4WVZA

Crystal structure of artificial crosslinked thiol dioxygenase g95c variant from pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
195
structure length
195
Chain Sequence
ILRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPGQITPVHDHRVWCLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate and pH-Dependent Kinetic Profile of 3-Mercaptopropionate Dioxygenase from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa bwhpsa021
molecule tags Oxidoreductase
molecule keywords Thiol dioxygenase
total genus 48
structure length 195
sequence length 195
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4wvzA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4wvzA02
2HJIA 3H1MA 1XE7A 4XFBA 3LA3A 5BPXA 3ES4A 1E79H 4XF1A 5CU1A 1CGPA 5KHKA 1O4TA 4HSLA 1QXRA 3JZVA 3FHIB 4D7SA 1ZRCA 2ZCWA 4IEVA 2OZ6A 4F8AA 3MZHA 3MDPA 3SCFA 4EWDA 3HIFA 1FI2A 2E5YA 4IEQA 4LULA 3IBMA 2W6JH 4XETA 5I8TA 3CL1A 3H8UA 3RYPA 1FXZA 2ET1A 1CAXB 3NW4A 4Q29A 1G6NA 3PNAA 2GU9A 2BEOA 3H3ZA 4OFGA 2GC3A 1ZRFA 4XFAA 3H1WA 2IXKA 4A2UA 3I59A 3PVBB 2IXIA 1YLLA 1LR5A 3HQXA 2CAVA 1YFWA 2IXCA 4I02A 2XKOA 1U12A 5E16A 5AVPA 4B29A 4O9EA 2ET7A 4H7LA 5LEKA 3FWEA 3BPZA 1IPJA 4K8FA 3DL3A 2VECA 1CAXA 3BCWA 4ZU4A 2XLAA 2MPFA 1EYBA 2E5TA 1X8MA 1VR3A 4META 2QE7H 3E5XA 3LZZA 4QMAA 1YWKA 4E2QA 1IPKA 3EJKA 4MGIE 4WVZA 3I59B 2KXLA 1Y9QA 4I0BA 2FMYA 3BU7A 2PQQA 3RPQA 3D82A 4P9GA 3NJZA 1I6XA 3PJSK 1L3JA 5JR7B 1SFNA 4IEXA 1ZX5A 2B5HA 1CX4A 1SEFA 4AVCA 3OD0A 2OZJA 2WSSH 4R8HA 3G7DA 4JVAA 2XKPA 4FAHA 2GC0A 2V7QH 3LWCA 3M70A 4HBNA 4ONUA 1OMIA 3VHRA 4HN0A 3D0JA 1ZZCA 3RZZA 5KBFA 4Q0VA 4WZCA 3TNQA 3FZ3A 1OI6A 1CAWA 2H6BA 3CLPA 3OCPA 2XLGA 4JV4A 4HVQA 4BH9A 4DINB 1FS0E 2O8QA 2CV6A 4CYDA 1EY2A 2D5HA 4F7ZA 3I7DA 4UBGA 3EQEA 3USSA 3E97A 4MH0E 5LEJA 3ZDSA 1O7FA 2Q0AA 1DZRA 2IXLA 2Q1ZB 4WBBA 1O5UA 4I3PA 4BYYA 3LA2A 4MGZE 1EP0A 2XLFA 4Q0UA 3LOIA 3SMHA 1O5LA 1CAWB 1YUDA 2PHLA 2XHKA 1J58A 4KWLA 3NSTA 3DKWA 3NVCA 4Q0PA 4JTNA 1CAUA 1UIJA 3WW2A 5BV6A 5BUVA 5LRRA 3D0SA 3PLQA 3WW4A 4YRDA 2EVXA 4KU7A 4FAGA 4J1WA 5I0RA 5CVRA 4MGKE 1XE8A 2BNMA 5I91A 4DJGA 1LRHA 2XGXA 1ZZBA 2D40A 3MYXA 3RNSA 3FE5A 5JSOA 1CAVB 1ZZ8A 2EA7A 3U11A 4XEZA 4LLOA 2OA2A 5I0TA 1X7NA 4LA3A 4UBHA 5JCTA 4MUVA 4QGLA 4PIZA 3HT2A 2Z69A 3DN7A 1EPZA 2E9QA 4I2OA 4AXOA 4XF9A 3RYKA 1RTVA 4IEZA 5E1RA 3WW3A 1H1IA 2IXJA 4Z07A 4MGYE 3E6CC 4FT8A 3EHKA 1VP6A 3U10A 1RGSA 2BYVE 2XL7A 4R52A 4AQ2A 4QGNA 1IFPA 2CAUA 2UYAA 2QNKA 4XFCA 4PIXA 4YXWH 3M3IA 4L11A 4YARA 3SHRA 4IETA 1BSNA 4LTAA 4UXAA 3E6BA 2K9ZA 4FBFA 1J1LA 2C0ZA 1CAUB 1FT9A 5I8SA 4GULA 4N9IA 1UCXA 1RC6A 3IDCB 4HVOA 1ZVFA 1UIKA 3OF1A 4XF4A 5FQ0A 5EZWA 2ETEA 1Q43A 2XNDH 2MNGA 4XFIA 4LEJA 1YFXA 3CO2A 3O14A 5JSRA 5K8SA 4E2GA 1BSHA 3I54A 3QOPA 1LB2A 5T3NA 4IEPA 2PA7A 4XFHA 1YFYA 2UYBA 2VPVA 3E6DA 1AQTA 4HN1A 2CK3H 3RYRA 1CAVA 2N7GA 2Z2SB 4N9HA 3ST7A 1PMIA 5C8WA 4HSJA 3NL1A 4KU8A 2PAMA 2PAEA 2CGPA 1ZNPA 3S7EA 2PYTA 5FQ0B 1J3RA 3C3VA 2Y0OA 2B8MA 5FLHA 2GZWA 2ATFA 2EAAA 2K0GA 1I5ZA 1RUOA 2JDIH 4PJYA 4IEWA 1ZREA 3B02A 1NYWA 4BIFA 2QCSB 4XF3A 5JAXA 5J7MA 2P17A 4EWEA 2QJVA 3GBFA 3ROUA 2WC2A 5EFUA 2PFWA 3E5QA 1VJ2A 3UKNA 3EO6A 1ZZ9A 2DCTA 4ZU5A 5D1IA 2QVSB 1NXMA 4YYOA 4OLLA 1GQHA 1NE6A 4MZUA 1PM7A 3CF6E 4XF0A 5FLIA 5FPXA 1O3SA 1JUHA 3E5UA 4LUKA 4E2SA 3UKTA 4QXKA 1X82A 5I93A 3H9AA 1JEKA 4I09A 3IWZA 4I0AA 4QM8A 3ACLA 3QACA 4HLTA 3H3UA 3NKTA 1SQ4A 4XFFA 3H7YA 2H0VA 3LAGA 4IERA 1WA4A 3R6SA 4BHPA 5KHGA 1H1MA 1HW5A 2D5FA 2BNOA 1Y3TA 2PHDA 2GH2A 4KWKA 5I8YA 4AVBA 3KMHA 3SXWA 5FCCA 1J3PA 5CADA 5BY5A 3OTFA 1XRUA 4IESA 4YNIA 3SCHA 1UW8A 3CJXA 5C6CA 3N4MA 3EBRA 4MX3A 1ZZ7A 1Q3EA 4AVAA 1DGWA 1X8EA 3H1YA 1RL3A 1Q5OA 4O9GA 1V70A 2GAUA 1OD5A 1J59A 1UD1A 3CEWA 1OFNA 3TNPB 4QM9A 5F1RA 1UPIA 1ZRDA 3ETQA 1DGRA 4AQ6A 1J3QA 2O1QA 4QGMA 2BGCA 5KHHA 3FFQA 3SCGA 3FX3A 3WW1A 5I0SA 1RUNA 3KGZA 4HZFA 5BXXA 4ORFA 1WGPA 2Q4SA 2FQPA 4Z82A 3EFFK 2ZKLA 4EWAA 2OPKA 2GC1A 5FPZA 5J3UA 1NE4A 4TLFA 3ELNA 4X6RB 4Q0SA 2PAKA 3OGJA 4Q0QA 1O3RA 2GC2A 1ZZ6A 2V09A 4HMZA 5LRSA 1LKNA 2OYZA 1TQ5A 3S7IA 1YHFA 1WLTA 1NZCA 1ZRRA 3H50A 4X6QB 4NVPA 4XFGA 3GYDA 4KL1A 2UY9A 4KWJA 2B9UA 3UKVA 4EROA 4L2NA 2I45A 1YFUA 2WFPA 5JSPA 2IC1A 4I01A 3KSCA 4QX5A 1QWRA 3KGLA 5HI0A 4IEYA 4LUMA 3S0MA 2F4PA 3HT1A 2UY8A 5FDBA 2BNNA 2H6CA 5KHJA 4YSFA 5FLJA 2Q30A 3KCCA 3DV8A 3FJSA 2VQAA 1O3QA 2MHFA 4MV2A 3IIAA 2PTMA 3LA7A 3MPBA 3ES1A 4J1XA 4JTOA 2XL9A 1O3TA 4HVRA 3RDIA 4D7TA 4IEOA 3BALA 3BB6A 4PIYA 5KHIA 1QXJA 2HKXA 1DZTA 4RD7A 3H7JA 4IEUA 3IDBB 3U0ZA 4ZU7A 1GQGA 4LA2A 4EV0A 2QDRA 2D93A 2IXHA 1QY4A 5J48A 3L2HA 5I0UA
chains in the Genus database with same CATH superfamily
1Z7S1 2DU1A 5K9YA 4PI0A 5FFOC 2XXZA 1VPHA 3T08A 4CPBA 2K9JB 2DCKA 4WBAA 4RQPB 2YFZA 2XJPA 4H14A 3WSOA 1L0NJ 4WVWA 5FZKA 3B9IA 3WNXA 3ZXKA 2VMIA 4CXXA 1RVF1 1KJRA 5BNNC 1V9U1 2A75A 2IUWA 4XFGA 4Y4YA 3P32A 1QQP2 1O4TA 1JW6A 1QXRA 3IT8A 3FHIB 3ZOIA 1BHGA 4F8AA 3MZHA 2PAJA 4M4PA 5ANNA 3DECA 3OOXA 2W94A 3MDPA 4TYSA 5IK5A 3WF3A 3VYIA 4P9WA 1MZEA 5DABA 4XPVA 5E88A 1K73Q 4LXLA 1IS6A 3PMSA 4QDSA 3UGFA 4CEWB 1L0LG 1PO21 2J7MA 1YJKA 1VPCA 2RM21 2YMZA 1EAH3 5FP4A 1UKRA 4Q26A 3CX5E 4K20A 1ZBA2 3H8UA 2B42B 2BVBA 1HVVA 1RVF3 3LFIA 3NNLA 1V9U3 3POJA 1SQQJ 3NW4A 4HFSA 4L8QA 3ZM8A 4BLJA 4DFSA 2Z4EA 4Q29A 4CCNA 1RXFA 3K48A 3A5TA 4N78E 4UWDA 3VBSC 3I2JA 3WQ7A 2BEOA 5DG2A 5AW4B 1NTZE 2IYPA 3POFA 4X6QB 3VBSA 1L0NK 3L74D 2BRTA 2EIGA 4EZHA 1ZRFA 1IQDC 2AACA 5CG9A 2B46X 3I3DA 1KZUB 1VQ6P 1WCQA 2ZJSE 3R4UA 4QKNA 2V7QJ 4CUBA 3I59A 2FDFA 1E5IA 1M1KQ 2R49A 5LCWL 4HETA 2P10A 3HQXA 2LS6A 1ULGA 2TBVA 1M06G 5FOBB 4RO0A 3WP4A 4WVVA 1U12A 1QQP3 4EYYQ 4JPZB 1Y9MA 5LEKA 2JR8A 1GMMA 3BPZA 1AJKA 1ST8A 3HNYM 1LOGA 1GQPA 1NVOA 1UQXA 5AFBA 1CAXA 1HLCA 5K5GB 2HYXA 3K75B 3P8CD 2C0XA 1EPWA 3H1IE 1CZTA 2ZEYA 3APBA 3JQXA 4JHZA 4JKKA 3SEEA 2Q8EA 2DW3A 4META 5CFDA 2RG4A 3TEYA 3T4VA 4QPIB 2D2CD 1W6PA 4MXVA 4A3XA 2YKOA 1NU1E 4Y20B 2RS32 2FXPA 4QHBA 4EN8B 1ND3A 2DYCA 1AVBA 3O1TA 4YW5A 1W6OB 5FUNA 3VBRA 1OT5A 2EXIA 2WL1A 2XVGA 3HOBA 1A34A 4CU7A 2X8KA 2K9YA 1H6YA 1SS1A 1S2EA 3MIBA 1L2PA 3SSUA 1ZMEC 4GB32 3HE5A 2Q3IA 2Y6JA 3NNFA 3AP9A 3R05A 4AI3A 4CA9A 4EYUA 2PQQA 1YITP 3RPQA 4DUVA 5CHXA 1YHQP 3WDUA 2JEEA 4D69A 2VZ3A 2Y33A 2P37A 1CI6B 3GM8A 2RR13 2XPJA 3O7OA 1FC2C 1D4VB 4XABA 5GLZA 1GNZA 3VDCA 2BERA 3ZFEB 1UKGA 2B7YA 3KF3A 4AYCA 1RXGA 5FMDA 3HAGA 4AYUA 1C8M3 3TGUG 1QU0A 1RVF2 4Y28J 1N7SA 1HUCA 2OYIB 1OLQA 5KLIC 1PVC2 1RJ8A 3M1HA 4R8HA 1YXWA 3POGA 1Q8OA 4JVAA 4AQTA 3BUCA 2GC0A 1PIXA 4CDXA 3H32B 4NUBA 1XSRA 2C6SA 3U07A 2RN0A 1VBC1 2E32A 2WNVC 3HNBM 2OYHB 3POYA 3KPEA 2RJ2A 4FP2A 1OMIA 1OLME 1OQ1A 2HWC1 3B94A 2Y9ZA 3LEMA 1REDA 2BU9A 3VHRA 1QDOA 3DKQA 4LHNA 2JG9B 4A7YA 4UB6H 4Q0VA 1XSQA 3H1ID 3WG3A 2VUAA 3U1XA 4NRPA 1YQ2A 4KGGA 4NIGA 1GZWA 2VBBA 3AKSA 3TBDA 3AZZA 4LBJA 3OCPA 2XLGA 4JV4A 2IZ1A 4R9BA 1GSLA 2YXQB 2YZ4A 3RZKA 5A3PA 3AE4C 5KLVE 4Q4Y2 5EPAA 1DLLA 1I3HA 2XQXA 3AKTA 4XBLA 2L9LA 5FY4A 3TK1A 1NTMJ 3LEIA 4V2VA 5GM0A 2Q1KA 4MH0E 3C8XA 2KLUA 5EXOA 1Q56A 2IZ0A 1O7FA 3ZDMA 1CD3G 2GP3A 3ABZA 4LMFA 1PGL2 1EAH1 3JCUH 1VBB1 2IXLA 1VRH2 4KNCA 5DDJ2 5FMCA 1D7MA 3L71G 1A8MA 1B35C 1O5UA 2VVEA 2B9VA 3NTNA 4NHKA 2ZT9B 4DXTA 1T3JA 1S0GA 2RJLA 3IM0A 2W08A 4QQLA 3AMPA 4ZKTB 3MIWA 3IAOA 1W2TA 1BZWA 2YC2A 5F5CA 1B35B 4GQ7A 4WV8A 4GIFA 1WMFA 1YUDA 1HBWA 1FV3A 1R1A1 1VQ5P 2PHLA 2R063 2VNGA 3MV01 5SV5A 2VRSA 3H1JD 1JHNA 1UIJA 3BGAA 1A3KA 3I8TA 3WW2A 2KM2A 5LRRA 1UX6A 3PDQA 1TVGA 4NIIA 4L76A 1KDMA 2XKMA 5M1BA 3L75D 1JZ6A 3ZXEA 3AYAA 4E4ZA 3TNUB 1E5RA 1CI6A 2WFF2 4PLOA 2R32A 3RWNA 3GHNA 1RUE2 4OUSA 4CEWA 5I0RA 5CCHA 4MGKE 1H4GA 3VD5A 3ZXGA 5FY1A 4U36A 3V64A 1HJFA 3DCQA 4CU8A 1COV3 5ANQA 1YQ4C 2VZ1A 2KIKA 4Q27A 2JJLA 3TNPB 1DQ4A 4CDXB 3H32A 2QQOA 2VXRA 1I9RA 1X8YA 3N36A 1UZYA 4PLMA 1ZXGA 3OBAA 4IXLA 1SQBJ 1XQNA 3WNLA 4DY3A 1ZZ8A 1BE3E 5KTBA 1VQKP 1OPOA 1T6GC 2EA7A 2Y6GA 2YYOA 3U11A 2WO2A 5I0TA 4AI1A 1X7NA 2KSJA 1RUH1 4Q4W1 1HF9A 2ZMKA 1FAYA 5KKZC 4L92A 3ZVXA 1GWLA 2X5IB 5FYUA 3DN7A 3I55P 1DHKB 1UY3A 2WFF1 4IGPA 4MGSA 1EV12 2WYFA 1UMZA 3VP9A 3FN9A 3RYKA 1UOGA 2TUNA 2D97A 2Y0CA 2YXRB 4PD4D 2BBAA 2DVFA 5APTA 3A0BE 2OUJA 2B87B 4ZNCA 5F2SA 3WW3A 1ACCA 5CISA 4URTA 5AVXB 1M7LA 3VHOA 5HV4A 3O1MA 3PJQA 5J36A 3BU0A 4L0PA 3ZYFA 3UL2A 2EIDA 4CCMA 4OI4A 3CQOA 2JWDA 5KAIE 4OMCA 2RS51 4QX2A 1VP6A 3E7KA 4YW4A 1G1IA 1SBFA 2D3SA 3B69A 5L19A 2QVAA 2WPQA 2EXKA 2Z5WA 3NO8A 1Q8VA 2XL7A 4OI2A 1QX8A 2E33A 4DIQA 2WFF3 3FUOA 3D5OA 2W1SA 4FP3A 3MIDA 1XNCA 1IFPA 1IFIA 2R062 3B5NB 4YPCA 2ZEXA 1NH4A 1NLRA 2PRRA 4DZOA 4FQ4A 2ZXXA 5DAWA 3CCMP 4Z92B 3RK3D 4YARA 1B35A 2WSEH 3HUSA 4Y99B 5GTIH 3MUDC 3C7HA 1HB4A 4LTAA 3ZYBA 4P9IA 3E6BA 1KILC 1J1LA 2YMYA 3ZR6A 4QB1A 3CWBG 2ITAA 2JICA 4ISQA 5I8SA 3FGAD 3THCA 1DYOA 1RC6A 1WBLA 1URQA 1W9WA 4FPOB 3M9QA 1H2KA 3SEPA 3OUJA 2VBPA 3TNUA 1BEV2 2JG9C 3RZJA 3AE8C 2MNGA 4MGTA 5FZMA 3WXPA 2ADEA 4DEVA 2FD8A 1FX5A 2K1AA 1ZLLA 4FTEA 3I54A 2WDBA 3TGUD 1NKGA 4DB5A 2ZZJA 2VUJA 1N1SA 1SLTA 2ARAA 2H7HA 2WNVB 3QOPA 3RS6A 4LC1A 4HH2A 2IVJA 1KFXL 1JM0A 5LK7B 3V0BB 1O3SA 4FOWA 2GN7A 3I4IA 2JENA 3H1HG 3RZHA 1YQ6A 4R9DA 2VPVA 1GL2A 2DCZA 2WLQA 3H42B 3B93A 3VKOA 5C39A 4PD4E 2LALA 2Z2SB 5FYVA 3H1KE 1WRGA 1LESA 1PMIA 2W1UA 2WJSA 2L91A 3DXTA 3NL1A 4HSJA 2ID4A 3RVHA 1JYTA 4YFWA 2PAEA 1SLAA 4GKYA 5CAZA 1TNRA 2R042 2DFCA 3S7EA 2BEZF 2LROA 1SVFA 2JDMA 2W5FA 3AYDA 4FO9A 3X29B 3VMXA 3GF7A 4DS0A 4LBQB 2ZPXA 3VZOA 1VMHA 5C5TA 3O12A 1EZVI 1Q90D 5FJKA 4D6TD 2WPVB 2JB4A 2QQJA 2VCBA 5FZ4A 1ZREA 2HWD2 1MFTA 4DXRA 5ISLA 4K1ZA 3A0KA 3ILNA 4XF3A 1C8M2 3T1MA 4YZ4A 5AVUB 4M3LA 4MN4C 2P3JA 5EYXA 3MP7B 2WC2A 3OGGA 3MF9A 3WHTA 5EFUA 1KQLA 5CJ4A 2BGOA 3ZYIB 4XBQA 4JQ0D 3ZN6B 4YVSB 2FYZA 1AL22 3UKNA 2VCMA 3HE4B 1PO12 2IPPA 2WSCH 3ABVC 3I5CA 4HONA 1REFA 1X9TA 3S5QA 3CIHA 5D1IA 1RYYA 1CW5A 2F6BA 2FMDA 3UGHA 4AHZA 2VO5A 3MLJA 4G3YC 2X09A 1Q8SA 2HWE2 3HD7B 1YQ3C 4Q4W3 4QPYA 4OLLA 1VQOP 3L75E 1GQHA 2IZWA 5GLUA 4AI2A 1PPJD 1JMUB 3H3LA 4CDXC 4CDWB 1GU4A 3H1JE 1X50A 2E75C 2K88A 2WQYC 1RUJ3 1W2AX 1TEIA 2WA4A 3KVAA 2QSIA 3N9PA 2W87A 1AJYA 1AQ5A 4C0BA 4E4SA 1URQB 5JOYA 1GL2C 1GR3A 1WMDA 4OUMA 1PP9J 1KYOI 2ZEZA 2QTWB 5IVBA 4UFHA 2J5UA 4AK3A 1X82A 3GCXA 1JZ3A 1AR72 2GNBA 5AW3B 4YPJA 3ZXAC 2DVDA 4JYBA 2FZ1A 2M5AB 1OH3A 3WNPA 1RJ7A 1AL21 4WVMA 4LT5A 2D6OX 5F37A 2RMZA 5FWJA 1PFIA 3M3QA 1KMIZ 3B9CA 3TRSB 1SQ4A 1VBA2 1WD4A 3GBGA 3POBA 2WS91 4LO4B 4XFFA 1PZ7A 2Y9YA 1KD1Q 4COWA 3O1RA 2NP0A 2BCCJ 3L73D 3UK9A 2P1BA 4CEYB 3BCCG 3TYYA 1GL2B 4UB8E 1RUI2 3LSDA 2O01J 3R6SA 3LCPA 2D5FA 5J09A 3S5AA 4ZZ5A 4BRYB 3SLIA 2GH2A 2KA3A 3USUB 3MICA 1QJX1 3FWNA 3OYWB 1JY2N 5LWBA 4AFCA 3ZFFA 4AFMA 1JTHA 4QDQA 1JBCA 3P8MC 1RUF2 3HD7C 1XNTA 2Y26A 2QFEA 1VB4A 4UT5A 4ATEA 4N3YB 2FYUE 5BY5A 1SQVG 1SQXE 2BCCG 1XRUA 3OTFA 4B4PA 4QQHA 3GCWA 4H13D 3ZMNA 1BCCG 3AP7A 1W06A 4CCDA 3AEDC 2J22A 3QH9A 1UW8A 4LBLA 4AGGA 2EF6A 5C6CA 1PNGA 4NRQA 3CXHD 1C57A 3IKWA 2SLIA 4CU9A 2JDKA 1ZZ7A 1LHNA 3F5HA 4Z1MH 1Q3EA 1VBA1 1X9PA 1TG7A 2VQUA 5KJ7D 2O8OA 1K45A 1QL2A 1FOSE 2VW2A 4UI9L 1DGWA 2IWGB 3KT7A 2UWJE 3VD3A 1FJKA 1X8EA 4PF5A 1RL3A 1BLZA 2E63A 4ATFA 2DTYA 5KAFE 4BM8A 4DUWA 3WUTA 4YLZA 3ZN6A 1UD1A 5IT6A 3VDBA 1WA6X 2Q3EA 3OPZA 1PHMA 1R64A 2GNTA 4UW6A 3CC4P 1R8EA 1KN7A 4M01A 4ZU4A 3N9NA 1J1EB 1HXS1 1TE1B 1JY2O 3TN92 1S5LH 5F1RA 1JODA 1RUF1 2O1QA 3WDWA 4AHYA 4CEWC 2DFBA 2OPWA 2Z4FA 5FYCA 2DBIA 3WW1A 5JVVA 1M90Q 5IVFA 5DZGA 1EDKA 2QQUA 3ZXLA 2WAOA 3WY6A 4S2FA 1GOFA 1W0NA 4E9KA 1F2NA 2Q4SA 2RS13 2Y60A 4K8RB 4M3CF 5LA9A 2W27A 3T3YA 2RDRA 1VAVA 1E5HA 2ZKLA 4RA0A 1J1TA 4IUGA 3MD0A 4Y1XA 3W59A 1F8VA 2VQTA 1VIWB 3AJYA 1SQPG 4U3FD 4M0NA 4Q8LA 1S5LX 2XDJA 1N73C 2Q5TA 3GNEA 5IFPA 1JS9A 3JCUE 3JQWA 1UU4A 1ASJ2 1SP4A 1P8JA 2ARXA 3AXDA 3FFZA 4NPLA 3U78A 3P8CE 1T2KD 1EDIA 1D0GA 1NKZB 3AEBC 1QHDA 2OGUA 4HMZA 1QGKB 5EP9A 1PGPA 2ZYAA 2EAKA 5B5EE 4NMIA 1R1ZA 3CC2P 5LB6A 4PD4H 1OVSA 2FDGA 4OH8B 1EXIA 3JXSA 2XJVA 4C8DA 1H8TA 4QQ2A 4M3CA 3ZYHA 4FOVA 3TB0A 3AE6C 1LGBA 3OJBA 1KILE 3R4DB 4JGZB 1X22A 2XBO1 4NVPA 4QHZA 4YW1A 4BRYA 1AXZA 2QQLA 4Y3OA 1KEXA 4LGDE 4EROA 1KILB 2CWMA 1X33A 2I45A 3KQRA 3OYWA 3P6BA 4GA9A 3T97B 5EJ3A 3USUA 2R16A 4Y99C 1E5SA 1FV2A 4LBNA 2E26A 3KT4A 4HL0A 5ABJA 5JSPA 3MHZA 3L74E 3CCEP 1M1JA 3B5NC 1W39A 1N3QA 4JKLA 3WDVA 1QOTA 4QX5A 2QJYB 1QWRA 1IFDA 1GZCA 1JYCA 2K46A 5HI0A 3B8EB 5FO8B 1PVXA 3CCUP 1BXHA 2SBAA 1PV3A 3Q8CA 1L0ND 2W1WA 3PUSA 4I30A 3OEBA 3OAKA 3HT1A 5FYHA 5C3RA 2JG8C 1OZHA 2H6CA 5JIUA 2Y6LA 2XJQA 4YW6A 2NRGA 2RR11 3JD73 2FCUA 3DV8A 4MXWB 1Y43B 2MHFA 4MV2A 4JRLA 3Q2YA 1HQWA 5ACA3 1NTZG 2EXJA 2DURA 2R3SA 3O6QA 3ES1A 3MPBA 1AX2A 4AE2A 2VJXA 1CVNA 4AOCA 2KNCA 4ARXA 2XL9A 3ZSLA 4NWVA 3QBQA 4HVRA 4D7TA 4Q8KA 5AW0B 1CESA 2WMMA 1OW6A 1QJX3 1X79B 4ISRA 5FZ9A 3WEZA 4BQ3A 3J8F3 4HG6B 2WABA 1AFOA 5AVQB 3SH5A 3KZIH 2W9XA 4IE5A 4PIYA 3T2QA 3UJQA 3AZYA 1M56D 3ALQA 4N6JA 5IYYA 2R0FA 5KHIA 3F2ZA 1DF0A 1DZTA 1AV1A 4GD4A 4KWUA 1O3RA 2E43A 2RJKA 1OA4A 4RD7A 2RS31 1SFCA 2NMNA 3H7JA 1NUKA 1SHWB 5CCGA 2HLEA 2XJUA 3M2MA 5KJ7C 4HKOA 4YM3A 1DD3A 2D3RA 2P3IA 3RG0A 3WUDA 1BGYD 5AVVB 5C3SA 1HTLC 3WP3A 2J1UA 4FQZA 3I2KA 1OUSA 4LA2A 1PO22 4LQRA 3BVHA 3JBG3 3RZGA 1LNQA 3SKJE 2ZGQA 4YZ1A 4XJWA 1H8AA 2AEYA 1WW7A 5FYSA 4FFIA 2AEZA 4GMP1 2AXTE 1QMJA 1LU2A 2WITA 1JZ5A 4XFBA 3LA3A 3VZKA 4CCLA 4F83A 1YYNA 3FXDA 3ES4A 4YM0A 4M3CB 2WPSA 2J1VA 1FJPA 3CCLP 3KV9A 1V6KA 1HRV1 5A80A 3VBUC 5C9AC 2JIGA 5KHKA 4H13B 3SITA 3JBG1 5TISH 4UFMA 1O91A 4XAAA 5FXWA 4GWNA 2ZCWA 5FZ3A 5DUXA 1ZRCA 5D21A 2XZRA 1RUJ2 3V56A 2AEJA 4NOTA 5H9SA 2HWC2 1A02F 1BCCD 1DQ0A 1ZA4A 4AL9A 4A4AA 4CDQB 1M1JB 1T6AA 1ULEA 1P84H 1N3PA 1NCQA 1MKMA 4BWNA 1Q8QA 1QJY1 4QD2A 4L74A 3VDDC 3U59A 4FVVA 2IYOA 3L70D 3CL1A 1AZDA 3R4SA 5F6LB 3RYPA 4BQXA 2A6XA 1US3A 3QLQA 1PGQA 1AYM3 1LOEA 4UFIA 3J7LA 3NAPC 5FZ6A 3RSJA 1DFQA 2ZHNA 4QXHA 3WP6A 1JH5A 4OFGA 3DXUA 4XAEA 1J84A 3QCWA 1SBDA 5A1FA 1RHI2 1L0LK 2MKVA 1KITA 2IDBA 2POHA 3HRNA 3NRUA 5F8PA 3O6QB 2IXKA 4GALA 4YGDA 4AEJA 4H0LC 1GZ9A 1YIPA 3PHMA 5C7GA 2HODA 1LTGC 1S72P 1IKQA 2OW4A 5TISE 3CJIB 1ZR2A 2CAVA 3GZTB 5AW8B 3HQRA 4Y1YA 2Q8OA 2H0BA 3AEGC 1GDTA 2IXCA 3K51A 2PHFA 4I02A 1URQD 5IUQA 4D8MA 4XE5B 5E16A 3AE3C 1WCKA 1IKPA 1LULA 3I3QA 2ET7A 4H7LA 3FWEA 4K8FA 4DQAA 4MVTA 2WSFJ 5L9VA 2JKXA 1DGWX 1Q86Q 4DRVA 3ATGA 2JECA 3DL3A 1NYHA 2OYHC 1DP0A 1TME1 3NKGA 5BNNB 1W8ZA 4FPKA 5IWFA 2LXCB 1R1A2 2VNOA 3VV1A 1EYBA 2BPA2 1MQTB 3RK3B 3E5XA 3VBOB 1MVQA 4YGCA 1SQXD 2FYUD 2OYIC 2GMEA 1RHI1 4NROA 5JUVA 2N9BA 3AK0A 3Q5RA 4ZS3A 4NAMA 1JMBA 4UYBA 1CJPA 1CR7A 2JWPA 4MGIE 3I59B 3ZFEC 1NT0A 1MPXA 1J1DB 1K5MA 2KXLA 1Y9QA 4S2GA 5FKCA 4Y22B 5FY9A 4NRMA 1IK7A 1RHZB 3RWKX 2JE7A 3GXUA 4XURA 3I3MA 2O1JA 3PHLA 3J7MA 3J9SA 3M06A 4YVWC 1PP9E 1UY4A 1KB9H 1XOYA 2G19A 3BU7A 4IV1C 4J25A 4Q4X2 1D2SA 1LEMA 1VRH3 4P9GA 3L73E 1IFMA 3NJZA 4FI9A 4C1WA 1OC1A 2G9FA 5JXGA 3I2OA 2W91A 1NX9A 3NNJA 4NHYA 1SFNA 2Q1MA 4GKXA 4PDWC 2DWRA 2K3RA 3B4SA 3OUHA 3TN93 1OVUA 2B5HA 3H1HJ 1CX4A 4DEQA 3V0BA 1SMVA 5CFDB 2VOXA 4AVCA 2NPSA 4FPCA 2DVBA 1W6PB 2OZJA 2VTXA 3G7DA 2A45G 1LOAA 3TSIA 2C9KA 2HWE3 2V7QH 2WT0A 3G6JB 3LWCA 1RE4A 4Q4W2 2IFMA 4Y20A 5FZEA 3TGUJ 3EFGA 1Q81Q 2RMU1 4RFRB 1NLQA 1VRH1 1W6OA 3T0AA 4Y5TA 5FYMA 4W80A 5CKNA 2W3JA 1W8UA 3FLTA 1JYIA 3D0JA 3RZZA 4B1LA 3E6CC 2FYUJ 3TNQA 3KV6A 1SLIA 3KT1A 2PFXA 4O9BA 3CWBJ 4Q5OA 1CZVA 2ZX1A 1BKZA 1CAWA 1DGRN 1K12A 2I1JA 1M8OB 1RITA 1AVOA 2H6BA 2VZUA 3BKZA 4GAZA 1U0AA 2RDQA 3KHUA 2C9NY 2A5ZA 2RS52 1UF2C 5FZ0A 2HODB 1PP9G 3Q3DA 2NQYA 3C7OA 3MTUE 1PGSA 4XVHA 1D7PM 3A3YB 2D5HA 1T8ZA 4F7ZA 3EQEA 3IZOA 3RL0g 3FHAA 1W3XA 3KCYA 3LF7A 4DCKA 3ZR5A 2BCCE 2JDHA 3NMBA 3L2YA 4AHXA 5FOJB 3HNMA 5SV8A 3ZDSA 3J7NA 3L72E 3AVRA 4YZ2A 4PT6A 4CCKA 3G6EP 4WM7C 4UW5A 2KI7B 1R083 5GTHH 5LBFA 2Q1ZB 1S0IA 3ILRA 1NOVA 4WBBA 1OHFA 2XDVA 4YW2A 2Y8KA 1QJZA 1S2BA 3GGLA 1VBA3 4COZA 4ZPIA 2P2UA 3MFAA 1EP0A 2XLFA 2PGDA 2OTJP 2JG9A 2NYYA 3VBOA 3RZMA 2WSFH 1JOJA 1OF4A 2QQVA 2AXTH 3LOIA 5F6KA 4LK6A 2ENRA 2KS1A 3FLPA 3RZLA 5BNPA 1POV0 2FXMA 1TU3F 3AE9C 4ASWA 2KR2A 1J58A 1JU3A 2RE9A 2VCAA 3DKWA 2KZJA 3NSTA 1LTIC 4GWJA 4KWLA 3H1KD 1UL9A 2RM23 4JTNA 2IX7C 1CAUA 5JDBA 5BV6A 5BUVA 3D0SA 1FZFA 1RUH2 1IS3A 1YCIA 1P84D 3G71P 2GP5A 2XG3A 4KG0A 1UPSA 1MS3A 4RQPC 3V6IA 3A0BH 5CCHD 1LU1A 2EVXA 3WDYA 3ZFGC 4EN9B 4KBBA 2O3JA 4INDA 2I8DA 5A6ZA 2P34A 1Z0HA 2RS11 1K42A 4FPHA 3JCIA 1W0OA 1W8WA 1KD7A 5CVRA 1YJNP 2O01H 1UAIA 4QAWA 5FYTA 1HRI2 3SWYA 3TGUE 2BNMA 4DJGA 1VQ7P 1OOPB 2NPSB 1WLDA 3OBZA 4Q4V1 4XUTA 1YEWA 2A06E 3DF0A 3ACHA 2JDZA 2R041 4QX0A 3WHUA 4XHBA 3H1HE 2WWUA 2ZAHA 4ES8A 4AI0A 1WZXA 1M57D 2Y34A 3BIEA 1XC6A 5CBOA 3AMMA 3IAPA 3LPGA 1QNYA 4NPRA 4GZ9A 2BOIA 5CZKA 2VZRA 5GTIE 2P6HA 3CHXA 4XEZA 1STMA 5FZAA 2D2CB 4LA3A 2Y6HA 2NPSD 4MO3M 3OSDA 5L36A 5CFCA 4CZSA 3LW5H 4MUVA 4QKBA 5JCTA 1LTJA 2W8ZA 3V0AB 3AZWA 3MHVA 4YFZA 2LXBA 2Z69A 1MVEA 4FPYA 1OA3A 4MSVA 5DUUA 5FK8A 1EPZA 5LK5A 4I2OA 1GL2D 4AXOA 1G7YA 2B88A 1A02J 1W2UA 1HWTC 3WUVA 1ZYBA 2W6AA 3H1LG 1RTVA 5CCGD 1ZOYC 1QEXA 1RF0C 2PHXA 2R043 4D6TJ 1HRI1 3ME2A 1ENQA 4RR3C 3H6PA 1BMV1 2E51A 5DDJ3 1GWKA 2HBUA 5DUWA 1OIPA 2KP8A 2M3EA 2WTYA 3B01A 3OA7A 5FXVA 1FOSF 3TYJA 5JWPA 2VH9A 1KYOE 4BISA 4FT8A 4COUA 1RE3A 3V4QA 3EHKA 5HPOA 1ZP0C 2QQWA 2KUBA 3EXUA 5DAPA 1RGSA 4JCKA 2X05A 3B71A 3U10A 2BVVA 1COV2 1CIWA 2ZX3A 4R52A 3VBFB 3AP6A 3VHPA 4Z1VA 4LITA 4AQ2A 1XXNA 2AR6A 1OLMA 2FYNB 3KXDA 2IFWA 4AFAA 2N1TC 1RUE3 4LO6B 4LOTA 1QH7A 2BUKA 2E31A 2QNKA 4Q2FA 4XFCA 1KS5A 1H2LA 4W6XA 1SLCA 4YXWH 1KDKA 2D6LX 3I2GA 1LOCA 1SFYA 2CHHA 1RF1B 2X5IA 4L11A 5BNPB 1ZRTD 5AW1B 4O7XA 4OQ9A 2K9ZA 1BK0A 4FBFA 1NAEA 4H2AA 3BOPA 1CAUB 3FMGA 5FPVA 1I1EA 4N43B 5H9QA 3T30A 2WSVA 4QKDA 1ASJ3 3U1AA 3PL0A 2YU2A 2IBZG 2ETEA 2NLRA 2XNDH 1NTKD 5HXMA 5T52A 3CO2A 5JSRA 5K8SA 2E74C 3ZX7A 4P02B 5GKAC 3K4AA 1WCUA 2V5YA 1L0LD 2D43A 3CWBE 4NHLA 5C33A 2YKPA 2R7EB 5D2AA 4N8MA 2WN2A 1QNWA 1OOPA 2XR4A 5GZFA 4WB4A 5DN2A 4XDOA 1FZAA 1W2OA 4RN5A 1UY1A 1CSBA 1W9FA 1YFYA 3MBWA 4GB31 3GLMA 3FLRA 1SDDB 1OW7A 4OGQB 2A6WA 2WKKA 3HUSB 5TJHA 2WT2A 3WG2A 4P00B 3BTYA 4NHMA 3JUUA 1RB8G 2H43A 1N1TA 1OFCX 3H1IG 2HBTA 3ST7A 4KU8A 5JXHA 1N3OA 4U7JA 1C4RA 1UU6A 3WNOA 1ZNPA 1L0LJ 2O1KA 4D94A 1W5CE 5CFCB 3V0AA 1LTJB 2ZGRA 5KLVJ 3I56P 2Y0OA 5FLHA 4AAXA 2LR2A 2EAAA 4R4XA 2E74D 5GZDA 1L4AB 2YIUC 4BE3A 3OD4A 4BK4A 3S1KA 1PVC1 4MADA 5CKQA 5L9RA 5FR3A 1RUOA 2JDIH 1UYZA 1WW5A 4PJYA 3NJYA 4IEWA 1U7MA 5F32A 1S0JA 1S1CX 5AW9B 3B02A 4QB6A 2DCJA 4AVVA 4IFMA 1N7SD 1H89A 3Q8BA 1AHSA 3RFRA 3G4SP 4HYTB 4W8JA 3BTXA 2WWSA 1PX3A 3GJAA 3ZPOA 1X36A 5LY2A 5KC6A 5FPBA 5KWRA 1NCRB 1G9DA 4N53C 1G2CA 1IQAA 4CDUA 5B4XA 4D7YA 2PFWA 4R4LA 1ZR4A 3CBNA 3E5QA 2TEPA 1VJ2A 3EO6A 1ZZ9A 1MEC2 3L74G 3VZNA 4IV3B 2XMLA 5G04L 1VQPP 4K7JA 2P58A 1NXMA 1WMEA 1JYVA 2VBDA 1DU3D 5BNOB 1JY3N 5KLVK 3WNMA 3L72G 2EIBA 4C1XA 1AA0A 4LBQA 3L37A 4XUQA 5AW2B 1PM7A 2JDPA 3CF6E 5E6HA 5FLIA 4FPFA 5BU8B 3LKJA 1PNFA 3ITKA 4ARYA 5FPXA 1QKQA 3V2NA 2P3YA 1G1JA 4G4FA 4MHUA 1SLBA 1V9U2 5JI7A 2VZVA 4N43A 2FBWC 1QH6A 3E5UA 1HN1A 1HV1A 1WCSA 4OQ8A 4GXLA 1VBB2 5DDJ1 2JEMA 4DXSA 4C46A 1LOFA 4LBQD 4IOIH 3GBWA 1VMFA 3KF5A 3UKTA 1EC5A 4QXKA 3O1PA 3ZIWA 3PJYA 1FU1A 1JEKA 4AQRD 5KLVG 3E1IA 2ILMA 2WLPA 3RGUA 2ZABA 5DAXA 5J37A 1XNDA 3M4FA 3WU2H 2J1RA 2YO2A 4I0AA 1PGOA 1RY3A 2ZGPA 1W2EA 4IL6X 1MZ5A 3ACLA 4QM8A 2LRPA 3HE4A 4YVSA 1HV0A 3H3UA 1FZCC 5AC91 4Y1ZA 5F3CA 3AVSA 3H7YA 4LIVA 4P08A 4OUEA 4OZXA 3L35A 1JB0J 1WA4A 4IERA 3NFQA 4IE6A 4IE0A 3HD7A 1GK4A 2FDKA 5KHGA 1R082 1CN1A 2W6BA 2BWAA 2BNOA 5AVYB 4K35A 3CCQP 2PHDA 2VVFA 1EZVD 1ALYA 3I3EA 5I8YA 2VMCA 4WM8B 3KMHA 1C1LA 1F4HA 1XNBA 5E8AA 2QJPC 1R091 3M0DC 2XJSA 1LT9C 5GZCA 3BOWA 3EMRA 1YJWP 3A0HE 1LTEA 2FBEA 2J1AA 4OGQD 1GK6A 5FZCA 4AF9A 5CADA 5ERLA 2WZR3 4NIDA 1KQRA 4IESA 1CONA 5T54A 4YNIA 1L4AA 2BW8A 1PMJX 2J1TA 2VOWA 3SCHA 4NPFX 1HKDA 3CJXA 1XTGB 5CJ0A 2DTWA 3WU2E 2IFNA 3VD4A 4IV1A 1AXKA 4BXSV 1XU2A 3VKMA 2J42A 3Q8AA 2A6VA 4IW3A 1R5LA 3Q9OA 4CCOA 3FHQA 4DMIA 1PO13 1BCXA 1FBMA 1EZVE 4CEYA 3MW2A 1NCRA 3ZFGA 3GJBA 4RKUJ 1G2CB 4RHV2 1W8FA 2GAUA 3MZWB 1OKOA 1SFCD 1DBNA 1J59A 1A78A 1HJ0A 1ZA7A 3ZYRA 4XJUA 2MJZA 3DPRA 3AKRA 4UB8H 1UPIA 2HR3A 3P7KA 3ETQA 4XJZA 3K46A 4AR2A 3ZFFB 4K6BA 3W58A 2BP6A 3I49A 4QGMA 5BNOA 4PD4I 3SCGA 4A41A 2RR12 4XXAA 2WBKA 4IQPA 3ZDVA 1OWAA 3KGZA 5JLVA 2XBO2 3Q5PA 5BXXA 1EDJA 2TNFA 5C4WA 4DXZA 3WDTA 1OW8A 2EALA 2JX9A 2FQPA 4IL6H 3CPWO 1LAJA 3LIDA 1WUVA 1RQVA 3CX5D 3MLLA 1NTKG 2OPKA 1BGYJ 5T50A 2IFRA 1G9AA 1YIFA 1NE4A 3RK2C 3ELNA 4Q0SA 4OI1A 2D6PA 3NMDA 1LJ7A 1YC61 3P5BA 2GC2A 4MLOA 5T55A 2QIWA 1VQ4P 1ZZ6A 3JD72 1AR62 3NJVA 2W95A 3POIA 3CU7A 4I1LA 2WIIB 3UNPA 4GDOA 4I2LC 4HOOA 2GDFA 3I2IA 3VN4A 1TQ5A 3S7IA 1VBC2 1SFPA 1JMMA 2HEWF 1UXXX 1WLTA 5CIRA 2XVKA 3VDAA 2YFUA 2HYKA 5IW0A 1SQQD 3J7HA 4IEZA 3H1JG 4NHXA 2WYSA 4PI2A 3GYDA 1LWUB 2VULA 3AEFC 3ZMOA 1U5YA 3UKVA 2WPRA 2JO1A 3M9BA 1NCQC 1XPWA 3KVBA 4KWJA 4WM8A 4R4MA 2HEYF 5CBLA 1W28A 3MIFA 5FYYA 2M0BA 1MS1A 4HB1A 1QGLA 1PK6C 2IC1A 3SKVA 4CP1A 4CCCA 4EIJA 1VBD1 4Q4Y1 5IK7A 2O0OA 1F35A 4AI8A 3L71E 2E76B 1T6BX 1RUC3 2A3YA 2V5DA 3KGLA 3MIEA 4IEYA 1IZNB 5L8RJ 4LIUA 3D6ZA 1LGNA 3L70J 3AYEA 3OEAA 3S0MA 4FTBA 1GOGA 4W7ZA 4URAA 4AVTA 1NOHA 5E79E 3RL0B 1UYXA 2UY8A 1VF5B 3Q8FA 5L7OC 1USDA 2CL2A 5C70A 2D3PA 1RUJ1 1DGLA 2Q30A 4H7MA 1ZBA3 3KCCA 4MG2A 3FJSA 2VQAA 1H8TB 3V2QA 4YZ5A 3WF0A 3IF4A 3LA7A 2PTMA 4JGZA 1UZ0A 2AUYA 4J1XA 1EQ7A 3HEIA 4QDRA 4XMIA 3AEEC 3H1JJ 1NQJA 1UIIA 2YGLA 1KILA 1Z78A 2JDYA 3DPRB 2DV9A 3HBZA 3KWVA 4XJAA 4EE2A 4RS5C 2VE1A 1HGZA 1PPJG 4IEOA 5ABJB 3CWBD 3VLBB 2RMU3 4PV1C 1W6NB 3CMAP 1L0LE 1W0PA 3BB6A 3NV3A 1UIXA 1SFCC 3N7LA 1QJEA 4V1PA 3UT0A 2HKXA 1CIYA 3O0XA 2HWD1 3GF3A 5C4WB 1WWYA 2JD4A 4LBMA 1WLWA 2DCYA 1VAKA 1RQUA 1GNHA 3AKPA 1VE0A 1YTZI 2UWAA 3IDBB 4QX8A 1SZBA 3NNMA 4ZU7A 4K21A 4AZZA 1KXGA 5E79H 4JKMA 1KYOH 4FPGA 4I7ZB 2SPZA 3HJRA 5E89A 4EV0A 5A3TA 5IFTA 2A45H 1QIQA 4QB2A 3A7OA 2D93A 4WY4C 3G3ZA 2IXHA 4OHZA 4A7KA 3ZN5A 1QJFA 5F9TA 5J48A 4WWIA 2NZ9A 2R1BA 3MLKA 5BNQA 4WY4D 2KNCB 5I0UA 1JY3P 2HJIA 2QE3A 4TT3H 2HWD3 4I7ZC 2V4HA 3H1MA 4NJ4A 1D0HA 3IDAA 1NU1G 4IGQA 5BPXA 1QOSA 5DZEA 4CVUA 5HCFA 4XIOA 4MOAA 1Q8PA 3ZO0B 4M4RA 2Q7CA 5CYYA 4AQSA 3H25A 2CPSA 5IVVA 5CU1A 4JGYA 4AEDC 1CGPA 1LTBC 4BWOA 4B8EA 4D7SA 1DG6A 1SFCB 2ADDA 2ZZQA 4IEVA 2WSEJ 1G8WA 2A6ZA 4OVEA 4Y26A 4COVA 4LKEA 2QJKC 4LHLA 5FZ8A 5IVYA 3WNKA 5ABJC 3SCFA 5H2FH 1Z7S3 5GLWA 3IR9A 3CCSP 3BYWA 1FI2A 3AXEA 4IEQA 4LULA 2WVRA 4KBZA 1QOOA 4DUXA 3F89A 3IFMA 4C7NA 2FFDC 2DUOA 2YU1A 4PCRA 1FXZA 2ET1A 5A3UA 2C26A 4L75A 3HVDA 1NTMD 1OD3A 3ECQA 3C1LA 4LOSA 1HB3A 4CDUC 1JTZX 4HKLA 4N53A 3RMYA 4JF7A 2QDNA 5EYYA 1AYN3 1VBD2 3PNAA 2GU9A 3LQCA 4E4DX 4ZKPA 2VW0A 3PUHA 1VF5C 1F5FA 2F4LA 2GC3A 2HEVF 3MIGA 4PQQA 5T5JA 1S0CA 3O1VA 4JBZA 1S2KA 4XFAA 2QZ3A 5FP3A 3H1WA 3W68A 4LLHA 1EUTA 1Y4WA 2R061 2DBNA 1Z56A 3QD6A 1FMD1 4A2UA 2WNUB 1JYXA 4TTGA 2A06D 1YLLA 3HMYA 3MW3A 1LR5A 3L72J 2A7AA 2WO1A 2ZHMA 2OTKE 3GZEA 5A6YA 2YB7A 1NJIQ 5FV3A 3OB8A 1PK6B 1YFWA 5C8CC 3HR9A 3C8VA 2Y0DA 4RGGA 3O1UA 5AVPA 2YNYA 5AVWB 1W6NA 4B29A 2OARA 4O9EA 5APWA 3WVJA 2KB7P 2CDOA 2CGNA 1NCQB 4D6TG 2R071 4KG8A 2KZIA 3D8CA 1PVC3 2H88C 2ZVOB 1RUD2 2EXHA 3I2FA 2EIEA 1LWUC 5LY1A 2Y6KA 1W2NA 3B5LB 2VECA 1BEV1 5A7OA 3AEAC 1P84E 1KV4A 4LLFA 2E5TA 1UY2A 1VR3A 2CPBA 3C7FA 1DYPA 2ZX2A 1WW6A 1KQGB 4QMAA 2UURA 3U37A 4D6SA 1IC2A 3CNAA 3HN3A 3S30A 3MUY1 1YWKA 5DJTB 1UO9A 4E2QA 4BMEA 1IPKA 2JXAA 5F5QA 1JY2P 2IBZE 2C9AA 4JRAA 1S9KD 1N1YA 4OZOA 4I0BA 3CMEP 2XH6A 3POEA 3CJIA 1RUH3 2FMYA 4K3AA 2ZHLA 2RVAA 1GUIA 3EYPA 5D8AB 3RI8A 1DEEG 3CXHH 2VZPA 4FXGB 3LEKA 5F3IA 3VKLA 4BXFA 5K4LA 3MIHA 3EQ2A 1EDLA 1DYKA 4H0LD 3V4WA 5BNNA 5C8CA 3CDZB 3RRDA 1I6XA 1FDIA 4DOJA 2VUCA 2VR4A 2XUMA 4JGYB 5JR7B 1PGW1 1ODMA 2JDAA 4CUCA 3VZMA 5AW7B 1ZX5A 3BTZA 2BCCD 3L73J 1H2MA 1U5IA 2JDNA 4LNVA 3VN0A 3A0NA 1MQTA 1CZSA 3ZFFC 1SEFA 3LIGA 3OD0A 1NTZK 4A45A 5FAXA 3WDXA 1ZV8A 2Z5HA 1IK9A 1N7SC 2XKPA 3C7GA 4FAHA 2Y0EA 3TEZA 3MUZ1 4KGQA 4Y24A 5FMOL 1EXJA 1GU3A 2PHRA 4C7NB 2ZGOA 3J8F1 1QVFO 3M70A 4LKFA 1FZGA 2MEV1 3VL9A 2FFDA 1K5MB 4ONUA 3LGRA 4Y22A 1BQPA 2HFED 1W6MB 4HN0A 3JB8A 5KBFA 2OQ6A 4WZCA 4GH4C 1CPMA 2NMOA 3FZ3A 1OI6A 1VBB3 4FPEA 1GFF2 5A3NA 1K04A 4XQ4A 2D98A 3CZUA 2HWF1 5FK7A 1KTMA 2G9ZA 2WNUA 4D3WA 2ZGKA 4HVQA 1PGW2 4CP9A 4BH9A 4DINB 1YI9A 1MEC3 2CV6A 2ZJCA 1SQBK 1O8SA 4R4ZA 1HQLA 4QU2A 1EY2A 3K77A 2CSGA 3T0DA 1JZ2A 3ACFA 1PK6A 1ND3C 4UBGA 4FXKB 4TN7A 5HV0A 4UAPA 4DOUA 2I74A 4XQDA 3IAQA 3KHBA 5APQA 2R0HA 4C0HA 1KQSO 2ZYDA 1IS5A 1V6NA 1DZRA 2Q0AA 2RDNA 5F5AA 1YRZA 3J8F2 4RGKA 1SQPD 1H88A 1BGYG 3GHGC 2GN3A 4SLIA 1LOBA 3VKFC 2A70A 4NPEA 2ZX0A 3M7AA 1URXA 5H9PA 2ARBA 2E7QA 3LA2A 5FXXA 2VMGA 1V6IA 3POWA 4MGZE 3CL3D 4P9LA 3M3OA 4Q0UA 4Q4V2 1JUIA 2DVAA 3ZLIA 4BQ5A 4PV1D 3R4YA 1EV13 1US2A 3SMHA 1NTME 1O5LA 1SQPK 2VY0A 3MW4A 2WT7B 1CAWB 2XHKA 1VQNP 5KC5A 2G4IA 4Q4X3 4ZY9A 1VBE2 3IMMA 1DX7A 1OLRA 4LO7A 4Q0PA 4QPGC 5A33A 4EN0A 5A3LA 1T2KC 2HYNA 1VQMP 1GU5A 1N8RQ 1NTKK 3PLQA 3VBRC 3KHCA 3WW4A 4BQ4A 4YRDA 1CX1A 3KYQA 2DUQA 1YI7A 3RQ0A 3LE0A 4YW3A 5ACA2 3DGTA 2GMMA 3GW6A 4FFGA 5FXZA 4LR4A 2GM4A 3AE5C 1TZOA 1VMJA 4XDPA 3RK2D 1FDMA 3VUOA 4U3FG 1VQ9P 2WAAA 3KCXA 4UOJA 1XE8A 3THTA 2XJTA 1HB1A 1LRHA 2XGXA 4ITCA 4C7RA 4IV3C 1ZN5A 1XBFA 5F5IA 5HCAA 1JYWA 2O01N 1ODNA 3OGVA 4RHV3 2R1DA 3MYXA 2GUSA 3FE5A 2KS1B 4CPBD 4OHVA 2M8RA 1BYHA 4TLGA 1VBE1 2HG5D 1D4M1 1QJU1 1UZVA 2WNOA 4LLOA 1OF3A 3D71A 5APUA 2YC4A 1QF3A 1KB9D 5DAVA 3H8XA 1NY72 4NO4A 3ZIXA 4PIZA 2A06G 5FP7A 1K5JA 4A3ZA 1WBFA 1JNMA 1RUG3 2MEV2 1HXS2 3HT2A 1AVYA 4H44B 2ZMLA 2QM8A 2JKVA 2VG9A 4XF9A 4QPGB 4CP9B 1RHI3 3UYJA 1NKNA 5FBZA 3O1OA 2ZX4A 3Q8EA 4IDZA 4XJ9A 5E1RA 4AGVA 3VBHB 2C9LY 4BIOA 4EQVA 5K0UA 5CFCC 1H1IA 2IXJA 4NIHA 1DQ1A 1FZBA 1U57A 2BDRA 2HWF2 4HXCA 4Z07A 3SNMA 2CU5A 3J26N 1FZEA 4B4RA 4ES9A 4MGYE 4QX1A 3ZKYA 1RIRA 1GWMA 5FYZA 1JXNA 4OWFA 1GOHA 1ULCA 2BYVE 3WQBA 3AL5A 1IHMA 4WY4A 3T0BA 4OGQC 1SQVE 1SQXG 1D4M2 3AC0A 4PBOA 2QQPA 1EUUA 4QGNA 1J83A 2LTNA 4GMP3 2CAUA 1OH4A 1GKBA 1GW4A 1W3VA 2D6NA 3NAPA 4H55A 2CYFA 2YXSA 4DNYA 3NWKA 4CXWA 1U5XA 3DUIA 2JD9A 1JCDA 3M3IA 1JOCA 4IETA 4QPWA 2WT7A 1BSNA 4DPNA 4NPDA 4LE4A 2D6KA 1F15A 4NAOA 2VCCA 3WUCA 3QWOC 2ZKNA 2DU0A 1I5PA 1W99A 3BCCE 3L74J 1UYPA 1FT9A 2XU6A 4XZPA 4GULA 1KC8Q 4N9IA 1UCXA 1POV3 3IDCB 4YTPC 1ZVFA 1UIKA 3SWKA 3OF1A 4XUOA 2JJ6A 4N43C 3OG2A 1KS4A 5EZWA 3VL8A 1BCCJ 2ZGMA 4BLIA 5FQ0A 4P5HA 2Y0IA 2W2IA 3U75A 2KSEA 1NA1B 3ZXDA 4QXCA 2QBXA 3H8OA 1QJY3 5JI9A 3GZAA 1K5MC 1SQQE 2YUEA 2OIIA 2R6QA 3POSA 4SBVA 5BNPC 5FPUA 4N90A 1FNZA 5GJ6A 1LENA 4FFFA 1G86A 4BB3A 4IEPA 5DZFA 2K37A 1PIV3 1KJLA 3VTPC 5L7OA 1V6LA 1OFSA 1V6JA 2E42A 4PBPA 4XDQA 3AECC 3PP5A 1FOD1 1EV11 1FPN3 1PZ9A 1NQDA 1GV9A 1AQTA 1RF1A 1RUC2 2DVGA 2PXJA 2CK3H 4YZ3A 5HXVA 2PHTA 5T5OA 3RYRA 3MGUA 1YQ8A 5IVCA 3B7MA 4XXPA 3RL0D 5CBNA 2H8PD 2XV5A 3EWKA 3O5SA 4N9HA 3JU9A 4Q4X1 2ZVNB 4ZZ8A 4JGYC 5C8WA 3RGBA 4XA4A 3SFEC 1AR83 1RUF3 1UNBA 2FCTA 4LHKA 2P6CA 2CGPA 5KXDA 3WV6A 1LTTC 1GICA 1L0NE 2PYTA 2WNEA 4PQ9A 2WZR2 1J3RA 5AVAA 1WD3A 4YM2A 1ND2B 1OPMA 1W03A 5D8AC 2GZWA 2ATFA 1H0BA 5JR2A 3L9JT 5JZGA 1N7LA 3BASA 2LM3A 4PLNA 4AEDB 4XOGA 2K0GA 3B00A 4IE4A 1V6OA 5FPAA 1HJGA 3BI3A 1H1AA 4YG3A 3VBHA 3C9IA 1ULOA 2FHRA 5K0UB 2RMU2 1TMF1 3C7EA 1MFZA 1C8NA 4Y5SA 5JAXA 5J7MA 2G9GA 2P17A 4OYUA 2WN3A 4OHYA 3CX5H 4XACA 1IOAA 1F5JA 2X10A 3GBFA 3ROUA 3V2RA 2AZ5A 3PIGA 2ZA9A 1T2XA 3VBFA 1CPNA 4WY4B 1C5IA 3FUQA 4XMAA 4RESB 1YI2P 2HWB2 1AYN1 1SBEA 5APXA 1ZM1A 2VMDA 2VC9A 1D4M3 4GODA 4ZU5A 1XNKA 3KLSA 1O6UA 2QVSB 1N86A 1LOFC 1S0BA 1AR93 5GALA 3NV2A 1V00A 2XBO3 4K3UA 1FMD3 1Q2NA 2R5DA 1TMF3 1RUG1 3PU3A 1HB2A 5C4WC 2E76D 4KHXA 2QA4P 3WUUA 4A7PA 4U3FE 1WKYA 2WS93 3KM5A 5IVJA 2JP3A 3B5ND 3ZFGB 4PV1B 2A45I 2OTLP 3MO4A 2HH9A 2V4AA 2ORXA 1QQP1 5EWSA 3CCRP 4XTPA 2VMFA 2VTFA 3DYPA 4MGQA 1LODA 4QQOA 1XJAA 3DPRC 2YBSA 3U4SA 3AYCA 4I09A 3KQ4B 4GJZA 1H9WA 4CDUB 4HJGH 2JIJA 1BE3G 5F39A 5A3MA 2W47A 2ZOEB 3WQ1A 3WF1A 5AW5B 2HWB1 2FYUG 3BRTB 1SQPE 1JU4A 3OUIA 4HLTA 3VB9A 1NTZJ 3H1LJ 3W9AA 1S0EA 2WSCJ 4IV3A 4Z8BA 1OXZA 1PMHX 2H0VA 5L7OB 1IFJA 2ORZA 4IFFA 1SQVK 4BHPA 2QJKB 1H1MA 2VL4A 3AE2C 2E7TA 1HW5A 2WINB 3W5NA 4QX3A 4AW7A 2OYOA 2HPCA 2E76C 3SFDC 2A71A 2LW8A 2OQQA 1FAVA 2QZ2A 4Y5Z0 5L73A 4AVBA 4BQ1A 1JZ8A 4GWIA 3SH3A 1H0TA 2RS12 1GZLA 2HWB3 3M0DA 3OBTA 4UW3A 1FE6A 3BCCJ 3WZ1A 1CJDA 1HH0A 3H1LD 3A7QA 3P3PA 4B1MA 2NM1A 4P5YA 4LORA 3H8RA 4BJ0A 2RS33 5A70A 4BU2A 1HN0A 4B7KA 1XB9A 1USEA 1JUNA 2D7FA 3DEMA 3L75J 3EBRA 5KAIH 3HWJA 4MX3A 2Q6QA 4AVAA 1DQ2A 4BQYA 2YPDA 1XE0A 4LBKA 2P3KA 1NZIA 1WCDJ 1LJ2A 3PIJA 3THDA 4D0QA 3H1YA 5FIXA 1PX4A 3ZPYA 2CY6A 2GUVA 2YKQA 1H8VA 1Q5OA 2JG8A 5K0UC 3HTKA 1UZZA 1DIWA 2MEV3 1J2JB 2KLVA 5B66H 1OD5A 2OS2A 5IAXA 3CEWA 1S0FA 3PTYA 2FDJA 3NQHA 2VAUA 4QM9A 3UETA 1ZRDA 2OQ7A 2B9BA 2NZ2A 3AZVA 1DDLA 1SQXJ 1ND2C 1BK1A 5FZHA 5CFDC 5A1LA 1AL0G 3H1KG 1DGRA 4V2WA 4AQ6A 1SCRA 1AR71 2BGCA 2O14A 2XWJB 3THPA 5FMBA 4BZ4A 3OPTA 1AR92 3FX3A 5I0SA 1RUNA 4RS5B 3PLNA 3L75G 5A7SA 2XJRA 4PDWB 3OJAB 1OVVA 2Y38A 4GB33 3A0HH 2P5BA 4LBOA 5CNAA 1S9KE 2ZGNA 1B09A 3NJXA 2IBZD 4XHXA 2QEXP 1JN2P 4JYCA 4TXWA 3BTAA 5A7PA 4OI0A 4TSVA 4IV1B 3MFCA 4AFBA 1W05A 1VF5D 2GC1A 5FP8A 2FXOA 1S55A 3PTZA 4X6RB 4TLFA 2JKBA 5LBEA 4ZMDA 3H1KJ 2PAKA 2XNXA 3OGRA 4CTEA 2G1MA 2VZQA 1AR73 1U5ZA 2VOTA 2WZ8A 2OX0A 1Y9GA 5JMCA 2VW1A 2WQ4A 5B66E 3P1IA 1S1AA 5LRSA 3BRVB 2W92A 5LA0A 5DPNA 1NA1C 2PLV3 1GTWA 3ACIA 2RH0A 1YHFA 1HX6A 1MQTC 1UXZA 3HQUA 2OVUA 3W67A 1AR91 1NZCA 1W9SA 1BEV3 1ZRRA 2WRAA 2YBKA 3H50A 3R0RA 4K40A 1L7LA 1OXCA 2XONA 4KL1A 1ULFA 2DF7A 4QXBA 2HPCB 5DXDA 4ASMB 2UY9A 3I2HA 2B9UA 2PELA 1O4ZA 1OVRA 1OVPA 1OQDA 1HGVA 1YFUA 2YBPA 3K3OA 3O8ZA 3TF5A 2GMPA 5LBCA 1H0TB 2ZGSA 1DIPA 4L9BA 4XYXA 3CKHA 2QJPB 4COYA 2Z79A 3KV4A 2ZXEB 3KSCA 1AR82 4OULA 1GYKA 2VVDA 1XU1A 1ZRTE 4H0LB 4LUMA 5EQUA 4D6RA 1AR63 5FZBA 5CB7A 1NO4A 4ZHNA 4AEKA 4B86A 3GHGA 2F4PA 3MI8A 5FDBA 3LIEA 3N9OA 3UESA 1EAH2 3IPVB 5FLJA 2BJSA 3N7NA 2ZAEB 2ZBJA 3UJOA 3ZSJA 1PIV2 1VB2A 1HDKA 4NWWA 1U7JA 2AREA 4OCTA 5FY5A 1BJQA 5FZGA 1OA2A 3IIAA 3SC7X 3HTKB 3VBHC 1KQFB 2CWSA 2RKLA 1AYM2 1LWUA 1S4XA 3VDDB 4JTOA 3M0AA 2ZT9D 1O3TA 1LT1A 4GOFA 3S9OA 1YIJP 3RDIA 4H44C 1AF9A 2CGOA 4A6OA 3CX5I 1QXPA 2NN8A 5FKBA 2B45X 3QH6A 5AVZB 1QDCA 1ASJ1 2YHJA 1SLLA 3M8LA 4RS5A 3TEWA 2XHNA 4GOEA 1QXJA 2HWC3 3ITQA 4PDWA 2ZGLA 3K4DA 3K5BA 1W8HA 3U14A 3J4UH 4JDNA 3WG1A 2J1EA 1LP1B 1BBT3 1YNAA 3SISA 3WG4A 3U0ZA 1H4HA 1F9KA 4UW4A 4XQWA 2E53A 1O4YA 3INAA 1UMHA 2XUEA 2ZGUA 1HJBA 3LFMA 3N7MA 4AI9A 4EN7B 3U4XA 2VTXJ 4CUAA 4RYDA 4EDFA 1MEC1 3LSEA 3CC7P 4XUPA 3FL7A 3H1HD 1W9YA 5F2WA 2C24A 4B4QA 5JMOA 2R072 2IVIB 1DD4A 3GMAA 3AP5A 5F7UA 4Z2AA 4K1YA 2W90A 1JO5A 3D70A 1XE7A 3JC22 1MZ9A 5FZFA 3KV5A 3ACGA 1O8PA 1E79H 5GLTA 3ZYGA 4CP0A 3A23A 3Q1MA 2OT7A 1YQCA 3N3HA 1ZRIA 4XF1A 4KT0J 1ZBE1 1KFMA 1MS4A 4R9CA 1W04A 2A1XA 1PM4A 4HSLA 1DZQA 2L5GB 3MGNA 3JZVA 2QM7A 1LGCA 2OZ6A 2WSUA 4YM1A 1Y9BA 2AEMA 2GSYA 2BV4A 2RHPA 1KRIA 1APNA 2ZACA 3VZLA 1ULPA 1NGMB 5FUPA 2A3XA 3HIFA 4E4HA 3WT3A 1N47A 4EWDA 5IATA 2E5YA 2Z5IA 1NTMK 3AJZA 3IBMA 1C5HA 1UOFA 2W6JH 2YROA 1VLNA 3RBZA 4EI2A 3HBKA 4KMQA 1TNFA 4W50A 4XETA 1Q82Q 4YW7A 5LBBA 5I8TA 1CAXB 3PVEA 5F3GA 1PL5A 1N2DC 3GHGB 2AYHA 1ZBE3 4Y4RA 3LOBA 1JI6A 1HRV3 3FX0A 1RE4C 2UWCA 4Q1RA 3JSVC 5KAFH 1G6NA 3PUIA 2D44A 2ZAAA 4RSUA 2PLV1 3H3ZA 1LGHB 5B4NA 2FZ2A 4JDMA 3I3BA 1ND3B 4A44A 2XB6C 5J96B 2CNAA 1GW3A 2J59M 3UV9A 3VDDA 5IK8A 3PVBB 2QJYC 2IXIA 3L72D 4JC1A 4DT0A 4C91A 5JOWA 3HE5B 1JHJA 1LHUA 2QQNA 2XVLA 3OGSA 3VHNA 3KB5A 1MUUA 5J98B 3WNNA 2B89A 2C4XA 5FZOA 5FZ7A 5BNOC 2XKOA 4ZONA 4GH4B 3AP4A 1AYM1 5FO9B 2WO3A 1W8OA 3UGGA 4JQRA 1IGOA 2KK7A 5A7WA 3AE1C 1IPJA 1LNSA 1BE3J 2VU9A 5H2FE 4H44D 4JGZC 5I0DA 3BCWA 3ZFEA 2J1SA 5BYNA 1LP1A 1PGJA 1AR61 1L7QA 2XLAA 2C1FA 2MPFA 5G05L 2N9YB 1KORA 2QRXA 1BBT2 1F4AA 1X8MA 4K9SA 3PMEA 4N53B 1N7SB 2OYIA 2N1TB 2QE7H 3LZZA 5FJHA 5BU5A 2FYNC 3H1LE 1VQ8P 1S0DA 4P9JA 4XJ8A 3ZYJB 3A22A 5CEHA 3JBG2 4KH9A 3T1LA 1MS9A 2PHWA 3TN91 5ACA1 3EJKA 1JZ4A 2OYHA 3ZXFA 4WVZA 3GALA 2J58A 1OUXA 4CU6A 5JOZA 1POQA 1GZTA 3LDRA 1H2NA 4GIQA 2LKMA 4NR1A 4FOYA 1SQQG 2JE8A 2Q9IA 1OBNA 1ULDA 3MV11 4BXLA 1R093 1LTJC 1QVGO 1QJY2 1FPN2 3LIHA 3D82A 3FXEA 1GZWB 1LEDA 4U3FJ 5KR7A 3PJSK 3HN1A 2VZTA 1L3JA 5JOXA 2BZDA 4IEXA 3WF2A 1W8NA 1WW4A 2VQ0A 1DCSA 4GWMA 1AUYA 5B2GB 2XOMA 1FATA 3HPNA 2WQ8A 4N7IA 4XBNA 4FSJA 1BBT1 1G9FA 5APVA 5KLVD 4BQWA 5JXJA 1VL2A 2D2CC 4KJMA 1MR5A 2WSSH 2VGDA 4NE9A 4F3JA 1SQXK 2UWBA 2WZEA 1NHLA 4QT6A 4AVSA 3W5MA 5APYA 4HBNA 3RJ2X 1NU1J 3AE7C 4HK8A 2E74B 3L73G 3VGIA 4CRQA 1SDWA 3S57A 1CWPA 1ZZCA 2NPSC 2A3WA 1VRBA 2WR9A 5D8AA 3PU8A 2RM22 2YDEA 3MF6A 3S6PA 4Y1VA 3B3QE 4MYEA 1EZVG 1YJLA 3AMQA 2FDHA 5C8CB 3LPFA 1CQ9A 4Q1PA 4AEMA 3CLPA 2ZS6B 1XTCC 3KZIE 2HWE1 1FS0E 2O8QA 2QG4A 5A7NA 2WNUC 4CYDA 4AUWA 4UFLA 2PLV2 4GMP0 3D6EA 5DG1A 4BA6A 5CG8A 4UF0A 3I7DA 4IL6E 4E27A 5FZOB 3O0WA 3USSA 2GNDA 3E97A 2I07B 5EJ1B 2ZXQA 4GH4A 5LEJA 3PUQA 5FZLA 4AAPA 4ZXKA 1YYCA 2UU8A 5A7WB 5A1AA 1SQPJ 1GP5A 5FY0A 1LHOA 3V2PA 2PQSA 4OHWA 5T5LA 5KXCA 3SH4A 2R5BA 1NU1K 5C3PA 1Q7YQ 2FFDB 2ZEWA 4I3PA 4HANA 1MACA 4CCJA 1MV8A 4BYYA 3PUAA 2AH2A 1MS5A 3UIAA 1W6MA 4PJ0H 4A7ZA 3QH7A 2N1TA 2GNMA 3NXSA 1L4AD 1IPSA 5LA1A 3M9HA 3ASIA 1MS8A 1UOJA 4ASVA 3L70E 3D6YA 1W2BO 3T4HB 2WQZC 3VD7A 1NU1D 1VDFA 3WR0A 3M3EA 2JE9A 3L71J 1RE3C 3NVCA 1LHVA 1HXS3 1UZWA 3LDKA 4LJHA 5DUVA 3DYMA 3RJRA 5CA6A 1BCCE 1R081 5FZIA 2JB8A 2BTVC 1OSGA 4QWNA 2RV9A 1URQC 1DLCA 5FP9A 2D6MA 4DRRA 2ES3A 2E75B 4O65A 5FMOS 3DYOA 3U1CA 3AFGA 4EOTA 5FBJA 1K3IA 3OPWA 4KU7A 4Q4Y3 1M4WA 1WT6A 1XYPA 4NIAA 3N35A 3CLQA 4FAGA 4RJTA 1RUC1 2FY8A 1K05A 2W46A 3BVCA 4J1WA 4LK7A 1BDCA 3C2UA 5AFEA 3ZSMA 2B87A 2WZPP 2FYUK 4HPKB 4XTMA 3W21A 3WCSA 2QUOA 4CUGA 5I91A 5IK4A 1DQ5A 5LW9A 3TDKA 1ENRA 4PJ0E 3V5BA 1ZZBA 1SPPB 3IIIA 2D40A 4YG6A 3CXHI 1SQVJ 4XW3A 5KXEA 3RNSA 2AEFA 4LKDA 2HLOA 4S2DA 4YVSC 3K2OA 4LKSA 5A32B 2QQKA 4CP2A 1AXYA 3BCCD 1CAVB 5JSOA 2H89C 2R44A 2QKDA 4AWDA 1NTZD 1LTAC 1H6XA 5A33B 3H0OA 2OA2A 1L7RA 1UU5A 3AMHA 4UBHA 4N78D 3B5NA 5FTTC 1BGYE 1G9CA 1JY3O 3Q5SA 4QGLA 3T2TA 1W90A 1SG3A 3N9MA 3ZYPA 2I1KA 1VALA 2E9QA 4Q4V3 3WLUA 4X8PA 2W0XA 5TSWA 5IVEA 3VBUA 1SQBG 3RI9A 5C9AA 3JB4C 4UFJA 5CMZA 1RUE1 1V6MA 1SQVD 1QLED 3HD8B 2E75D 3BODA 1AX0A 4YGEA 4UF0B 3N7JA 2WWWA 1OKQA 4W6WA 3ZSEA 1H8TC 4JDOA 1PZ8A 3LW5J 4XFJA 4YVWB 2FCVA 2BWCA 1JOPA 2N1TD 5JPNB 2NPIA 3AFKA 2C0WA 5EV7A 4MHRA 3RL0C 1SCSA 3W20A 1NWQA 4LE3A 4J6GA 1H30A 3VMYA 4XCAA 4L73A 2WNVA 2P4EA 4BDVB 1FNYA 3PH0A 2YMKA 4EN6B 2WZ7A 4WM7B 4XIKA 3JD71 1D2QA 3VBOC 1NTKE 1W9TA 2UYAA 2P1JA 1HRI3 4PIXA 3AMNA 5JXIA 2BQPA 4E8CA 1TMF2 2Q1FA 3SHRA 4FTSA 3N9QA 3RMXA 4L99A 1IG3A 1KB9E 1UMIA 4XE9A 1F31A 4UXAA 5FWEA 4FOQA 4QPGA 2C0ZA 1GNYA 3CCJP 4BMBA 2GA1A 4M0HA 2WWJA 2VXJA 1VBC3 3M3CA 5AVTB 4HVOA 4O61A 1OX3A 2ZFCA 1WMKA 3VP8A 2WO7A 4XF4A 2P67A 2WZR1 3AB0A 4XZUG 1Q43A 1TME2 4H3WA 2WA3A 3BATA 3IMNA 1S3JA 4LEJA 1YFXA 3O14A 4XFIA 5J1XA 4E2GA 1KILD 5GZGA 1BSHA 1UY0A 5C3QA 5CKMA 2ZMNA 1HQNA 1NLSA 3IN6A 2DDUA 2HWF3 3ILFA 3VKNA 1O59A 1LHWA 4HPKA 5T3NA 1LB2A 3L70G 3E1F1 4WZFA 3WX5A 5HCBA 1IFNA 2PA7A 4I3GA 1GBGA 3NAPB 1KB9I 1KYOD 1NTMG 3RK2B 4XFHA 1LCLA 1SPPA 4KI5M 5IHRA 3VD9A 1IG0A 1YO8A 4KQ7A 3E6DA 4HN1A 2G3AA 5DJUB 3IB3A 4A6SA 1RMU3 2AGSA 3V65A 4CE8A 5A32A 2WUHA 5FZ1A 3K4ZA 1GMJA 1CAVA 2E7AA 2N7GA 2W52A 4R9AA 5LZ6A 1M1JC 2OXBA 5APAA 2GH8A 2PAMA 4CDQC 5AC92 1G9BA 4FPJA 3PRJA 4XILA 2OKXA 3FWLA 3OW2O 5FQ0B 4ZKUA 3LEGA 2IBZI 1ONAA 3C3VA 4YWAA 4ASKA 4TZDA 4CCEA 2B8MA 4D6QA 5K7PA 3T2OA 1RUG2 1NA1A 3ORJA 4CDWA 3VBUB 3KDPB 1VQLP 4BCUA 2QQMA 5C9AB 2YC0A 3PVNA 1I5ZA 1J1DC 5F3EA 5DAQA 4ZXEA 2VZOA 3WOGA 3WQ0A 1FYUA 2VUDA 5FY7A 2X5IC 3ZN4A 5KKZB 1NYWA 1P84I 2QCSB 4ZS2A 4BIFA 2W39A 4YVWA 1FDOA 1L0NG 1GP6A 4EWEA 2W68A 3RK3C 4FPLA 3WD5A 2QJVA 2ZTNA 1A6CA 4B3NA 2E6VA 2M5AA 1SACA 2P7JA 3N4XA 2AXCA 1BDDA 1XYOA 1LTSC 4WVMB 4FFHA 5FREA 2P2KA 4QQPA 3MPPG 4OVNF 3CMGA 4RFT0 4WM7A 2LUWA 3M91A 2DCTA 4HKZH 3N9LA 1JZ7A 2V4VA 1IJDB 3WF4A 3GDBA 3TWIA 1KFNA 3N7KA 4Y33A 4GT1A 4YYOA 3CXHE 4QU1A 4JQTA 2KD7A 5KXBA 4CXYA 1LT9B 1GLHA 1V0AA 2BFUS 1NE6A 1ND2A 4AG4A 4MZUA 4XF0A 1JYNA 2VMHA 3CJIC 2KXPB 5L9BA 1OURA 5JZGB 1KGYA 4WM8C 1R5SA 2EICA 4N7UA 4RHV1 3D4KA 2Q8CA 1NAYA 4AEDA 5FO7B 4ET7A 4CDQA 3KQGA 2XWBB 1ENXA 1HRV2 1JUHA 1JTHB 1UYYA 4XCBA 3O0VA 4LUKA 5JZGC 2Q5UA 1VBE3 4E2SA 1VBD3 2YY1A 1C8M1 2BGPA 2VMEA 4GKGA 1NXD1 2BOJA 2Y6FA 3FC0A 4L97A 5IAVA 5C71A 3H9AA 5I93A 2VZSA 3IWZA 3WMM0 1GANA 1FZCB 1YQ5A 2F17A 4TWTA 3TAYA 4DZGA 5A3WA 1Y8AA 2ZYGA 3VOPA 3VMZA 3QACA 1XYNA 4HKWA 1X0TA 3AX4A 4QPIA 3NKTA 4B7EA 4E8DA 4HT1T 4BPZA 2RDSA 4DY5A 2M3BA 3LAGA 2I2SA 3WCRA 2ZT9C 1DH3A 5EJZB 5FYIA 2CDPA 3PTRB 5AVSB 4OMDA 5H9RA 3WP5A 2VNRA 5JPMB 1Y3TA 1MZ6A 4KWKA 3F95A 4H13C 1A8DA 3T09A 3SXWA 2VNVA 2KOGA 4AGRA 5FCCA 1BMV2 1UX7A 1J3PA 4XUNA 1FMD2 2FDIA 5AC93 3GG2A 1REEA 4LO8A 2KYVA 1SQBD 3MEPA 3OBRA 5BVZA 4DO0A 4RGAA 1YBKA 4YG0A 1QL1A 4Z2WA 1K9MQ 5HBAA 3O1SA 1C3HA 3I2DA 4M00A 2V72A 5GZEA 1PPJE 1W6QA 4AHWA 1KFUL 1W8TA 2VOVA 4LO5B 1SQBE 3N4MA 1IS4A 3CD6P 3ZKUA 1GD2E 5APSA 1NCRC 1K8AQ 4QHOA 2QQIA 3SQOA 1C1FA 1PGL1 4JAAA 2XQRA 3A4UA 3AM2A 5C3OA 4ASLA 5EHDA 3BN6A 1QJU2 1POV1 5B5EH 4O9GA 1V70A 4RR3A 1MS0A 2AC1A 1RF0A 2G8YA 3KS7A 1NY71 1RMU1 4P9YA 1R1A3 1OFNA 5DQ0A 1L4AC 2YIUB 1N73B 2X53S 3GF6A 5JIAA 4QX7A 3E1RA 2Z42A 5KLIB 4LHSA 4M3CE 3S4RA 2YGMA 4HK9A 4P9XA 3VZJA 2PN5A 3D3AA 1J3QA 5KHHA 3NV1A 5KJ7A 1IZ3A 4D6TE 4IFDK 1GP4A 2A6YA 1LT9A 2B4KA 1DQ6A 1Y7BA 2ZGTA 1WLCA 1PP9D 2K2SA 1UN1A 1PIV1 4HZFA 4JZRA 4S2HA 5T5PA 1PO11 3LB9A 3PURA 4JX0A 4XC9A 4ORFA 1WGPA 4GJYA 4YXDC 4Z82A 1NG0A 3EFFK 3T97A 1OQEA 2JDUA 2WS92 3GHMA 3RBXA 2BASA 3HUSC 4W7YA 4I6MC 2A73B 4I0WB 5FY8A 3LD8A 2FKWB 3II6A 3ZXJA 4EWAA 5FPZA 1PO23 1J1EC 1COV1 3R2PA 1AJOA 3PVOA 5J3UA 4Q0QA 3OGJA 2YG0A 1AR81 2PP6A 2BFUL 3KD4A 4G9SB 5GTHE 2JG8B 1FZCA 1S4CA 3OY8B 1T3UA 2AENA 1ENSA 4FCAA 4W4ZA 1QJX2 2ARCA 1E57A 1RUI3 2V09A 4Y1UA 1R092 3T2PA 2JWAA 1LKNA 1Y47A 1VAMA 2Q8DA 4P14A 2OYZA 1BVVA 1QJU3 2DUPA 1NAFA 2K9JA 3CI9A 4RQPA 2W1QA 2C5DA 4MXWA 3IN9A 1TME3 3ON7A 4W65A 1RH5B 3VMAA 4AFDA 2BEQD 1JOBA 1XNAA 2W83C 1S5LE 1CZQA 3A21A 4U2AA 2YPJA 1YTZT 4L2NA 2WFPA 3BPSA 5A7QA 1UWWA 1ZBA1 4X8NA 5LATA 4W6YA 4EZ4A 2UYBA 1RF1C 1RUI1 1JCCA 1SQQK 2B39A 2PHUA 5HCHA 5A6XA 3L36A 4I01A 2R073 2BBVA 4QKFA 5FZDA 1N1VA 3CZJA 5AVRB 2VOKA 3URFA 3TOJA 3P3NA 1W6QB 2RS53 4YGBA 1ZW0A 5LA2A 1ZBE2 3VBFC 4JHTA 3RK3E 4BQ2A 4EJRA 2ERFA 3HD7D 1FOD2 4CEYC 2BNNA 5KHJA 3ENRA 3TEXA 4YSFA 1LECA 1NTKJ 2YV8A 2PMWB 4NN0A 3VBSB 3KZ4C 5A6QA 3ZSKA 4LPLA 1O3QA 3SWFA 3A2AA 5LASA 1UOBA 3FBYA 4PHZA 4RR3B 3GZUC 5CCGC 5C5UA 5CCHC 5FPLA 5DMYA 1MZFA 4UB6E 3BIWE 1DEBA 1BVP1 1AX1A 1H9PA 1Z7S2 1N73A 5FUIA 1IO4A 3I97A 4CSWA 3FFQA 2Y64A 3AL6A 3FBMA 3G9RA 3L4FA 5AW6B 4IGOA 5GLVA 1AL23 3K3NA 2R3CA 4RL7A 4NPMA 4PF1A 3AZXA 3BALA 3IDEA 4UFKA 5M0TA 1RMU2 1RUD3 1X9VA 2YO3A 4IL7A 4CDWC 3WINE 1HIXA 1C28A 5A3OA 3MUDA 2VD7A 4IEUA 4A42A 2GALA 1E5WA 1RINA 2WT1A 5EFWB 3ETPA 1SLQA 2X29A 2ZHKA 5FYBA 4BK5A 4C90A 4CPGA 3L71D 2VM9A 1GQGA 1PZQA 2OUHA 3IPVA 3EB7A 3LDBA 3NV4A 1YJ9P 4OHXA 1BE3D 2CTVA 1OOPC 3CCVP 5EIYB 4BOWA 1AYN2 3AKQA 2QDRA 4QPIC 5IJRA 2V73A 1QY4A 3H1IJ 1WMXA 1FOD3 1FPN1 3L2HA 3OY8A 4IE7A 2R30A 5FRAA 3VBRB 3NNGA 1RUD1
chains in the Genus database with same CATH topology
1Z7S1 2DU1A 5K9YA 5FFOC 2DCKA 4RQPB 2XJPA 4H14A 3WNXA 4WVWA 3B9IA 2VMIA 1RVF1 1KJRA 1V9U1 2A75A 4Y4YA 1QQP2 1O4TA 1JW6A 1QXRA 3IT8A 3FHIB 4F8AA 3MZHA 3MDPA 4TYSA 5IK5A 5E88A 4P9WA 1MZEA 4XPVA 1IS6A 3PMSA 1PO21 2YMZA 1YJKA 2RM21 1EAH3 1UKRA 4Q26A 4K20A 1ZBA2 3H8UA 2B42B 2BVBA 5BNNA 1RVF3 1V9U3 4DFSA 4HFSA 3NW4A 4L8QA 1AR62 4BLJA 4Q29A 3K48A 3VBSC 3WQ7A 2BEOA 5DG2A 3VBSA 2EIGA 1ZRFA 5CG9A 2B46X 3R4UA 3I59A 2R49A 4HETA 3HQXA 1ULGA 2TBVA 5FOBB 3WP4A 4WVVA 1U12A 1QQP3 5LEKA 3BPZA 1AJKA 1LOGA 5AFBA 1CAXA 1HLCA 4ZU4A 1EPWA 3APBA 3JQXA 3V0BB 4META 5CFDA 1W6PA 4MXVA 4A3XA 4Y20B 2RS32 4QHBA 4EN8B 1ND3A 2DYCA 1AVBA 4YW5A 1W6OB 3VBRA 2EXIA 2XVGA 2WL1A 2X8KA 4GB32 3RSJA 3MIBA 5J09A 4AI3A 3R05A 3AP9A 2PQQA 3RPQA 3WDUA 4D69A 2P37A 2XPJA 2RR13 3O7OA 1D4VB 5GLZA 1GNZA 3ZFEB 1UKGA 2B7YA 4AYUA 3HAGA 1C8M3 1QU0A 1RVF2 4P9YA 3ZIXA 1PVC2 3M1HA 4CZSA 1OLQA 1RJ8A 4R8HA 1YXWA 4JVAA 1Q8OA 4AQTA 2GC0A 4CDXA 3U07A 1VBC1 4FP2A 2WNVC 3POYA 1OMIA 1OQ1A 2HWC1 3B94A 3VHRA 4CDXC 1REDA 1QDOA 4LHNA 2JG9B 4A7YA 4Q0VA 3WG3A 2VUAA 4KGGA 1GZWA 3AKSA 3AZZA 4LBJA 3OCPA 2XLGA 4JV4A 1GSLA 2YZ4A 4Q4Y2 1DLLA 1I3HA 3AKTA 4XBLA 5GM0A 4MH0E 5EXOA 1Q56A 1O7FA 1CD3G 1EAH1 1VBB1 2IXLA 4KNCA 1VRH2 5DDJ2 3WV6A 1A8MA 1B35C 2VVEA 1O5UA 4NHKA 1S0GA 2RJLA 3IM0A 2W08A 4QQLA 3AMPA 4ZKTB 1BZWA 1B35B 4GQ7A 4WV8A 1WMFA 1YUDA 1FV3A 2PHLA 1R1A1 2VNGA 2R063 5SV5A 1JHNA 3I8TA 1UIJA 3WW2A 1A3KA 2KM2A 5LRRA 1UX6A 1KDMA 3ZXEA 3AYAA 4E4ZA 2WFF2 4PLOA 2R32A 3RWNA 3GHNA 1RUE2 4OUSA 5I0RA 4MGKE 1H4GA 4U36A 3V64A 1COV3 1DQ4A 4CDXB 2VXRA 1I9RA 3N36A 4PLMA 1UZYA 4IXLA 1XQNA 4DY3A 1ZZ8A 1T6GC 1OPOA 2EA7A 2YYOA 3U11A 5JDBA 5I0TA 4AI1A 1X7NA 1RUH1 4Q4W1 2ZMKA