2M3B A;  1QX8 A;  1LTB C;  3MD0 A;  1PFI A;  3S9O A;  1RH5 B;  3PH0 A;  1EXI A;  2BAS A;  4IOI H;  2ZVN B;  1D7M A;  2BEQ D;  4AUW A;  1VL2 A;  3JCU E;  2QM8 A;  5CCG D;  3MIW A;  3NFQ A;  1SFC A;  1GMJ A;  4N3Y B;  5CBN A;  1LP1 B;  1MV8 A;  2Z5I A;  1SQP G;  1EDK A;  3CXH E;  1BE3 E;  1YJ9 P;  5TIS H;  1VPC A;  2IYP A;  1PGJ A;  1X0T A;  1HGV A;  5KLV G;  2JJL A;  3OAK A;  1E5W A;  4L76 A;  1EDL A;  3L35 A;  1USD A;  4C7N B;  1FZF A;  2W6A A;  2FYU J;  5KLI C;  1KD1 Q;  2BCC E;  3P32 A;  3L36 A;  2N9Y B;  4YTP C;  1PZQ A;  1T3U A;  3GF7 A;  2P58 A;  3V2R A;  1GK6 A;  3I55 P;  2QJK B;  4KT0 J;  3BRV B;  3AE3 C;  2PP6 A;  1KYO I;  3NTN A;  2P7J A;  1GL2 A;  1NTK E;  1KQL A;  2B9B A;  2V7Q H;  3WU2 E;  3O6Q A;  1Q86 Q;  4HYT B;  3B5N C;  2L5G B;  3L72 D;  2WMM A;  1JY3 P;  3BVH A;  2A06 E;  1JY2 N;  2Y9Y A;  3H1J J;  2NPS A;  1M8O B;  3D70 A;  1FDI A;  3U59 A;  4HH2 A;  1K04 A;  3N4X A;  2RN0 A;  3M9H A;  2CPS A;  1SQX K;  1BE3 J;  1GU5 A;  3PTZ A;  3BCC E;  4DJG A;  1R5L A;  3KDP B;  3H1L E;  1KN7 A;  2Q6Q A;  1GU4 A;  2E42 A;  4WB4 A;  2FYU D;  2QJP B;  3KQG A;  3CLQ A;  1KIL D;  2BCC J;  3FGA D;  2NZ2 A;  2RKL A;  1KIL B;  2UWJ E;  1BDC A;  5CBO A;  3H1K G;  1NOH A;  4JBZ A;  1YHQ P;  3AE1 C;  1N73 A;  2JDI H;  5AVQ B;  2KS1 A;  2HPC A;  2E5T A;  4L74 A;  1S3J A;  1L4A A;  1SP4 A;  3Q1M A;  2E74 D;  4RO0 A;  3U1C A;  3RL0 g;  2AXT H;  2BEZ F;  1JUN A;  3C1L A;  2KZI A;  1FJP A;  2W6J H;  1A02 F;  3M9Q A;  2YMY A;  1P84 I;  2R5B A;  5KJ7 D;  3HE5 A;  3CXH D;  4NPE A;  1EC5 A;  5KKZ B;  1SQV J;  2FXP A;  1GL2 C;  2ZXE B;  1BE3 D;  3EFF K;  4IL6 E;  4U3F E;  1SQP K;  3BCC J;  1N7S D;  3T97 B;  3H1L J;  3RBX A;  3E1R A;  3L74 E;  3M91 A;  1VQO P;  3ABV C;  2NPS C;  5AW7 B;  2BCC D;  3TGU E;  1H89 A;  2O01 H;  5AW8 B;  1HGZ A;  1SQQ K;  3EWK A;  4TT3 H;  3A7O A;  3LIE A;  1R5S A;  2FFD B;  3TNU A;  1GD2 E;  4WY4 D;  1NTK D;  1OFC X;  2B87 B;  1JTH B;  4IL6 H;  4ZKU A;  5BVZ A;  1DX7 A;  1VQ4 P;  1L0L E;  2A06 D;  3L72 G;  2KUB A;  1BCC J;  3FWN A;  5APX A;  4RES B;  1URQ D;  1KMI Z;  1SQX J;  3W67 A;  4TLF A;  2JR8 A;  3B8E B;  3SFD C;  4QMA A;  3P8C E;  1JY3 N;  3UIA A;  4H44 C;  3SWF A;  1HBW A;  5B5E E;  4RJT A;  3H32 A;  1QGK B;  3BCC D;  2DW3 A;  1NH4 A;  3FX0 A;  4YXD C;  3H1L D;  1Y47 A;  1Y8A A;  1BSH A;  1KYO H;  1NAY A;  1N2D C;  4IFD K;  1OXZ A;  4UB6 E;  5KAI H;  3CWB J;  2XV5 A;  2IYO A;  1EZV G;  1W2B O;  1CZQ A;  1VF5 B;  4BRY A;  3VMY A;  2C9L Y;  3CCM P;  3HD7 D;  1T6A A;  2WVR A;  1RE4 A;  1M1J A;  1WMK A;  1NU1 E;  1VDF A;  2OYI B;  1RHZ B;  3HD7 B;  5KAF H;  3H25 A;  2KOG A;  2K9J B;  2W90 A;  3CMA P;  1HTL C;  1DEB A;  1KB9 I;  1FZB A;  3QH9 A;  4XA4 A;  1SQP J;  3PHL A;  1FBM A;  2WSF J;  3RL0 B;  1RE3 A;  4UB6 H;  3GHG B;  3H1H E;  2IPP A;  2ZXX A;  2OYH A;  1LTJ B;  4U3F D;  2E75 D;  2OYO A;  4Y28 J;  3RGU A;  1FS0 E;  2YKP A;  1SQQ J;  5AW6 B;  1EDJ A;  1K73 Q;  1OMI A;  1Y9B A;  1LTJ C;  3L74 D;  5AW0 B;  5L8R J;  1Z56 A;  3TGU D;  3VP8 A;  3OJA B;  2YO3 A;  2YXQ B;  1HF9 A;  1LWU B;  3NXS A;  1BGY G;  3AEE C;  1IFN A;  1YIT P;  3CXH I;  3KZI H;  1VQK P;  1HVV A;  1P84 H;  1NU1 J;  1NTK G;  2H43 A;  1NTZ G;  1L0L D;  2M5A A;  2ZT9 C;  2D2C D;  3HE4 A;  1MKM A;  3QWO C;  2I1K A;  1RF0 A;  2D2C B;  2CK3 H;  1OW8 A;  1ZME C;  3L71 E;  4H0L C;  2LR2 A;  4EI2 A;  2G8Y A;  2C0W A;  4L73 A;  3P8C D;  1OVU A;  4R4L A;  5CJ4 A;  1RE4 C;  1W2E A;  3PRJ A;  1J2J B;  2KNC B;  1FZC B;  2J59 M;  1LT9 C;  2WSC H;  3V4W A;  1VQM P;  3N7N A;  4XFJ A;  3F89 A;  3V5B A;  1T3J A;  1AQT A;  2E76 D;  1JY2 O;  3H1K J;  1N86 A;  2E76 B;  1RE3 C;  1WRG A;  4WBA A;  1EXJ A;  5AW2 B;  3IF4 A;  3Q5R A;  3Q5S A;  3U1A A;  1S5L E;  1J1D C;  2M8R A;  5H2F E;  1NKN A;  2PGD A;  1RY3 A;  5CCH C;  3L75 J;  5CCG A;  3IAO A;  3SSU A;  1NU1 D;  1KOR A;  3II6 A;  2O1K A;  2ZYD A;  1GDT A;  2Y0D A;  4A7P A;  2QJY C;  1JB0 J;  1KZU B;  1YIJ P;  2FKW B;  4C7N A;  4GOD A;  1FZA A;  1KB9 E;  1ZP0 C;  2OAR A;  2V4H A;  3H1H D;  2KLU A;  1S5L H;  2QEX P;  4U3F G;  2JWA A;  3L70 J;  2NRG A;  3L73 J;  4H13 C;  1NO4 A;  5DJU B;  2P2U A;  1SQB J;  2Q1K A;  1M57 D;  3ZDM A;  1JCC A;  1RF0 C;  2A45 I;  2ZVO B;  1JMB A;  3TGU G;  4L75 A;  3K5B A;  3KXD A;  2OQQ A;  2H7H A;  4MN4 C;  1AJY A;  3OA7 A;  1M56 D;  3H1J E;  1K8A Q;  1KB9 H;  2KXP B;  3V2Q A;  2K37 A;  4N6J A;  4W80 A;  4D6T E;  1S2E A;  3AE9 C;  1AV1 A;  1CSB A;  2ZFC A;  3CCS P;  1VQN P;  5APT A;  2R3S A;  3GF3 A;  2KIK A; 
#chains in the Genus database with same CATH homology
 2W6B A;  3U1C A;  3BAT A;  4LLH A;  3P7K A;  1NTZ K;  1X9V A;  1MZ9 A;  3VOP A;  3VP9 A;  4JYB A;  3A5T A;  1JUN A;  4AQR D;  1IFD A;  5CCH D;  1FJP A;  1J1D B;  1NHL A;  1A02 F;  1YYC A;  3M9Q A;  2YMY A;  3VTP C;  3HRN A;  4B86 A;  2N1T C;  2FYU K;  2WZ7 A;  2R5B A;  5KJ7 D;  3HE5 A;  1KIL A;  2FYZ A;  2XU6 A;  5CCG C;  1GL2 C;  2ZXE B;  2OYH C;  3TK1 A;  1CI6 B;  1LT9 A;  1SQP K;  3RK2 D;  2FXM A;  3V2N A;  1N7S D;  2Q7C A;  3B5N B;  2WSE H;  3E1I A;  2OYI C;  3RK2 B;  5BU8 B;  1J1E B;  5CMZ A;  1FZC A;  3HD7 C;  5AW3 B;  3BRT B;  3M91 A;  2NPS C;  1FOS F;  5AW7 B;  1LTT C;  2A45 G;  1HWT C;  1H89 A;  2QM7 A;  2O01 H;  5AW8 B;  3KYQ A;  1HGZ A;  1SQQ K;  5AVV B;  5AVR B;  2KP8 A;  2KB7 P;  3A7O A;  3M06 A;  4W7Z A;  2O1J A;  3LIE A;  3RL0 C;  2HOD A;  3HUS B;  1JY3 O;  1GW3 A;  5CCH A;  4GT1 A;  3GHG C;  2FFD B;  3TNU A;  1GD2 E;  3M9B A;  1N7L A;  3HE4 B;  2IX7 C;  4WY4 D;  1KFM A;  1KFN A;  3TSI A;  1CI6 A;  3HUS C;  5KJ7 A;  1L0N K;  1JTH B;  2Q3I A;  1X8Y A;  4ZKU A;  5BVZ A;  1DX7 A;  1FZG A;  5APV A;  2HFE D;  3TYY A;  4I2L C;  4O9B A;  4JYC A;  4AYC A;  2LKM A;  1N7S A;  5AVX B;  1SQB K;  3MUD A;  5APX A;  2XZR A;  1GZL A;  1URQ D;  4RES B;  5AVU B;  4EIJ A;  5CJ0 A;  2JEE A;  3B8E B;  1ZN5 A;  3A3Y B;  5AW4 B;  2WT7 B;  1SFC C;  2C9N Y;  3KPE A;  1JNM A;  1ZV8 A;  2R3C A;  3G3Z A;  3P8C E;  1JY3 N;  1LWU C;  3UIA A;  1SLQ A;  5CHX A;  1H8A A;  5BU5 A;  3SWF A;  1HBW A;  2N9B A;  1M1J B;  3H32 A;  1ZR2 A;  1NH4 A;  1MFZ A;  2HG5 D;  3WMM 0;  2POH A;  1YTZ I;  3PP5 A;  1XTC C;  1HUC A;  4W7Y A;  2Q5U A;  4IFF A;  4GKG A;  1JTH A;  1LGH B;  3O8Z A;  4WY4 A;  4N78 E;  1T2K C;  1N2D C;  1NTK K;  2KLV A;  2N1T D;  2VRS A;  4IFD K;  4Y99 C;  1RF1 A;  2C0X A;  1OXZ A;  2H8P D;  1GK4 A;  3MTU E;  2GM4 A;  3MGN A;  3VYI A;  3VMX A;  1HJB A;  1JO5 A;  1GL2 D;  2N1T B;  2XV5 A;  3RK3 C;  1QL1 A;  2R5D A;  3BAS A;  1CZQ A;  1GL2 B;  2WPR A;  2OYH B;  3VMY A;  2WTY A;  1URQ A;  4GIF A;  2WPS A;  2C9L Y;  1OWA A;  2HLO A;  3HD7 D;  1RE4 A;  1JY2 P;  1M7L A;  1FZE A;  3IFM A;  1IC2 A;  1M1J A;  2OYI B;  1VDF A;  2WIT A;  1IFJ A;  2GUS A;  3B5N D;  3HD7 B;  1FZC C;  1SQV K;  1H88 A;  2KOG A;  2NPS B;  2E43 A;  2MJZ A;  1XTG B;  1NAF A;  1L0L K;  1G1I A;  1HTL C;  1FAV A;  5KLV K;  1DEB A;  1FZB A;  4XA4 A;  1FBM A;  1YTZ T;  2XDJ A;  4I6M C;  3RL0 B;  2YKQ A;  5KTB A;  2A45 H;  1RE3 A;  2N1T A;  3GHG B;  2IPP A;  1ZR4 A;  4IFM A;  5APY A;  3SWY A;  2OYH A;  1LTJ B;  5AVY B;  2P67 A;  2W27 A;  1G1J A;  1LTG C;  2YKP A;  5AW6 B;  2OYI A;  1NWQ A;  2YNY A;  3EFG A;  1LTJ C;  1SVF A;  5AW0 B;  1N7S C;  3L4F A;  1FJK A;  5AW9 B;  4KHX A;  1AFO A;  1SFC D;  3T97 A;  1Z56 A;  1MUU A;  4LGD E;  3B5N A;  1T8Z A;  3VP8 A;  1AQ5 A;  1GTW A;  1DH3 A;  3V4Q A;  1SFC B;  3OJA B;  2YO3 A;  1S9K E;  1IFM A;  1G2C B;  3CI9 A;  1NTM K;  1LWU B;  2R32 A;  3CL3 D;  1NKZ B;  2J58 A;  2HPC B;  3NXS A;  1N73 C;  1WT6 A;  3GHG A;  5AW1 B;  2IFN A;  1IFN A;  5APW A;  4C46 A;  1X79 B;  2YO2 A;  1T2K D;  1HVV A;  3HUS A;  1IFI A;  2M3B A;  4C7R A;  1L4A C;  2H43 A;  2FFD A;  3NMD A;  2YKO A;  1LTB C;  3EQ2 A;  4WY4 C;  2KSJ A;  3MD0 A;  3LW5 H;  3HE4 A;  3RK3 D;  1PFI A;  4Y99 B;  2BAS A;  1RF1 C;  2PAJ A;  5AVW B;  1A02 J;  2I1K A;  1JCD A;  4AUW A;  1RF0 A;  3P8M C;  3RK3 B;  3HE5 B;  2QM8 A;  5CCG D;  3MIW A;  3NFQ A;  3H6P A;  2C0W A;  1SFC A;  1FDM A;  1URQ C;  2Z5H A;  4N3Y B;  3P8C D;  5CJ4 A;  3IR9 A;  1LWU A;  3VN0 A;  1RE4 C;  1MV8 A;  1W2E A;  2Z5I A;  1KIL C;  1LTI C;  1J2J B;  1EQ7 A;  1ZLL A;  4ZKP A;  3HTK B;  3M0D A;  2WT7 A;  1FZC B;  2J59 M;  2CPB A;  1LT9 C;  2WSC H;  3V4W A;  3N7N A;  1VPC A;  1JMM A;  1HGV A;  3L37 A;  4DZO A;  2JJL A;  3V5B A;  1T3J A;  2NPS D;  3V2P A;  3OAK A;  1E5W A;  3I5C A;  4JF7 A;  2XNX A;  3L35 A;  4N78 D;  4C7N B;  1FZF A;  2W6A A;  1JY2 O;  2GUV A;  1N86 A;  2HOD B;  2WWW A;  1RE3 C;  1WRG A;  3P32 A;  4WBA A;  5AW2 B;  3L36 A;  3RL0 D;  4EOT A;  2Z4E A;  3TNU B;  1JOC A;  2KYV A;  3U1A A;  1J1D C;  2M8R A;  1T3U A;  1NKN A;  1RY3 A;  5CCH C;  3V2R A;  1GK6 A;  3BRV B;  5CCG A;  5APS A;  2PP6 A;  3R2P A;  3NTN A;  2P7J A;  1GL2 A;  1IJD B;  3HTK A;  1KQL A;  3VMZ A;  1N7S B;  5KJ7 C;  3II6 A;  2O1K A;  4OH8 B;  5AVS B;  1GDT A;  1QL2 A;  1FU1 A;  2I1J A;  4HYT B;  3B5N C;  1FOS E;  5AVT B;  2L5G B;  3RK2 C;  1JY3 P;  1J1E C;  3BVH A;  3HD7 A;  1KZU B;  2FKW B;  1JY2 N;  4C7N A;  2NPS A;  1FZA A;  2OAR A;  3U59 A;  1N73 B;  3H32 B;  4DOJ A;  4HH2 A;  1L4A D;  1IK9 A;  3N4X A;  3M9H A;  2P1J A;  2WPQ A;  2CPS A;  1L4A B;  1SQX K;  1GU5 A;  2XKM A;  2FFD C;  2HYN A;  1LTA C;  4WY4 B;  1NO4 A;  4XE5 B;  4I1L A;  2P2U A;  4LC1 A;  1RF1 B;  3KDP B;  1LTJ A;  3LID A;  5AW5 B;  5APU A;  3A2A A;  3M0A A;  1JCC A;  1RF0 C;  1NU1 K;  2A45 I;  1GU4 A;  2E42 A;  4WB4 A;  3KQG A;  2Q9I A;  3CLQ A;  1KIL D;  1S9K D;  1URQ B;  1LTS C;  1HH0 A;  1CW5 A;  5AVZ B;  2H7H A;  3OA7 A;  5APQ A;  1KIL B;  1GW4 A;  1NOH A;  2IFM A;  1N73 A;  3V2Q A;  3M0D C;  4N6J A;  4W80 A;  4M3L A;  1G2C A;  5AVQ B;  1LT9 B;  3C9I A;  1CSB A;  2HPC A;  2ZFC A;  1M1J C;  5APT A;  1L4A A;  1SP4 A;  2WSF H;  1IO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...