4WVZA

Crystal structure of artificial crosslinked thiol dioxygenase g95c variant from pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
195
structure length
195
Chain Sequence
ILRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPGQITPVHDHRVWCLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate and pH-Dependent Kinetic Profile of 3-Mercaptopropionate Dioxygenase from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa bwhpsa021
molecule tags Oxidoreductase
molecule keywords Thiol dioxygenase
total genus 48
structure length 195
sequence length 195
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4wvzA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4wvzA02
1ZX5A 1YUDA 3RYRA 5KHJA 3H50A 4QMAA 4LTAA 2OA2A 2QNKA 4IEXA 2BNNA 1ZRCA 4Q0PA 4KU8A 5LRSA 2UY9A 3SMHA 2BGCA 1ZZ9A 4IEOA 4QGNA 5KHGA 4TLFA 3O14A 2Y0OA 1XE8A 3I7DA 2Q1ZB 5FQ0A 4XFIA 2QJVA 5FQ0B 2PHLA 1VP6A 3ROUA 1I5ZA 3OTFA 1Y9QA 4H7LA 4E2QA 3EJKA 1NYWA 4HVRA 3BCWA 1ZRRA 3G7DA 3USSA 1ZVFA 4ZU5A 1IFPA 3WW2A 2D40A 3NVCA 4D7SA 2IXIA 5FCCA 3I59B 3H7JA 2ET1A 4XFGA 2GC2A 3LA2A 4HSLA 5D1IA 5LEJA 3CO2A 3OD0A 3MZHA 3RYKA 3S7IA 2GU9A 4PJYA 3S7EA 3EBRA 4X6RB 4J1XA 3E97A 3RPQA 2QCSB 2Z69A 3IBMA 4DINB 3M3IA 3BU7A 3UKVA 3ES1A 1I6XA 5T3NA 3E6CC 5BPXA 1HW5A 3RNSA 2UY8A 1IPJA 4EV0A 1RTVA 3RZZA 3JZVA 2K9ZA 1FI2A 1GQGA 4HBNA 1EP0A 4Q0UA 2PAKA 3QOPA 4AVCA 4EROA 5C6CA 1DGRA 2PYTA 1OMIA 2IXJA 3RYPA 4GULA 2CAVA 1EPZA 2FQPA 1E79H 1QY4A 2QVSB 4KWKA 3C3VA 1J3RA 4HN1A 2FMYA 2H6BA 3EHKA 1UIKA 2H0VA 1WLTA 2CGPA 2OZJA 4JVAA 3TNQA 3KCCA 3D0SA 3PJSK 4MUVA 4Q0SA 2B8MA 2W6JH 1O3TA 2O8QA 2CK3H 3ETQA 5CVRA 2N7GA 4LUKA 1VR3A 3SXWA 4UBHA 4AQ6A 1O3SA 4LLOA 1OD5A 2OYZA 5JCTA 5E1RA 1ZZ8A 2BNOA 2VQAA 4MZUA 4LULA 4IEYA 5LRRA 1JEKA 2XKPA 2BEOA 3FZ3A 3H1MA 4IEUA 3R6SA 1YFXA 1RC6A 5CADA 3NSTA 2Q30A 2VPVA 2UYBA 3ACLA 1ZZ7A 2UYAA 2MHFA 3CF6E 2ATFA 4IEPA 1ZZBA 1J3QA 4PIXA 4MGYE 5EFUA 3U0ZA 4HZFA 1J58A 2PTMA 3EO6A 5BV6A 2ZCWA 1RL3A 4EWDA 4I0AA 4XETA 1CAUB 2B9UA 3BPZA 3E5QA 2GH2A 4LA3A 1UW8A 2D93A 3WW1A 1ZZ6A 4MV2A 4KU7A 4BIFA 2XL7A 2XLAA 2QE7H 3IDCB 4MGZE 4Q29A 2PAEA 4YSFA 2PQQA 1L3JA 4UBGA 1CX4A 1CAVA 5LEKA 1CGPA 1RUOA 2JDIH 2XLGA 3UKNA 2XLFA 1XE7A 2ETEA 5JAXA 3SCGA 3NKTA 1RUNA 4HLTA 2DCTA 1Y3TA 5I93A 3SCHA 4PIYA 1V70A 4OFGA 3ZDSA 2D5FA 2E5YA 2IXKA 4RD7A 3RDIA 4I01A 5KHHA 1CAWB 3DKWA 2CAUA 1GQHA 3SHRA 3MPBA 1UPIA 2B5HA 5FDBA 1CAUA 1Q3EA 1WA4A 1H1MA 1O7FA 1YFWA 2IXHA 5FLJA 4MX3A 1J3PA 1O5LA 4HMZA 4N9IA 5F1RA 5BXXA 3ELNA 2ET7A 3LAGA 4IEVA 4QM8A 1DZTA 3NW4A 3H1WA 4P9GA 4QXKA 2Q0AA 4AQ2A 5HI0A 4AVBA 1VJ2A 1FXZA 4AVAA 4QGLA 3H9AA 2GZWA 1EY2A 2GC3A 3U11A 2O1QA 3IIAA 3PLQA 4WBBA 1FS0E 1SEFA 2OPKA 4L11A 4JV4A 1LR5A 3HQXA 4XF9A 3MYXA 4PIZA 1DZRA 2H6CA 1CAWA 3FWEA 3N4MA 4MH0E 1RGSA 4N9HA 1AQTA 4ORFA 3LOIA 4B29A 3H3ZA 3KMHA 1LKNA 2C0ZA 1ZZCA 4FBFA 1Q5OA 5CU1A 4YYOA 4K8FA 4MGKE 3DN7A 3H3UA 1O5UA 4OLLA 4HN0A 3E6DA 2WC2A 3KGZA 4HVQA 4YARA 4R8HA 1YHFA 2MNGA 2XGXA 4IESA 4XFCA 4I02A 4YNIA 5BUVA 1UIJA 2MPFA 3CLPA 1X8MA 4BH9A 1SFNA 4I09A 4IEQA 4KWJA 4O9GA 4ZU4A 3H1YA 4HSJA 5I8YA 4D7TA 1QWRA 4I2OA 3M70A 3L2HA 3LA3A 4XF1A 3WW4A 1CAXB 4HVOA 3I59A 1X7NA 3OF1A 4J1WA 5FLHA 1X8EA 3FE5A 1UCXA 1O3QA 2WFPA 3IDBB 2OZ6A 3HT1A 2IXLA 3NJZA 4KL1A 4YRDA 4EWAA 1BSNA 3D82A 1SQ4A 3EFFK 1LB2A 3E5UA 5I91A 3I54A 1O4TA 1YLLA 2XNDH 3VHRA 1CAXA 2E9QA 3UKTA 4KWLA 4BHPA 5I8TA 1X82A 3EQEA 5C8WA 4DJGA 1J1LA 1U12A 3H8UA 4UXAA 2GAUA 5FPZA 3HIFA 2PAMA 5AVPA 4IEWA 1G6NA 1ZRDA 1NZCA 4XF3A 3KSCA 4F7ZA 2I45A 1OFNA 5JR7B 2BYVE 1PMIA 3CEWA 3QACA 2PFWA 5BY5A 2XKOA 4WVZA 2XL9A 3D0JA 3DL3A 3DV8A 5FPXA 3ES4A 4FT8A 4Z07A 1BSHA 2HJIA 1QXRA 4I3PA 4IETA 4XFBA 5I8SA 1NE6A 4O9EA 3LA7A 4IEZA 2EVXA 4IERA 2XHKA 2GC0A 2ZKLA 5I0RA 3BB6A 3PNAA 2QDRA 3IWZA 2E5TA 5FLIA 4WZCA 1ZRFA 3FHIB 4E2SA 1ZNPA 3PVBB 5J3UA 5J7MA 5KBFA 1WGPA 3FJSA 4LA2A 4L2NA 4X6QB 2EAAA 1ZREA 4QX5A 3OGJA 1OI6A 3KGLA 4CYDA 3LWCA 3FFQA 1DGWA 4E2GA 2BNMA 4JTOA 2IC1A 1FT9A 2EA7A 3SCFA 2K0GA 5E16A 3CJXA 3GBFA 1XRUA 5JSPA 4YXWH 4LEJA 5EZWA 2V7QH 2P17A 4AXOA 1O3RA 4A2UA 4FAHA 2F4PA 2IXCA 2V09A 3U10A 1NE4A 4XF4A 3HT2A 1TQ5A 5JSOA 1CAVB 2Z2SB 5KHIA 3E5XA 2GC1A 3BALA 1PM7A 3FX3A 4BYYA 4XEZA 3WW3A 3CL1A 5I0SA 2WSSH 2PA7A 1YFUA 1H1IA 4LUMA 4META 4MGIE 2PHDA 1Q43A 1YWKA 4XFAA 3S0MA 2HKXA 4XF0A 3ST7A 2CV6A 1J59A 3MDPA 2Q4SA 2KXLA 1YFYA 4FAGA 3H7YA 1IPKA 4XFHA 4F8AA 4I0BA 5KHKA 5JSRA 1UD1A 3GYDA 5I0UA 5K8SA 3NL1A 4ZU7A 1LRHA 1EYBA 5J48A 4EWEA 1QXJA 3E6BA 4Q0VA 2D5HA 4QGMA 4QM9A 3LZZA 4ONUA 2VECA 3OCPA 4Z82A 1NXMA 4JTNA 4XFFA 5I0TA 4Q0QA 1JUHA 4NVPA 3TNPB 3B02A 4R52A
chains in the Genus database with same CATH superfamily
1AYM2 5AW7B 4MXVA 1LTTC 1JY2N 4N43A 1YUDA 4QU2A 4K7JA 4BQ2A 5AC92 3HOBA 5BNPC 3JCUH 3RYRA 1X36A 3S5AA 2ARBA 3OGVA 4DUXA 4JGZC 2QNKA 2FXMA 3H0OA 2YNYA 1ZRCA 4B1LA 2EIGA 5LK7B 1NKNA 2UY9A 1A6CA 1NCQB 3WNLA 4QQ2A 4DY3A 4H7MA 1SFCB 1OPMA 3LFMA 5FWEA 2YXSA 3N35A 1QJFA 1S0JA 4CE8A 2DWRA 2BCCE 4X8PA 3H1LD 2WTYA 3THDA 4CUGA 2CPBA 3O1MA 3M2MA 3VMYA 1DYKA 2YKOA 1OPOA 1JTZX 1XE8A 1MS9A 3HQUA 5L9BA 2QJYC 5BU8B 1MR5A 1O91A 2Q1ZB 4K40A 2O01N 2ZX3A 3VGIA 4AZZA 5JOZA 1HXS1 1G86A 1UU6A 2YKQA 2BQPA 3FLPA 2QJVA 1COV1 1TNRA 1XPWA 4K9SA 3T30A 3SEPA 1G9CA 4I1LA 1W3VA 5ERLA 2NMNA 2ZZJA 1LTEA 3N7LA 4H2AA 3VDBA 3SC7X 1M1JA 4CZSA 4N7UA 1DGWX 2Y0CA 3GZTB 2YU2A 4AAXA 3OEBA 1NGMB 3N9OA 3EJKA 1SQPJ 4E2QA 1E5WA 4OGQC 1S2BA 1JM0A 3MGNA 2RKLA 1XXNA 2ZT9C 1QU0A 3KHUA 2DFCA 2YU1A 1ZR4A 2VE1A 1GICA 3ASIA 3IKWA 1IFPA 1L2PA 4ZU5A 4DIQA 1JYVA 5IK7A 2R5DA 4D7SA 5E8AA 3QH7A 5FCCA 1X22A 4NPEA 1FOD2 3CC7P 2LXCB 2RS51 3D70A 2AXCA 5LZ6A 2QM7A 4JGYA 4WY4B 1HDKA 5CHXA 2G4IA 3RRDA 5A3PA 3GF6A 2HODB 1AXKA 4WY4A 3SISA 1W99A 4P9LA 3IIIA 1WW4A 5LA2A 3MZHA 3VOPA 1PO12 1VBC2 3IZOA 4DMIA 2LUWA 2O8OA 3P1IA 1EDLA 2BGOA 2GU9A 4Y24A 4RS5B 1NTMK 3L35A 1BJQA 4X6RB 1WMEA 4BWNA 1S0BA 3TGUD 3HWJA 5D2AA 1MV8A 4NO4A 2PHXA 4IL6H 1H0BA 3T1LA 4GOEA 2WR9A 3M3IA 4DXRA 3CPWO 2FMDA 3DKQA 1W28A 3CCSP 2RS11 3WF1A 2Q9IA 2IWGB 3L73G 1L0LJ 4COYA 1UMIA 1D7PM 3EYPA 4DFSA 3M9HA 1VQKP 2Y60A 1KILD 4GT1A 1B35B 1ND2A 1V0AA 1JN2P 1HVVA 3CI9A 1C4RA 1MS8A 3OGSA 4JRAA 3SLIA 1QJY1 1W6NA 1YRZA 3S9OA 2J1TA 1GQGA 5ACA3 4LMFA 1FC2C 2IFMA 1UN1A 2K9JB 4AVCA 2RHPA 2R061 2ZX2A 2PYTA 3L75G 1GUIA 3D6YA 3GDBA 5CFDB 4XDOA 3M4FA 5AVVB 3RYPA 4GULA 2CAVA 3I2JA 1L0ND 3E1F1 5FZFA 2XJPA 3P8CE 1WCSA 2OUJA 1J3RA 2CGOA 2J58A 4HN1A 4AUWA 1U7JA 2HWF3 2J1UA 2A45G 1WCKA 2KIKA 4ZKPA 1UIKA 2W1WA 3EHKA 1LGNA 4JZRA 3D4KA 3VB9A 3FGAD 2CGPA 3B4SA 2XHNA 3PL0A 4M3CF 3PJSK 1SMVA 1POV3 5AVRB 1YJNP 1OXCA 2XUEA 3EXUA 2VOWA 1CPMA 1CONA 3VL8A 5ANNA 2ZJCA 5C33A 4AI1A 1N86A 3BASA 2D3RA 2N7GA 1NX9A 2GH8A 3KQ4B 2AC1A 5LB6A 2ZGMA 1OURA 1UZ0A 1UZYA 1MZFA 1H4HA 3P6BA 4KNCA 3PLNA 4CEWA 3WP6A 4QX1A 2E75C 1DYPA 4BRYA 1L7QA 1BGYE 4TSVA 3GZEA 4XILA 5F2SA 3O1RA 2WJSA 1YTZI 2CPSA 4M3LA 3AMMA 3CDZB 2FHRA 4N90A 2WSFH 1U5YA 2BNOA 2VZOA 1HTLC 5AVQB 2J1VA 3P8MC 3RVHA 4DB5A 1XTGB 5FZ1A 4BE3A 2XJUA 1KQGB 1VQ5P 3FZ3A 2X09A 3RL0C 5IVVA 4S2FA 1YFXA 4AHWA 5CA6A 3MUZ1 2C26A 1JZ8A 2TBVA 3CKHA 3AE8C 1OQDA 1PO21 2C6SA 2YMZA 1QQP3 1OXZA 3NQHA 4XA4A 2JX9A 1QVGO 2VMCA 4P00B 1WLCA 4BXSV 3D71A 3D5OA 2YZ4A 1X9TA 2R30A 3CF6E 5GZCA 5K7PA 1M7LA 2IFNA 2R3SA 3HE4A 1CI6B 1N1TA 1NCQC 1FZEA 2ZJSE 1VRH3 2GP5A 3PUSA 1ENRA 4Q4V3 1GOHA 1ZZBA 1J3QA 4PIXA 4KHXA 1O4ZA 3FHQA 3QWOC 1NYHA 2C24A 4ET7A 3ZSLA 2QQVA 1J58A 5JXIA 1BMV1 3AYEA 3ZXDA 2WZR3 1JI6A 1HRI1 1WW7A 1RL3A 5A70A 3WV6A 2RS32 4I0AA 4D6TJ 1OWAA 3J8F3 1XSQA 1S0EA 2HFED 3J7NA 4KI5M 4JGYC 2SLIA 2PP6A 5GZDA 3F5HA 5A3NA 1NZIA 4IXLA 2D93A 3U59A 4KG8A 3AB0A 1E5RA 2Y8KA 5HV0A 4MV2A 5A3MA 3GF3A 1W8TA 1KTMA 1VDFA 2XLAA 2DTYA 4BQ3A 1ZA4A 4QAWA 1VQ4P 3I3DA 2NLRA 4CEYB 2H89C 1RUG1 3P3PA 4JKKA 1NJIQ 3AFKA 2KS1A 3M9BA 3CQOA 4MOAA 5TSWA 1JYXA 1AF9A 4JDNA 1ULFA 1PFIA 4WVWA 5JAXA 2VG9A 5CJ0A 2QQMA 3FBMA 2ZEZA 2HWE1 3R0RA 4MGQA 3HTKB 2VCBA 4PI2A 5FZBA 5LA1A 4DQAA 1VRH2 4NHLA 3TEWA 1PIV1 3VBUA 5JIAA 2WS91 3U14A 1UX6A 1CJPA 5FZOA 3PTRB 4XHXA 2ZFCA 2OTLP 1DYOA 2AH2A 1Y9MA 1JYNA 4HT1T 5FZOB 5I93A 3Q8FA 4YPJA 3VN4A 2C9LY 4IDZA 5C8CB 1V70A 2W1UA 1QF3A 5T5PA 1I3HA 4PBOA 3RDIA 4KT0J 5EYXA 1EDKA 1ZMEC 5FBZA 4CCEA 2DFBA 3A2AA 2UU8A 2VCCA 2CAUA 2H8PD 3DKWA 4RGKA 1XYOA 3IF4A 2Z4EA 2RS13 2DYCA 3C7HA 2B5HA 3VBRA 4Y5SA 5FDBA 5KLVE 1NUKA 4JCKA 2WPRA 4PJ0H 1CAUA 2XG3A 5FYYA 3BCCJ 1LOFC 2Q3EA 1XNAA 4D0QA 3VKNA 4N3YB 1N3QA 4XUPA 3D6ZA 2HLOA 1RE4C 2IYOA 4XXPA 1H9PA 1V6OA 4ARYA 3SH3A 2PHFA 2YG0A 4HMZA 4FFFA 4N9IA 5FK8A 2N9YB 1HGZA 2Q1KA 3ELNA 5BXXA 2WZPP 1BDCA 3WNXA 1OQEA 3O0WA 2X5IB 4Q4Y1 3UNPA 3JD73 2AR6A 3H1WA 1CVNA 3NW4A 3I56P 1S55A 4P9GA 4ZONA 3SNMA 2X5IA 4YZ3A 5EV7A 5HI0A 2A6XA 3T97A 3G6EP 1GMMA 1KQLA 4B4QA 2A73B 3AP6A 4Y4YA 4QGLA 4AVAA 4BQ5A 1K12A 3ZXFA 2ZVOB 2FDJA 4YM2A 2ARCA 3K4AA 2GC3A 5ABJA 1ZV8A 4C8DA 1RUE3 1ALYA 4LBLA 1JB0J 3M1HA 4JDOA 2RM23 5DUWA 2AACA 5F3EA 5AW3B 5KXDA 4JYBA 5FXWA 5BNOB 2VD7A 5F37A 1SEFA 4CUBA 3I3BA 2E31A 4AQSA 4JV4A 3RL0B 1RUF1 1SFCD 2LROA 2WN2A 4CVUA 3H1KE 4LO4B 1JY2O 4OGQD 1PGSA 1LP1A 5APQA 3TYJA 1RMU3 1NLSA 3OUIA 1L0LD 1GKBA 5APWA 2NQYA 4YVSC 4BK4A 3RK2D 1CAWA 2I1KA 2LRPA 2YO3A 3ZX7A 1ZN5A 3WF0A 2JIGA 5TJHA 3VD9A 1BMV2 3K5BA 3C7OA 5FMBA 1NU1J 1RVF3 5FXZA 2XB6C 5CFCA 4B29A 3KMHA 3WHTA 3L71J 3AE5C 1HH0A 3I5CA 3DPRC 3WNPA 1LU2A 1YQ6A 4X8NA 3MO4A 5G05L 2W0XA 2QA4P 2FFDA 5LK5A 3AE7C 1ZBE3 1IC2A 4YYOA 2EIBA 3DPRA 3H8OA 2JR8A 1UKGA 1ZYBA 4MN4C 1VAMA 1ULGA 3DN7A 2FYUD 4NHKA 3CX5I 5FZKA 1ZBA2 3RG0A 3GG2A 3MLJA 1FBMA 4L73A 1CQ9A 4HN0A 5CCGA 2P37A 4RS5A 1ZXGA 3PP5A 4BQXA 1Y43B 3SEEA 1LNQA 3U07A 4BCUA 2HR3A 3THTA 1IFDA 3AMNA 4RS5C 2WNVA 2KOGA 4QU1A 1LGBA 2R0HA 4LK6A 2FYUK 2PXJA 5KWRA 5FMOS 3PRJA 4ZKTB 1SQBG 1G2CA 4HKZH 5LY1A 3UJOA 4XFCA 3SQOA 2F6BA 5JIUA 2PMWB 1T6GC 3IAPA 5BUVA 3EB7A 2MPFA 5LWBA 3V0AB 4RO0A 1AZDA 2FFDB 2WS92 3NV4A 4INDA 1YIJP 4JDMA 2N9BA 1SFNA 1PL5A 3BIEA 5DAVA 3V2QA 3CX5E 1RUH1 2YYOA 5AFBA 1SQBK 2D43A 2SPZA 2K1AA 2J1AA 1GP5A 3AL5A 4CRQA 5FOJB 2Q7CA 1A8DA 2YMYA 1GW3A 1K45A 3WXPA 1MS4A 1Q90D 4Z8BA 1GZCA 1QJY2 3BGAA 1QWRA 3JCIA 2UWJE 3ZR5A 1ZRIA 2E76C 3MD0A 1DHKB 3LA3A 5AW5B 3ORJA 1UKRA 3SWFA 3MFCA 3WINE 4H44C 1Z56A 4EI2A 3JD71 1QQP2 4XJ8A 5FY5A 4HVOA 4D6TD 2CDPA 2NYYA 4H44D 1DZQA 3ZXKA 3H1LJ 4DXSA 1FOSF 5GJ6A 1K9MQ 1JMBA 1S5LH 3FFZA 1KYOE 4HOOA 4J1WA 4R9AA 3VBHC 3JXSA 3FE5A 1UCXA 1YI2P 3PHLA 3Q8EA 3CCVP 3NO8A 4Y3OA 1V00A 5FZIA 5F3GA 3IFMA 3ZFGA 3FHAA 5FIXA 4QQOA 4P9WA 1B35A 1SLLA 1RF0C 4KWUA 2WWWA 3HBKA 4XPVA 4Y1XA 5KJ7D 1AYM3 1UOJA 2VVDA 3WSOA 1RUC1 3WNMA 4YW2A 4EWAA 3O1PA 1MZ9A 4Y99C 4GXLA 4UB8E 2VZRA 1LB2A 1JOCA 2KLVA 3E5UA 1H4GA 2V4HA 3I54A 4BQWA 5I91A 2WO7A 3N7JA 4AVSA 3O1OA 2XNDH 2ZHLA 2E9QA 4EOTA 3QH6A 4KWLA 3UKTA 3WG4A 4B7KA 4BQ1A 1VF5D 5I8TA 2Y6LA 4BZ4A 3NV1A 5C8WA 4DJGA 1U12A 2A3YA 3H8UA 1CIWA 2WS93 4HONA 4DUWA 3VP8A 1NAEA 2GAUA 2HWB3 1AVBA 1KDMA 1LHVA 5FPZA 5FZ9A 1H8TB 3NJYA 3O8ZA 4N78E 1RUF2 5DPNA 2WVRA 3VBFB 2VC9A 2VZ1A 3TBDA 1URQC 1NZCA 3LDBA 4M4PA 1QXPA 2JB8A 4B3NA 2I45A 1JY3N 2DCYA 4PV1D 2ZHKA 3KT7A 3LD8A 5CB7A 3VZNA 3KB5A 3WF2A 5D8AC 1PMIA 3QACA 5BNPB 4IFFA 2G19A 2Q8DA 4DT0A 3DV8A 1IO4A 2ZX4A 1XNBA 1OZHA 2YO2A 1H0TA 1JBCA 1OC1A 1QDOA 2VQ0A 3PHMA 3QBQA 3WF3A 3NXSA 1NLRA 1ZP0C 1DGRN 1QJU1 2ORXA 2XJVA 5I8SA 3VD5A 2XNXA 1GV9A 4AVVA 5FYCA 5K4LA 3B71A 4IEZA 2VCAA 2R073 4MGTA 2XHKA 1MPXA 2E74B 2ZKLA 3UJQA 1LTGC 5I0RA 1NH4A 2ID4A 3W5NA 2JECA 2WWSA 4H3WA 1KFNA 5JI7A 4EN9B 3M3QA 1DQ5A 2EIEA 2ZXEB 1NWQA 5EIYB 1WMDA 3PVBB 5DZGA 2E42A 1N73C 1O8SA 1S0CA 2CU5A 4HL0A 3FJSA 5A3UA 4X6QB 4DXTA 5LA9A 2OX0A 3WZ1A 1ZREA 4QX5A 1PX4A 1BE3E 1K5MA 2NM1A 2UURA 1YXWA 1OI6A 4XHBA 3C7FA 2F4LA 1Q2NA 4R9BA 1KILA 4QPIA 4WVMA 2ZGLA 3FFQA 3LWCA 1LESA 4FPJA 4OVNF 3ZSJA 5A7QA 1LTIC 2BNMA 1ODNA 3ZYFA 4E2GA 5HPOA 1GU4A 1EZVD 1EUUA 3TGUE 3BVHA 1BE3G 3N9MA 4FPHA 4OH8B 1AVYA 3GBFA 1RQVA 2HYNA 2ZX0A 1N7SD 2I07B 2BFUS 4CCCA 1YQ2A 1W9FA 1HB4A 2QQOA 4LEJA 1W6OB 5DUUA 5CBLA 3RZJA 3PVOA 3O7OA 4P9XA 1DQ6A 3CWBE 1LECA 1W6OA 1VQNP 4AXOA 1F8VA 5BNNA 4KGGA 2JWDA 1URQA 2LXBA 1D2QA 1JYWA 4UB6H 4FAHA 2G9GA 4W6WA 1NTZJ 2JDMA 4CU8A 2F4PA 3U10A 1XC6A 4FPYA 4QX7A 3FWNA 1PNFA 1UOGA 2RVAA 1LGHB 2HPCB 2VXRA 1TQ5A 2BTVC 5FREA 2FFDC 1BVVA 3E5XA 1Q8PA 2RJ2A 4C90A 1X0TA 3H1HE 2FYUJ 5DG1A 5T5LA 2Q5TA 3DYMA 1TZOA 1UYZA 2R5BA 3L73E 3L74G 1UIIA 3BRVB 3HR9A 3UK9A 3RMYA 5APUA 1H1IA 4META 4XZUG 5GZEA 2JENA 2DCKA 4UFLA 3VDAA 5A33B 2WSFJ 3AFGA 2OYIA 3UV9A 2XQRA 1Q43A 2JG8B 4XFAA 4ASWA 1Z7S1 3TAYA 3S0MA 3VBUB 3RZKA 4AHZA 1BK1A 1QOSA 2OTKE 3MDPA 1GDTA 1FOD1 2RS52 4LIVA 3WOGA 4DCKA 2KXLA 3C2UA 2VZUA 2QQLA 4LORA 4Y1ZA 1XYNA 3VD7A 1RYYA 1SLIA 1VBC3 4CP1A 3R05A 4F8AA 5CBOA 3ZM8A 2HYKA 3WY6A 3H1KJ 1J1EC 1PO11 2GNMA 3NL1A 2XBO1 1DFQA 2WITA 1LRHA 2H88C 1EYBA 2L9LA 4QWNA 4CDXA 5LY2A 5B5EH 4UFKA 1Y8AA 4UWDA 4EWEA 1NTZG 1QL1A 2R49A 2I8DA 4Q2FA 4JKLA 3ZSEA 4QGMA 1YQ8A 2JD9A 1S5LX 4QM9A 3UYJA 2OUHA 5FR3A 1JZ6A 2HODA 4JF7A 1PP9J 3T2PA 3TGUG 1SFPA 4QPYA 4EDFA 4Y1UA 4CDWC 2BCCG 5D8AB 4DNYA 2FY8A 4U3FJ 5KTBA 1VQ9P 2RS12 3QLQA 4XFFA 4CUCA 4LK7A 4XE9A 4PLOA 3B7MA 5C5TA 4LHNA 3CU7A 3V56A 1GYKA 2ZEYA 1PZ7A 1H8TC 4RJTA 1ENQA 1W05A 1YIFA 2A45H 1CX1A 2D6NA 2KD7A 1BDDA 2KP8A 4IFMA 3LIGA 4EN6B 5IK4A 2NPSA 1M06G 1FZAA 3GHGB 4LTAA 1KC8Q 3I4IA 4IEXA 3EMRA 1DEBA 5L36A 3DPRB 1SQPE 1V6KA 4FXKB 1O8PA 4CTEA 4KU8A 2LKMA 4FPFA 3SMHA 2PLV1 4GAZA 5CIRA 1S5LE 2F17A 2VZPA 3MP7B 3MW4A 4QGNA 5FZDA 2WZEA 1KS4A 1PP9D 2KZIA 1G9FA 1C5HA 2KS1B 2DTWA 1EQ7A 2P10A 3U1AA 1SACA 3K75B 5A7NA 1KFMA 1RUD1 1NTKJ 4A7KA 4CCKA 3LB9A 2B88A 4OHYA 2DUPA 4NRMA 2ZVNB 2VVFA 1H6YA 4AWDA 5KLVK 5H9QA 2BPA2 3MIHA 3MIDA 4A3XA 1QKQA 4XFIA 3VDDB 3CNAA 5FQ0B 2IYPA 1LOBA 4CEWC 3V0AA 2JJLA 1EXJA 2O01J 1TMF1 1VMFA 3JB4C 4A6OA 4C7NB 1POV1 2ZEXA 3R4UA 5A7PA 3OTFA 5ACA2 5FP3A 4B4PA 3P5BA 4KH9A 4Y20B 4H7LA 2IPPA 1C3HA 3DEMA 2RG4A 5FYSA 2PGDA 2HWE2 4R4LA 1RVF2 3PMSA 5B66E 3BCWA 4WM8B 2Z79A 5A7SA 1GL2A 2XWBB 3WU2E 3A5TA 3T4HB 4CU9A 3G7DA 3USSA 4E2SA 3KZIE 4YM3A 1REEA 1W6PA 2QZ3A 3WW2A 4FOVA 3HD7C 1M1JC 1FZCB 1GSLA 1UPSA 2D40A 2OT7A 1MZ6A 2VL4A 3NVCA 2IXIA 4UF0B 2E7TA 1T3JA 1RJ7A 3H42B 1F4HA 5BNNC 3B9CA 3L72J 2ET1A 5KC6A 2QQJA 4H13B 3VDDA 5IFPA 3ZN6B 1M8OB 1WZXA 3AE4C 4HSLA 4PLMA 4ZNCA 3TK1A 1LODA 4YW1A 2BGPA 5C4WA 1IG3A 2D98A 4AI2A 3OUHA 2DCJA 2YFUA 1REFA 3L71G 3AJZA 1V6MA 5FUNA 4AEKA 1RB8G 4YFZA 3UGGA 2IZ0A 1UY4A 4M3CB 1ULPA 1PGW1 3S57A 3H32B 1Q56A 4YZ4A 4ZPIA 2Q8OA 3ZYPA 4M3CA 1VALA 3S7EA 2VULA 3TSIA 4PD4H 3O6QB 3EBRA 1AYN2 5CFDC 2QCSB 5FKCA 2ADDA 3Q9OA 4A3ZA 2YC4A 4AI8A 4EZHA 5C8CC 3IBMA 1W9YA 1H2LA 1YITP 1LJ7A 1AX0A 4L8QA 2DV9A 1VMJA 4CPBD 2ZXXA 4YGCA 5C9AA 1HN0A 2VGDA 2DW3A 3U4SA 2ZPXA 1YBKA 5APAA 4CU6A 3V6IA 3E6CC 2RV9A 1B35C 1MQTB 4QPGA 5HCFA 4GMP0 3LEGA 2J22A 2ZGNA 3OYWA 4FXGB 4PD4E 4WV8A 1UU4A 4EV0A 5KJ7A 1RTVA 4BMBA 1U0AA 5TISE 1NTKE 4XW3A 1DLCA 2KNCB 1T6AA 2B45X 5F8PA 1ZA7A 5GLWA 1ZW0A 4I7ZB 1EP0A 2E74C 1BK0A 1HV1A 1IFIA 3WDVA 1A34A 1VIWB 2VXJA 4V2WA 3G4SP 1T3UA 1DGRA 1QQP1 3ZSMA 5KLVG 3J26N 3I49A 5A1LA 3KYQA 1FE6A 3AP9A 4GIQA 3U78A 3VD4A 1IS6A 4AYCA 1EPZA 2V73A 2FQPA 3LEMA 5FMCA 1QY4A 1GMJA 2JE7A 3K77A 4PV1B 1QJEA 3C3VA 3P8CD 3H1KD 5G04L 1KILB 2FMYA 2H6BA 1OUXA 1BCCE 4WVMB 3KV9A 5DDJ3 1V6NA 3RWNA 3WT3A 2GA1A 4DS0A 1WLTA 5FYIA 1X8YA 2Z5HA 1DX7A 4LITA 3FUOA 1RF0A 3I3EA 4E4SA 1G1IA 4ITCA 4MUVA 5JZGC 2W6JH 4U3FE 3AKSA 1O3TA 2CTVA 2IFWA 2XVKA 3ILNA 2O8QA 2CK3H 3KV5A 3OJBA 5DUXA 2VBBA 1RJ8A 3A7QA 1TNFA 4IW3A 1SDWA 5CVRA 2VMDA 1VR3A 4UBHA 1VBE2 4UW4A 3SITA 4UT5A 3Q8AA 4PF5A 1C1LA 1UYYA 1UZWA 2OQ6A 1W2NA 4Y26A 1YYCA 3AKRA 4BB3A 1T2KC 1JTHA 1VL2A 1F31A 5FY7A 4CDWA 1LAJA 4AOCA 2FDIA 2OYZA 4Y99B 4BXFA 4OYUA 3T2TA 2KLUA 1CZVA 1ND2B 5JCTA 3I3QA 2AENA 2VQAA 3WUCA 4M01A 1KD1Q 3CMEP 1OQ1A 2NPIA 5APTA 2BOJA 2WDBA 4LULA 3LDRA 4N8MA 2FYNC 5LRRA 1VAVA 4NAMA 4Q8LA 3VDDC 2W46A 5C70A 2XKPA 2E6VA 3AP4A 3B5NB 5AVWB 3VTPC 1FX5A 1MS0A 2A75A 2FCVA 4RR3B 4BQYA 5B5EE 2H7HA 4CP2A 2VZTA 1XE0A 5CADA 3O0VA 3IN6A 1LOEA 2A7AA 4QX8A 1HB3A 5DZFA 5KR7A 2D2CB 4SBVA 2VPVA 3K51A 1FV2A 4U3FG 2ZAAA 4DXZA 1BCXA 2MHFA 1S4XA 4EIJA 1IFNA 1UZZA 3RQ0A 2ATFA 3JUUA 1MS5A 5FTTC 4IFDK 1T8ZA 2E76B 3FXEA 3BKZA 2QJKC 1BGYG 3H1IJ 1MVEA 1T2XA 4DUVA 5C7GA 5C9AC 1NA1C 1JYTA 2NZ9A 3T4VA 1YQCA 3EWKA 2YMKA 2W1SA 3POEA 4OZXA 3ACHA 2K9JA 3T97B 3EO6A 3HVDA 1DH3A 1OH4A 4XETA 4E27A 2FBEA 1CAUB 2QQIA 2B9UA 2XVLA 3BPZA 2YKPA 2GNTA 4NRQA 5FZLA 2CY6A 4FPGA 4A44A 4LA3A 4YGEA 3L72D 5DAQA 3KM5A 4BK5A 4M00A 2QJPC 2LALA 3ZN5A 4R9CA 1CJDA 3L70E 2A06D 1RUC2 2QE7H 2ZMKA 1NTKG 1Y47A 5F6LB 1HB2A 4WZFA 3UT0A 3Q2YA 1PO23 5C3PA 2C4XA 4IL7A 4YSFA 4CDUA 2PQQA 2R16A 1CX4A 5DJTB 5H9RA 5LEKA 3W5MA 3RJRA 3BUCA 2WN3A 1SQQK 1NQDA 3BTXA 2XLFA 4Q4Y3 3I2HA 3MLLA 1J1EB 2GALA 4IGQA 2DVAA 2H43A 4PQ9A 2ORZA 4D3WA 3L36A 1AXYA 1US2A 2JKVA 2DBIA 2M8RA 2Y33A 1SQQE 2WBKA 5KKZC 2JO1A 1EV11 2VNRA 4LKSA 4WM8C 2Q8EA 4CDQC 5KLIC 2BVVA 4RGAA 1VB4A 2A3XA 2E51A 4YPCA 2VW0A 2WSCJ 4AEDA 5F3CA 3AKQA 4DY5A 1ASJ2 3POBA 2D5FA 5LA0A 2IXKA 4N78D 4CXXA 5GTHE 2O1JA 2W87A 1LTAC 2BCCJ 3MICA 4MVTA 3BI3A 4Q4X2 1WLWA 4ZMDA 2P3KA 1R091 4UFHA 1PPJD 2O01H 4NR1A 4QXHA 3RI9A 4C91A 3G9RA 1Z78A 1W5CE 3KZIH 1UPIA 3MPBA 3MUY1 1ND3A 2C5DA 3POFA 5F39A 1PGJA 4GD4A 1M56D 4LIUA 2VAUA 1POQA 1Q3EA 1V6JA 2R6QA 5AW9B 1H1MA 1O7FA 2WSCH 3BYWA 3ME2A 4LBMA 3AX4A 2WZ8A 5FLJA 4NHXA 2DU1A 1C8M1 2WZR2 4HPKB 4JGYB 1O5LA 2VY0A 4CXWA 2XU6A 4GA9A 5F1RA 1LT9B 4RA0A 1JZ5A 3HAGA 3F89A 3LAGA 4IEVA 1OVPA 1YJ9P 1FZCC 3ZYBA 5IVCA 2PLV2 3SSUA 1C1FA 1FNYA 3VBSA 4K8RB 1RY3A 1FV3A 1ACCA 1CZTA 1TEIA 1FOD3 3LKJA 4MGZE 3WVJA 5JXGA 3X29B 4AVBA 4PD4D 3VBSC 3TDKA 1IJDB 3OY8B 3RBZA 4GDOA 4D6TE 4Q4W1 2D7FA 5FPUA 1AL0G 3H9AA 4L74A 5D21A 5FV3A 4C0HA 2RN0A 1SQXE 2GZWA 1AR83 1CR7A 1LT9C 2WA4A 2WYFA 2O1QA 4FOWA 5DDJ1 3U11A 1R092 3URFA 3OB8A 2HEYF 4EQVA 4CCNA 2QQPA 3P7KA 1KZUB 4UB6E 3OBZA 1UF2C 5FP9A 1UL9A 5JMCA 3HD7D 1FS0E 2OPKA 1NTZK 1R1A1 1OW8A 4UW5A 5KLVD 2RR12 3HQXA 5FP4A 1LTJC 4HKOA 3LPFA 4M4RA 3VBFA 1L7LA 3FC0A 4PIZA 5FY8A 4DOUA 4WBAA 2H6CA 2YPJA 3JB8A 3WQ0A 1DD3A 3L74D 3PVNA 5A6XA 5FPAA 2ENRA 3SFEC 1AR71 4LE4A 3RGBA 3O1UA 4N9HA 5AW2B 1S9KE 4JHTA 1U5XA 4DRVA 3ILFA 1CN1A 2B9BA 2C0ZA 4BOWA 3H8RA 3L75D 1RUG3 1XJAA 1WW5A 2V4VA 4XE5B 1ZZCA 1E5IA 4MHUA 3VDCA 4CP0A 1QMJA 1RHI3 2D6MA 1U57A 3ZFEB 4QPGB 3M3CA 1F5JA 3JU9A 3I55P 1KFUL 5FZ6A 1LHWA 1OBNA 1BGYJ 3H1IG 2BERA 2K2SA 2ZS6B 1O5UA 4IE0A 4XJUA 4A7ZA 5CFCC 2BRTA 1GWLA 2WT7A 3GZUC 1OLMA 5FYMA 1HQNA 1QJU2 5DABA 3GHGC 3I2IA 4TTGA 2JG8C 3ACIA 3A21A 3KGZA 2OS2A 4LO5B 2QBXA 4YARA 1Q8OA 2QQUA 3VBRB 1YHFA 2CNAA 3VMXA 1VQ8P 2WSVA 4PD4I 2WWUA 5C4WC 2E76D 5C71A 2XGXA 4IESA 3OJAB 1FZCA 2I74A 4YNIA 4W8JA 2JDHA 4Q4W3 5T55A 3VKOA 3MW2A 4ASMB 3HUSB 1UIJA 3HQRA 3JBG2 1AR82 1W6QA 1AR72 1UXXX 1NXD1 1DLLA 3HEIA 3J8F2 5F5IA 4BMEA 1EV12 1JH5A 4BM8A 1O59A 4OI0A 4BH9A 3FN9A 1OOPB 3KCYA 4I09A 4O9GA 5B2GB 2DVGA 4MHRA 3UL2A 4ZU4A 1M1JB 1J1DB 1PK6B 4ES9A 5CISA 1JZ3A 4LPLA 1D4M2 2AEMA 1NA1A 1HJ0A 3O12A 2E43A 5IVFA 4HSJA 5HXVA 1W3XA 3MF9A 1NA1B 1ZBE2 2WMMA 1C8M3 2E7AA 3GHMA 4L76A 4LNVA 3M70A 2QJKB 1GNHA 4PJ0E 1N1VA 1VBA3 2YPDA 3L2HA 4LKEA 4XF1A 4XUNA 2IBZG 2VMGA 2YHJA 1SBDA 3V5BA 1PVXA 2XUMA 5FPVA 1CAXB 2RMU1 2HBUA 1OVVA 2R44A 3RGUA 2YY1A 3I59A 3BTZA 3VBFC 2YROA 1STMA 1YQ4C 1JOPA 3CMAP 4HKWA 3RK3E 3WU2H 2M5AB 5EQUA 2ZMNA 1WT6A 1KYOD 4Z1VA 3DCQA 2K88A 1K5MC 4LBQD 1GZ9A 1QVFO 1SLBA 4PLNA 4EN8B 4K6BA 3KVBA 2WA3A 3I2FA 2ZGOA 5HBAA 1BEV2 3MIGA 3H8XA 4JQ0D 4HXCA 5C5UA 1RXGA 3CIHA 2BBVA 2W5FA 3VP9A 4MSVA 1BSNA 3D82A 4QPIC 1SQBD 2J1RA 2N1TA 2OQQA 1N7SA 3EFFK 1PNGA 2B7YA 2GNDA 3S6PA 2W27A 3AEDC 2Z42A 1N7SB 5L7OB 3UESA 4UFMA 3QH9A 3VN0A 1ZR2A 1YLLA 1CAXA 2JD4A 1SP4A 2RDSA 5DZEA 3LEIA 5JI9A 1PVC2 5APVA 1X82A 2VMFA 3SKJE 3LOBA 3JBG3 5ANQA 4P02B 1UY3A 2W95A 4Q4V2 2YV8A 4Y20A 1J1LA 1UOFA 1XNCA 3C7GA 1CPNA 1WWYA 4LBQB 1QJX1 4UXAA 3A7OA 5JOWA 2FDGA 1RF1A 4EYUA 4EZ4A 1OW7A 2OW4A 2PAMA 2OARA 5B66H 1WKYA 4K35A 4IEWA 3M06A 4ARXA 4Z92B 1G6NA 3OBAA 3WX5A 2AUYA 1W06A 4FPCA 5JLVA 1W6NB 4XF3A 2FDHA 2X53S 4LLHA 5AW6B 1AX2A 1A02J 3KSCA 3N36A 1NU1G 1SQPG 3CCJP 1H6XA 4NJ4A 2BYVE 4BIOA 2CSGA 3CWBG 1AL21 3S4RA 2PFWA 2KYVA 1AJKA 5F5AA 2WT0A 4WVZA 2XL9A 5ACA1 3DL3A 2ZACA 5FPXA 5IT6A 3O1VA 3ES4A 2W91A 2AXTE 1BSHA 1V9U3 3CCLP 4I2LC 1IS3A 1VBD1 1QXRA 2JG8A 2VMIA 4HJGH 3CJIC 1NE6A 3I2DA 4GH4C 4XFBA 4XUTA 2EF6A 3LW5H 2M0BA 2VQTA 1AA0A 3MIWA 3GZAA 4URTA 2HWC2 1HRI2 2EVXA 4NWWA 2HPCA 4IERA 3N9QA 2RMU3 2XH6A 3UIAA 3BB6A 4Y28J 2QDRA 2TNFA 2ZYAA 1PHMA 3PUAA 3IWZA 1UNBA 2E5TA 1BBT3 1HV0A 1MS3A 1S0DA 4PDWB 4YW3A 3ZVXA 1Q81Q 3MHVA 5EJ3A 4NIHA 1PVC3 1ZRFA 1BVP1 3FHIB 1QEXA 1ZNPA 3CZJA 2EXHA 4N53C 2RM21 1GK4A 4Y5TA 3WQ7A 5J3UA 1WGPA 2DUOA 3CJIB 5EWSA 4F83A 2ZZQA 3A0HE 3ACFA 2B4KA 4PF1A 2M3EA 1BYHA 1SCRA 3MPPG 1E5SA 2Y9YA 1RUJ3 3TRSB 3DYPA 5A3OA 2R041 3K48A 1W6MA 2WQZC 3RK3C 1POV0 1G9BA 2P2UA 3TEYA 2DVBA 1W6MB 2BOIA 3U1XA 2W90A 3DUIA 1EDJA 4GH4B 4XBLA 3J7MA 4IGPA 1OKQA 3LCPA 3UGHA 4AE2A 5GKAC 2EA7A 1AYN3 2DBNA 1MEC1 2K0GA 4LKDA 2Y26A 3L71D 1PIV2 5DJUB 4P08A 1ZBE1 4RHV2 5JSPA 3WDXA 3HE5B 5FY1A 1GU3A 2Q1MA 1J83A 5EZWA 1LOAA 1H2NA 3RJ2X 3JD72 2ZXQA 5CKMA 3WR0A 5LBEA 4Q26A 3ZXLA 2RMU2 5FZ0A 4A2UA 4OQ9A 2Q8CA 4K3AA 3MI8A 2AREA 4RQPA 5FZ7A 5HV4A 3WEZA 1RHI1 1WMXA 2GN7A 2W3JA 5GTIE 3AEBC 3NV2A 4XF4A 5EP9A 2IZ1A 2GC1A 1NTKD 1LP1B 2V7QJ 2B9VA 4MGSA 5L7OC 3K3NA 4CDUB 1LULA 4UB8H 4E8CA 4FFIA 4XEZA 3CL1A 1GNZA 1Z0HA 5I0SA 2PA7A 1A02F 4QPIB 4FQZA 1LCLA 4LUMA 1JCCA 4NPLA 1A8MA 1HKDA 4G3YC 5LBCA 1UAIA 2VMHA 4FPKA 5CCGC 1KRIA 4UFJA 2P58A 1WRGA 3ST7A 4XDPA 2MEV2 1JMMA 2K46A 4LBKA 2W2IA 1J59A 1AXZA 4OMDA 3WNOA 2PAJA 1UWWA 2ILMA 3TOJA 1IPKA 2VUDA 2WFF2 4XFHA 1PP9G 4QKFA 5IVEA 3NKGA 1G1JA 1SQPK 3WUVA 4QKBA 3O5SA 1TMF3 3T1MA 5CCHC 3GM8A 2GUSA 4G4FA 3VBOC 2WNVB 2DU0A 5IHRA 4O61A 4XBNA 2JKBA 1PIXA 2R071 4FCAA 3H1HD 3VBOA 3ETPA 3A3YB 4Q0VA 3DXUA 2WO2A 2JDNA 2V5DA 3OGRA 1OVUA 4LKFA 4URAA 2P7JA 1X79B 1V6LA 3LZZA 1GFF2 1ST8A 2A70A 3POIA 5F6KA 2VECA 1OOPC 4MYEA 4Z82A 3P32A 1NXMA 1GZWB 3PU3A 4JTNA 4QQLA 5J96B 5ISLA 3IAQA 1MEC3 2D3PA 5JPNB 3T0DA 4XZPA 5I0TA 2NPSC 3AE9C 3HUSC 3MUDA 2MKVA 1PO22 4Q0QA 1DIPA 5AVZB 1G7YA 5GALA 3AJYA 3HD8B 3LPGA 1HLCA 1RUD2 3VZKA 4DEVA 4R52A 1ZX5A 2HEVF 3F2ZA 2KB7P 1H1AA 3CZUA 4R4XA 1RMU1 4HB1A 1JNMA 1LEMA 4RQPC 2ARXA 4BJ0A 3NMDA 2ZBJA 2OA2A 5C9AB 3L74J 3L75E 1NG0A 2QDNA 4K20A 4ES8A 5KJ7C 1SHWB 4OQ8A 4Q0PA 1MACA 1N7SC 1SFCA 1F9KA 4IV3C 1USEA 3DECA 2A6WA 3TN92 4AFBA 1GWMA 5J09A 1YO8A 4JKMA 4QPGC 1AX1A 1NCQA 4IEOA 4XBQA 4CCDA 5KHGA 1X50A 2O1KA 5AW4B 5J98B 3ATGA 2IZWA 1PX3A 3LSDA 3O14A 4GWNA 2VUCA 1KQSO 1USDA 4LHSA 1I9RA 1JOJA 2DF7A 4GJZA 4YXDC 3I7DA 3CXHI 2QUOA 4W80A 4XIKA 5A7WB 2XDVA 3NRUA 2BVBA 1UYXA 1UX7A 1DQ1A 3A0KA 1NKZB 4N6JA 5AVYB 1JOBA 4E4HA 3AYCA 2PHLA 1VP6A 1F15A 4LJHA 1IK9A 3H1JE 4U36A 3GJBA 5FYTA 5DN2A 1ZM1A 5DQ0A 1R8EA 1H2MA 1Y9QA 4NHMA 1W8HA 2RS53 4WZCA 2QZ2A 3LIHA 3WQ1A 1QGLA 5C3SA 5CKQA 1NYWA 2HWD3 5FAXA 1L0NG 3I97A 4PQQA 4HVRA 3ZSKA 4A45A 4B7EA 1ZRRA 3ECQA 4COZA 3OPTA 4ASVA 1MS1A 2D6LX 2JKXA 1RUI3 4KGQA 5CNAA 4GWMA 1ZRTD 3M91A 1RQUA 4TT3H 3Q8BA 2P1JA 1COV2 4TN7A 5AW8B 1M1KQ 1VLNA 3B00A 3H7JA 3I59B 1SS1A 4XFGA 3ITQA 2JXAA 5BNQA 4OI4A 3HUSA 3LA2A 5D1IA 3KV6A 5LEJA 1BBT1 1HUCA 1DGLA 1F4AA 3OD0A 1GOGA 3PH0A 2WAAA 4IV1C 1AR61 1PP9E 5FBJA 3A0BE 3IAOA 4A7PA 3MFAA 3RYKA 2HLEA 5C39A 3S7IA 5JMOA 1NAYA 2O0OA 3M3OA 4PJYA 3RS6A 2KZJA 2FZ2A 2BWCA 3H1IE 1NOVA 1W90A 5DAXA 1C57A 2VOTA 2QQNA 2N1TB 1OF3A 2Z69A 5CFCB 3H25A 2LS6A 3CXHE 2Y38A 3BU7A 3VBRC 1XYPA 3J4UH 3LIEA 1I6XA 3A0BH 1RUH3 1Y9GA 5T3NA 3A0HH 3MUDC 3I2OA 3L4FA 1WBFA 4CDQB 4WWIA 1AHSA 4LOSA 1N73B 5FYVA 1BQPA 2WYSA 1NQJA 2E32A 2R1DA 5IVYA 2UWBA 3RNSA 2O14A 3POYA 3ZPOA 1BKZA 2P67A 1WBLA 2UY8A 2WLQA 2OKXA 4AFAA 4CCLA 1XQNA 4XJAA 4YZ1A 1J2JB 3IT8A 3MBWA 1QLED 3JZVA 3VL9A 2K9ZA 1GL2B 3OPZA 1IHMA 2HWD2 4HBNA 1Q82Q 2NMOA 4Q0UA 5CEHA 1W6PB 4QB1A 3V2NA 5FY9A 2PAKA 4AQTA 4OHVA 4CU7A 3RK2B 3ZFFA 3TB0A 4ZS2A 2ZHNA 1PGW2 1RE3C 2HWC3 2WT2A 1WUVA 2W08A 2K9YA 2A45I 2IXJA 3H1HJ 2XXZA 1LEDA 5F7UA 3L74E 3L75J 5JXJA 5FPLA 3ZFEA 1OLQA 4WB4A 3AEGC 1JZ7A 2OYHA 5FP8A 5A3WA 1L0NE 2GNBA 2ZGUA 1PGQA 2XMLA 3O1TA 2WNOA 3HBZA 1CZQA 4TWTA 1SQVK 3CXHD 3MTUE 2H0VA 2RJLA 2ZOEB 4OUMA 5F3IA 2SBAA 4YGBA 3CWBJ 3DYOA 3N3HA 2X8KA 3POWA 3WDTA 4H0LB 2CDOA 3WF4A 4Q0SA 5BNPA 4U7JA 2B8MA 4L75A 2JDYA 4QT6A 3ZKUA 4UF0A 4XIOA 4GKYA 2AEFA 4XC9A 4IV1A 4XQDA 3D8CA 3OW2O 1SQXG 1E57A 3NTNA 1MKMA 1SLQA 4OMCA 5AVAA 1O3SA 3FMGA 2RE9A 2CGNA 5A7OA 4XQ4A 2OGUA 3TNUB 1BZWA 4LLOA 1SQVE 2XJSA 1OD5A 2ZGQA 4R9DA 4LBJA 4RHV3 1HRV3 5JWPA 4OUSA 4ZKUA 4Y22B 3NNJA 5CG8A 4XABA 5E1RA 1ZZ8A 4MZUA 3LGRA 1TG7A 2QRXA 1QOTA 1WCDJ 5T50A 4BU2A 3AEAC 3NV3A 4IEYA 4SLIA 4QX2A 2FCUA 1S2EA 2EAKA 2KA3A 1JEKA 3HE5A 1BEV3 3V4QA 1W0OA 1YI7A 3N7KA 3H1MA 1V9U2 5FJKA 4IEUA 2B87A 4YW5A 2YBKA 1U7MA 1RC6A 3HN1A 1H89A 1H9WA 3NSTA 5CCHD 1QHDA 3J7HA 4GKXA 4QX3A 4RFT0 4Z2AA 1AYM1 2P2KA 2UYBA 3ACLA 3GXUA 3ZFGC 3ZN4A 4HPKA 1Q8VA 2YIUC 4LHLA 3ZIXA 3PUQA 5FO7B 1K42A 2Z5IA 1TVGA 2G1MA 2VUAA 1X9VA 5JZGB 4IEPA 4GIFA 3GNEA 4LQRA 4QDQA 4YM0A 3AE3C 1KB9I 2O3JA 4CXYA 1KORA 1LWUA 5FJHA 4I30A 2AXTH 5CCGD 1JCDA 1VMHA 4BWOA 4GB33 4BQ4A 3U0ZA 1SQXJ 5BV6A 1EAH2 1DU3D 2ZCWA 4D69A 2YB7A 4EWDA 2J1SA 2Z4FA 5FZGA 1CWPA 1AR92 1S72P 3ITKA 1GR3A 1S3JA 3WUDA 4PV1C 1LHUA 1OFCX 1TMF2 3V65A 3H1LG 2NPSB 1UW8A 2GH2A 4R4MA 1W8UA 1SBEA 2BUKA 4OI2A 3WW1A 3V0BA 1N2DC 3KZ4C 3RMXA 3MGUA 1A78A 4KU7A 3JSVC 1JU3A 4DOJA 4LE3A 2VQUA 4LOTA 4BIFA 2AZ5A 3A4UA 1IFMA 3IDCB 4H14A 4CPGA 3ZMOA 3RZHA 3OBTA 3HE4B 4UI9L 4S2DA 3USUA 2RH0A 2PAEA 1NCRA 5JZGA 1SQVG 1RUF3 2ZABA 4DO0A 1CAVA 2POHA 4W65A 1IKQA 2JDIH 1ZBA1 1OW6A 2RS31 3UKNA 5JVVA 1I1EA 1RUE1 3VBOB 2PFXA 2B46X 4Q4V1 1MQTC 1O4YA 3B3QE 4LLFA 5HCAA 1RUNA 1KB9H 2YXRB 3ILRA 5CAZA 5IATA 4OVEA 4HLTA 3L9JT 3SH4A 3K4ZA 2DCTA 2ITAA 5L9VA 5A32A 3JQXA 4C7NA 1VBB3 1DP0A 3SCHA 3ZLIA 1OHFA 4PIYA 3G71P 3OBRA 1ND3C 2WUHA 2QG4A 2HYXA 2YIUB 4OFGA 3ZDSA 5AC91 3J8F1 2E5YA 4RD7A 2ADEA 3W58A 3AE1C 1QJZA 1Q8QA 1SQQJ 3AL6A 1KITA 1FU1A 1KB9E 2QVAA 4LO8A 1GQHA 3SHRA 3B5NA 5IFTA 3T2OA 3Q5SA 1SQXK 1O6UA 3D3AA 2Q6QA 1PGOA 3VMZA 3POSA 3RBXA 4L9BA 1KQFB 2YFZA 5FYHA 4NPRA 2W68A 1WA4A 4A4AA 4LT5A 1RITA 3Q1MA 1X33A 2FYNB 1NU1D 1YFWA 2D6PA 2IXHA 2YGMA 3PTYA 4FP3A 4S2GA 3CCEP 4MX3A 5FFOC 3CC4P 1J3PA 2JWAA 3LE0A 3CHXA 1P84I 1KDKA 1W2TA 3QD6A 5EJZB 4ZXEA 1W8OA 2DURA 3KVAA 1NVOA 3U1CA 1QX8A 4K3UA 4QM8A 5A32B 4H13D 4FP2A 3AEEC 5C8CA 2JDZA 3E7KA 1UY2A 4QKNA 4FPLA 1DZTA 3ZFFC 4DEQA 1GZWA 4WY4C 1SFYA 2Q0AA 4XUOA 5CMZA 4AQ2A 3BOWA 4UAPA 1VJ2A 3BPSA 1AR62 4B86A 3J9SA 1GZTA 2ZTNA 2GN3A 1EY2A 1S0FA 3CXHH 4H0LC 2C1FA 2B39A 2XOMA 3FLRA 4XMAA 3EQ2A 1LNSA 3V4WA 1OSGA 1X9PA 2A6VA 2AEJA 1LOFA 2AEZA 1LWUC 2JG9B 1N8RQ 4AGVA 2Q1FA 5FUPA 3KLSA 4WBBA 4IUGA 4GJYA 3WNNA 2BJSA 1W04A 3N7MA 2PRRA 4QQHA 1NKGA 1WA6X 2GSYA 1M4WA 1Y9BA 2P1BA 1COV3 2R063 3MYXA 4FI9A 5CZKA 4CP9B 1K8AQ 1EXIA 1YQ5A 2B89A 1GL2C 1FJKA 4D6QA 3C8VA 4Y33A 3L71E 3N4MA 1DQ0A 1IQDC 2DDUA 1NTMJ 4MH0E 1RGSA 2IX7C 4NHYA 4AK3A 3SFDC 1G2CB 1AQTA 1ASJ3 1ULDA 2JWPA 2W6BA 1OFSA 1NTME 1SQBE 2GM4A 2IBZD 1RXFA 2W47A 4XMIA 5FO9B 4I7ZC 5A7WA 3KHCA 4Q27A 1ZRTE 5FP7A 4QD2A 2XKMA 2ZKNA 4MADA 3BCCG 2BDRA 1S2KA 3W59A 4IV3B 2E74D 3H1KG 2IFRA 3B5LB 1KJRA 3A22A 4OLLA 4OCTA 4UW3A 4WM8A 5E89A 3E6DA 2FYUE 5FYBA 3JC22 2ZYGA 3WLUA 4NRPA 1DDLA 1VRH1 1GW4A 3V2RA 4DZGA 2W94A 4YW7A 3I2GA 4E9KA 1VAKA 3VD3A 4HVQA 1F5FA 3M8LA 4QHBA 2WWJA 2GDFA 1RUD3 3AVRA 5M0TA 1APNA 2A06E 3CCMP 5FYZA 4I02A 3II6A 5AC93 3ZOIA 3GHGA 1NTMD 5DXDA 1AUYA 5C3OA 3APBA 4YTPC 1S9KD 4E8DA 1FPN3 4YW4A 1PM4A 1RUJ2 2VMEA 4L92A 1BCCJ 3T2QA 4LO7A 4O7XA 5DAWA 3TN93 5GTHH 1RF1B 5A3LA 3H32A 5IVJA 1KN7A 2FYUG 2BP6A 3HMYA 4CEWB 5I8YA 3WG3A 2E7QA 4D7TA 4I2OA 3BCCE 1H2KA 1W0PA 3OY8A 4HK9A 5JOXA 5APYA 5A80A 3R4YA 3THCA 1KQRA 1MFZA 2WNVC 4FPEA 3WW4A 3PIGA 5FYUA 1BE3J 4JQRA 1HRI3 3T0BA 5FUIA 1YNAA 4BISA 4XFJA 4Q4Y2 1JY3O 3B5ND 2WSEH 2Y6JA 1UU5A 2ZGTA 2BEQD 1IG0A 5FLHA 1X8EA 4ZZ5A 1SG3A 3OAKA 3PMEA 5EXOA 3VBHB 3L73D 2N1TC 3AZVA 1H8TA 3OPWA 4I3GA 3IDBB 3NJZA 2ARAA 1AR81 4KL1A 5E88A 3VBHA 1D0GA 2HH9A 5A1FA 5JR2A 2J1EA 1AR73 4YRDA 2IVIB 5IK5A 3L70G 4XJ9A 3OEAA 3AP5A 5A1AA 3OUJA 4YG3A 1AR93 3UETA 1HGVA 3K4DA 3VV1A 4IV1B 1SQ4A 4NE9A 3BCCD 4QX0A 3CMGA 3G6JB 2P34A 5J36A 1KMIZ 1O4TA 1YEWA 2WPQA 1DCSA 4XQWA 2PELA 4AEJA 2AYHA 3KQRA 3AXEA 4BHPA 2K3RA 3TNUA 2IDBA 1JHJA 1RUI2 5DMYA 5K0UB 1J1DC 1PK6C 3BOPA 4XURA 5K0UA 2YBPA 1TME1 4XCAA 3EQEA 1MQTA 3IPVB 2RDQA 4W7YA 1DBNA 4XJZA 3GF7A 1CI6A 3RZGA 1DIWA 3NWKA 4LO6B 1PK6A 3HIFA 2MJZA 3NAPC 2CWSA 4QHZA 4YG0A 3GHNA 1HF9A 1DF0A 4XAAA 1AFOA 1ZRDA 4IOIH 1HJFA 3KPEA 2A71A 4J25A 4LBOA 4F7ZA 1OFNA 2B87B 3B8EB 3S30A 1LENA 3WDUA 1V6IA 2VU9A 3CEWA 3IDEA 3K3OA 5BY5A 2XKOA 2W6AA 3B01A 2IVJA 2RM22 5J1XA 2E53A 1KEXA 2KR2A 4FT8A 4HK8A 4K1YA 3RI8A 4AFCA 1IFJA 1Y7BA 2P4EA 2W8ZA 2HJIA 4IETA 1H0TB 2L5GB 1FZFA 3KQGA 2R062 3Q5RA 2LTNA 4O9EA 2OTJP 4CDXC 3LA7A 4NOTA 3MEPA 4XUQA 3RK2C 5JXHA 1OX3A 1RE4A 4IE5A 1G8WA 4QXCA 2JIJA 3AXDA 3PNAA 2P6CA 2E26A 1OLME 4FTEA 3BU0A 1GP4A 4M0HA 1HQLA 5FOBB 4QQPA 2WKKA 1JU4A 1W0NA 2WPVB 3ZDMA 5KAIH 1AQ5A 1OA3A 1URXA 1XBFA 1PPJG 1KILE 3OA7A 5CCHA 2EIDA 3HD7A 2WNUA 5J7MA 1AR91 3H1LE 5M1BA 1GBGA 2A3WA 4RESB 2AEYA 3A0NA 3FBYA 4H0LD 3NNGA 4L2NA 4LA2A 4GZ9A 5GLVA 4Q5OA 2J5UA 2M5AA 1ULOA 4HG6B 3GJAA 3CBNA 3KGLA 3AECC 1R5LA 3W20A 1K5JA 2E75D 4CCOA 5CKNA 3USUB 1EUTA 4JTOA 1SQVJ 5KAIE 1BHGA 1CD3G 1VF5B 2W1QA 2CL2A 4L0PA 4N43C 5DUVA 1LHOA 4CDUC 1OF4A 3N9NA 2VOXA 4CCJA 5E16A 3CJXA 1YJKA 2WQ8A 1VBB2 2Y6GA 1V9U1 2OQ7A 1FZBA 1P8JA 2VH9A 5GLUA 5EFWB 4YXWH 1KFXL 4CUAA 4P5YA 4Y5Z0 5CFDA 5FWJA 5IYYA 3LQCA 1VB2A 2WNUB 2OYIB 1RUE2 5FLIA 5GLZA 1URQB 1L0LG 2CWMA 1ASJ1 1YIPA 1O3RA 2G8YA 3IDAA 1PO13 1JXNA 2Z5WA 4K1ZA 3O1SA 4Q4X1 4FTSA 1W2EA 4F3JA 3KF3A 4FFGA 2V09A 3AYDA 1FYUA 3IR9A 1NTKK 1NE4A 2V72A 1GZLA 3HNMA 4G9SB 4KBZA 5L73A 3T0AA 5J37A 1VQMP 1EZVI 1IKPA 1U5IA 1CW5A 2Z2SB 2R042 2LW8A 1M90Q 5IVBA 1XU2A 2M3BA 2WFF1 1PM7A 2WSUA 5A6YA 2R0FA 1YHQP 2XDJA 1TE1B 3IMMA 5F32A 1VF5C 1FPN1 4BYYA 2V4AA 1K73Q 3ZXAC 2WNEA 2WSSH 1NTZD 3B93A 3GCWA 2W83C 2Y34A 2JEEA 3VHPA 3ZPYA 2X29A 1HBWA 1UOBA 5LATA 1MEC2 2PHDA 2VNVA 2IBZI 1YWKA 1VQPP 2HKXA 2C0XA 4XF0A 4AEDB 3UGFA 1SQBJ 1PVC1 3AKTA 4H55A 1NU1E 2JJ6A 4AGGA 5D8AA 5KLIB 4FAGA 4IQPA 1GLHA 1HN1A 2FXPA 5LCWL 3LIDA 2WT7B 1ULEA 2WO3A 2WQYC 1HIXA 2ZGSA 4I0BA 4PDWA 5JSRA 4JQTA 5K8SA 1HJGA 1IQAA 4N53A 4NIIA 2XWJB 4AI3A 1AJYA 1RHI2 4JRLA 1WCQA 1JY3P 1HXS3 3BRTB 4PI0A 3AEFC 1RUG2 1EAH3 4PBPA 5EHDA 4CDXB 1AL22 1WMFA 1YTZT 2JP3A 4Y1VA 4DZOA 2WRAA 1VBA1 3VMAA 3ON7A 5A33A 1Z7S2 4KMQA 4HH2A 1HJBA 1FPN2 2A1XA 3NFQA 2JDUA 1W6QB 4I0WB 2OYIC 4GB31 1M57D 4ONUA 5KC5A 3OCPA 4FOYA 1SQXD 1DG6A 2Y9ZA 4RQPB 4YWAA 2FZ1A 4D8MA 4GH4A 3SWYA 1W8ZA 2VTXJ 4AI9A 1IZ3A 4D94A 3AZZA 1SLTA 4EYYQ 3AM2A 2FD8A 1JUHA 3OSDA 1QGKB 3AZXA 5DG2A 1W9SA 3TNPB 4AI0A 2VO5A 4W6YA 3W67A 1MZ5A 4HKLA 1Z7S3 3B02A 3NNLA 3LDKA 4JAAA 4YM1A 4YVWC 5A6ZA 5E6HA 2RDNA 1KJLA 1S0GA 2D3SA 2PHTA 3H50A 3K2OA 3AMHA 4K21A 4V2VA 4QMAA 1R081 2HWD1 3ZFEC 4KQ7A 5ABJB 3AMPA 5B4XA 2BNNA 5GM0A 3TGUJ 5KAFH 4ATFA 1SPPB 2IBZE 3M0DC 2X05A 1QH6A 3H6PA 1R1ZA 3SH5A 3SKVA 2JE8A 5LRSA 2KSEA 3SWKA 1WCUA 2BGCA 1ZZ9A 3KD4A 1LU1A 1UY1A 2OVUA 3KT1A 1VBA2 2FDFA 2GP3A 3ZYHA 4TLFA 4B8EA 4P5HA 1FMD2 3IN9A 1C8M2 1RINA 2BCCD 2WZR1 3VZMA 2A5ZA 1W8NA 2Y0OA 3ZYIB 1LTJB 4LBNA 4LXLA 4MLOA 1JHNA 2VCMA 1SCSA 3B5NC 1LTJA 5KAFE 3H3LA 3T08A 5FPBA 2A06G 5IUQA 1QJU3 1OVSA 4AYUA 1AVOA 1QL2A 1XB9A 5FQ0A 4WVVA 4YVSB 4W6XA 4XDQA 1KV4A 4AHXA 1L4AD 2H0BA 2P3IA 1RMU2 1I5ZA 1D7MA 2VUJA 4H44B 3ROUA 2E75B 5HXMA 5F9TA 4OHWA 1SDDB 1OT5A 1XNTA 5FXVA 2VBDA 3C8XA 2VBPA 1KD7A 2XVGA 1ZVFA 1FDIA 1R1A2 2QTWB 5A6QA 2JDKA 5F5QA 3T3YA 1D4M3 2BFUL 1HXS2 4Q1PA 5LBBA 3ABZA 3RFRA 4A6SA 5LW9A 1JYIA 2HWF2 4EE2A 1NAFA 3KS7A 4QDSA 1ZBA3 2ERFA 2UWCA 2KSJA 3HRNA 2VW2A 2GC2A 3G3ZA 3L72E 1BEV1 3CO2A 3KV4A 2WNUC 3ZN6A 3CCRP 1GNYA 4MO3M 3H1HG 5H2FE 2QIWA 5IAVA 4O9BA 2DVFA 1ZOYC 1KB9D 2QSIA 4LHKA 5KHHA 1Q7YQ 3O6QA 2XJTA 5LBFA 2J42A 3DXTA 4QB6A 4NPDA 4MXWA 4J1XA 2VVEA 1FNZA 3WD5A 3E97A 4N43B 1EC5A 1L0NK 4WM7B 5FZHA 4XJWA 3RPQA 4MXWB 2PQSA 4XTPA 3CC2P 4AAPA 2XJQA 2NZ2A 4DINB 1S1CX 1YJWP 1QJX2 1TME3 3J7LA 3ES1A 4QPWA 3UKVA 1S1AA 1W2UA 4IE4A 4FOQA 1QNWA 4QB2A 1R093 4XACA 5BPXA 2EXIA 4CPBA 5IK8A 1RIRA 4CDQA 3ZMNA 1AJOA 4D6TG 1HW5A 3AP7A 2I1JA 1UIXA 4NAOA 1PMHX 1K04A 2EALA 1IPJA 2JE9A 3OYWB 2KI7B 2KNCA 3MIEA 3HNBM 3ALQA 3PIJA 4QXBA 3RZZA 2OXBA 5FZ4A 5GLTA 1WD3A 3V2PA 3Q8CA 4UYBA 4YFWA 3CD6P 3WCRA 1FI2A 2QM8A 2ZGPA 1YJLA 4GODA 2EXKA 3L70D 1WLDA 2K37A 3QOPA 5IWFA 4EROA 1OA4A 5C6CA 1YC61 5LASA 2W92A 1IZNB 5BVZA 1L4AB 1OMIA 1REDA 2WLPA 1L0LK 2WO1A 5FZEA 2FDKA 1EDIA 5F5CA 1DEEG 1L4AA 5E79H 2VRSA 2C9NY 4Z2WA 1E79H 2HG5D 2QVSB 1JTHB 1SVFA 4KWKA 1NCRC 1RUC3 4RFRB 1GP6A 5FZAA 3NMBA 4FPOB 4JHZA 1BLZA 2ZYDA 1J1TA 3FX0A 2FYZA 1OA2A 2I2SA 2ZT9D 5L9RA 2OZJA 1GL2D 4JVAA 2RR11 1SQPD 4H13C 3TNQA 1CESA 2JEMA 1IK7A 1L7RA 2JG9C 3KCCA 4PT6A 3CCQP 3D0SA 4HYTB 4AL9A 5T54A 5HCHA 2A6YA 1SQQG 1BXHA 2XR4A 3PURA 4ISRA 4YVWA 5SV8A 4AHYA 5KHJA 3HD7B 3VKMA 1L0NJ 3ETQA 2D97A 3RL0g 5BU5A 2YDEA 1NTMG 4LUKA 5H9PA 3TF5A 3ENRA 2XV5A 1QJY3 4R4ZA 1HX6A 3SXWA 1TU3F 4GMP1 1W9TA 4RL7A 1FAVA 3ZYJB 4AQ6A 1TME2 1RVF1 2QQWA 3AVSA 5L19A 3ZYRA 2X10A 1OLRA 2GMMA 2VNGA 1B09A 2R3CA 4NUBA 4D6RA 4C0BA 4ASKA 2BEOA 1JODA 3WNKA 4CEYA 2XJRA 3R6SA 2XQXA 2PHRA 4Y4RA 1OUSA 5BNOC 3VKLA 1UQXA 2ZGRA 4ASLA 3WHUA 1L0LE 5JOYA 3MZWB 3L2YA 2YUEA 1C28A 3NNMA 4YGDA 1FDOA 2Q30A 2VTXA 4I6MC 2BZDA 1ZZ7A 2QQKA 3HNYM 5EYYA 2UYAA 3TN91 1PGL1 2OYHB 1JMUB 1MZEA 1UXZA 3RSJA 4LBQA 4BA6A 4C1WA 4A41A 1GQPA 4AGRA 4ZY9A 1CZSA 1VBD3 2WFF3 3L73J 3BODA 2OYOA 4TLGA 1C8NA 1JS9A 3WQBA 3WUUA 3VYIA 3ZDVA 2FCTA 4JGZB 3M0DA 3CCUP 4MGYE 5EFUA 4CSWA 2R32A 2YGLA 4JGZA 4HZFA 1MFTA 2PTMA 2X5IC 5AW0B 2RJKA 2WINB 1NLQA 2ES3A 4JYCA 1T2KD 1BE3D 2LR2A 2A6ZA 3GCXA 3JBG1 1HWTC 1NTZE 3U4XA 4ZHNA 3RZMA 3FUQA 2PN5A 3GBGA 4W7ZA 5AVXB 4GQ7A 3E5QA 4BLIA 5H9SA 1LTBC 2AGSA 1Q86Q 3KWVA 3MLKA 3TEXA 1ZZ6A 3N7NA 3LF7A 1W2OA 4CEYC 2IUWA 3IPVA 3CLQA 2P6HA 4XAEA 4XXAA 4JPZB 1R5SA 1KILC 4BRYB 1NOHA 2PHUA 1Y4WA 2XL7A 3DF0A 3JQWA 1XNDA 5TISH 3MF6A 4P14A 3OGGA 1DD4A 1G9DA 1QNYA 4Q29A 1D0HA 3WG1A 1FDMA 1LOCA 3I8TA 1P84H 4EN7B 2OPWA 1AR63 1L3JA 4UBGA 1PGL2 1L4AC 4M3CE 4KBBA 5CG9A 1CGPA 1RUOA 2Y0DA 3T09A 3VHOA 4AVTA 2XLGA 3TYYA 1ND3B 2ZMLA 5KLVJ 1XE7A 2ETEA 5EPAA 3SCGA 3NKTA 1MUUA 2DCZA 3VZLA 3IM0A 2YXQB 3CJIA 1UZVA 1LHNA 2L91A 3BATA 3N9LA 1N47A 3E1IA 2XONA 1JO5A 1W8FA 2JG9A 2W52A 2Y0EA 1VBE3 4RHV1 3RZLA 1Y3TA 4IL6X 1RUH2 3W9AA 2NRGA 2J7MA 1WD4A 3I3MA 2D44A 2D2CD 4E4DX 4AQRD 2OYHC 2YC2A 3BN6A 1N3PA 2D2CC 5A3TA 1GANA 1W8WA 2QEXP 4I01A 4BLJA 1CAWB 2YC0A 3AZWA 2CHHA 1GK6A 5FZCA 1JUNA 3IMNA 3KF5A 4FFHA 5T52A 4D7YA 4RR3C 1VE0A 1U5ZA 2BBAA 2VZVA 4P9YA 1N3OA 4ISQA 4Q4W2 4FTBA 2XPJA 1CSBA 1F2NA 1GWKA 1KGYA 2PHWA 3PU8A 5DDJ2 5I0DA 3Q5PA 4OULA 4L99A 3LEKA 5FK7A 3MW3A 2GUVA 2ET7A 4O65A 4XYXA 5IW0A 2BEZF 3KXDA 1XTCC 1VQ7P 2Y64A 3Q3DA 2VZ3A 3P3NA 4JBZA 5H2FH 3QCWA 3PVEA 4QHOA 2HBTA 3U37A 1SQVD 1SBFA 2HWC1 2ZX1A 3AK0A 1NY72 4QXKA 1SZBA 5FXXA 3AKPA 4IE6A 5SV5A 1K3IA 1OIPA 4HFSA 2ZAEB 3VBSB 3WDYA 4AFMA 4TZDA 3L72G 2WZ7A 1FXZA 3MIBA 4AEMA 3RK3D 2GMEA 5KXEA 3LFIA 1XSRA 2OIIA 1UY0A 2MEV3 4GALA 1GOFA 1N1SA 3NJXA 5KXCA 5AW1B 2HWE3 2YBSA 1VQ6P 4NMIA 4AG4A 5C3RA 1P84D 1VPCA 1R1A3 3IIAA 5BYNA 5FO8B 3PLQA 3H1ID 3THPA 3WP4A 3ZXJA 3BTYA 1OD3A 3C7EA 1SPPA 1I5PA 4GMP3 1FOSE 3R4DB 4L11A 5AFEA 4OHZA 1LR5A 2VM9A 4XF9A 3M0AA 1NCRB 2JDAA 3CX5D 1QOOA 3ZYGA 3M9QA 2HWB2 1HRV2 1N1YA 1DZRA 1SLCA 2Y6FA 2BWAA 3B69A 3ZFGB 4MG2A 3FWEA 4YG6A 3N4XA 4LGDE 2VZSA 1PZQA 4XOGA 4ORFA 1BBT2 2QFEA 3LOIA 3WG2A 3H3ZA 2VNOA 1IS5A 1LKNA 3HN3A 3PJQA 3GGLA 4NWVA 3GMAA 3OD4A 4YVSA 4FBFA 5KKZB 1Q5OA 5FY4A 1NO4A 1SQQD 1JYCA 5CU1A 3FLTA 4K8FA 2KXPB 1WW6A 3AZYA 4MGKE 3H3UA 3KT4A 4Q8KA 2WIIB 1RH5B 2VZQA 3R2PA 2EXJA 4BPZA 4C1XA 5GZGA 1H8VA 4LR4A 4NROA 2PLV3 2WC2A 1QJX3 1PZ8A 4A7YA 2RMZA 3AC0A 3M7AA 5C3QA 4PCRA 4WM7A 2WAOA 4R8HA 5L8RJ 3A23A 2Q3IA 1LJ2A 1KXGA 1UYPA 2E33A 2MNGA 3M3EA 4FO9A 4ZS3A 3POGA 3O0XA 3VLBB 1JZ2A 4FQ4A 5B4NA 1HRV1 4J6GA 4WM7C 1LTSC 4IGOA 5CJ4A 1YCIA 4FVVA 4UFIA 3CLPA 1X8MA 2D6KA 3B9IA 3CWBD 1UMZA 2HEWF 3PUHA 2B42B 2VOVA 2P3YA 4N7IA 4OUEA 4OZOA 4AR2A 3RWKX 4IEQA 5BNOA 4KWJA 5JDBA 1KS5A 3EFGA 1DQ4A 2VTFA 4A42A 3H1YA 2C9KA 2R7EB 1YI9A 4CP9A 4OI1A 4COUA 4U3FD 4ATEA 2Y6HA 4NIDA 3PTZA 2JDPA 2VOKA 4GB32 2EICA 5AVSB 1RHZB 1J84A 2R072 3FXDA 3CX5H 4TXWA 1YQ3C 3WP3A 1X7NA 1N73A 5FZMA 1QH7A 3OF1A 3KDPB 5T5OA 2WPSA 1K5MB 5AVUB 1VBC1 1VQOP 2QJYB 1HQWA 1OOPA 4AFDA 2WFPA 2OZ6A 2W9XA 2ZAHA 2IXLA 3HT1A 5FRAA 3E1RA 2NP0A 3H1JD 5K5GB 2J59M 5GTIH 5HCBA 4BXLA 3TWIA 3MV01 1RUJ1 5F2WA 1JW6A 1VBE1 2R043 3ABVC 4U2AA 3VZJA 1ND2C 3BVCA 1PV3A 1XOYA 4XVHA 5APXA 3WUTA 3FL7A 1W9WA 4KG0A 2FBWC 1KYOH 1YYNA 1S4CA 3ZXGA 4BDVB 2V5YA 3D6EA 3VHRA 3AE6C 4Y1YA 1NU1K 2RDRA 5L7OA 1PMJX 5ABJC 5BNNB 1ULCA 1RF1C 1US3A 2BW8A 3BIWE 2TUNA 1RE3A 1GTWA 1PZ9A 1URQD 1QIQA 1E5HA 1R083 3PDQA 1SFCC 1EV13 4IV3A 3V64A 3L70J 1PGPA 2NPSD 2BV4A 5IAXA 1W2BO 3HPNA 3U75A 1OH3A 3LSEA 3S1KA 5AVPA 2VW1A 4OGQB 3FWLA 4KJMA 1EZVE 1S0IA 2C9AA 4EN0A 3H1JG 2FKWB 2Y0IA 4FSJA 3VKFC 3KCXA 1K05A 3LW5J 4S2HA 3I2KA 4RR3A 5JR7B 1VQLP 1GU5A 1UO9A 1LT1A 4PHZA 4QKDA 4YVWB 5FMOL 3D0JA 4GWJA 4IE7A 5FKBA 3ZFFB 5JUVA 2C0WA 1W03A 2GMPA 1LGCA 1AL23 2UWAA 2ZHMA 4Z07A 5IJRA 2VR4A 4EJRA 4YLZA 4I3PA 1FJPA 3F95A 5T5JA 3VHNA 2Q5UA 3GW6A 1EPWA 1Q8SA 2RR13 2WQ4A 2XBO3 3PUIA 2XZRA 4Y22A 4UOJA 4AW7A 4CDWB 3VZOA 1CIYA 1EAH1 2VJXA 1IPSA 1IS4A 4DPNA 3H1JJ 1FAYA 1OKOA 5APSA 2GC0A 1A3KA 3C1LA 1RUI1 3AYAA 3GALA 3NNFA 1O3QA 2HWF1 3ZIWA 1BCCG 3CL3D 3L37A 5E79E 1JY2P 1JUIA 3IB3A 4IL6E 4GKGA 1VBB1 4C46A 2G9FA 3INAA 4N53B 1T6BX 4RGGA 1WMKA 4OHXA 4NPMA 3NJVA 4GWIA 5KBFA 5K9YA 1PPJE 3VBUC 2E63A 1NHLA 4UW6A 2CYFA 5GZFA 5AVTB 2ZEWA 3N9PA 4L97A 1D4M1 1D4VB 2EAAA 2G9ZA 3OGJA 5KXBA 4NN0A 4CYDA 3MHZA 3C9IA 1DGWA 2WABA 5FMDA 4AF9A 2KK7A 4COVA 1VPHA 2IC1A 4JC1A 1LWUB 3ZO0B 2WL1A 4OWFA 1XU1A 1FT9A 3DGTA 2D6OX 5FZ8A 3SCFA 4DRRA 4Q1RA 2KM2A 3ZKYA 4RKUJ 1XRUA 1SLAA 1BCCD 2BASA 1R64A 1AYN1 4LC1A 1FMD1 4CA9A 3ZR6A 1IOAA 3WDWA 4V1PA 1QDCA 3OOXA 4B1MA 2V7QH 1AV1A 1NT0A 1ODMA 2P17A 3R4SA 4Q4X3 4E4ZA 4YZ5A 2DUQA 5JPMB 3BTAA 3NAPB 4QDRA 3RL0D 2KUBA 2BU9A 1LT9A 1KYOI 3NAPA 1D2SA 2QE3A 1FZGA 2IXCA 1PIV3 1OVRA 2WT1A 1XNKA 2MEV1 2XBO2 3TEZA 3HT2A 5JSOA 3HJRA 1CAVB 5KHIA 5K0UC 4PDWC 3BALA 2ZT9B 3GBWA 4RSUA 4YZ2A 4RYDA 1ZLLA 3FX3A 1H30A 3WW3A 2W39A 3WCSA 2TEPA 4JX0A 4XTMA 1LOGA 1YFUA 4B4RA 4GOFA 4MGIE 1H8AA 4AEDC 3B94A 4ZXKA 3WMM0 3MV11 3PJYA 4W50A 1N7LA 1H88A 2DVDA 4P9IA 5CBNA 2FXOA 1UMHA 1MVQA 2CV6A 2QKDA 3POJA 5DAPA 3WP5A 4Z1MH 4COWA 2RS33 4C7RA 2Q4SA 3RK3B 4D6SA 1EZVG 1YFYA 2Y6KA 3OG2A 1JZ4A 3H7YA 2G3AA 3AE2C 1GD2E 1W2AX 5FZ3A 5KHKA 3W68A 1NY71 5FY0A 2N1TD 1UD1A 3GYDA 1ONAA 3MIFA 5I0UA 4CCMA 4HETA 1VBD2 4ZU7A 3W21A 3S5QA 2P5BA 4RN5A 2JICA 3K46A 3ZXEA 1ENXA 1IGOA 5J48A 3HTKA 1QXJA 4W4ZA 3E6BA 5CYYA 3GLMA 1FMD3 2D5HA 2ZA9A 3AMQA 1R082 1DQ2A 4ZZ8A 1C5IA 1P84E 1ENSA 1W39A 4HANA 3V0BB 3JCUE 4NIAA 4P9JA 4TYSA 5C4WB 2ZGKA 4WY4D 3VUOA 1HB1A 1BGYD 2QJPB 1F35A 2NN8A 2WSEJ 4M0NA 4NIGA 1VRBA 2P3JA 2LM3A 1G9AA 4XCBA 1FATA 2R1BA 2HWB1 3ACGA 3KHBA 4NVPA 5EJ1B 4YW6A 4NPFX 2JB4A
chains in the Genus database with same CATH topology
1AYM2 4N43A 4MXVA 4QU2A 1YUDA 5AC92 4K7JA 5BNPC 3RYRA 1X36A 2ARBA 4JGZC 2QNKA 3H0OA 1ZRCA 2EIGA 5LK7B 2UY9A 1A6CA 1NCQB 4DY3A 4QQ2A 4H7MA 1OPMA 2YXSA 3N35A 1S0JA 2DWRA 4X8PA 3M2MA 1DYKA 1OPOA 1XE8A 1JTZX 1MS9A 1MR5A 2Q1ZB 1O91A 4K40A 3VGIA 2ZX3A 5IK8A 1HXS1 1G86A 1UU6A 2BQPA 3FLPA 2QJVA 1COV1 1TNRA 4K9SA 1G9CA 2NMNA 2ZZJA 1LTEA 3N7LA 4N7UA 1DGWX 3GZTB 4E2QA 3EJKA 1S2BA 1XXNA 4Y1VA 2DFCA 5J36A 1QU0A 1GICA 3ASIA 3IKWA 1IFPA 4ZU5A 5IK7A 4D7SA 5E8AA 3QH7A 5FCCA 1FOD2 2RS51 4JGYA 1HDKA 2G4IA 3GF6A 1AXKA 3SISA 4P9LA 3MZHA 1WW4A 1PO12 1VBC2 4DMIA 2LUWA 2O8OA 2GU9A 4Y24A 4RS5B 1BJQA 4X6RB 1WMEA 1S0BA 3HWJA 4NO4A 2PHXA 1H0BA 3T1LA 3M3IA 2FMDA 2RS11 2IWGB 4COYA 4DFSA 1B35B 1ND2A 4JRAA 1JN2P 3SLIA 1C4RA 1MS8A 1QJY1 1W6NA 1YRZA 1GQGA 5ACA3 1UN1A 4AVCA 2RHPA 2R061 2ZX2A 2PYTA 5CFDB 3M4FA 3RYPA 4GULA 2CAVA 2XJPA 1WCSA 2OUJA 1J3RA 2CGOA 4HN1A 2HWF3 1WCKA 3EHKA 1UIKA 1LGNA 2CGPA 3D4KA 4M3CF 3PJSK 1SMVA 1POV3 3EXUA 2VOWA 1CPMA 1CONA 3VL8A 5C33A 2ZJCA 4AI1A 2N7GA 2D3RA 2GH8A 2ZGMA 1UZYA 1MZFA 1H4HA 4KNCA 4CEWA 3WP6A 1DYPA 4TSVA 4XILA 2WJSA 3ZX7A 3AMMA 4N90A 2FHRA 1U5YA 2BNOA 4DB5A 4BE3A 2XJUA 3FZ3A 4S2FA 1YFXA 4AHWA 5CA6A 2TBVA 1PO21 1OQDA 2YMZA 1QQP3 2JX9A 1WLCA 3D5OA 2YZ4A 5GZCA 2R30A 3CF6E 5K7PA 1N1TA 1NCQC 1VRH3 4Q4V3 1ENRA 1ZZBA 1J3QA 4PIXA 1O4ZA 3ZSLA 1J58A 1BMV1 3AYEA 3ZXDA 2WZR3 1HRI1 1WW7A 1RL3A 3WV6A 2RS32 4I0AA 3J8F3 1S0EA 4JGYC 2SLIA 5GZDA 4IXLA 4KG8A 2D93A 3AB0A 4MV2A 5A3MA 2XLAA 2DTYA 1ZA4A 2NLRA 4CEYB 1RUG1 3P3PA 5TSWA 3AFKA 1AF9A 4JDNA 1ULFA 4WVWA 5JAXA 2VG9A 3R0RA 3FBMA 2HWE1 1VRH2 4NHLA 1PIV1 3VBUA 5JIAA 2WS91 1UX6A 1CJPA 4XHXA 2AH2A 4HT1T 5I93A 3VN4A 5C8CB 1V70A 1QF3A 5T5PA 1I3HA