4WVZA

Crystal structure of artificial crosslinked thiol dioxygenase g95c variant from pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
195
structure length
195
Chain Sequence
ILRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPGQITPVHDHRVWCLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol dioxygenase
publication title Substrate and pH-Dependent Kinetic Profile of 3-Mercaptopropionate Dioxygenase from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa bwhpsa021
total genus 48
structure length 195
sequence length 195
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4wvzA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4wvzA02
1UW8A 3D0SA 5AVPA 2I45A 2UY8A 3LA3A 4L2NA 2D5FA 1DZRA 3HIFA 1J58A 4XF1A 5J48A 2EA7A 3C3VA 3DL3A 4XFBA 4AVCA 1O4TA 4IEOA 1YLLA 2FQPA 4KU8A 3RZZA 5HI0A 4FAGA 4HSJA 2OZJA 2BNNA 1FXZA 3LA7A 3GYDA 1EP0A 4MX3A 2BGCA 2V7QH 5T3NA 1X8MA 2GC2A 2H6BA 3H7JA 1ZZ9A 4HSLA 4KWJA 4WZCA 1YFYA 2H6CA 4DINB 4QGLA 1AQTA 2OA2A 3SHRA 4JTNA 1CAUB 3DN7A 3ELNA 4IESA 4YSFA 3RYKA 3JZVA 2GZWA 3I59B 3IIAA 5CU1A 5LEJA 2CK3H 4HZFA 4JTOA 1TQ5A 4AQ2A 5LRSA 5I0SA 1ZRDA 2E9QA 2ET7A 3OD0A 5C6CA 5BV6A 1ZNPA 2MNGA 1ZRFA 5J7MA 4D7SA 5I0UA 3LWCA 4MGKE 4EWAA 4HVQA 1NXMA 5LEKA 1FS0E 5FLIA 5I8SA 4PJYA 1I6XA 1ZZ7A 3RYRA 3I54A 1FT9A 1LRHA 3LA2A 3NW4A 1VP6A 2W6JH 3DV8A 4QGNA 3SCGA 1RTVA 5I8TA 2Q0AA 1H1IA 1PMIA 4QX5A 5CADA 1QXRA 5FLJA 1O3QA 4R8HA 4Z07A 4Q0PA 3WW4A 1PM7A 1ZX5A 2DCTA 2CAVA 1CGPA 2IXCA 2FMYA 2Q4SA 3BU7A 3LAGA 3M3IA 3CEWA 3LZZA 2B5HA 2Q30A 3E5QA 2GC1A 1UCXA 4XFGA 2IXIA 2XGXA 3EBRA 3L2HA 3VHRA 3QOPA 4O9GA 4XFIA 1O7FA 2H0VA 3E5XA 2B8MA 1O3TA 4X6RB 4MGYE 4XFHA 3QACA 4KWKA 3BALA 2BNOA 4Q0SA 4ZU4A 1UIJA 4FT8A 3H1WA 2JDIH 2CV6A 1EYBA 3LOIA 2PAKA 4Q0VA 2P17A 1DGRA 5J3UA 4J1WA 1GQHA 3E5UA 3M70A 3UKNA 4MH0E 1ZREA 1H1MA 1YFUA 3D0JA 5I0RA 3EHKA 2IXKA 4ZU5A 3CL1A 3OF1A 5FQ0A 1DGWA 3MDPA 4BYYA 5FPXA 3H3ZA 4R52A 3B02A 2WFPA 2IXLA 2XKOA 2Z2SB 4FBFA 2GC3A 2PHLA 3ETQA 4ORFA 5KHIA 3KGZA 3SCFA 5KHKA 4AVBA 4J1XA 2E5TA 1Q3EA 3NSTA 3FFQA 2UYBA 3H1YA 4F7ZA 4KL1A 3IBMA 1QWRA 3WW3A 2EAAA 4N9IA 2WSSH 5E1RA 1JUHA 4IEWA 3E6BA 1SFNA 1RC6A 1HW5A 4KU7A 1YUDA 4YRDA 1WA4A 2KXLA 5CVRA 1YFWA 1YWKA 1CX4A 4MUVA 4IERA 4EWEA 4AXOA 4PIYA 4E2QA 3CLPA 3FE5A 1IPJA 5I93A 3KMHA 1CAWA 4I02A 3BB6A 3N4MA 4TLFA 3UKTA 4IEYA 4XFAA 1J3RA 5D1IA 4XF4A 3SMHA 1ZZ8A 4XEZA 3MPBA 3UKVA 5I8YA 3PVBB 2MHFA 1ZZCA 5KHGA 5JR7B 4AQ6A 3BPZA 4E2GA 4WBBA 5JSOA 3EO6A 3RNSA 3HT2A 1UPIA 4XFCA 3S0MA 3WW1A 2CGPA 3NL1A 4Z82A 1CAXA 1O5UA 4XF9A 1XE8A 2XNDH 3U0ZA 4I2OA 1V70A 2CAUA 4PIZA 3TNQA 4LLOA 3E97A 2GAUA 1OD5A 1SEFA 5I0TA 1RL3A 2D40A 4QMAA 4LUMA 1RGSA 3D82A 4IEZA 4D7TA 3H9AA 2QVSB 1J1LA 2PQQA 1ZZBA 1O3RA 5JAXA 3BCWA 5C8WA 3OCPA 2XL9A 2C0ZA 4Q0UA 1ZVFA 3SXWA 4LTAA 4BH9A 4IEQA 4HN0A 1UD1A 2XLFA 3TNPB 2BEOA 3H3UA 5BY5A 2QJVA 5E16A 4I0BA 5EZWA 3WW2A 5F1RA 5KHHA 4K8FA 3FJSA 1SQ4A 1CAUA 3ACLA 2PA7A 4ZU7A 1YFXA 2O1QA 4UBGA 3H50A 3USSA 3I59A 2V09A 4HBNA 1CAWB 3U11A 1L3JA 2PHDA 3IWZA 1E79H 1CAVA 3NKTA 4MV2A 3CF6E 2UYAA 1Y9QA 1QXJA 4LUKA 2UY9A 3EFFK 3NVCA 4UBHA 3ES1A 5BPXA 1EY2A 3KCCA 1FI2A 4XETA 1Q43A 3FHIB 5FCCA 1UIKA 2B9UA 4JV4A 4JVAA 4MGIE 2VECA 5FDBA 2ZKLA 4CYDA 1EPZA 4YNIA 1LB2A 1XE7A 4META 2PAMA 2Z69A 4H7LA 1OI6A 3MYXA 2GH2A 1J3QA 4IEXA 2XLGA 2GU9A 2XLAA 4DJGA 4X6QB 2D93A 3FWEA 2GC0A 2XHKA 4EROA 2BYVE 3HQXA 2PFWA 1Y3TA 1X8EA 4L11A 5BXXA 3DKWA 3H8UA 2K0GA 3O14A 2MPFA 3U10A 4F8AA 3ES4A 4OLLA 3G7DA 3EQEA 1I5ZA 2OYZA 1OMIA 4IETA 1X7NA 2VQAA 1GQGA 4LEJA 1JEKA 4HVRA 4LULA 1X82A 3IDBB 4BIFA 2XKPA 3PNAA 3ROUA 5JSRA 2HKXA 4LA3A 5FPZA 1BSHA 3HT1A 4MZUA 4Q29A 1IFPA 3OGJA 2WC2A 5LRRA 1IPKA 1ZZ6A 2PYTA 3RPQA 2N7GA 4B29A 4Q0QA 1U12A 4I09A 4QXKA 1J59A 1RUOA 2PTMA 1NE6A 5KBFA 2IXHA 4MGZE 4E2SA 4O9EA 1CAVB 5K8SA 1OFNA 4NVPA 4QM8A 2ETEA 4OFGA 2EVXA 4HMZA 4FAHA 4HLTA 1WGPA 2VPVA 4HVOA 2E5YA 3RYPA 4HN1A 4PIXA 1ZRRA 5FQ0B 4IEPA 4XFFA 3E6CC 2F4PA 2OPKA 4YXWH 5FLHA 4QM9A 2QE7H 4N9HA 2Q1ZB 2PAEA 1QY4A 2QNKA 5I91A 3OTFA 1VR3A 1G6NA 4XF0A 4P9GA 3MZHA 5EFUA 2K9ZA 3E6DA 2O8QA 4IEVA 2ATFA 4QGMA 3PJSK 4XF3A 2XL7A 3SCHA 4BHPA 4RD7A 1NE4A 4I01A 3FZ3A 2D5HA 4YARA 3H7YA 1O3SA 4A2UA 1YHFA 4EV0A 4GULA 3R6SA 2Y0OA 3CJXA 1XRUA 2OZ6A 2IXJA 1BSNA 5JSPA 3RDIA 4KWLA 3I7DA 3IDCB 3ZDSA 4I0AA 4UXAA 2BNMA 4AVAA 2HJIA 4LA2A 4EWDA 3S7EA 1LKNA 1NYWA 2QCSB 5BUVA 3FX3A 2ZCWA 2IC1A 1O5LA 3KSCA 3EJKA 2ET1A 3S7IA 4IEUA 5JCTA 1J3PA 5KHJA 3CO2A 1WLTA 4WVZA 1ZRCA 4YYOA 1RUNA 1NZCA 1LR5A 3H1MA 3PLQA 1VJ2A 3GBFA 1DZTA 3ST7A 4I3PA 3NJZA 1CAXB 4ONUA 2QDRA 3KGLA 1Q5OA
chains in the Genus database with same CATH superfamily
5AVPA 2ZJSE 3N7JA 2UY8A 1TNFA 3DPRC 2VNRA 4YZ2A 1H9PA 4HSJA 2BPA2 1G9CA 2VMIA 2NZ2A 2W3JA 2ZMKA 4RS5C 2ZA9A 1AQTA 3POSA 4LORA 3C9IA 2VUAA 5AVTB 5FMDA 4YSFA 3RYKA 1VBE2 3THDA 4DRRA 5FZCA 2WJSA 4LO5B 5BNNB 2KZJA 3ZKUA 3CIHA 5FUIA 5APYA 2FDJA 4Q1RA 1FDOA 4C91A 2AREA 3OGSA 3RS6A 1EQ7A 5F6KA 2XMLA 4DUWA 4YFZA 2Y6FA 2XBO3 5K7PA 4RHV1 2FCTA 2A5ZA 4XDQA 1TE1B 3LIDA 3TAYA 2ZYGA 5AW9B 1QH7A 5A3LA 2BVBA 4QU2A 4QPGA 5FO7B 2JDZA 1CGPA 1U5IA 5EYYA 4QX7A 3LZZA 2VCBA 1UCXA 1EPWA 2IXIA 1HRI1 2N1TA 1HIXA 4DOJA 1ZV8A 2VR4A 1NA1A 2A06D 2VE1A 4X6RB 2QFEA 2KLUA 4CCDA 1ULPA 3BALA 3CXHD 3WNKA 1EYBA 4QXHA 3L73J 2WT7A 2PHWA 1FC2C 2IZWA 5J3UA 5CFDB 3JB4C 1Y47A 2W1UA 2ZXQA 3CDZB 1UPSA 3B02A 2WFPA 3CI9A 3OEAA 4BISA 4XCBA 3P7KA 1UXXX 4UW5A 1QDCA 5L36A 5CBNA 1OLRA 4GALA 3QH9A 3RZGA 2P7JA 4N53B 1NTME 3IN9A 5IAVA 4P9LA 1USEA 2QE3A 1VQ9P 5C70A 4Y26A 5KLVG 3VZKA 1KEXA 5GLWA 4KBZA 1S0GA 1MEC2 2FYNB 3N7NA 2IX7C 3UKTA 1V6OA 3LDKA 3RGBA 1M57D 3L72E 4GQ7A 2J1TA 3AVSA 4LQRA 3MF6A 2JG8C 3OYWB 1UPIA 3WUVA 1REFA 4XF9A 1SQQJ 4AK3A 2M5AB 1RL3A 5GM0A 3NAPC 3J7MA 1RGSA 3BGAA 4MGSA 1H8TC 3LGRA 5C8CB 5A3OA 5JLVA 5A32B 1S3JA 3AYEA 3OCPA 3TEZA 4FP2A 4Q0UA 1H0TA 1KILD 2NM1A 5CCHC 2CY6A 1VF5B 3NMBA 3GALA 4K8FA 2R3SA 3L9JT 5J96B 4FTSA 2C0WA 3A7QA 5IUQA 1E79H 5JZGB 1URQD 2VD7A 4YVSA 1MS0A 4IGQA 4RO0A 5KC5A 1EY2A 1O6UA 4JV4A 4RR3C 3F89A 4AFAA 5FDBA 1KQLA 3V65A 2RS13 2PHXA 4META 4C0HA 2JDMA 1S0CA 1Z0HA 3WNOA 4CE8A 5LBFA 4NIHA 4CCKA 3HTKA 1Q7YQ 1YJWP 1BEV2 4A7PA 4MGTA 1GV9A 3O14A 4R9BA 1DDLA 3T0BA 1UZWA 1W6MA 5FWEA 1BK0A 4IDZA 1H0BA 3AE6C 3B7MA 1NCRA 4Q29A 3OGJA 4DOUA 5FY9A 4AI1A 2X53S 2JE8A 4YM0A 1NCQA 4MGZE 1DQ4A 1UMZA 2ETEA 3D4KA 2FBWC 3RZKA 4CEWC 1AR81 1FOD1 5J36A 1EZVG 2OPKA 1VBB2 4DIQA 2PAEA 3I5CA 3VD3A 3V2RA 1TNRA 3E6DA 3KS7A 1FZCA 1SP4A 4DCKA 4A2UA 2VZPA 1FU1A 2O0OA 3NV1A 1VQKP 3IAQA 4DS0A 1FMD3 2J7MA 1V6MA 3AZXA 3MIWA 2W8ZA 2Y33A 1R092 5KXCA 3AEFC 1SHWB 4R9CA 1OQEA 3RJRA 2Y8KA 4F3JA 1LNSA 1AVYA 1VQNP 1JY2O 4PD4E 5KLVK 1DLCA 4WVZA 4FFFA 3SEPA 1PX3A 1PVC2 2NYYA 2HPCB 2RS52 2NPIA 4YZ1A 2VU9A 5C3QA 2ARBA 1GSLA 2RM21 1C8M1 5LBBA 4YTPC 2XHNA 1HJGA 4P02B 3I2GA 4K3AA 4XF1A 3L71J 4LE4A 4AVCA 1O4TA 3SKJE 2FQPA 3RZZA 2GUSA 4BA6A 4XHBA 4PCRA 1X8MA 2GC2A 3I3MA 5LWBA 2A45G 1VF5D 4XAEA 4JDMA 3PUQA 1CAUB 3K3NA 3I56P 2ZHLA 5FZ4A 1W8ZA 5FYMA 3WP5A 2WWJA 4IL6X 3BUCA 1N73C 2RJLA 3CC4P 3TGUG 3HE4B 2Y9ZA 4NWVA 5J7MA 1ZRFA 1IS5A 4AAPA 2ZMNA 1RUC3 3OD4A 3RZMA 1W9FA 1Z7S2 2K9JB 5EP9A 3CMEP 1JH5A 1J84A 1WLDA 2WO1A 2YMKA 1YQ3C 2VOKA 1R081 4CU8A 1AYM3 3AZWA 1PM7A 5AC92 1J1EB 3VBFC 2XGXA 4QQPA 4H3WA 1I5PA 3WF2A 5H2FE 1GOFA 3O1TA 1H2NA 4Q4W1 4MGYE 5FZ3A 1W04A 3JUUA 4CPGA 4ZU4A 3CNAA 1BE3G 3VBSA 4FT8A 3Q5PA 2B4KA 5A33B 2X5IB 3OOXA 5GTIE 2D3PA 2R44A 5A6YA 4RGKA 3OF1A 3CC7P 3H1JD 3H3ZA 2ZMLA 3VHNA 1RUE2 4RFRB 1CI6A 4MXVA 2D97A 3WP3A 1OA4A 4K8RB 2CGOA 1JTHB 3S1KA 3QH7A 4CPBD 1YUDA 1T6GC 3PMEA 1WA4A 3HD7A 4OUMA 4QPWA 4E4ZA 3PVOA 1RUF3 3CX5E 3KXDA 4GODA 5F3GA 2E75C 3Q8EA 1IHMA 4IE0A 4M0NA 2NPSD 4YW7A 4M3CE 5KHGA 1GNYA 2WAOA 5JR7B 3H1ID 4WZFA 2YU1A 3RNSA 1BCCG 1SZBA 3WCSA 3AEAC 1YJNP 1OOPC 1ULCA 1O5UA 4CCLA 1PO22 4I2OA 3WG1A 2CPBA 3ZVXA 4V2VA 2GAUA 2Z79A 1C5IA 4L9BA 2XBO1 1SFCA 5FZMA 2VM9A 4IEZA 3JU9A 4FCAA 1FV3A 1WCDJ 2F4LA 5E6HA 1WW5A 1ASJ3 3T2QA 4AFBA 3VD7A 3J7HA 1YQ8A 4AFCA 3L70J 1W39A 1ENQA 4K6BA 4LIVA 5AW1B 2O1QA 2ZXEB 4IL6H 1CAVA 4W7ZA 5B66H 1LTIC 3EFFK 1YIFA 3KCCA 3R4SA 4CU7A 1OT5A 1DGRN 1NLRA 4EOTA 2R071 1VQPP 5KAFH 2GH2A 3RQ0A 2RDSA 3W68A 2YBPA 4GIFA 3QLQA 2OYIA 1D4VB 2GC0A 4LBNA 3K4AA 2KIKA 2YDEA 4K3UA 3JSVC 2X05A 1ZXGA 3WP4A 1HXS1 5JXIA 5JOZA 2Q1KA 1ND3C 3D6EA 2BCCJ 1BGYJ 3KZIE 1SQPG 2OYHC 4U3FJ 2YPJA 3CU7A 1K5MB 2D2CD 3KLSA 3VZLA 3H1HD 4YZ5A 4MOAA 3LIEA 3N3HA 5KLVE 2JJ6A 5FBZA 1WD3A 2WSEJ 3CLQA 3AP5A 1F8VA 3ZR5A 4HN1A 1VRH3 5IK7A 4MN4C 4XFFA 5EJZB 3PUHA 1XJAA 1QY4A 3N9OA 5KJ7A 3INAA 2ZAHA 1FAVA 4CDWA 3FZ3A 1OZHA 1SCRA 1YHFA 4OHVA 2RDNA 2Y0OA 2QJKB 1O4YA 4IV3B 4Q4V2 4KWLA 2AGSA 1IZ3A 5FJKA 2FBEA 2BGPA 4JKLA 4FPEA 2KZIA 3M2MA 2Q8DA 2ZVOB 3KSCA 1IKQA 1W6PB 4N78D 3WY6A 1W99A 1OFSA 1L7LA 1AX2A 3AXDA 3KZ4C 3K4DA 2ZEYA 1W8HA 4QPIC 1WMEA 2QEXP 1DH3A 2ZGSA 3PUAA 2B89A 1M90Q 1F5FA 4BQ2A 4NPDA 3VKOA 4OZXA 2P58A 4JGZC 2RS11 1SS1A 1PNGA 1ND2B 3A5TA 2H8PD 4Y1UA 5FO8B 1OQ1A 3SQOA 4FAGA 1WMFA 3HOBA 3UGGA 1AXZA 1FXZA 1SFYA 3ZXLA 1SVFA 1ZZ9A 4D69A 3VZMA 4HSLA 3HAGA 3VN0A 2LALA 3LQCA 4C7NA 2EXJA 3O8ZA 5F5AA 1MFTA 4IUGA 1JY3P 5M1BA 3VZNA 2WDBA 4LBQB 1WCQA 4DY3A 2XKMA 4UOJA 1QJZA 3ZYPA 3I4IA 4L73A 3OD0A 2XJQA 2Y34A 1BJQA 4D7SA 4B3NA 4WM8C 5GLZA 4Y5SA 2WQ4A 5FKBA 5C4WB 1ZZ7A 1ZRTE 4GH4B 1MUUA 1BQPA 2W6JH 3R05A 4Q5OA 5FWJA 2LXCB 1MZ9A 3S57A 3SCGA 3MBWA 1H1IA 3WDTA 2FMYA 4INDA 3CWBE 2A06G 3GHMA 2AXTE 3AVRA 1PZ9A 3S30A 2GP3A 1US2A 1GL2D 5J09A 2ORZA 3EBRA 4PF5A 1A34A 3QOPA 2G4IA 1AR82 2VXJA 1RUJ2 1HN0A 1FMD1 4FPOB 2E76C 1KGYA 2CV6A 1SQPK 1W2EA 2ZT9B 2EF6A 1AR73 4MH0E 2VL4A 3W21A 1JMUB 3MDPA 2EIGA 2XH6A 2PHLA 3ETQA 4FO9A 5CKQA 5F8PA 2WWUA 1HV0A 4D6QA 1UYXA 1L4AA 1XU1A 2HWD3 4AQSA 5E1RA 2YXSA 5FYIA 1T2XA 2JDAA 4EN7B 4KU7A 2WNUB 2HYXA 5FYSA 4JKKA 1WCSA 4H7MA 2CWSA 2OUJA 5DAPA 2XQXA 2D43A 2HWC2 4U2AA 4AHWA 3N4MA 3TEYA 1RINA 2RM22 4LITA 2BWCA 1WWYA 3V2NA 4CSWA 3JCIA 1JUIA 1DEEG 3ABZA 3O1SA 2W5FA 2VVFA 3C7EA 1CAXA 2QG4A 5C3OA 1RUC1 4MXWB 2ERFA 1X0TA 3BCCG 3AM2A 1R1A2 4M00A 3AL5A 1UD1A 1LEMA 1AYM1 4D6RA 2WSFH 2VTXJ 1C1FA 1SQ4A 4NUBA 2O3JA 3L75J 3U4SA 2YFZA 4D3WA 5JXGA 2WWSA 1FZEA 1JYTA 3U11A 2VW2A 2HEVF 2RMZA 1QXJA 2WWWA 2GNBA 1FNYA 2P5BA 1H2LA 4D8MA 3GF7A 2B45X 2WO2A 3H8RA 2B9UA 2HEWF 1N2DC 1DIWA 3WNXA 2BBVA 3GZUC 5BNPA 2Z69A 1LGHB 2Q5TA 1DD3A 3VB9A 1OW7A 5F5QA 1UY2A 3WUUA 4MHRA 3HEIA 1N8RQ 1NOVA 3HQXA 5KR7A 4Q4W2 5DUVA 1NZIA 2BRTA 1CJDA 1NLSA 3J8F2 5L7OB 1NY71 3ROUA 1VMFA 1V6NA 5B5EH 4MZUA 1YC61 5C3SA 5FMCA 5BNOB 1QDOA 5LRRA 1RUF1 3L72J 2H88C 2IWGB 2JR8A 2ZT9D 2M8RA 1LTAC 2IFNA 4RN5A 1F15A 1LOBA 2BWAA 4UFKA 3KVAA 4CDUC 4RQPB 3VYIA 2QE7H 2Q1ZB 3VBHC 2GMPA 1RUH2 3JCUH 2JD4A 1KS4A 5H9RA 1AJYA 3WNLA 1YIPA 2RR13 3SCHA 3BTZA 1O3SA 4A7KA 3LEGA 1IQAA 1QGLA 2IXJA 4Z2AA 5F39A 4AYUA 5B4XA 1ASJ1 2EIDA 3ALQA 5ACA3 2Y6HA 3WX5A 1L0NK 1LKNA 4A3ZA 1B35A 1XSQA 2ZCWA 1NTZJ 2B87A 1MVEA 3L37A 5KHJA 4MHUA 1KFUL 5FPLA 2ARXA 4FPLA 1OXCA 2JEMA 1GZWB 4KGQA 1CZVA 2LROA 3DUIA 3H1KD 1JOCA 1F4HA 2WABA 3CCVP 4PDWC 5JXHA 2Q1MA 4GB33 1SPPA 5HPOA 1J58A 2AZ5A 4IL6E 4XFBA 2X29A 4KMQA 1C5HA 1YLLA 2DF7A 5HI0A 5B66E 1IS3A 2PLV1 3RL0g 1L0ND 1R5LA 4AAXA 4OGQB 1IFDA 4NRQA 1TMF1 1K12A 3IF4A 1ZLLA 1OSGA 2OTJP 2R072 5EFWB 1UU5A 2K2SA 3AEGC 5D8AA 5C5UA 1SQVK 1YTZT 3K75B 1V00A 4CUAA 3HJRA 5FZ6A 1SQPE 5BV6A 2MNGA 1IQDC 3ZYHA 2DURA 1EV13 4C46A 1D2QA 1AR61 1UZYA 2V4VA 5FZGA 1N7SB 5LA9A 2KOGA 2B46X 1LWUB 1HQWA 1J2JB 1S9KD 1VRH1 4D0QA 1IKPA 3ZFFC 2A1XA 1X9VA 4H0LD 1OLQA 3AMNA 3S4RA 1FAYA 2XVKA 2QQWA 2Q4SA 3LAGA 2R041 2FCVA 4JYBA 2QQMA 5C39A 3L2HA 1SQVD 1YITP 3RWNA 1GP5A 3TB0A 1O3TA 2QJYB 4BQ5A 3FUOA 4H2AA 4N43B 1WMDA 5FPUA 1IFJA 3H1JG 5CCGD 3IFMA 1IFMA 2BASA 4EYYQ 1ZREA 2LS6A 4LOTA 1PM4A 3EHKA 5FQ0A 1UZVA 1K8AQ 2R49A 2YO2A 3BYWA 2Z2SB 5FRAA 3WUCA 1W8NA 2ZKNA 1AA0A 2WPQA 3DF0A 2KP8A 5A80A 1MS8A 1C4RA 1V0AA 1RUG2 1JUHA 3M3EA 1SFNA 4QPGB 2ZEZA 3WSOA 4DNYA 4HK8A 2ZX3A 1O91A 2Z42A 3DPRB 1EUTA 2JXAA 3OBZA 1E5HA 4H13D 3BB6A 2EICA 4GWIA 4ASKA 1L0LG 3ETPA 1ZP0C 5CA6A 1NA1B 4WY4C 3ZPOA 4HL0A 4E4DX 3UK9A 1OD3A 4BM8A 3OGRA 1MS1A 5AVYB 5C9AC 5FZ8A 4YM1A 5FP8A 3HRNA 4U7JA 4QX3A 2P4EA 2WZ8A 5TISE 4NPEA 2L91A 1YQ4C 1IJDB 1E5SA 1Q8QA 1J1LA 5IK8A 1D7MA 4LC1A 3DYPA 5HXVA 1HF9A 2WSVA 4BH9A 4D6SA 4DQAA 1KILA 5FZ7A 3T0AA 5EZWA 5F1RA 4QPYA 3ZYFA 1J1DC 4OI1A 3R4DB 1JY3N 3SFDC 4MG2A 1M7LA 2PHDA 1NTKK 1Y9QA 4B4QA 4D6TG 1SDWA 5DAWA 1URQA 3ZLIA 4TT3H 2WZR1 3CZJA 2Q1FA 1SG3A 3V0BA 1PL5A 1RXFA 4Y4RA 2IBZI 1O4ZA 3O1RA 2PRRA 1W03A 3ITQA 4IEXA 2EXKA 1N7SD 1KB9I 2GU9A 1PPJD 2XLGA 1C28A 5APUA 2A6XA 3D5OA 3O0XA 3VHPA 4UWDA 2GN7A 3DKWA 5FYYA 4QKDA 2FXPA 2O1KA 2HWD1 1H0TB 1AYN3 2VCCA 4CDQA 4LA3A 1C3HA 1L0NE 2BQPA 3B5ND 1ZBE2 1U57A 1ZMEC 4JF7A 2BW8A 2E74B 5IJRA 2C0XA 3WF0A 3WUTA 2EXIA 1YYNA 5F3IA 3I8TA 5GZCA 3GJBA 4Y22B 5CFDA 5JOYA 3RYPA 4LNVA 4PIXA 3PIGA 4OHZA 1HLCA 3O0VA 3VMXA 4OZOA 1MZEA 3RK2C 1RE3C 4M0HA 1W9YA 1QJY3 2W95A 1CZSA 4HG6B 4LXLA 4N53A 2Z5HA 2ORXA 2MEV2 1YQ6A 1SQBK 4JGYC 1S9KE 3M9QA 2XJVA 1LOFC 2ENRA 3J7LA 1W6MB 4PV1C 3WQ1A 1U0AA 2YIUC 3ECQA 3BCCE 3WP6A 1NCRB 4C0BA 5FP7A 3VBUC 3KQGA 5CFCA 4R9DA 3EJKA 4YFWA 2O01J 4AYCA 3GHGA 3L73D 1SQVE 2O01N 1F35A 5F32A 1LT1A 1NCQB 4LOSA 1GDTA 1VBE3 1CZTA 3FXDA 3I49A 2CU5A 3WQBA 1W6NB 5LCWL 4L2NA 1SQQK 5A6XA 3GCXA 2W9XA 3IMMA 3C3VA 1XNCA 4Y1ZA 4A45A 2KR2A 1TG7A 4IQPA 1CX1A 1GQPA 5CYYA 4QX0A 2ZPXA 3CMGA 3A3YB 2H6CA 4XZPA 1LTTC 3LOBA 3IB3A 3ACFA 2KS1A 4WVWA 5CAZA 4QX1A 1PP9G 2QZ3A 3FMGA 2DVFA 1UAIA 5KLVJ 1KV4A 4HZFA 4JTOA 1ZOYC 3POEA 4AQ2A 4H55A 1R5SA 4GT1A 1QJFA 2V72A 3ZFGC 3P5BA 2WPVB 4M3LA 3M7AA 4AHZA 1NU1K 3BPSA 1JW6A 4CCOA 2H43A 1TVGA 1JZ4A 1IS4A 4AI3A 5A3MA 4LHLA 1PMIA 3MUDC 4CEWB 2RDRA 1P84H 4BU2A 4Q0PA 2XJTA 1GP4A 2FDIA 5TSWA 5A7OA 3V64A 4QB1A 2ZX1A 1JS9A 1QOOA 2NPSC 1CVNA 4IV1C 4DEQA 1HWTC 2RKLA 2H0VA 5A7PA 3PUIA 1VE0A 5ACA1 3Q8AA 1PGPA 3H1WA 1XPWA 4Q0VA 1FE6A 1H2KA 1MEC3 1LT9C 3E5UA 1RF0C 5I0RA 1APNA 3RZJA 5CZKA 3MUZ1 2GSYA 3SCFA 1KYOI 4J1XA 2E5TA 3VKLA 4CXXA 4GB31 3LKJA 4XUPA 2QSIA 1DQ1A 1PPJE 3SSUA 1CONA 1YI2P 3DXTA 1W9SA 4YRDA 4CPBA 2B7YA 1N1SA 4IERA 3BTYA 1RE4C 4EZ4A 2Q9IA 5HV4A 1IPJA 1AR93 3PUSA 4XFAA 3SWKA 2YXQB 4AVVA 4AFMA 1NTKE 1FDMA 4I30A 5CCHD 2W92A 4XQWA 1S0EA 4XUQA 1RF1C 3MF9A 1S0FA 3EO6A 2HPCA 4XFCA 1YQ5A 1JZ5A 2CDOA 1OD5A 3LF7A 1EV11 3LW5J 1N73B 1X50A 2WAAA 2WT0A 3D82A 5HV0A 2LR2A 2IYPA 1LEDA 1PMJX 3CWBJ 3AXEA 2FKWB 1LHOA 4LTAA 3LSDA 5FZ9A 1PK6A 4FOYA 3HD7B 4XC9A 2P3IA 4UYBA 5KHHA 1BEV3 1CAUA 2M3EA 2WNOA 5GTHH 2TNFA 3WOGA 1YNAA 3BRVB 3RK3B 4MV2A 1AX0A 1IK9A 2XJRA 3ZN5A 1MQTA 2VULA 3MLLA 4BQYA 2ZKLA 5L19A 1HKDA 3A0KA 5DDJ2 2K9JA 4IE5A 1ZYBA 1UY4A 3L71D 3ZXAC 2WS91 1D0HA 1KD7A 4AI2A 4HOOA 3WDWA 2K0GA 4AOCA 5A3NA 1SQBE 1JODA 3H8XA 1JMMA 4CP9B 4IETA 4GKYA 3VOPA 1VBB3 1N7LA 2ZVNB 3WHTA 3CCMP 5JR2A 2AENA 3W5NA 1IPKA 4Q0QA 3J7NA 1OQDA 4NRMA 1CAVB 5F3CA 2OARA 5LA1A 2X5IA 1JU3A 1CESA 2ZGKA 4LO8A 3I55P 1R093 3VD9A 2E75B 3DECA 2VUJA 3TGUJ 3AP6A 2V4HA 1OH3A 1DD4A 3BIWE 1SQQE 3H25A 3A7OA 1PVC3 2R1DA 1RMU2 4UFLA 3U4XA 2RS53 3B01A 4CXWA 1NE4A 3TYJA 2G9GA 2Z5IA 2WNVA 2JG9A 1QH6A 3IDAA 5ABJA 5FYZA 4JBZA 2D6NA 3N7KA 4AW7A 4XACA 4XOGA 2Q8CA 1P84D 2HBUA 3FX0A 1JI6A 3SH4A 3P8CE 4ZKPA 2ZS6B 3PLQA 1TME2 2FYUG 3T2TA 3HR9A 3B71A 4OI2A 1BE3J 1UYPA 1NU1E 1DQ0A 3GG2A 3CJIC 2OQ6A 1EZVI 1KQGB 4AWDA 3S5AA 3FWNA 3B3QE 4FFHA 5GZGA 3VUOA 4UB8H 1H6XA 4IE4A 4BMEA 4QQHA 1Z7S3 3LA7A 3NKGA 3Q3DA 2VG9A 4CUBA 1VQ6P 4CDWB 2WZR2 3ZYBA 4Y5Z0 5FR3A 5HXMA 2YY1A 5AC93 1AYN1 1VB4A 1T8ZA 4WM7A 5A1AA 3AMMA 4HKOA 2BBAA 1ND3B 1RHI2 4YM2A 2PHRA 4YG3A 4XIKA 1POV3 1O8SA 4E27A 1Y7BA 1NXMA 1FS0E 2VMEA 5FLIA 4PJYA 3O6QB 1I6XA 3POBA 5D2AA 3NW4A 3W67A 2AEJA 5FYTA 1OPOA 2J1EA 4Y1XA 1F5JA 1NQDA 3L70D 1QJY1 1W2BO 5A3TA 1X33A 1RUE3 4GAZA 2VW1A 1GL2A 2VCMA 2A45I 2GDFA 4OVNF 4BDVB 1UWWA 4BRYB 4HETA 1PX4A 4YPCA 3I2HA 4NPRA 3PU3A 1W9TA 2W47A 4QDQA 1GQHA 2E75D 4COVA 1PV3A 2PHTA 5GZFA 1LJ2A 1NJIQ 4ZU5A 2FFDC 5FPXA 4LKSA 1GZLA 4R52A 3AJZA 1VBE1 1RUI2 5EJ1B 5J37A 1ZN5A 3JB8A 1BYHA 1NG0A 3KCXA 3T30A 4PQQA 3E7KA 4SLIA 1UY0A 2D6KA 2VMCA 4QPIB 3L71E 1PO23 4SBVA 4P9YA 5K0UC 1YFWA 1XYNA 2ZGTA 2BCCD 1BGYD 3AYCA 5AW4B 3UL2A 4EWEA 4U3FD 4FFIA 1SQXG 1VBD2 5AVXB 2P6CA 2KA3A 5D1IA 1CD3G 3T4HB 4DMIA 5IYYA 3H1LG 2DTYA 4NR1A 1DEBA 1W6PA 2ZBJA 3ACGA 4L97A 1SQPJ 2YXRB 3BPZA 5M0TA 3KQRA 2OTKE 4ISRA 3HT2A 3WW1A 1PP9E 3AEBC 2OX0A 3AKRA 2H0BA 1V70A 2CAUA 1KDMA 2DV9A 2JDYA 2W0XA 4JKMA 1VQ7P 1VBC2 1FATA 2Y6LA 1LOCA 2ID4A 1W06A 1L4AB 3VMZA 3DCQA 1LHNA 3NTNA 5E16A 1ALYA 3WW2A 2AUYA 5J98B 1L7QA 2GP5A 5GLTA 1KFMA 4EN8B 4Y20B 4LUKA 1QIQA 3O1UA 4ITCA 2NRGA 4XJUA 1DYPA 2WN3A 3AE8C 3SWFA 1WW7A 4DUVA 4CYDA 1UYYA 3VBRA 1XE7A 2A3XA 5FK8A 2E76B 5C4WA 5KKZC 2XLAA 1MEC1 2R7EB 4HFSA 2ZGRA 3FWEA 2Q8EA 4Q27A 1DF0A 4YW3A 5L9BA 3U10A 5FPVA 3EQEA 1W2NA 1FZFA 4LEJA 4JC1A 4BIFA 3PH0A 4ZKUA 1AL0G 3II6A 1JHNA 3KCYA 1QJX2 2CYFA 3O1OA 2PMWB 1W3XA 5FPAA 1AFOA 1RUOA 1E5WA 4CA9A 4Q4V3 5FXZA 2CSGA 4JQ0D 3PTYA 5GJ6A 5A70A 2JD9A 1KITA 4A41A 5BNPB 4N9HA 1C8NA 1LTJC 4HK9A 3HNMA 3JBG2 1OFCX 1HJ0A 2KSEA 1VBA2 2O14A 1JZ2A 3H7YA 4X8PA 2R0FA 1WBFA 5KC6A 2R30A 3L73G 3S9OA 5JIAA 3L70E 5GZEA 4EWDA 4NHYA 3AFGA 3MV01 3ZMNA 2PHUA 4DXZA 2QRXA 1BEV1 1PZ7A 1C1LA 1PO12 2DBNA 4CEYC 4B4PA 1HB3A 5FZKA 1DZTA 1QLED 1LESA 1J1TA 3Q5SA 3NJZA 4XJ9A 2K9YA 3HPNA 4E4HA 4E4SA 2FMDA 2VCAA 1HJFA 5LASA 1BHGA 1W8OA 4NAOA 4MXWA 3ZFEA 1L7RA 1QF3A 4AR2A 1T2KC 5BNNC 4ZHNA 5FZOB 3MP7B 1T6AA 2OZJA 1H8AA 4Z8BA 5FV3A 3R0RA 2D3RA 1F9KA 3SHRA 3K3OA 4JTNA 3BASA 4B86A 1Q2NA 4BLJA 1VBB1 3WDXA 1XTGB 1FPN2 2FZ2A 1LGBA 2BCCE 1BGYE 5JVVA 3BU0A 4EI2A 2FZ1A 1B35B 1G9AA 2WS92 4AVSA 4L99A 1W8UA 5I0SA 5LRSA 1YIJP 4XJZA 4W65A 3A4UA 1AR83 1BLZA 1RUJ3 2B39A 2E76D 1ZRIA 2WO7A 4K9SA 4TXWA 4EWAA 2E33A 2DVDA 2UU8A 3L74E 2JKBA 3RYRA 1R091 5KWRA 1NH4A 1J83A 1SPPB 2GALA 3BRTB 3ZN4A 5A3PA 1IO4A 4CDUB 4PD4H 2WYFA 4IFDK 1PVC1 4DXRA 1D0GA 1FOSF 2RS51 5APSA 4ZONA 2AYHA 4HT1T 2HWE2 3L75D 3UJQA 1HUCA 2Y6KA 1OXZA 3MV11 2W91A 4S2FA 1O7FA 3KYQA 3AE3C 2FYZA 3BCCJ 5LB6A 4W6WA 3WD5A 3ZYRA 1CPNA 3QH6A 4QXCA 1JHJA 5D8AB 3KHCA 2TEPA 5CCGA 3BN6A 5C5TA 1ACCA 3PRJA 3WU2E 2XU6A 5A1LA 1LU2A 2VOXA 2HWC3 2PQSA 5IK4A 2RM23 4O9BA 2ADEA 1URXA 1NLQA 2WSCJ 1EXIA 1QQP2 4WB4A 2IXLA 3FUQA 2ARCA 2FYNC 2I8DA 5FY7A 3PMSA 4HKLA 3IBMA 2P1BA 4B7KA 4I7ZB 2WSSH 2P37A 1PGJA 1LTGC 2KXLA 4PDWB 1QKQA 1OA2A 1G86A 2JDUA 4JRLA 1Z7S1 3ZOIA 3TEXA 1PIV2 3KMHA 4ZXEA 3CXHI 3B9IA 3L72D 5JWPA 5FZHA 1R1A3 1W9WA 3PVBB 5AFEA 1W0NA 4QD2A 5C8CC 1NTZK 1GZWA 2OUHA 1T6BX 3M9HA 3AMHA 3POIA 1D7PM 4XVHA 3OG2A 3T2OA 5AVQB 1PZQA 1IS6A 3R4UA 1W90A 4LLOA 4C1XA 4Y33A 2D40A 3SISA 1POV1 2C9AA 2D6PA 5H2FH 1H1AA 3H9AA 2A6WA 2PAJA 5JZGC 3BCWA 5DUUA 1UU4A 1N1VA 4IEQA 4GD4A 1QNYA 2Y0IA 4XQDA 5IWFA 1QNWA 2L9LA 5GTIH 4Q4W3 5EWSA 1YFXA 2SLIA 1NTZD 1RUE1 1SMVA 2PELA 4JZRA 2WUHA 5FZAA 3BATA 3J8F3 3PL0A 4L75A 5HCBA 3VL9A 4QQLA 1YYCA 3MICA 2VECA 3WVJA 3IR9A 5C3RA 3OPTA 3AB0A 3CX5H 1N7SA 1DG6A 3NWKA 1LWUA 2WMMA 1M56D 1UL9A 1V6KA 3KT7A 5AW5B 4NPMA 3PDQA 5APVA 4ZPIA 1VQ8P 1I5ZA 5EQUA 1GW4A 4LK6A 3D70A 1G2CB 1RUH3 1PO21 2W90A 2DBIA 4XYXA 5FPZA 1KILB 3GCWA 4I3GA 5JPMB 2VZ1A 5LW9A 4HYTB 1ZZ6A 3B5NA 1NTKJ 2N7GA 1U12A 4N43A 2EIBA 4QDSA 1DQ2A 1J59A 1NVOA 2PTMA 2YKQA 3SFEC 5FXWA 2EVXA 1GANA 3FBYA 3ILRA 1URQB 2GNTA 3V0BB 3H1LE 4IEPA 3WR0A 3ZX7A 1Y43B 1OVSA 4NE9A 3LE0A 4WY4B 1XNKA 2HH9A 2XXZA 1PGL2 3OTFA 3AL6A 2K9ZA 2P3YA 5JPNB 4JDOA 3THTA 1Y9BA 2O01H 3I3QA 1LOAA 4AF9A 3A0BE 3DPRA 1WLWA 5FY8A 4OI4A 1ULEA 4UB6E 2LM3A 4CDQB 1YEWA 4PD4D 1PGW2 4QU1A 3E1F1 4M3CB 1LENA 2ET1A 3L75E 4URTA 3H1MA 4RS5A 2W52A 2R073 5JIUA 1CZQA 1J1DB 5A7WA 1HV1A 4OLLA 1W5CE 3C7GA 2YFUA 1FX5A 2DVBA 1EDJA 3KZIH 2D5FA 2RVAA 4QDRA 1WCKA 3A23A 1UOBA 4JHTA 3USUA 1JYCA 1HXS3 4KU8A 2VOVA 1SQBJ 3GYDA 3H7JA 5FREA 4NJ4A 4DINB 4DT0A 4PI2A 4AL9A 4EN0A 3JD72 4E8DA 3JZVA 4GMP3 4BXSV 4BMBA 1WD4A 4AG4A 1QL1A 3ORJA 2V7QJ 3HN3A 4QB6A 5CB7A 3SH3A 1JOPA 1C57A 3AKSA 5CFCB 3GHGB 3IAPA 5C6CA 4B1MA 1L0LJ 1M1KQ 4RGAA 4Q4V1 2ZGOA 3LWCA 5DAXA 4XTPA 1LRHA 2YMYA 4AGVA 1ULGA 5CKNA 4QGNA 1EC5A 4JYCA 1QXRA 4BXLA 2CAVA 2IXCA 3RRDA 3N9LA 1AXKA 2B5HA 2YNYA 4PT6A 3RK2B 3E5QA 1XNTA 5AFBA 2X8KA 3TWIA 3TNUA 3B4SA 1RUG3 4XFHA 2KS1B 4JGYB 4YLZA 2BNOA 1RQVA 1MR5A 2A6ZA 4LBMA 1G9FA 2OYOA 3ILFA 2RHPA 1NTZE 4PV1B 4CXYA 4ZZ8A 5GALA 4Y22A 1H2MA 2P34A 1NU1J 2E7QA 3CL1A 4D6TJ 4WY4D 2LRPA 3RGUA 4FBFA 2GC3A 4ORFA 5KHIA 3CCRP 4D7YA 2JG8A 3IN6A 3CBNA 3WG2A 4F7ZA 2D44A 4DZGA 1QHDA 1UOGA 5F7UA 4N9IA 3VBOC 2Q5UA 5FY4A 4KG8A 3ZKYA 4UT5A 3CX5D 2KNCB 1YWKA 1CIYA 4DEVA 1Q86Q 3PJQA 2K88A 2RN0A 3NAPA 2RS31 5KXDA 3CLPA 1CAWA 1H8TA 2VOTA 2WLPA 3Q8BA 3LW5H 4UW4A 2E51A 1ZZ8A 5I8YA 3SEEA 5AW6B 5T52A 4GWMA 4D94A 3PHLA 5CCHA 4E2GA 3WF3A 3OGVA 2AXTH 4Y99C 5EIYB 3E97A 2JIJA 1W6NA 2WRAA 2PGDA 5DN2A 4GKXA 1JYVA 1HBWA 3H8OA 1GR3A 1RUJ1 4LUMA 1JY2P 1AV1A 2IBZE 1H8VA 4RR3A 3UNPA 2PQQA 3ZFGB 1DP0A 2GMEA 4IE7A 1KB9E 1P8JA 3OB8A 3FWLA 1HH0A 1STMA 1JBCA 5JI7A 1XQNA 1HRV2 3HUSC 3NRUA 3FJSA 1WMKA 1X36A 4QX8A 5A6QA 2FHRA 2BEZF 1O8PA 3Q2YA 1GK6A 2R5DA 1S0DA 1G7YA 1UO9A 3KWVA 1R64A 5F6LB 4YW1A 1WW6A 1SLQA 4KNCA 1MV8A 2NPSB 4GXLA 4IV1B 3DEMA 1OKQA 3DYMA 2RV9A 1ZBE3 3RG0A 2FY8A 1HB1A 4X6QB 2HWC1 1WCUA 1HX6A 4WWIA 3ASIA 3C8VA 1V9U1 2XJPA 1S2BA 2BOIA 4CEWA 3Q8FA 1LT9B 5HCAA 4R4LA 1K5MC 3ES4A 3RK2D 2OQ7A 1PFIA 4EZHA 2J1SA 3PNAA 2LTNA 1M06G 2JKXA 1PK6B 4Q8KA 3I3DA 2WC2A 3A0HE 4N3YB 2JB8A 2RMU2 1UKGA 1UOJA 3CQOA 5KLVD 2MEV3 2DCZA 3HWJA 4AI0A 3RPQA 3RMXA 2WA4A 2YKPA 1NE6A 2JKVA 1POV0 5DUXA 4PV1D 3VDDB 3GF3A 4E2SA 4RL7A 5FP3A 1UF2C 1R1A1 1MQTB 3IDEA 4GWNA 1PP9J 1D4M2 3OBRA 2DUPA 4E8CA 4YWAA 2QJKC 3HQRA 2N9BA 2DU1A 1W05A 4IV3C 1IG3A 2WO3A 1GFF2 4UF0B 1GMJA 1VR3A 2C26A 1JUNA 1RF1B 1OUSA 3C2UA 3PJSK 4ES9A 5SV8A 3PLNA 2DFBA 1QL2A 2D5HA 4OVEA 3AC0A 4N90A 4RJTA 3IDCB 4AEDC 2D6OX 1H4HA 1UOFA 1VIWB 2ZYAA 1LULA 2Y64A 2DCJA 2Z4FA 1ND2C 2IFWA 1W8FA 1RUNA 1RJ7A 2JX9A 3GJAA 4OH8B 1JCCA 2D2CB 4BK5A 3ACIA 3J8F1 2R061 2YBKA 4CDXC 2P10A 4AHYA 5LATA 2ZGNA 5FZLA 1XTCC 3CZUA 5KTBA 3U1XA 3UV9A 1N73A 4FPGA 1NWQA 3M1HA 3X29B 3P1IA 4AVTA 3AEEC 5FZFA 1OVRA 2H6BA 3MTUE 2WNVB 4XUOA 1YFYA 2PFXA 2JG9B 5ABJB 5KLIB 2MKVA 1UX6A 5C4WC 3IIAA 2WT1A 4GH4C 1RUH1 1A02J 1OVVA 1DGWX 3VBFA 1TQ5A 2DFCA 2NMNA 1BBT1 4IXLA 4AI9A 4P5YA 2M3BA 2E42A 5I0UA 1ZRTD 1GYKA 2YGLA 3CC2P 4A6OA 2VNVA 2E43A 5IATA 4XQ4A 3J26N 3NJVA 4NIIA 3DV8A 1HVVA 2K1AA 3T0DA 3H32B 1MS4A 3CWBD 1WT6A 4COWA 3BU7A 3BI3A 4NIAA 3WQ7A 3CEWA 2FD8A 4CP9A 1KYOE 1XYOA 1WBLA 1LU1A 2VMDA 3MUY1 3I2IA 4KHXA 3AE7C 1VAMA 4NAMA 5CBLA 4B7EA 4COYA 2QA4P 1M1JC 3VMAA 4FXGB 3C7FA 2W27A 4WM7B 4OI0A 4LK7A 1DGRA 4W80A 2WNUC 1NTMG 3RI9A 5C71A 1H1MA 2SBAA 3KVBA 2BUKA 3CCJP 2G9ZA 2E7TA 3L4FA 4GOEA 3I2JA 4LHKA 1RIRA 4OYUA 3U07A 2I74A 3TN92 1IK7A 2Q8OA 1Q3EA 3T3YA 1PIXA 1GZCA 1BXHA 1SFPA 2PLV3 3UT0A 3MIBA 5FP9A 3A2AA 3VP8A 2HWB2 1OOPA 1LP1B 2C6SA 1E57A 3L72G 5IK5A 1TMF3 4MUVA 3CJIB 1EXJA 5FZBA 4RKUJ 2ZJCA 4AXOA 4S2DA 2K3RA 2PN5A 2F6BA 3L35A 3M3CA 5CNAA 1Y9GA 3C7OA 1GL2B 1UIIA 4I2LC 5CG8A 1GMMA 4XF4A 1IC2A 4UFHA 1KDKA 4OWFA 1W28A 4GMP1 3M0DC 1NT0A 2ZZQA 5APXA 1W3VA 5FTTC 1AR63 3ZO0B 2X09A 3S0MA 3E1IA 3G9RA 3L74J 4EN9B 4DPNA 2Q3EA 1QX8A 1UKRA 4A4AA 1H4GA 2RH0A 2QQUA 2R6QA 2W39A 1ZZBA 2R043 1MS9A 5DDJ3 4WVMB 1Q8PA 1IG0A 2J22A 3MIHA 2VZVA 3TOJA 3ZXKA 2BEQD 3TF5A 1Y4WA 4XDOA 2ZOEB 3UGHA 1G9BA 3C7HA 3IWZA 3EYPA 1KS5A 1RUG1 4PJ0E 2HLOA 4BB3A 3LPGA 1BCXA 3ES1A 1ND3A 2XWJB 2VJXA 4TSVA 3I3EA 2HG5D 2OYHA 5APQA 2C4XA 3ABVC 3L36A 5L7OC 2CGNA 3PVNA 2BDRA 3O6QA 4DJGA 3U1AA 2NLRA 2FYUJ 1MZ5A 1D2SA 2E26A 5BNOC 3FL7A 1N3QA 1Y3TA 4I6MC 1OUXA 3WMM0 2P6HA 1T3JA 2D98A 3GW6A 1WZXA 3PJYA 3AE9C 1GQGA 1A8DA 3FXEA 1RB8G 2ZGMA 1RMU3 4RQPC 5IFPA 1BSHA 2LKMA 4ASLA 5TISH 4BRYA 5T5LA 3G3ZA 5K0UB 2YB7A 1W6OA 5T55A 2VRSA 2YC2A 5APAA 2JENA 5FY0A 3Q1MA 2CTVA 4NVPA 4BQ4A 3OPWA 2QBXA 2CNAA 4KH9A 2A75A 5AVSB 2XUEA 2F4PA 3VBRB 3AZZA 3QCWA 3VKNA 2RS32 1VMHA 2UWBA 1TME3 1KXGA 5H9SA 3MZHA 2O8QA 5FIXA 3GXUA 1XOYA 3ME2A 3CL3D 4QPIA 4J6GA 4DXSA 3KPEA 1S0JA 3UYJA 3CJXA 1EZVE 4BZ4A 1XRUA 1YCIA 2ZFCA 1R1ZA 5JUVA 3ZMOA 4JGZA 1VRBA 1RH5B 4AE2A 2HYKA 5FYCA 1QU0A 1G9DA 3OBTA 2HBTA 4Q4X2 2ZYDA 2XV5A 3Q9OA 3PU8A 1MPXA 1QVGO 5JCTA 5ANQA 1ZRCA 2WZR3 4BQ3A 4QHZA 2AEZA 1XB9A 1A78A 3PP5A 2G3AA 3W20A 2TBVA 3V0AA 3CHXA 1MS5A 1Q5OA 4PI0A 2ZABA 1UW8A 1ZBE1 1JY2N 1RHI3 2UWAA 5F3EA 2YV8A 1OC1A 4YVWC 4JDNA 4Q4Y2 2DCYA 3I3BA 3WINE 4ZS3A 4WM8A 1EDKA 4LE3A 5KKZB 1SLAA 5BU8B 2XG3A 3JQXA 1KORA 1GZ9A 2XNXA 4TYSA 2GZWA 3I59B 4YZ4A 4P08A 4P00B 1COV2 2HWF2 5LEJA 4Y20A 1SQPD 1VAKA 1V9U2 2P3KA 1SQXJ 3DYOA 1ZRDA 4DFSA 2ET7A 2MEV1 2QQPA 2E63A 4UW3A 2XVGA 3MIFA 2NQYA 1SLIA 3H1LJ 5EV7A 3T08A 3I54A 4A3XA 2WFF2 1HB2A 1CW5A 1F4AA 2QJYC 2W87A 3TGUE 3ZFEB 1PGSA 1S0BA 5JI9A 1PNFA 4ARYA 1W2OA 3M3IA 1JYNA 5H9QA 1DFQA 1JNMA 1K9MQ 1RUI3 2C24A 4CTEA 3ZIWA 2A3YA 3FLRA 4O9GA 3B93A 1JXNA 1JMBA 2A70A 2WSCH 2BJSA 3LOIA 5IVVA 4AZZA 5CMZA 4GJYA 4JX0A 4QPGC 4TWTA 1VBD3 4J1WA 5CJ4A 2C5DA 2XR4A 4XW3A 3OUHA 2FDKA 3AX4A 2JDHA 3KT4A 2RDQA 1BE3E 1UMHA 4CEYB 5KHKA 2YC0A 2N1TC 4P9WA 5E8AA 4CUGA 3H1YA 2Q6QA 3LEIA 4IGPA 5D21A 2XVLA 1NA1C 3PTZA 1DHKB 1RUD2 1NXD1 1OX3A 4H0LB 1VBC3 4OHWA 4OMCA 2R062 4A6SA 3LEMA 3FE5A 3M3OA 5FMOS 4TLFA 3N4XA 4O61A 4YM3A 4IEYA 3NNJA 1S5LE 5JOWA 1CR7A 5T54A 3T97B 2DUOA 1ZZCA 1ONAA 3B69A 4LKFA 2AC1A 4W50A 2R3CA 1E5IA 2XNDH 1BK1A 1GTWA 1GWMA 1ZBA2 2BU9A 3A0NA 1BCCE 5FZOA 4RSUA 5FAXA 1BBT2 2XJSA 1WLCA 4GKGA 1UYZA 2QQOA 1U5YA 4B4RA 3ACLA 4HONA 4NHLA 2A71A 3CKHA 3I2DA 4UBGA 1S2EA 4OMDA 3H50A 4HBNA 1AHSA 1L3JA 4FQ4A 2WSUA 3CF6E 2PXJA 2UYAA 4H13B 3O1VA 4RESB 1KFNA 3NVCA 4AUWA 2VOWA 1Q43A 2WZPP 5ISLA 4CRQA 1NUKA 4JVAA 4UFMA 3KM5A 1QJX3 1EPZA 1LB2A 2NZ9A 2QKDA 4FP3A 4BOWA 1OI6A 3W58A 1Z56A 3FC0A 1PMHX 3OJBA 3TRSB 3AEDC 2XHKA 2CL2A 2OW4A 2BTVC 2E74C 2MPFA 2BFUS 3MI8A 4CDUA 2VXRA 2W6BA 4NN0A 1ENSA 5JOXA 2JP3A 1ZA4A 4YVSC 1HQNA 4GMP0 2DVAA 3VBHA 3WNPA 3KDPB 2XKPA 4B1LA 3JBG3 1OLME 3N9NA 4QKNA 4FTBA 4UFJA 1VBA3 1IFPA 2EALA 4L76A 2WQ8A 1RVF2 5I0DA 5SV5A 3GMAA 5KBFA 4R9AA 4RYDA 3ACHA 5L9RA 4YPJA 4QHBA 5DJTB 2VUDA 4QM8A 4HMZA 4COUA 1BVP1 1WGPA 2Y26A 1EAH2 3VKMA 2DU0A 2IYOA 4MO3M 2W1QA 1OIPA 3HVDA 1PO13 3ZXJA 1JB0J 3K4ZA 3WXPA 1AR92 3AZYA 4IEVA 1NCRC 4PLMA 5FZDA 2F17A 2JE7A 3EFGA 1BVVA 2QQVA 4W6YA 4PDWA 4GULA 1NCQC 5C3PA 4FI9A 5JSPA 4G4FA 5BVZA 1T2KD 3G6EP 5DDJ1 3BCCD 3O7OA 2YGMA 4CP2A 2BP6A 2QCSB 4AEKA 3OUJA 5C7GA 1JZ6A 3B5NB 1QJEA 3NQHA 2QQLA 3B8EB 1VJ2A 4A42A 5DG2A 3OPZA 3M91A 1K5JA 1FZCC 1LECA 2QVAA 1FPN3 4XILA 3H3LA 1JTZX 2WS93 3THPA 4LBOA 1V6JA 3FHQA 3MIEA 2WN2A 2BVVA 1LNQA 3MW4A 3MFAA 3ZSMA 3WG4A 1N1YA 3KV4A 2BERA 2QZ2A 1EP0A 2V7QH 3FHAA 4L0PA 4KWJA 2BOJA 3ZYJB 3V2QA 5E79E 3H0OA 1SDDB 3ZFFA 1K05A 1LTBC 3ELNA 1DZQA 4BWOA 3G71P 4XXAA 3H1IG 3CD6P 2C9LY 1RMU1 2ZGQA 2D7FA 3M0AA 2XZRA 3HD8B 1KTMA 1V6LA 1LOEA 4YW2A 2HWE3 5KAIE 4K40A 4RS5B 4Z2WA 1KQSO 3CWBG 3SITA 4NPFX 3T1LA 2EAKA 3I2OA 4HVQA 1WUVA 3SH5A 5A7WB 1DQ5A 2D3SA 3AE4C 4ATFA 3P3NA 1I1EA 4ATEA 1RTVA 4ZY9A 5I8TA 3JXSA 4LJHA 1LTSC 1EDIA 4R8HA 2VC9A 4PLNA 3USUB 1TME1 3D71A 2VZRA 5FZEA 4P14A 1QQP3 4NMIA 1H30A 5H9PA 2VTFA 4IGOA 4K1ZA 1G2CA 1K73Q 2WR9A 1GP6A 1SLTA 3HMYA 5AW3B 2YG0A 4EDFA 1GKBA 2A06E 4FPHA 4C8DA 1AZDA 2PAKA 4CCEA 2E32A 3VZJA 3CXHE 2ZXXA 1PIV3 3DKQA 4QB2A 4XBNA 5A7QA 4BYYA 1JZ8A 4EIJA 2UURA 4S2HA 2VZ3A 4WY4A 2A6VA 4S2GA 3BVCA 4N8MA 2AXCA 2BGOA 5C9AA 2VAUA 3MGNA 4AI8A 2VZQA 4QHOA 2ZEWA 1S55A 1RHI1 4K7JA 3ON7A 3VBSC 1HTLC 5F5CA 4PIYA 3H1HG 4I02A 3W5MA 1NTKD 1VAVA 3TNUB 4DRVA 1QXPA 4M3CA 1GBGA 2WQYC 1DCSA 1UNBA 4FPYA 2YMZA 2G8YA 3OUIA 1YO8A 4NIDA 1JU4A 1WKYA 1XNDA 5LBCA 5FZIA 3HD7C 1BMV2 3LFMA 2Y6GA 3U14A 2VQUA 3V4WA 4IFMA 2P67A 2ZEXA 2JG8B 3RK3C 1O3RA 3WDVA 3U1CA 5DAQA 2KYVA 4PBPA 1ZVFA 4WVVA 5FPBA 3NXSA 3L2YA 2GH8A 1KILE 4M4PA 4I0BA 1RJ8A 3KV6A 5AW2B 2PA7A 1RY3A 3NAPB 1RUI1 5AW0B 4ASVA 2WZEA 1CAWB 1H8TB 1W2TA 1SBEA 4CUCA 3TBDA 2AEMA 3F5HA 2VQTA 1ULDA 5BU5A 1SFCC 5BPXA 4XETA 5FCCA 4DZOA 2VQ0A 5AVWB 4MGIE 3LFIA 2BZDA 4RGGA 2Z4EA 4YNIA 2R5BA 2R32A 2PAMA 3MYXA 1VPCA 1J3QA 1L0LK 2PP6A 1AL22 1FYUA 1VBD1 2KK7A 4XJ8A 2NMOA 2PFWA 1VMJA 3UGFA 1UU6A 5TJHA 4JQRA 1SQBD 2Q3IA 1QJU2 1VL2A 4LO6B 1RYYA 4RR3B 2KLVA 4N7IA 1OVUA 1OMIA 1RHZB 1CIWA 4LULA 1RE3A 1X82A 3OY8B 4BIOA 3HT1A 2LW8A 1MS3A 1VBC1 3VBOB 1KZUB 2WBKA 5FMBA 4JGYA 1GICA 4I09A 2OYIC 1LOFA 4RFT0 2M0BA 1L0LD 2K46A 2Y0EA 1KJRA 1HGVA 5BNQA 3IPVA 2IZ1A 2KXPB 5DMYA 4M3CF 5CJ0A 3JQWA 3VBUA 4AEMA 1SQQD 1VQLP 2QNKA 5I91A 5EYXA 4XF0A 4P9GA 2WTYA 2JIGA 1DIPA 4RD7A 3J9SA 4Y99B 2YROA 2KNCA 2WIIB 2ZZJA 2JE9A 4RHV2 4O65A 2W2IA 1TU3F 2BNMA 3U59A 1ZM1A 3P8CD 5GLVA 1AXYA 5JXJA 3CCUP 2I1JA 2Y0DA 1ZR2A 1LAJA 1QEXA 1NAEA 3BVHA 2IC1A 1RITA 1J3PA 4C90A 2ZTNA 3HUSB 4M01A 3NO8A 3JD73 5KJ7C 4MVTA 2A73B 1NU1D 3ST7A 4I3PA 4D6TD 3IZOA 1FZBA 3RFRA 1XNBA 3PIJA 4CDWC 3WEZA 3Q8CA 4BCUA 2YKOA 1HRI2 2J1VA 3CCSP 1OURA 3HQUA 3OW2O 2VVDA 1QJX1 1VB2A 4HANA 2A7AA 3HIFA 4LIUA 5J48A 1KQRA 3U37A 4Y4YA 2H7HA 1N47A 3ZFGA 1EDLA 3VV1A 2BGCA 3R2PA 5LA2A 1P84I 4LGDE 2B9BA 2IFMA 3AP9A 3MUDA 5HBAA 1VDFA 3ZXEA 2P1JA 3OA7A 4R4XA 3IMNA 2CDPA 2VMHA 3JBG1 1MKMA 2CK3H 2WITA 1H9WA 1GZTA 1VBA1 1PGOA 3BKZA 3K48A 2JDKA 2G9FA 2NPSA 2W08A 4IV1A 1I3HA 3WNMA 1UXZA 1GW3A 2E31A 4MGKE 4FVVA 2VBPA 5I8SA 4QWNA 3LA2A 2VBDA 3LSEA 1NKZB 3AKTA 4XMIA 2YBSA 2VUCA 5FLJA 1PO11 4CZSA 1LT9A 4Z07A 3WW4A 1RF0A 2OIIA 1AJKA 1SLLA 4XAAA 4AHXA 2FDHA 5FYHA 5KXEA 4XFIA 3MIDA 4BQXA 4Q0SA 3NFQA 4P5HA 2J42A 4XDPA 1US3A 3VDDA 1RE4A 3VBFB 4AEDB 2V5YA 2W6AA 2VZSA 2P3JA 1KD1Q 2IXKA 4C1WA 5AVVB 4IL7A 5FYVA 4UF0A 2LXBA 1FPN1 1FBMA 3H1JE 3M4FA 1RF1A 4CP1A 4K21A 2FXMA 5FZ1A 4QKFA 4CDXB 4LT5A 1HDKA 1CX4A 3ENRA 3KT1A 1OH4A 4K1YA 5A3UA 3M3QA 5E88A 2WSEH 3POFA 2OT7A 4LKDA 1AVBA 2J1UA 4FPKA 2KB7P 4C7RA 3SMHA 4XJWA 4FOQA 2VGDA 1HRV3 4AQ6A 3GZEA 2RJKA 1PP9D 1L4AC 3HNYM 3NNFA 3H1IE 2CGPA 2DCKA 1JO5A 1XE8A 2MJZA 2HWE1 1L0LE 1YXWA 2DYCA 4XABA 2WA3A 1GUIA 1Y9MA 2ZAEB 5C33A 1JY3O 3LIHA 3ITKA 1NYHA 5L73A 3N35A 5F9TA 2C0ZA 1OA3A 1OOPB 3TNPB 2R0HA 3WU2H 1EUUA 1WA6X 1FOD2 4Y5TA 2ARAA 1QQP1 4DO0A 5CEHA 5FXVA 2ZX0A 2V09A 3VDAA 2FCUA 1N3PA 3H1KG 4ISQA 1OWAA 3VL8A 3POJA 3GDBA 3THCA 1UIKA 5FUPA 4YW6A 1M8OB 4YGEA 5FOBB 2RMU3 4OHYA 3K2OA 1M1JB 2JDPA 1PIV1 3ZDVA 3UIAA 3Q5RA 2D93A 4D6TE 2HODB 1VALA 1X8EA 3H32A 1L0NG 3RL0C 3N9MA 1D4M3 1GWLA 5BYNA 1H88A 4PF1A 2OGUA 4OQ8A 2G19A 2WVRA 2WT2A 1YI9A 4H44C 3T09A 4KJMA 4OUEA 4W4ZA 3OBAA 1C8M2 5DUWA 2J1AA 3ZN6B 5BNPC 4MSVA 3OGGA 1DBNA 1GU4A 3P6BA 3MW2A 4NWWA 1S1AA 2NP0A 4NROA 2KM2A 1OFNA 5K8SA 1JYIA 3H1HE 3TK1A 1ZRRA 3EQ2A 2OYHB 1FJPA 2ADDA 1ST8A 1BCCJ 3H6PA 4XF3A 1W6QB 4BHPA 1LP1A 4V2WA 4JQTA 1SQVG 1ULOA 3G6JB 3WF4A 3CJIA 2JDNA 4LBQD 4AVAA 4GOFA 4RA0A 3I2FA 1GLHA 4BPZA 3NV2A 1R082 3EB7A 3MFCA 5BUVA 3FX3A 1LGNA 3S7IA 3CO2A 4K35A 1W6OB 4FTEA 2XWBB 1S0IA 4N78E 1KN7A 3N7MA 3CCLP 5B4NA 4ONUA 4IE6A 4P9JA 1XXNA 2DWRA 2J58A 4ZMDA 3NNLA 2EA7A 1NTMJ 3MO4A 2ZHNA 4IEOA 1B35C 1K42A 4L92A 1JOJA 1OLMA 5T3NA 4WVMA 5IW0A 5FJHA 4WZCA 1W8TA 1TEIA 2L5GB 1ZW0A 5CBOA 4MLOA 4JGZB 1KQFB 1PGL1 4UI9L 1XYPA 2FXOA 4YGDA 2VNOA 1F31A 2JWPA 1G8WA 2XUMA 4TZDA 3BOWA 4DXTA 1U7JA 4Z92B 2AH2A 3L74D 2VNGA 3AECC 1DGLA 2O1JA 3A0BH 2E53A 3V0AB 4XURA 1PGW1 4UB6H 4LBJA 2Q0AA 3UJOA 4HPKB 3U78A 4LHNA 1O3QA 2FYUK 2WINB 1LHUA 2B42B 5D8AC 2PHFA 2FFDA 1PZ8A 2XDVA 3CPWO 5E89A 4Q1PA 4WM8B 3TN93 2GC1A 4XUTA 1WMXA 5T5JA 4QX2A 1L2PA 2HWB3 2B8MA 1U7MA 2XBO2 4LMFA 3MGUA 2IZ0A 5K0UA 1IFIA 3F2ZA 4I7ZC 3NNGA 3CCQP 3P32A 3ZSEA 1PPJG 3UKNA 1DGWA 3VDBA 1NKGA 2OXBA 2FYUD 3JD71 3WCRA 3HE5A 3RSJA 3KGZA 3MEPA 2Y60A 3NSTA 4LBLA 5G04L 2A6YA 2YC4A 5FO9B 5FKCA 4CCCA 4YW4A 1REEA 2QJPC 3E6BA 2H89C 1NTKG 1HW5A 4GZ9A 4A44A 5KAFE 5A1FA 4CU9A 1OF4A 4YVWB 1J3RA 1JZ7A 4JAAA 4XEZA 1JYWA 5F5IA 5FYBA 3POWA 3RZLA 3LCPA 3ZIXA 1UY3A 2KD7A 3BODA 1HXS2 3GBGA 2Y6JA 1DYOA 4Z1MH 2I2SA 3NL1A 1KC8Q 1S4CA 2QM8A 3I2KA 5CKMA 2DVGA 1W2UA 4PIZA 2XDJA 4FPFA 5CHXA 1SEFA 5JDBA 4CCNA 4Q8LA 4LBKA 4PQ9A 2JB4A 3P3PA 5IAXA 1LTEA 4FFGA 3SXWA 4MADA 5DZEA 4HN0A 2V5DA 2XLFA 5DAVA 1ULFA 5DJUB 1VLNA 1JCDA 4QQOA 4EN6B 3W9AA 2IPPA 1UX7A 2GM4A 5IVBA 3USSA 3FGAD 3I59A 4X8NA 4FPCA 4F83A 1HQLA 1Q56A 3URFA 1JM0A 1G1JA 1DLLA 3EWKA 1GU3A 1SQXK 1NGMB 1S4XA 1SQBG 1F2NA 3OJAB 2R1BA 1FZAA 4CU6A 3V4QA 3TYYA 1KILC 1X8YA 1X9TA 4GIQA 5GZDA 4EQVA 4NO4A 3AE2C 3P8MC 2C1FA 1X7NA 1SLCA 3V2PA 1HN1A 3KV9A 2RS33 4JHZA 1LTJA 1YI7A 1URQC 3SWYA 2N1TB 5JSRA 5FMOL 3KV5A 2DUQA 3N9PA 5EPAA 3A22A 2RS12 3M06A 1SQXD 1K3IA 1SQQG 4O9EA 4FOWA 2WT7B 4PHZA 3NNMA 3POGA 1KB9H 3H1LD 2YO3A 2RJ2A 4Q4X3 1HRV1 1VQOP 4N7UA 4QM9A 1DQ6A 2EXHA 4CEYA 1FOSE 4CDQC 2W94A 2E7AA 4OGQD 4DB5A 4YARA 4G9SB 2VBBA 1BSNA 4LLHA 2KSJA 1FNZA 1ODMA 3KHBA 3VBHB 3ZM8A 5BNNA 4Q4Y3 5CFDC 1QGKB 4XZUG 3S7EA 1XNAA 4MGQA 1NYWA 1NU1G 5T50A 3AE1C 4KT0J 1O5LA 2YUEA 3T97A 2WNEA 3GM8A 1OW6A 3VKFC 4KBBA 3AFKA 3O0WA 1FV2A 4N53C 5CIRA 5IVFA 2C9KA 1NO4A 1AR71 1COV3 2QDRA 3KGLA 2HWF3 3H1KE 1FZGA 1ODNA 2ZAAA 4DUXA 1V9U3 3ZSJA 1ENXA 3MLJA 2RMU1 1DZRA 2WL1A 5FY1A 3A0HH 1FMD2 4Q2FA 3N36A 5IVEA 2FYUE 1LOGA 2FDGA 2BFUL 1Q8OA 3OSDA 5GKAC 1ENRA 3LPFA 4P9XA 5LZ6A 4MX3A 5CFCC 4LR4A 3GHGC 4LHSA 3ZXFA 1D4M1 2WFF3 3W59A 1HGZA 2VY0A 4K20A 3E1RA 4QGLA 3D3AA 4KI5M 3WLUA 4PD4I 2CPSA 3ZPYA 2AR6A 3S5QA 5AVZB 1KMIZ 2Q7CA 5A3WA 4AQTA 4YVSB 2D6LX 1GU5A 1CQ9A 3FFZA 1XBFA 1A8MA 4JCKA 2VZOA 1X9PA 4IOIH 2XOMA 1YJ9P 5KXBA 4KWUA 1VF5C 3HTKB 2Y9YA 1VQ4P 4CCMA 2IDBA 4P9IA 1VQ5P 3T4VA 1GOGA 1VPHA 1PGQA 2N1TD 4EYUA 2OS2A 2QIWA 4CVUA 4XFGA 4I0WB 3VHRA 1GK4A 3ZXDA 3UETA 3E5XA 3GBWA 1RUC2 3ZFFB 1RUD3 4XHXA 4KWKA 5FXXA 3HBKA 1SCSA 3OYWA 1NHLA 3RMYA 4DY5A 2R063 4PLOA 4Z1VA 2I1KA 1AYM2 3L71G 1X79B 1QOTA 2M5AA 2KUBA 4HJGH 5FUNA 2XKOA 4L74A 1QVFO 3F95A 2K37A 3T2PA 4Q26A 5C8CA 5A32A 1QOSA 1QWRA 1Q8SA 2EAAA 1FZCB 4IEWA 2ZGPA 3RI8A 3D6ZA 5IT6A 1YBKA 4AGGA 3RVHA 3GZTB 1X22A 1YHQP 3JC22 1ZBA3 3AE5C 4V1PA 2QQIA 2QQNA 4BLIA 5JZGA 3MLKA 3GNEA 1T3UA 2OKXA 2QQKA 1BBT3 2MHFA 4Y1YA 1GOHA 1GNHA 2XB6C 4XA4A 4ES8A 1SQXE 4Z82A 1MZFA 4EE2A 5B5EE 1KYOH 1NY72 3ZSLA 2IBZD 2I07B 5LBEA 1RUF2 4D7TA 1KB9D 3FLPA 3CX5I 1ZA7A 5JAXA 5LK5A 5C8WA 1QMJA 2RR11 3WDYA 5C9AB 2JO1A 5L9VA 2VZUA 2UWCA 3H3UA 5IVCA 1IZNB 2FDFA 2ZX2A 2E74D 3JCUE 3TN91 1PHMA 2YHJA 3SLIA 1A6CA 2JJLA 2R16A 1NOHA 1IPSA 4UW6A 4YG0A 4BQ1A 1FJKA 2HWB1 4UBHA 3LEKA 4XIOA 4TLGA 1MVQA 2W83C 1ASJ2 4NPLA 2NN8A 1LHVA 1RVF3 1OF3A 3PURA 3APBA 1PK6C 3H1JJ 1BZWA 2P2KA 3TDKA 5ANNA 5IHRA 3B00A 4A7YA 1AJOA 1EAH3 3H8UA 3VHOA 4F8AA 3G7DA 3VDDC 5AVRB 2VQAA 1SBDA 3SC7X 4QAWA 1MQTC 4NRPA 4Y24A 1SACA 4XCAA 2QM7A 4B29A 3VBSB 2PLV2 3AP4A 4OFGA 3OAKA 3DGTA 2C9NY 2ZHKA 4FAHA 3H1IJ 1I9RA 4HLTA 4L8QA 2X10A 2W1SA 1TMF2 3AKPA 2J1RA 1O59A 4ZKTB 3E6CC 3AP7A 1J1EC 3O12A 5FLHA 4I1LA 3WDUA 4J25A 3KF3A 1USDA 1YTZI 3VD4A 3LB9A 4W8JA 1CI6B 3VDCA 3NV3A 1GD2E 3L70G 3T1MA 5FK7A 5EJ3A 4XBLA 1TZOA 3D6YA 2ES3A 4I01A 4PJ0H 3AYAA 4G3YC 4XMAA 2D2CC 3MHZA 1AR62 3K46A 2X5IC 3ZDSA 4UXAA 5DZFA 1POQA 5DXDA 4HB1A 1A3KA 1NKNA 1VRH2 1XC6A 3MIGA 1WLTA 4YYOA 3HE4A 1NZCA 2WYSA 3L73E 4ZXKA 2R042 4LLFA 4JPZB 3ZYIB 4FXKB 5T5PA 2WNVC 4QKBA 2YIUB 2JG9C 3IPVB 3D0SA 2I45A 5ABJC 5KLIC 3VBUB 5AVAA 4YGCA 4BQWA 1SFCB 2CHHA 4UAPA 3PVEA 3DL3A 1SLBA 2DDUA 3NJYA 1GWKA 2JWDA 3VTPC 2BCCG 1BGYG 2Y38A 2BNNA 4U3FG 4W7YA 4FSJA 2B88A 5F37A 3DN7A 4GDOA 2POHA 5HCHA 3VZOA 3L74G 5A33A 4FPJA 3H1HJ 2E9QA 4HXCA 1JZ3A 3J4UH 1YJKA 1W0OA 4W6XA 5L8RJ 4BE3A 3AKQA 2J59M 3ZR6A 3WT3A 2JWAA 4ARXA 2OYIB 2O8OA 3D8CA 4Q4X1 5FFOC 5CISA 1JTHA 1FDIA 4YXDC 4QX5A 1U5ZA 1JOBA 4Y28J 2DCTA 1KYOD 3PTRB 1S5LX 3I97A 1XSRA 5K9YA 4WM7C 2GN3A 3NV4A 5G05L 3KF5A 4BJ0A 3A21A 2IUWA 5ERLA 2WPSA 3OY8A 3GLMA 4TTGA 1Q81Q 2GUVA 3ATGA 3VBOA 4NHKA 4JRAA 3QWOC 4NIGA 3KB5A 1UIJA 4Q4Y1 2JDIH 1DYKA 2P17A 2ZACA 3BTAA 1KFXL 3M70A 4AFDA 3AMQA 3S6PA 1LCLA 5K5GB 2ZGLA 2QQJA 4LO7A 4YGBA 3SNMA 4URAA 1COV1 4AVBA 2HWF1 3GHNA 3FFQA 1GL2C 2UYBA 3WW3A 1IGOA 2WPRA 1LGCA 1YQCA 1UY1A 4XPVA 4ASWA 1RC6A 3RBXA 3HD7D 2HR3A 5HCFA 2QDNA 1NX9A 3V5BA 2A45H 3IAOA 4YZ3A 4GA9A 1XE0A 1NAFA 2WQZC 3EMRA 3RK3D 4NHMA 2WFF1 1AR72 2Z5WA 3IKWA 4AQRD 3WZ1A 2GNDA 5A6ZA 3KHUA 4IW3A 4AGRA 3CMAP 3M9BA 2N9YB 1W0PA 1OHFA 3MD0A 3HUSA 5JSOA 1N3OA 2HWD2 2D6MA 3TNQA 1WW4A 3MW3A 3VLBB 1KJLA 1SFCD 3VD5A 5A7SA 2V73A 4QMAA 4XE9A 5FYUA 2QVSB 2VO5A 5FY5A 3OEBA 3QD6A 4PBOA 1AUYA 1AL23 5T5OA 2AACA 4XFJA 4YW5A 4M4RA 5FBJA 3WNNA 2BEOA 1JYXA 5BY5A 2QJVA 4C7NB 5CG9A 1BDDA 1XU2A 4ZU7A 1K5MA 1QJU3 5LK7B 3C1LA 2AEFA 2OPWA 3LDBA 3NKTA 1HJBA 2ITAA 2TUNA 2IVJA 4XTMA 2UY9A 1LJ7A 1FI2A 1RUD1 5J1XA 2DW3A 1S1CX 1B09A 4ASMB 4ET7A 4KGGA 4H7LA 4BXFA 2HEYF 2RG4A 4H14A 1Q82Q 3O1PA 4FQZA 1PVXA 1S5LH 1YQ2A 5IFTA 3MZWB 2OYZA 3NJXA 4IV3A 3V6IA 3IT8A 1JEKA 1ZR4A 3WQ0A 4U36A 5LY2A 3IDBB 4ZS2A 2GA1A 1HB4A 3RBZA 2HKXA 2ILMA 2E6VA 1UZ0A 1MACA 2XONA 3VBRC 3MHVA 2PYTA 1ZBA1 3B5LB 4HKZH 3BIEA 2IXHA 4RHV3 3NMDA 4AEDA 1IOAA 2SPZA 4XXPA 1OVPA 3G4SP 1H6YA 4QQ2A 5LY1A 5IVYA 4A7ZA 2HLEA 4YXWH 4QXBA 1ND2A 5KJ7D 1G6NA 3LD8A 2VVEA 2W68A 2XPJA 2XL7A 1EZVD 4CDXA 1HRI3 2VW0A 3L75G 3TEWA 1KRIA 3R6SA 1UN1A 2OZ6A 3RDIA 1RXGA 2ZT9C 2VMGA 4LA2A 4LBQA 2Y0CA 1P84E 3ZSKA 4ZZ5A 2AEYA 1CJPA 1OW8A 4IEUA 1YJLA 1OBNA 3IIIA 4E9KA 2VMFA 4HH2A 3FLTA 1S2KA 1UIXA 3VGIA 2RR12 1CSBA 1CAXB 1BDCA 4IFFA 4GH4A 3WG3A 3CCEP 3LA3A 2YU2A 3M8LA 1RVF1 5ACA2 4OULA 2V4AA 2IVIB 5AW7B 2A3WA 3PHMA 2UWJE 5APTA 1EAH1 1RQUA 4XE5B 2OA2A 3RL0B 4IESA 5A7NA 2P2UA 4KQ7A 1AR91 1LHWA 5CU1A 5EHDA 2BV4A 4GB32 4XBQA 3RK3E 4H44B 3WV6A 4LO4B 4OHXA 3ZFEC 3N9QA 1ZNPA 1N1TA 5EXOA 1A02F 5LEKA 1M1JA 2WKKA 2XJUA 1CPMA 1GNZA 1FT9A 5GLUA 1VP6A 1IFNA 3TGUD 1G1IA 3U75A 4LKEA 2HODA 2VH9A 5CADA 5F2WA 4NHXA 2WNUA 3ILNA 1ZX5A 3HNBM 1DX7A 3AZVA 3WUDA 5LA0A 2Q30A 3H42B 1NTZG 4B8EA 2OVUA 1Z78A 5APWA 1EV12 5AW8B 4UFIA 3ZN6A 2W1WA 4NOTA 4GJZA 5AVUB 3KD4A 3DXUA 3QACA 1R8EA 3VP9A 1VQMP 5FP4A 2W46A 4QT6A 3FN9A 2J5UA 4H0LC 1YFUA 3D0JA 3H1KJ 1BE3D 5E79H 3BOPA 5GTHE 2RE9A 4XUNA 1AX1A 5FOJB 3M0DA 1DU3D 1L4AD 5F2SA 3LIGA 2HYNA 2XQRA 4WV8A 4KL1A 2YZ4A 4GWJA 1W6QA 3WF1A 4OCTA 4Y1VA 1Y8AA 3RJ2X 1WRGA 5CVRA 4HKWA 3BTXA 1L0NJ 2FFDB 5KAIH 4O7XA 1W2AX 5CCGC 4E2QA 5I93A 3HBZA 3QBQA 4TN7A 4U3FE 1CN1A 1OPMA 1CWPA 2B87B 3MPBA 3UKVA 3VMYA 5DPNA 5DABA 2HFED 2IBZG 2ZHMA 1FOD3 3K51A 2ZX4A 4WBBA 2KI7B 3TSIA 1W8WA 2ZGUA 3K77A 1AVOA 2G1MA 2QTWB 2IFRA 3U0ZA 2LUWA 4KG0A 5I0TA 4LPLA 5DQ0A 3FBMA 1BCCD 1E5RA 3HE5B 1NQJA 3LDRA 2OQQA 3O5SA 3VN4A 1NTMK 4H13C 2XL9A 2WZ7A 4BK4A 5L7OA 4MYEA 3ZDMA 3CXHH 4ZNCA 4N6JA 5B2GB 5IVJA 3RL0D 3MPPG 5BNOA 1SQVJ 4FOVA 1REDA 3N7LA 3K5BA 4CCJA 4H44D 3GZAA 2JECA 3FHIB 2WSFJ 4OUSA 1C8M3 4RQPA 4COZA 5JMOA 3GF6A 1MZ6A 4OGQC 2B9VA 1NTMD 3AK0A 1YRZA 4EROA 4EJRA 4Y3OA 2BYVE 4L11A 2YYOA 3ZYGA 4HPKA 5BXXA 1S72P 1H89A 2VZTA 1OKOA 1UQXA 2EIEA 4R4MA 1V6IA 2WLQA 4HVRA 5JMCA 4WBAA 1BMV1 2GNMA 4XJAA 3AMPA 3KQ4B 5DG1A 2QJPB 3ZXGA 4UB8E 5FZ0A 4QXKA 4R4ZA 1UZZA 3O1MA 5AC91 1N7SC 1LWUC 3B9CA 3B94A 2VPVA 4HVOA 3WHUA 3POYA 2E5YA 3R4YA 1R083 1SBFA 1M4WA 5FQ0B 3UESA 4YG6A 4BWNA 1MFZA 5DZGA 1AF9A 1UMIA 3V56A 3SKVA 5K4LA 1AYN2 5EFUA 1N86A 2ATFA 4QGMA 4OQ9A 1K04A 3B5NC 2JICA 4N43C 4EV0A 1JN2P 3AJYA 1Q8VA 3GGLA 3IM0A 2OTLP 3I7DA 1U5XA 3C8XA 4I0AA 1AL21 1LTJB 2HJIA 2QUOA 4AEJA 1Q90D 2VTXA 4YVWA 2DTWA 2CWMA 2GMMA 3RZHA 1LODA 1AQ5A 3EXUA 4CP0A 2JEEA 1QJU1 1LR5A 3RWKX 1BKZA 3AYDA 3GBFA 2YPDA 3HN1A 1QJY2 1K45A 1NAYA
chains in the Genus database with same CATH topology
4P9JA 1XXNA 2DWRA 5AVPA 2ZGNA 3N7JA 2UY8A 1W6NB 3UV9A 4L2NA 1TNFA 3DPRC 2EA7A 2VNRA 3C3VA 4YZ2A 4FPGA 1XNCA 4Y1ZA 2ZHNA 1H9PA 3M1HA 4IQPA 4IEOA 3X29B 4HSJA 4AVTA 1B35C 4L92A 2BPA2 1G9CA 1JOJA 5T3NA 2VMIA 4WVMA 2H6BA 2ZPXA 2ZMKA 2WNVB 4WZCA 1YFYA 2H6CA 4XZPA 1TEIA 4RS5C 2ZA9A 2JG9B 1AQTA 3POSA 4MLOA 5ABJB 3LOBA 2VUAA 4JGZB 4WVWA 4YSFA 1UX6A 3RYKA 1VBE2 5C4WC 1PGL1 4DRRA 3IIAA 5CAZA 2WJSA 2WT1A 4LO5B 4GH4C 5BNNB 1RUH1 2QZ3A 3FMGA 2DVFA 1DGWX 1UAIA 1XYPA 4YGDA 3VBFA 4HZFA 4JTOA 1TQ5A 2VNOA 1F31A 4AQ2A 4Q1RA 4H55A 4C91A 2DFCA 2AREA 2NMNA 1BBT1 4IXLA 1G8WA 2XUMA 4TZDA 3RS6A 5F6KA 3BOWA 3ZFGC 4YFZA 5I0UA 2AH2A 4Z92B 1GYKA 2VNGA 2XBO3 5K7PA 2YGLA 3M7AA 4RHV1 4AHZA 1JW6A 2A5ZA 1DGLA 4XDQA 1TE1B 4XQ4A 3J26N 3TAYA 2E53A 3V0AB 1IS4A 4AI3A 5A3MA 3DV8A 4LHLA 1PGW1 4LBJA 1QH7A 1MS4A 2Q0AA 1PMIA 5A3LA 3UJOA 4HPKB 2BVBA 4LHNA 4QU2A 4CEWB 4QPGA 1O3QA 5FO7B 4Q0PA 2XJTA 2JDZA 2WINB 1U5IA 1CGPA 4COWA 1LHUA 5TSWA 5EYYA 2B42B 3BU7A 3V64A 5D8AC 3WQ7A 2PHFA 3CEWA 3LZZA 1PZ8A 5E89A 4Q1PA 1XYOA 4WM8B 1WBLA 2ZX1A 1LU1A 3TN93 2GC1A 1UCXA 1EPWA 1QOOA 2IXIA 5T5JA 1HRI1 1CVNA 1HIXA 4IV1C 2H0VA 2HWB3 2B8MA 1NA1A 4X6RB 2QFEA 1VAMA 5CBLA 2XBO2 4B7EA 3MGUA 4COYA 5ACA1 3BALA 5K0UA 4FXGB 3H1WA 1EYBA 4WM7B 4Q0VA 4OI0A 2PHWA 1H2KA 2IZWA 3ZSEA 1DGRA 1MEC3 5J3UA 2WNUC 3E5UA 3UKNA 5CFDB 3RI9A 1H1MA 2SBAA 2BUKA 2E7TA 3JB4C 5I0RA 1DGWA 1APNA 4LHKA 3JD71 1UPSA 1RIRA 3B02A 2WFPA 3WCRA 3RSJA 3U07A 2I74A 3TN92 4UW5A 2GSYA 3KGZA 3SCFA 2Q8OA 1QDCA 4J1XA 2E5TA 1Q3EA 3MEPA 3NSTA 5L36A 3VKLA 4LBLA 1OLRA 2A6YA 1GZCA 1BXHA 4GB31 3LKJA 4GALA 2PLV3 5FO9B 4YW4A 1DQ1A 3MIBA 4N53B 1REEA 2HWB2 1OOPA 3E6BA 1CONA 1HW5A 1E57A 5IK5A 4YRDA 3IN9A