4WVZA

Crystal structure of artificial crosslinked thiol dioxygenase g95c variant from pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
195
structure length
195
Chain Sequence
ILRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPGQITPVHDHRVWCLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate and pH-Dependent Kinetic Profile of 3-Mercaptopropionate Dioxygenase from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa bwhpsa021
molecule tags Oxidoreductase
molecule keywords Thiol dioxygenase
total genus 48
structure length 195
sequence length 195
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4wvzA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4wvzA02
3I59B 1I6XA 4ZU5A 1BSHA 3WW1A 2WC2A 2PHDA 3PNAA 4MX3A 4XEZA 5C8WA 5E1RA 5KHJA 1O3RA 1VR3A 4N9IA 4AVAA 1RUOA 2QNKA 2WFPA 4YARA 3H7YA 1EY2A 4QM8A 4XFAA 3ZDSA 3M70A 3RPQA 5E16A 4FBFA 4J1WA 2IXHA 4CYDA 4AXOA 3M3IA 3USSA 3G7DA 2QDRA 3LAGA 2Z69A 2OA2A 3IIAA 4LA2A 3E97A 4D7TA 1Q3EA 2K9ZA 3ES1A 1H1IA 4FAGA 4QMAA 2GH2A 3GYDA 4IEYA 1O3TA 4QX5A 3MYXA 1O4TA 4I01A 3HT2A 4HVRA 4XFHA 2PAEA 2CK3H 1YFUA 3LWCA 1SEFA 1JEKA 4META 4DJGA 5LRSA 1ZRCA 1YLLA 3NVCA 1WGPA 1SQ4A 4IEVA 4N9HA 3WW4A 4XF1A 5FPZA 4Q0UA 4XFFA 5BXXA 1ZREA 3HQXA 1YWKA 1L3JA 3QACA 4IEPA 4HN1A 5I91A 2O8QA 3KGZA 1EYBA 3ROUA 1XE7A 1NZCA 5JSOA 2F4PA 3D0JA 1OI6A 3CF6E 3H50A 4LTAA 3RYRA 3KCCA 2B5HA 4YXWH 2ATFA 2BEOA 1X8MA 1Y3TA 2IXKA 2PYTA 3DL3A 5JAXA 1FT9A 1HW5A 1ZRRA 1ZNPA 3OCPA 4HBNA 4BH9A 4ZU4A 4YRDA 1CAXB 3UKTA 4LUKA 4KL1A 1NE4A 1ZZCA 2D5FA 4L2NA 2XL9A 4MZUA 5FLHA 3OGJA 3PVBB 5I8YA 1NE6A 2Z2SB 3HT1A 3H1YA 5J48A 5T3NA 5KHGA 2W6JH 2H6CA 4JTOA 1Q5OA 4E2GA 2V7QH 1I5ZA 3CL1A 2K0GA 1WA4A 4XF3A 3FX3A 5J3UA 2QE7H 3BCWA 2DCTA 4I2OA 1ZVFA 3IDCB 4EROA 2PTMA 3FFQA 1FS0E 4Q0QA 5FPXA 5BUVA 3RYKA 3UKNA 2OZJA 5LRRA 4IEQA 4I3PA 2GC2A 3OTFA 4GULA 2KXLA 3BB6A 2E5YA 2GZWA 5EZWA 1ZZ9A 4QGNA 4XF9A 5CVRA 5I93A 1QXJA 3CJXA 4YSFA 4AVBA 1UD1A 4HN0A 2VPVA 5CADA 3SCFA 2CAUA 1DGWA 3H1MA 3B02A 4KWKA 4J1XA 3R6SA 4Q0VA 3CLPA 1DZTA 1G6NA 1RUNA 4OFGA 3EQEA 5FLIA 4AVCA 1O7FA 2IXIA 3O14A 3I59A 4IEOA 1LR5A 1OMIA 2FQPA 5JR7B 3H8UA 4ZU7A 2VQAA 4MGYE 1J3QA 4MGZE 4XFIA 5I0UA 2ZCWA 2XNDH 3LOIA 2D93A 5FLJA 4JTNA 1FXZA 5I8TA 2GU9A 3DKWA 4DINB 4XFGA 1JUHA 2H0VA 4YYOA 3DV8A 2OPKA 3OF1A 1OFNA 3BPZA 4X6QB 1Q43A 1UPIA 2UY9A 3E6BA 2ZKLA 4UBGA 5JSPA 4RD7A 5I0SA 1VJ2A 2PQQA 3QOPA 2IXCA 1AQTA 2E5TA 1J58A 4E2SA 3LA2A 3LZZA 2P17A 3D0SA 2D40A 1J59A 4LULA 3VHRA 4Q0SA 5AVPA 3S7IA 3MZHA 4HMZA 1X7NA 3CO2A 4NVPA 1J3RA 3PJSK 5JSRA 2PHLA 4O9EA 4I09A 4KU8A 5BPXA 1V70A 2Y0OA 3CEWA 4BIFA 5K8SA 2GC3A 3H1WA 5BY5A 1Y9QA 1J1LA 2E9QA 3UKVA 1CAWA 3S0MA 4A2UA 1U12A 2XLAA 1CAWB 3EHKA 2OYZA 4I0BA 2XLGA 3H3UA 4R52A 4EWAA 1ZX5A 5C6CA 2ET7A 4IEWA 2MHFA 2CV6A 1IPKA 1ZZ8A 1LB2A 5J7MA 2XKOA 4Z07A 2PAMA 1IPJA 3H9AA 1ZZBA 3I54A 1LRHA 5F1RA 1CAVB 4JVAA 1CAVA 5FQ0B 5LEKA 4X6RB 1YUDA 5FQ0A 2EVXA 1XE8A 4R8HA 3KMHA 1EP0A 4HVOA 2ETEA 4IETA 4AQ2A 2B8MA 2GC0A 3PLQA 1RTVA 2CGPA 3SXWA 1YFYA 2QJVA 1OD5A 1PMIA 2UYAA 1UCXA 1CGPA 5I8SA 2XHKA 3NKTA 3I7DA 1ZRDA 5KHKA 1VP6A 2H6BA 1RGSA 3H7JA 3LA3A 4K8FA 2Q30A 3FJSA 4PIXA 2V09A 4FAHA 5KBFA 1PM7A 3IBMA 4B29A 2IXLA 2XL7A 1SFNA 2HJIA 4XETA 2BNOA 4HSLA 5EFUA 4EV0A 4MV2A 4BHPA 1H1MA 3TNQA 3JZVA 3EBRA 1UIKA 3E5UA 3ES4A 2CAVA 4MGKE 2BNMA 2WSSH 5D1IA 1DGRA 4PJYA 4AQ6A 4WBBA 3WW2A 4H7LA 2BNNA 1CAXA 2BYVE 4HSJA 1GQHA 3EJKA 4OLLA 1O5LA 4MUVA 4ONUA 3SCGA 1QXRA 2EA7A 1QWRA 5I0TA 2N7GA 1NYWA 3NJZA 3MPBA 1CAUB 4XF0A 2JDIH 1RL3A 4LLOA 2Q0AA 2IC1A 2XKPA 5HI0A 3NSTA 1CX4A 4HZFA 4YNIA 1RC6A 3WW3A 4UBHA 3RNSA 4I02A 1BSNA 1O3SA 3C3VA 3ACLA 3MDPA 3ELNA 4JV4A 4D7SA 2GAUA 3FHIB 4XFBA 4E2QA 4QGMA 1LKNA 3N4MA 2Q4SA 1UW8A 3GBFA 1DZRA 2FMYA 4QXKA 2PFWA 4I0AA 2GC1A 4PIYA 3E5QA 5CU1A 1E79H 1CAUA 3RDIA 4IESA 2PAKA 3NW4A 3U0ZA 4IEXA 4QGLA 3S7EA 3EO6A 4KWJA 4LEJA 1O3QA 5LEJA 5FDBA 4HLTA 3SMHA 2Q1ZB 3OD0A 2XGXA 3SCHA 5I0RA 1XRUA 3FWEA 2I45A 1WLTA 1ZRFA 1X8EA 3NL1A 1TQ5A 2UYBA 4XF4A 2HKXA 2OZ6A 4TLFA 2XLFA 4FT8A 3SHRA 4IEZA 2PA7A 4EWEA 4MH0E 4PIZA 5KHHA 4XFCA 2QCSB 2QVSB 2VECA 4LUMA 4LA3A 3BALA 2D5HA 3TNPB 5FCCA 3E5XA 4L11A 2MPFA 1QY4A 4KU7A 3KSCA 1EPZA 5BV6A 2MNGA 3FE5A 3RZZA 1NXMA 4F8AA 3E6DA 2UY8A 1O5UA 4Z82A 3LA7A 3KGLA 4MGIE 1J3PA 5JCTA 1FI2A 3DN7A 4EWDA 2B9UA 4UXAA 4IEUA 3D82A 4WZCA 3HIFA 1YFXA 3U11A 2EAAA 1YFWA 4QM9A 3ST7A 4Q0PA 4Q29A 2IXJA 3H3ZA 3RYPA 4IERA 1IFPA 3IDBB 3ETQA 2ET1A 4HVQA 1UIJA 3L2HA 3EFFK 3U10A 4BYYA 3IWZA 1ZZ6A 1GQGA 1YHFA 3E6CC 2C0ZA 4KWLA 4ORFA 1ZZ7A 5KHIA 1X82A 3BU7A 2O1QA 4F7ZA 4WVZA 4P9GA 3FZ3A 4O9GA 2BGCA
chains in the Genus database with same CATH superfamily
3AK0A 3PUAA 1EXJA 3EFGA 4CU6A 4HETA 3WHUA 4I1LA 2PHDA 1NXD1 1UIXA 2IDBA 2ZGQA 4XEZA 5FZGA 3Q3DA 1EZVI 4L8QA 1GNHA 2ZKNA 1OLMA 4N3YB 1SQVG 5HCAA 3CCJP 3TYJA 2CPSA 4Q4V2 4XIKA 3S4RA 4NMIA 2JWAA 1J83A 3ZDSA 3MZWB 5CCGD 1WW6A 5CFDC 2R0HA 5A32B 1H0TB 4KG0A 4XJ8A 5E16A 1NTZK 1KS5A 5FXWA 3ENRA 5H9QA 1JZ6A 4JQRA 2QDNA 4B1LA 4CYDA 4LPLA 2WWUA 2QDRA 2BWAA 3I3QA 3BRVB 1JBCA 2OYIB 3VD9A 3LAGA 5TSWA 3V64A 2F17A 1NKGA 1Q3EA 5C3PA 3AEFC 5L9VA 3GF3A 2JENA 1H1IA 3H1KE 4EZ4A 2ZHNA 5C9AA 1POV3 2ZMLA 2A06D 4PDWC 2D43A 4LIVA 1VE0A 1U7JA 1G86A 2CGOA 1RMU2 2OX0A 3MO4A 1NTKD 2J7MA 2P58A 2FYUE 1PP9D 4JYCA 1QOTA 2ARBA 3GYDA 3MYXA 1O3TA 3PUHA 1U0AA 1LOFC 3NNLA 4Y20B 4EZHA 1F15A 4PQ9A 3H42B 5C8CC 4CDXB 2WPQA 2PAEA 2CK3H 3UJOA 1E5WA 2CYFA 5B5EH 5CCHA 2W90A 1XNCA 4LKDA 4XVHA 4Y28J 2OTKE 2L91A 1MS9A 5A3WA 3ZR5A 4FSJA 3CJIA 3U4XA 5BNNA 4QB2A 3VD7A 1H8TC 1ZRTD 2ZACA 1ZBE2 4BB3A 3MIBA 1XSRA 1KFXL 3L71D 3ABVC 5KAIE 1CONA 3HTKB 1EV13 1WGPA 4N9HA 3ZYHA 4ZMDA 2CNAA 2JP3A 5FPZA 5BXXA 1ZREA 5H9SA 2B9VA 2BWCA 2NZ9A 2A6XA 2ZYAA 1DEEG 3KGZA 3G3ZA 1BGYJ 1EYBA 4N53C 3AE1C 3R2PA 1SQBK 1NZCA 2WO3A 2WQ4A 1EUUA 3AKTA 1JI6A 3TAYA 5CISA 3OPZA 4I2LC 3D0JA 3L4FA 5FZEA 3TSIA 2QM8A 1YIPA 1KRIA 5DAVA 4YW3A 2OTLP 3CJIC 4NUBA 2RMU3 5FMOS 3M1HA 5GLWA 4S2FA 3RYRA 3WNMA 4ASMB 1LTJB 2O1JA 1RUG2 3WW4A 4H0LC 2B5HA 4QHBA 3PMEA 2Y0DA 2ZGOA 3L71G 5LA9A 1NOVA 1SMVA 2BEOA 4BQ1A 1AL0G 2IXKA 1GICA 2IWGB 5FZCA 1OXCA 1VPHA 1HW5A 1FOSE 3NJXA 1T6GC 4FPLA 1ZNPA 4Q4W3 3VKLA 5ACA1 1OLRA 4YG6A 2P10A 4JQ0D 3JCIA 4NOTA 1G1JA 2VOKA 3T30A 1NQDA 4CPBA 1SDWA 3G9RA 2WQ8A 5F6KA 4C1WA 2P5BA 4JHTA 4UB6H 1EZVG 4KL1A 4LUKA 4UW5A 4UB6E 4IL7A 3H1HE 1EPWA 3HPNA 4AQTA 1W99A 1ZZCA 3DPRB 3T97A 4YW4A 1HTLC 3NMDA 1SQPK 5IWFA 4LO6B 3O1OA 2C0XA 2FY8A 1KDKA 4OHYA 3BKZA 1NUKA 1RE4C 3OGJA 5FY1A 3PVBB 1D4M2 4XTPA 1T2KD 1NE6A 1YJKA 2Z2SB 3HT1A 2WT2A 4JHZA 2R30A 4CP1A 3A0KA 2WIIB 2RDSA 4DXTA 1FMD3 4MYEA 5FV3A 2CDOA 2IX7C 1KB9I 2W6JH 1I3HA 2H6CA 2YKQA 1Q5OA 1YIFA 2W1SA 1W9FA 2XV5A 1A02J 1CJPA 2JDAA 1GDTA 1WCSA 4C7NB 3PVOA 2ZX2A 3I2JA 4NN0A 2QQJA 4YG0A 4CPBD 4FO9A 5IVBA 1H2KA 3A5TA 1EXIA 1CVNA 5ABJB 4B7KA 3SC7X 5JMCA 1WA4A 3LIEA 2J5UA 2DCJA 1UZWA 2YU2A 3EMRA 4GODA 2OUHA 4FOQA 3FHQA 2VTFA 4NO4A 1W6QA 2VOXA 4D6TG 1RE3C 4G4FA 2HWF3 5D2AA 1L0NE 2WQYC 4ZNCA 3E1F1 4DNYA 3VDDA 2AEFA 4DZOA 2CGNA 3B4SA 2WSUA 2VZ3A 5CBLA 1JS9A 1LTTC 2AENA 4ZKTB 2FZ2A 2BOIA 3OB8A 4JGZC 3RRDA 1GL2C 5ERLA 1OA4A 2ZHMA 3M91A 3K3OA 1WBFA 3UKNA 2PHXA 3A2AA 1UKRA 2J1RA 2OZJA 3PIJA 4JGZB 1X33A 1NCRA 5LRRA 2GC2A 2UWAA 2RJ2A 3T3YA 4GULA 1SFCD 3BB6A 1SQQG 5FZKA 2HWD2 3WNLA 2E5YA 1S9KE 3ZDMA 1L2PA 2BEQD 1RINA 1NTKK 4V1PA 5T5PA 1OVVA 5I0TA 3USUB 4AHYA 5C8CB 3L71E 4PCRA 1KQSO 1QXJA 5FZ9A 1KFUL 2NMOA 2JDYA 4YSFA 1QGLA 4PD4E 5E88A 1VDFA 3A21A 2WPVB 3I2IA 3FWLA 4GWIA 1BEV2 2YMYA 1PGQA 1AR83 1H2NA 3VBOC 2W92A 4YVSC 2JE8A 4Q1RA 2IBZD 1GYKA 1DP0A 3GLMA 3OBRA 2FYUJ 1L4AC 1G6NA 5KAIH 1S0EA 4OFGA 1M57D 5AVAA 5FO7B 2H8PD 4AVCA 4JPZB 1O7FA 1XYPA 4E27A 3VDBA 3KLSA 1CWPA 2R061 1WKYA 3UT0A 2E63A 2XDVA 4QB6A 1FDIA 2RKLA 2VZQA 4Z2AA 3S57A 1HGVA 1OMIA 3H8UA 3RI9A 4ZU7A 1BK1A 1KJLA 1ULPA 1FPN2 2E76D 4ZKPA 2ZGPA 1RHI2 3NNJA 4MGYE 5D1IA 5C4WA 4MGZE 3WT3A 5A3PA 5IK4A 5JZGB 1JYWA 2OQ6A 2Y0IA 5FLJA 2XHNA 4AFBA 1WUVA 1BCCJ 1C8M1 1VBC3 4JTNA 4UAPA 3PTZA 3KF5A 3VD3A 3U1XA 4QX7A 2V4VA 3DKWA 4PV1B 1L7RA 1FC2C 2UWJE 2H43A 1FV2A 2VNGA 4NRQA 3OF1A 1OFNA 3J8F3 1S5LX 3OJAB 2N1TA 4S2GA 3B5NB 4ARXA 5C8CA 1D7PM 1DLLA 1Q43A 1QU0A 1UPIA 3VB9A 2DBNA 3E6BA 4WM7C 4HL0A 3H1IE 4ZS3A 2VXRA 5F7UA 3ZN5A 5L73A 1DG6A 4IV1B 1M1KQ 4XQ4A 2R1DA 2YC0A 4U3FJ 3WX5A 5JSPA 3MV01 1AL22 1BE3G 2O8OA 4RQPB 3Q5SA 3ZYPA 2G8YA 3HNMA 5G05L 1J58A 5JXJA 4E2SA 3NWKA 1LTSC 3CZUA 2R042 1N7SB 4IV3B 5JOWA 1EZVE 5LBEA 1W9TA 1FOD3 2D40A 5FK8A 5LA2A 4LT5A 1DIPA 1W6NA 4LULA 2YFZA 5FPBA 1J59A 3C7HA 2JDMA 1DYOA 1R64A 3GHGB 5AVPA 2ZAEB 1HVVA 3WU2E 4LITA 5A7QA 1KQGB 2NYYA 3MZHA 4KJMA 4JKMA 1FV3A 3O1VA 3I56P 3POFA 1LEMA 5GALA 4QWNA 5FZ6A 4N53B 4NIGA 2D98A 4QQOA 1MS0A 2PHLA 1Z7S1 2VM9A 4I09A 4RQPC 5K8SA 2Y0OA 3QWOC 1NY71 1TZOA 1Y43B 2YV8A 1Y47A 2P6HA 4XBLA 2FCVA 3WLUA 2V4HA 3H1WA 2H88C 5F5IA 1Y9QA 3SKVA 4IL6H 3VBSC 1ZMEC 5FYVA 1BE3D 1LNSA 4Y1VA 3NV4A 1CAWA 3D3AA 4N8MA 3ZXEA 2XU6A 4CEYA 4BQ2A 2FDFA 1BMV2 2ZGRA 3W67A 3H1JE 1AXZA 2XOMA 2XVLA 2XPJA 1USEA 1U57A 2OYZA 1QJY3 1LJ7A 4GIQA 3F95A 2HYNA 1COV2 2GH8A 1NAYA 2QG4A 5KLVG 2NZ2A 1OA3A 2ET7A 5DAPA 3VHOA 4IEWA 1JB0J 1IQAA 2IFMA 1XXNA 2P7JA 1RUG1 5A1LA 5FYSA 1LT9A 2VW2A 1US3A 1V9U3 2RM23 5FXVA 2B88A 1ZZ8A 1UY4A 1YI7A 5CCGA 4GWMA 4CA9A 1K5MC 1LU2A 2JD9A 2PAMA 4LBNA 2F6BA 1IPJA 1XU2A 2Q1FA 1AJOA 1ZZBA 2W68A 1VQ4P 2Z79A 3L9JT 3BGAA 1CR7A 1R5SA 3GF6A 4Q4V3 5AW3B 1CAVB 4FFFA 3B8EB 2R073 2HWD3 4EN7B 4JVAA 4CEYC 5FQ0B 3AE9C 5LEKA 3IMMA 4X6RB 3PVEA 5AW0B 1LECA 1YUDA 1JOPA 3HNBM 3OSDA 4NHKA 3VBRC 1FZBA 3MFCA 5LY1A 1VF5D 1RF0A 1W8WA 3JB8A 3H0OA 2DVDA 2GC0A 2ORXA 4TXWA 2J1VA 3L74D 1DGLA 5LCWL 5FK7A 2A70A 3IDAA 2VZSA 3SXWA 3WINE 2QJVA 1OD5A 1PMIA 3CNAA 3WDTA 2XMLA 2XJRA 5EJ1B 5EV7A 1W39A 4Q26A 4CEWC 5IFTA 2WS91 1OVUA 1FJKA 4JYBA 2QQWA 3UJQA 4CP2A 2VZTA 1O59A 1KFNA 2WNOA 2C9LY 1NQJA 1VP6A 4XA4A 4RGAA 3VLBB 4ET7A 5LK7B 4IGOA 3ZMNA 2YO3A 5APQA 2F4LA 2RR12 3A23A 4AGVA 1FPN3 3FUOA 3FLPA 2OXBA 5ISLA 3LCPA 3LEMA 5KJ7D 4D69A 5K7PA 2BGCA 2A1XA 1IOAA 1AYM2 2JB4A 2OVUA 2WA4A 1BCCG 1ZR2A 4XW3A 2RV9A 1VPCA 1GSLA 1SACA 2ZVOB 4XE5B 2ZPXA 2VL4A 1FZAA 2D6MA 4I0WB 2BNOA 1H9WA 1EV12 5E8AA 3SKJE 5APYA 3GJBA 2FXOA 4N7UA 1J1DB 4LLHA 3VN4A 1PVC1 1NYHA 3LE0A 4EV0A 1FJPA 1R8EA 1R1ZA 2B89A 2J42A 2YB7A 3LKJA 4CXWA 3EBRA 1UIKA 3LW5J 2CAVA 5GM0A 1RUE2 1EZVD 4NHMA 1JYCA 2WYFA 3B94A 3KHBA 5LASA 1MS3A 2YC2A 1MS1A 3WY6A 2BNMA 1D4VB 4W6YA 4YFWA 4UB8E 2BV4A 3AJZA 1ZXGA 2WSSH 3BIEA 4JQTA 4Y4YA 3OEBA 2K9JA 2X10A 1GQPA 4K40A 3UIAA 1KILC 4QPIC 5DZGA 1CAXA 5CKMA 1RUD3 3VZOA 2FYNB 2VBBA 3A0BH 1S0CA 4W4ZA 5IK7A 2OYIA 1RUG3 2BP6A 3NV2A 5LBBA 3JB4C 1O5LA 1IK7A 1GNZA 3L75E 5CBOA 1YEWA 4GXLA 2AEZA 3WNNA 2EA7A 1IKPA 1LHWA 4P5HA 5F6LB 5T54A 4I7ZC 3BOWA 1LWUC 3IPVB 4AI2A 2W0XA 5DABA 2PMWB 5C9AC 1AR92 1QHDA 1DGRN 5T50A 3I2GA 1BYHA 4CCEA 3KM5A 5F5CA 4XF0A 3TEZA 2VULA 2R1BA 1JHJA 4FFHA 4L0PA 1IFJA 1O4YA 4TTGA 4L76A 1FYUA 1ZBA2 1KILA 3M2MA 2XH6A 1QQP3 5JIAA 2EAKA 3M7AA 2OYHB 3OAKA 1XBFA 1N73C 2AREA 3HOBA 4FOVA 5HI0A 4LHSA 1K73Q 2JG8B 4Y5SA 1LTJC 2B87B 3WW3A 4RJTA 1UU5A 1V6NA 4I02A 2PGDA 4N53A 1L7QA 4WM7B 4I3GA 1SQQD 2V72A 1FOD1 2I74A 2YXQB 5FYCA 1O3SA 4A7PA 3WCSA 1A34A 4BZ4A 2OTJP 2EICA 1KV4A 3W21A 3MDPA 5IVJA 1ULDA 1GKBA 4PD4D 1JZ4A 3W5NA 3LIDA 1WCUA 1IFMA 2XUMA 1NU1J 2Q5TA 3BOPA 3FN9A 3NMBA 4K21A 4XDQA 2ZGKA 1OW8A 3AE8C 3HAGA 1BLZA 3ZO0B 3F5HA 1L0NG 1WLWA 2IBZG 3R4DB 4Q4Y1 2KNCB 3AE4C 3L74E 1DZRA 3U37A 5T52A 1ND2B 2R072 3QBQA 4IV1C 1OWAA 5FFOC 2XQRA 5CFCA 5JMOA 2PFWA 3J8F1 1YHQP 3SNMA 4PIYA 1QX8A 3PHLA 3E5QA 5CU1A 3I3MA 1SQXD 1CAUA 1OW6A 3BCCJ 4D6QA 1X22A 5FZAA 4DEVA 3S7EA 2M3EA 2NQYA 1JMMA 4OULA 1N7SA 4IV3A 1SLAA 1SPPB 1LHUA 3HUSB 1FNZA 1ODMA 1X8YA 2HWC2 2NM1A 1AYN1 3EO6A 4FQZA 4QQHA 5A3OA 1IS5A 2X05A 1KZUB 5BNNC 1O3QA 5LEJA 4R9CA 1SG3A 3GHGA 5FDBA 5ABJA 5J09A 2W6BA 1N2DC 4Y99B 2JXAA 2P3IA 3N9MA 3B71A 4HPKA 4ATFA 4Q8KA 1HKDA 4B86A 1FATA 2RMU2 5KXCA 3RL0B 4OI0A 1LTBC 2W94A 5F2SA 3S6PA 4A3XA 4BM8A 2AXCA 1X8EA 5CCHD 2BCCE 2GDFA 2UYBA 3H8XA 1XOYA 3BCCE 4XF4A 3MW4A 4UT5A 1TMF1 5EP9A 4TLFA 2XLFA 4FT8A 2XONA 3RWKX 3TDKA 1N7SD 4IEZA 3RJ2X 2A3XA 3CDZB 1SQVK 5FJKA 4EWEA 1OUSA 1AR81 4JGYB 3P7KA 3RG0A 4MH0E 2WBKA 2WSVA 4XE9A 5AW9B 2BERA 2JICA 2QCSB 3OUIA 4FOYA 4RYDA 5C3QA 2WDBA 5JR2A 1W6OA 2HPCB 2TUNA 1HRI1 3C8XA 1W8ZA 4F83A 5KXDA 3JD72 4QDRA 5GKAC 4IGQA 1U7MA 2EIEA 2K9YA 4U7JA 1UQXA 3KSCA 4LHLA 4NAOA 3L73E 5JDBA 4RS5B 1RVF2 2R16A 1N3PA 1WW4A 2MEV3 2LROA 4Y26A 3I5CA 1DGWX 2HYXA 4TSVA 5FKCA 1NXMA 1D4M3 3PVNA 4JDMA 4X8PA 1SQPE 1D4M1 1GNYA 1W2NA 2NN8A 3LDRA 5HCHA 1UMHA 3MIEA 2DVAA 1IG0A 4AFMA 3FLTA 3UESA 4QKNA 4XAEA 4YZ2A 2MEV1 3HD7C 4YXDC 4MGIE 4YW1A 1C28A 1BE3E 3DYPA 3AZYA 5IAVA 3TGUG 2VW0A 1TEIA 3J7LA 1JYTA 4E8DA 1NCQB 3BVCA 4E9KA 4G3YC 3FX0A 1R1A2 3D82A 3HQUA 3KQRA 1HRI3 1P84I 4LHKA 4CPGA 4XACA 1PVC2 4BWOA 3U11A 1ONAA 2WSCH 4JGZA 5I8YA 4LKFA 2WT0A 3V56A 1JZ3A 1BK0A 3V5BA 4YW6A 2E76B 5AW8B 2HEYF 1K04A 2D6NA 1W06A 1CX1A 1NY72 3UK9A 3HD8B 1N86A 3L75J 1WCQA 2IZWA 1FE6A 1VBB1 3RYPA 1CPNA 1JTHB 1UU4A 1NKNA 3BIWE 1CPMA 3ETQA 1JCCA 2FFDA 3KT7A 4Y22A 5GTHE 5A80A 3CLQA 2QTWB 1YHFA 4PV1D 5FP4A 3U10A 2C0ZA 1CIWA 2BVBA 5LK5A 4WVVA 4C46A 4CXYA 3WNXA 3CPWO 4W6WA 5F3EA 2WZPP 1X82A 3BU7A 1MZ9A 3KZIE 4EYYQ 3GCXA 2O1QA 4FPCA 4YM0A 1POV0 3KT4A 4Q8LA 2I1KA 3NNMA 1WMDA 3WXPA 2QE7H 4DUWA 2OIIA 5FTTC 3AFGA 1AYN3 1EQ7A 3I59B 3Q8FA 4ZU5A 1SQQK 5FPUA 1BSHA 5HPOA 4LC1A 5FYMA 4QPGC 1FMD2 4Q4W1 4TYSA 5E1RA 5KR7A 1H88A 1YTZT 2ZA9A 4AEDB 1VR3A 1M1JA 2G9GA 3H25A 3PJYA 1ZRIA 4N9IA 4AVAA 2QNKA 2WFPA 3I2HA 2R5DA 2C0WA 4E8CA 2RH0A 2JKVA 5FY5A 1EY2A 4QM8A 1GZLA 1XB9A 1N47A 2ZGNA 3M70A 4O61A 4Q4Y3 1J1EC 5FWEA 5BNOC 1H1AA 1VMFA 1AUYA 4J1WA 2EXHA 1S1CX 5HXVA 2YZ4A 4L9BA 1KILE 1PGPA 3HD7A 2W3JA 5K0UB 3RK2D 3IIAA 3MUDC 5KJ7A 2C1FA 2Z5WA 1ST8A 3NO8A 2VH9A 4WWIA 4LA2A 4JF7A 4FPFA 4YVSA 1BBT3 1OOPA 1GMJA 1GW4A 4LIUA 5AW5B 3ES1A 4ZPIA 4PF1A 4AE2A 1GW3A 3OGVA 5CEHA 1W6PA 1U5YA 1YNAA 2R7EB 3WF1A 3H1LG 2GH2A 1S0BA 2UWBA 4LOTA 1PO23 4XMIA 5FXXA 3BATA 4D3WA 1IHMA 2JIGA 3X29B 2KSEA 3RZGA 3AECC 5LBFA 1UZZA 4COZA 2A06E 3MHVA 5IUQA 3VMXA 2OKXA 5AC92 1YFUA 1N3QA 2HLEA 4M4RA 4XC9A 4L75A 3W58A 4V2WA 2YIUC 3ZPYA 1LULA 2WUHA 4JGYC 4ES9A 5BU5A 2HG5D 3MIDA 4GH4B 2JWPA 4XYXA 4AI9A 3AKRA 1K9MQ 5FRAA 3H1HJ 3HRNA 3WOGA 1P84D 3CHXA 3UGGA 2ZMKA 4LJHA 5JI9A 4XDOA 4DPNA 4AOCA 4LBQA 2ZFCA 1JY3O 4DCKA 1FZGA 2VRSA 4EI2A 3LEGA 3O8ZA 5KKZB 4XF1A 1F5FA 2GNMA 2YGMA 3N9QA 3RL0C 4UW3A 5HCFA 1T3UA 2A06G 1L4AD 3EYPA 1L3JA 4IEPA 4HN1A 3WQ1A 1AR62 3CX5H 2O8QA 3PUIA 3ROUA 5F37A 4FFIA 5D8AC 5JSOA 1VRBA 4NIDA 1C8M2 1ZOYC 1L0LG 1NAFA 3H1JJ 2F4PA 3KCXA 3O7OA 3WSOA 4OGQD 1N1TA 1WA6X 4ASWA 2J1EA 3HD7D 1NU1K 3H50A 4LTAA 1JOBA 1QJZA 1PX3A 4A7ZA 2P34A 4XUOA 2PRRA 1JODA 1PPJE 1SLTA 1L4AB 2HWE1 4HXCA 1YQ3C 3KD4A 1PVC3 3JUUA 5AVSB 1DLCA 2ATFA 4UWDA 4YZ3A 3L72G 1SFCB 1LOEA 2XVGA 2D97A 1QJU3 3AVRA 2PHUA 4IE5A 1RUD2 1ZRRA 1BGYD 2JR8A 2R041 4D94A 5ANNA 3LOBA 2Y6FA 4CCDA 2WMMA 5FPAA 3HE4B 1NU1E 5GTHH 4NRPA 1FPN1 4M4PA 3VTPC 1LOCA 4WVWA 1ZP0C 3HE5B 2FYUK 3NTNA 1LHVA 2E7QA 4WM8A 2XBO3 4CCKA 2V4AA 1OX3A 1CAXB 3T0DA 4C90A 3TYYA 3UKTA 5GZCA 3IT8A 1PGOA 2Z4FA 1GL2B 4MXVA 1NE4A 4KHXA 2D5FA 1NCRB 2Y6LA 4L2NA 4BQ5A 2XL9A 3ZLIA 2SLIA 2H89C 3MGNA 1IFIA 4FXGB 1H6XA 4JGYA 2AXTH 1F35A 2BUKA 4MZUA 1A3KA 4AHZA 4C0BA 3FWNA 3H1YA 1RUC3 1NG0A 1RUI1 4R4ZA 5FZLA 4LXLA 5LB6A 1S1AA 3DECA 3IAPA 4JTOA 4FPJA 4YGEA 1LTJA 4RGGA 4AEDC 2BOJA 4UFLA 4CSWA 1IPSA 2ZAHA 2HR3A 3PDQA 5T5OA 2BCCG 1F5JA 3AZXA 3UGFA 2R071 3AYDA 5KXEA 1W2UA 2QJYB 3TWIA 1QJX1 2WQZC 3CXHH 3HBKA 4XF3A 4RHV2 2IFRA 2QE3A 4Q4V1 2HWB3 5FIXA 5DUUA 1NA1B 1PVXA 2E32A 3FFZA 3D71A 2PHFA 3BCWA 2QQKA 1W9WA 1PNGA 2VTXJ 3BCCD 1GTWA 1RUH2 4KBZA 4I2OA 4BLIA 3LDKA 2YBPA 4DRVA 1OD3A 5BNPA 4EN0A 5DJUB 3FFQA 3HE5A 1V9U1 1LP1B 3RK2C 1TNRA 2RM21 2TEPA 3MF9A 3R4UA 5SV8A 5KLIC 5FPXA 4QPGB 5JWPA 1HX6A 3POBA 1K05A 2ZXXA 2ZABA 5BYNA 3WU2H 2VUCA 1OA2A 2Y0CA 2DTYA 1FBMA 2P3JA 1D2SA 4KWUA 2DCKA 1L0LK 3T97B 2VJXA 4Y3OA 3A0HE 3IN9A 5DQ0A 2KXLA 1PZ9A 3VBSB 4D7TA 1URQA 2D2CD 1IS3A 4QAWA 1DFQA 5ACA3 2W47A 3VBSA 3CX5I 4QGNA 5FO8B 3AE2C 1RE4A 3V2QA 5GZGA 1X9PA 2AR6A 1H8AA 4YZ5A 3LFMA 1ASJ2 4E4SA 2HPCA 2L5GB 4HN0A 1S9KD 1Z7S3 4RGKA 4NPDA 3VDCA 3D8CA 4ZHNA 1DGWA 2WA3A 3V2PA 3E1IA 2LW8A 3H1MA 4HT1T 3T1MA 3K4ZA 2BGOA 3CLPA 3H1HG 4DS0A 3VKNA 5C39A 1I5PA 4L74A 2VMGA 2FXMA 3AP9A 2DUQA 3ZXFA 1JMUB 2RDRA 3AMNA 3ZX7A 2GMEA 5H9PA 5L8RJ 2RR11 2D2CB 3ZXAC 4Q5OA 4LK6A 3O14A 1KTMA 1H30A 4KGQA 3TGUD 4IEOA 1GP5A 2YPDA 3IB3A 5FMBA 3AB0A 1AYM1 3IAQA 5DXDA 4AEJA 2GM4A 4S2DA 3N4XA 1JY2P 1JY2N 3N3HA 3IMNA 5J36A 1N8RQ 4AGRA 4OVNF 2QUOA 4A45A 4LR4A 1VQLP 1JNMA 4O7XA 2ZCWA 1AR93 2YC4A 2VMHA 4AFAA 1CN1A 3SEPA 2AXTE 3LOIA 3UYJA 4KMQA 2O01H 2FDJA 4GJYA 1ZR4A 1UOFA 3KVBA 4HANA 2GU9A 1Q8SA 1X50A 1G9DA 4DINB 1X0TA 1F4AA 3OBTA 3RQ0A 2H0VA 3UETA 1NTZE 1UOBA 1G8WA 3NKGA 3Q2YA 1NU1D 2Q7CA 3VMAA 1MEC1 1YRZA 4NWWA 5FY0A 2WZR3 4CUAA 4WZFA 2I8DA 1MQTB 1PIV2 1PK6B 2ERFA 1QJU2 1UXZA 4IE4A 1MVEA 2ZKLA 3J26N 4UBGA 5BNPC 2NLRA 1WCDJ 2ZX0A 2ORZA 4QHOA 5KLVK 5E6HA 4RD7A 2Y9YA 1VJ2A 2PQQA 3QOPA 3J7NA 3C7GA 1VQ6P 3OJBA 3TN92 2E5TA 3VBOA 2VCCA 4IE6A 1VBD3 1RUJ1 3WCRA 5CMZA 2XJSA 2P17A 2VNOA 2XQXA 4NPMA 3DXUA 1LENA 4QQLA 1KJRA 3A0BE 3N9NA 5FZOB 2XVKA 1V6JA 2J1TA 4MO3M 1NLRA 3LD8A 3FXDA 1GOHA 4GWNA 4L99A 1YQ4C 2R063 4Q27A 4UW4A 3RBZA 4JKKA 1KB9E 3S7IA 4HMZA 5FXZA 1X7NA 1KB9H 1JH5A 5FUPA 3CMAP 1S0FA 2WNVA 2VMEA 3NAPA 4GQ7A 4UFIA 3CCQP 1J3RA 1RH5B 3VMYA 3PJSK 5L19A 4ZS2A 2GUVA 1Z78A 1V70A 2DVGA 4KU8A 2W27A 2IFNA 1WWYA 3I3DA 5FPLA 3N7KA 3T2OA 2FDKA 4JKLA 5BY5A 2ZX3A 4GT1A 3SFDC 1XTGB 5EJZB 3Q8EA 3UKVA 3S0MA 1DYKA 5DG1A 4A2UA 4CEWA 4W50A 1PK6A 2JDNA 2KI7B 1CESA 4CZSA 1PM4A 3RS6A 2YFUA 3GHMA 3V0AA 5J98B 3H3UA 2KM2A 4PLMA 4R52A 3Q8BA 5L9BA 2BU9A 1CZSA 1QNWA 2C9AA 3HMYA 3L37A 1KS4A 3CXHD 4WY4C 2ARAA 3HN1A 4Z92B 3W5MA 2GALA 2VNVA 1EC5A 2VU9A 1UYZA 1LB2A 4RA0A 5J7MA 4MG2A 4LKEA 4XUTA 2VNRA 2HWF1 3ON7A 3R0RA 5TISH 3H9AA 4AK3A 5TISE 4S2HA 2POHA 3I54A 1LRHA 5BNOA 1QVGO 3PTYA 2CU5A 4GZ9A 1G9AA 3NAPB 5B4NA 1RITA 3VBUB 2E75C 2EIGA 4XJWA 4BXSV 2JJLA 1M90Q 1VMJA 3OBAA 1SQVJ 1QKQA 4HKWA 4CDWC 1NTME 3N35A 1XE8A 1NCQA 4H44B 1LWUB 2JJ6A 4BXLA 4P08A 1EP0A 2QQVA 4B4PA 3VHPA 1N7LA 1I9RA 2HWE2 2XWBB 4URTA 4XAAA 2Y26A 4WM8B 4N78D 1RTVA 3ZXLA 1J1TA 4MGQA 3GDBA 2ENRA 4YGDA 3SFEC 4Y5Z0 5FY8A 2VW1A 3UL2A 1SQVD 2UYAA 4GB32 1CZVA 2P2UA 4BDVB 5KWRA 2WT7A 1NHLA 1BVVA 2FYNC 3CC2P 3KV6A 2IYOA 1RUI2 1WW5A 3NKTA 4OQ9A 1HJGA 4IW3A 2A45H 1HBWA 1W3XA 1YYNA 2A5ZA 4OHVA 5C3OA 2WSEH 3CWBE 1FX5A 5FPVA 4K8FA 2Z5IA 5FOJB 4WBAA 4Z1MH 2AYHA 3WD5A 3BVHA 5I0DA 3ATGA 1OFSA 2XJQA 3T0BA 3RK2B 4FVVA 2XL7A 1SFNA 2WJSA 4XETA 1HRV2 4ZXKA 1NTKG 1QDOA 1UYYA 4A6SA 2Y0EA 1BKZA 2WSCJ 1UMIA 1NA1C 5EFUA 4A7YA 5BNNB 5FYBA 4OGQB 1TVGA 3JD73 2ZXEB 3RMXA 4Z2WA 1C3HA 4AUWA 3AYCA 3ES4A 3GZAA 4XQDA 5D8AA 3VHNA 3ZFGB 4K35A 2P1JA 1MKMA 4DO0A 1RUF3 3OBZA 4HB1A 3L74J 5E79E 1DGRA 4K1YA 2R5BA 2E33A 1KB9D 4AQ6A 1JN2P 2UURA 3AYAA 3TN93 1HGZA 1AYN2 4WBBA 2BNNA 3SQOA 4B7EA 1H4HA 3GBWA 2ZT9B 1Q81Q 1GWLA 3WNKA 2BYVE 5DZEA 2EIBA 4LNVA 3MFAA 2VCAA 4K7JA 3LIHA 4FPOB 3GGLA 2OYHC 2Q1MA 1IFNA 4OLLA 4RFRB 2E7AA 1BCCD 1JO5A 3ZFFA 3OEAA 3WG2A 4ONUA 1FDOA 1QXRA 3SCGA 4P9WA 4CCLA 3UNPA 5LA0A 4DT0A 5C9AB 3ZSLA 4U3FE 1QWRA 1R1A3 1SQPD 1OLME 2N7GA 2J58A 1HRI2 2VG9A 3AP7A 3D5OA 2GNBA 4YTPC 5CFCB 4Q4X3 2HFED 3THPA 4DMIA 3AL5A 1JY2O 4BK4A 3NJZA 2PLV2 4M3LA 4Y20A 1N7SC 2JE9A 4IV3C 3NFQA 4QXCA 1HIXA 1L0ND 1VQ7P 3BCCG 5K0UC 1RL3A 1N1YA 3PMSA 5F8PA 1WMKA 3JSVC 1KGYA 2VZRA 2Q0AA 1Y9GA 4LLOA 3RSJA 5FOBB 1UF2C 4OHWA 1QJFA 3BTYA 1GU3A 3MIHA 1AR73 3AKQA 2KLUA 4HZFA 1OKQA 1RC6A 1JU4A 4L73A 4HPKB 1R081 2AACA 3RNSA 2IYPA 4K3UA 1W3VA 2M5AA 4KG8A 1B09A 1FZFA 1POV1 2AEYA 5BNPB 3SWKA 1VBA1 3G6JB 2J1AA 1G2CB 5A3MA 5IVEA 1JZ2A 3MLKA 4UF0B 1M7LA 3T2TA 1VBA3 3VBHB 1BEV3 3IDEA 4GMP3 1XNKA 1G2CA 1FZCC 1QMJA 4H44D 3MIGA 1R083 3A7OA 1NAEA 2R3CA 4JV4A 5DJTB 1NKZB 2EIDA 1KD1Q 4LK7A 1VQ5P 4Y5TA 1PIXA 2E76C 3L70G 4K20A 2Q4SA 3NV1A 4WM7A 5APVA 4N43C 4F3JA 1PGL1 1MFTA 1DEBA 4HKOA 4WV8A 1G7YA 4D6TE 1REDA 2AZ5A 1OSGA 2VMIA 4Y1YA 3HQRA 4QPWA 1WT6A 1ENRA 2P3YA 3BODA 4XDPA 2FMYA 1NTZJ 4IFMA 3IPVA 1SQVE 3S30A 2GC1A 1SQXK 2QQPA 1RUE1 4FP2A 1Q90D 1PPJG 2ZEYA 4IESA 3NW4A 3KF3A 3POWA 1SPPA 1S0GA 4V2VA 1R1A1 1Z56A 3WR0A 1UIIA 2QSIA 4EE2A 5IHRA 5CCGC 2W39A 1W8FA 3J9SA 4P14A 5A3LA 1HV0A 2E7TA 4KWJA 4LEJA 3MLJA 1WZXA 1HXS1 3P3NA 4CDXC 2PN5A 3KHCA 2DF7A 1X9TA 4GKYA 4RR3B 2FYUD 1AVYA 2A71A 1WW7A 1CW5A 2CSGA 5FY9A 3SCHA 3WP6A 1OZHA 5I0RA 3WDUA 2IVIB 2TNFA 3C1LA 1REFA 3NL1A 5APWA 4BLJA 3AEDC 4C0HA 3BN6A 2E43A 4YPCA 5D21A 2OZ6A 3ZDVA 3SHRA 2ZJSE 2E26A 4M3CA 1ZRTE 1YQCA 4Q4W2 3KQGA 5DUVA 3AMQA 3RI8A 4PIZA 1K42A 4FQ4A 5KHHA 3JCUH 2WNUA 2GP3A 5A3NA 4YGCA 3WQBA 4C8DA 3LQCA 1LEDA 2W1UA 3L72J 3L75G 2PXJA 2YUEA 4QU2A 2VQTA 1IS6A 4ZZ8A 5CBNA 2D5HA 5AVYB 1STMA 3E5XA 3GMAA 2BDRA 2NPIA 2PP6A 4RS5A 4HH2A 5DPNA 1CZTA 3WG4A 3MIFA 4OMDA 2LRPA 1KEXA 1EPZA 5A7WB 3WF4A 5ACA2 2D3RA 4FFGA 3VZLA 1TME1 3EXUA 2DYCA 3AMHA 1NVOA 1G9FA 2RS13 3AP6A 3FE5A 4PI2A 2J59M 1VRH2 1JU3A 5FZIA 1GZWA 2IPPA 3MF6A 3V2RA 2ZX4A 2ZTNA 1O5UA 2ZMNA 5JOZA 1RUJ2 3CD6P 3SWYA 4Z82A 4CUBA 3CQOA 3HWJA 3TNUA 3K46A 5F5AA 1IJDB 1M56D 1QLED 4C7RA 4DOJA 2LTNA 5IT6A 5JZGA 5GLTA 1BJQA 3AFKA 3BRTB 2LKMA 1ND2C 4EWDA 1E57A 4H55A 4K1ZA 3I3EA 3C7OA 3H1JD 5B5EE 4UXAA 3URFA 2HEWF 1YJ9P 1YFXA 2RDNA 4GB31 4Q4X2 5GZFA 5L7OB 1YFWA 2HBTA 2Q5UA 2KS1B 2A6ZA 1NTZG 3ST7A 2XUEA 3H8OA 2D7FA 1SLCA 3AZVA 1OT5A 3OPTA 4OI4A 1ULEA 4CCOA 1RUH1 4H3WA 3HUSC 5AW6B 1L0LE 4Q1PA 2WPSA 2JDUA 2ZYGA 2IXJA 4Q29A 4XXAA 4CEWB 5HBAA 3MTUE 1IFDA 1VF5C 1NJIQ 1ENSA 1S2KA 1HB1A 1GWMA 1V6LA 2ET1A 4GKXA 1PGW2 4HVQA 2IVJA 4BYYA 4PJ0E 1E5IA 3IWZA 1GQGA 3QH9A 4ITCA 3E6CC 4PJ0H 4DXSA 5KLVJ 2QQIA 3NV3A 4KWLA 2DDUA 2Y9ZA 1YIJP 1ZZ7A 3KZIH 3VD5A 3GHNA 3P1IA 1W6MA 4ASLA 4CCNA 3Q1MA 5KHIA 2YO2A 1HRV1 1KORA 1PMJX 3SSUA 1W5CE 2RS33 4HKZH 4O9GA 4YW5A 4BWNA 4YFZA 3ZXKA 2WFF2 5AVQB 1KD7A 4DQAA 4IDZA 1H8TB 1Q56A 1GP6A 5H2FE 3Q9OA 3PNAA 2M8RA 3V2NA 2QVAA 1FU1A 1AR82 4OGQC 1QJEA 2OPWA 2WO7A 1W2EA 2V5DA 1IQDC 5KHJA 2KR2A 2A45I 1O3RA 2VE1A 4GA9A 1M06G 4CP0A 2BVVA 1OF3A 2IUWA 3U1AA 4DUVA 2JIJA 2LXBA 5BVZA 4A41A 4YARA 4J25A 1JCDA 3H1IJ 1NZIA 2RS53 2X5IB 4Y4RA 4GIFA 4XFAA 1XNAA 5L7OC 2M0BA 1COV1 2KS1A 3GZUC 4LORA 3RPQA 4AEMA 5LY2A 3MP7B 4FBFA 5CFCC 1GU4A 4P9JA 1V9U2 2RM22 1ODNA 3I2KA 3USSA 3G7DA 5K0UA 4UB8H 2WWWA 2WTYA 3VUOA 3VBRB 1W0PA 1KITA 1NT0A 3VBHC 4JDNA 3P6BA 3ASIA 1OOPB 2KB7P 2OA2A 1ZBA1 3VBRA 2QJKB 4NPFX 1AX0A 1AL21 1KN7A 2WZ8A 2K9ZA 5DAXA 1A6CA 4FAGA 4IL6X 2SBAA 4P9YA 4ZKUA 3VBOB 4QMAA 3IFMA 1OQEA 2ILMA 2P4EA 4IEYA 2K3RA 1ZM1A 1MZ6A 1O4TA 1GL2D 3ZIXA 4D0QA 1PIV3 4XFHA 2K46A 1COV3 4DRRA 3LWCA 2R32A 1VMHA 1SEFA 1SLIA 3BPSA 5E89A 1VQOP 5C3SA 2QA4P 1PP9J 4IFDK 1JEKA 2JX9A 2DV9A 1Z7S2 4CRQA 3M3EA 2YY1A 2VZVA 4META 1GFF2 1UO9A 4YZ4A 2AH2A 3AE3C 3CJIB 2VMDA 1YLLA 2M5AB 3NVCA 2W9XA 3L72D 3M9QA 1S72P 2WRAA 4DXRA 3L36A 1SQ4A 4XJ9A 1N3OA 4BIOA 5IVFA 3RZKA 1QVFO 4LBQB 3OGRA 4OHXA 5CIRA 3GBGA 4CP9A 1YWKA 4ISRA 5IK8A 2R44A 2YMKA 5FZFA 4CP9B 1AYM3 1LU1A 5AVVB 1GD2E 1XE7A 2ZXQA 1PZ7A 5DUXA 1UWWA 3IZOA 3RZJA 2VCMA 1VBE2 3D6ZA 1T6BX 4MHUA 5FUIA 1OI6A 2GA1A 3N7NA 2O0OA 1DCSA 3VL8A 2ZYDA 3CF6E 3J7MA 5KC5A 2OW4A 2ZVNB 2GMPA 3KCCA 1HN1A 5LA1A 4RL7A 1RB8G 5KXBA 5JPMB 3P8CD 3OYWB 4C7NA 1HJFA 1SFCC 4YXWH 2WO2A 3ZR6A 2GUSA 4AGGA 4H0LD 1H8VA 1QJY2 1SZBA 2RJKA 3B5LB 5A7OA 2E53A 2ZJCA 5BNOB 2BPA2 4A7KA 5AVUB 5JXGA 1X8MA 3AMPA 4GAZA 2PYTA 1ULOA 5DN2A 1KILB 1OFCX 4HK9A 4CTEA 1HLCA 4HOOA 2WNUC 3KWVA 5CKNA 1T3JA 2EXKA 4XJAA 2XNXA 4AYCA 1VQKP 1YCIA 4HBNA 4JRLA 3CZJA 2JDPA 2FDHA 4BH9A 3K4AA 4ZU4A 1WMEA 4K9SA 4D6TJ 3ACGA 4P9LA 4COUA 1GK4A 2YKPA 4UFHA 4D6TD 2BFUL 3VD4A 4A44A 4OUMA 3MUDA 5KJ7C 4XHXA 4CDQB 3T4VA 5FZDA 5LW9A 3S5AA 1DDLA 2Z4EA 1G1IA 4PLNA 4CDUC 1UX7A 4OMCA 3MUZ1 1F2NA 3AVSA 4W8JA 3P8MC 5FLHA 1IGOA 3CCLP 4TWTA 2B4KA 3I2OA 1G9CA 1IZNB 1OBNA 2WS92 3TB0A 5T3NA 3LIGA 4OHZA 1SP4A 1QQP2 2N9BA 3PU8A 2BJSA 2W87A 3VV1A 1CD3G 3RVHA 3TBDA 4E2GA 2HYKA 2VBDA 1LTGC 2V7QH 4R4XA 2EXIA 5JLVA 1NTKJ 3TEWA 3IM0A 5AW7B 2RS52 3P5BA 4JCKA 2JEMA 1UY0A 3CL1A 1RUI3 2K0GA 1MVQA 2DURA 2AGSA 4PLOA 3FX3A 5FZ3A 4PBOA 3CX5D 1VAVA 4NE9A 1VQPP 1GZWB 3N7JA 2DCTA 4NHXA 3PP5A 5KAFE 1NA1A 3IDCB 3ZMOA 1YJNP 4O9BA 4GDOA 1GBGA 2PTMA 2PELA 1OPOA 1SQPJ 3I2DA 2P3KA 3LSEA 3WUUA 4R9BA 3JU9A 2VUAA 4Q0QA 1QXPA 3ZFEB 5BUVA 1Q82Q 1GK6A 5B2GB 5FWJA 2WFF1 2XR4A 1HXS3 1JYNA 4TT3H 1XPWA 3D4KA 4NPLA 4YGBA 3WUCA 2KLVA 1DIWA 4YPJA 2D2CC 3WZ1A 4DFSA 4IEQA 4I3PA 5JOYA 4QQ2A 3V0AB 3KQ4B 3GHGC 2VVFA 2JG8C 3BYWA 1S2BA 4P9XA 3VZKA 3P32A 4NPEA 3ZYFA 1NTMK 3ITKA 3G6EP 4UW6A 1YQ2A 1ZZ9A 4XF9A 5EZWA 1RUE3 3THDA 4B4QA 1J1EB 5I93A 2XXZA 3THTA 4ATEA 4W7ZA 3CL3D 2VMCA 2PHRA 3TRSB 3ZFFC 4FTBA 1RJ8A 1UD1A 1PO13 4OH8B 1RE3A 2HWE3 2VZUA 5DDJ3 1BDCA 2VPVA 1ND3C 3SCFA 2CAUA 2NMNA 1LTAC 5A7PA 3CXHI 3K75B 1DZTA 4WY4A 3O1SA 1LJ2A 1BZWA 1HN0A 2HEVF 1DQ4A 4RFT0 1NGMB 3RL0g 2C4XA 3WF3A 3BTXA 1C1LA 5IVVA 5GLUA 4XZPA 1BEV1 1RF1A 4PT6A 1URQD 4K3AA 3I59A 4BCUA 4OCTA 4N78E 2X29A 3O1TA 1LR5A 3HEIA 2JG8A 2FQPA 5JR7B 5C4WB 3O1PA 1JOCA 4JX0A 1WD4A 1Y7BA 2VQAA 4XJUA 1J3QA 2G9ZA 2YHJA 2KYVA 1H4GA 1ZA7A 1AR71 1AZDA 2XNDH 4XBQA 1CSBA 1FOSF 2D93A 3HN3A 2O14A 2NPSA 2A3YA 1LGBA 3A7QA 5KKZC 1AV1A 2JKXA 3I2FA 1FXZA 3H1ID 1PNFA 1RHI1 1PZ8A 2PHWA 1JUHA 4XFGA 4CU8A 1LT1A 3DV8A 2OPKA 1AR72 1AFOA 3WUDA 1JYIA 3AZWA 4GKGA 1A02F 1GR3A 1W2BO 2H0BA 1OHFA 3BPZA 4X6QB 1E5RA 3AE6C 2UY9A 4Q4X1 3WNOA 3N9OA 5A33B 1PMHX 3M3QA 3KV9A 2K88A 1Q7YQ 1VRH3 1ALYA 4MLOA 1UZ0A 5I0SA 3UGHA 2CWMA 3CCEP 2E74C 2BBVA 2FD8A 3LA2A 2OARA 1ZW0A 1V0AA 3CMGA 3POEA 3FGAD 3D0SA 4AFDA 1QGKB 4H7MA 1WCKA 2NPSC 4XJZA 5KLVD 1UZYA 2W6AA 5FZ1A 2KXPB 4IOIH 5AVXB 3S9OA 1C4RA 2A6VA 1JY3P 2DTWA 3PIGA 4PQQA 4Q0SA 3VHRA 3VGIA 3W9AA 3L73J 5AFBA 3CO2A 1UY2A 4NJ4A 2Q6QA 4R4MA 2BFUS 2X8KA 2WAAA 4UFJA 5FMDA 5JVVA 1ND3A 4X8NA 3VN0A 4GH4A 3WNPA 3AEBC 3B93A 5JSRA 3OGSA 4KQ7A 2PLV3 4O9EA 4C1XA 4BIFA 2E74B 1BCCE 2GC3A 3T08A 2XWJB 1GOGA 2HWC3 2YPJA 5FYYA 1VBB2 3ZN6A 1J1LA 3D6EA 2IZ0A 5JXHA 2E9QA 2QM7A 4CE8A 1U12A 4ES8A 4JC1A 2KA3A 2XLAA 4NIAA 2H7HA 3L70E 2O3JA 2W83C 1HB4A 2Z5HA 4PV1C 2O01J 1TE1B 3EHKA 1C57A 1W6OB 3NNFA 3OGGA 2XLGA 3WP4A 4AWDA 4EWAA 1RXFA 3PRJA 2WZ7A 1AX1A 1ZX5A 2CWSA 1LT9B 5FAXA 3VBFA 4GALA 2D6KA 4JZRA 4D8MA 5C6CA 1RJ7A 3LDBA 2R0FA 4YVSB 1KYOD 3ZVXA 2OS2A 4EYUA 4I7ZB 3TOJA 1T6AA 1RIRA 2ARXA 1IPKA 1D0GA 2W91A 3Q5PA 4FPHA 4YW2A 2XKOA 1JYVA 5L9RA 1MV8A 3QH7A 4XQWA 2K37A 1DBNA 5FYIA 1SS1A 1HUCA 2BRTA 2QJYC 4LOSA 1RYYA 2A6YA 3J7HA 3M9BA 1USDA 1ULCA 4UYBA 4E4ZA 3A0NA 1C1FA 1PX4A 3OA7A 3VBUC 5CA6A 2JO1A 3TEXA 2QBXA 3U75A 2RDQA 1SQXE 2KZIA 3MD0A 1JOJA 1M1JB 1J2JB 2VXJA 4JDOA 1BDDA 4XPVA 2P2KA 5CG8A 4YWAA 3WDXA 2EVXA 1ZYBA 4R8HA 2X5IA 4WB4A 1OVPA 1RVF3 5FZMA 2QIWA 1O4ZA 4BISA 5F2WA 2ETEA 1CI6B 5AVTB 3LW5H 2B8MA 5GZEA 4BQXA 2HBUA 3PLQA 1W28A 1XJAA 4OQ8A 3NJVA 3H8RA 2CTVA 2K9JB 3IAOA 1CJDA 2PHTA 1YFYA 1QNYA 4IXLA 3MEPA 1CGPA 5I8SA 3ZKUA 2B42B 1OUXA 2L9LA 2XHKA 3I7DA 1YJLA 4ZONA 2Q3IA 1ZRDA 1SVFA 2GP5A 2E75B 4QXHA 5KHKA 2H6BA 2IZ1A 1DX7A 3SITA 3B5NC 1RQVA 4EDFA 3CI9A 3R4SA 3VDDC 1XTCC 4HG6B 3S5QA 3WQ7A 1Y8AA 4D6SA 1D2QA 4PIXA 1MACA 3K3NA 1R5LA 1DQ6A 1QEXA 1QF3A 4FAHA 3AKSA 1BHGA 2ZS6B 1UXXX 4H14A 5CZKA 3ETPA 5KBFA 3O0WA 3ZYRA 5LWBA 2PFXA 3CWBD 2I1JA 1FAVA 1E5HA 3I3BA 5M0TA 3WUVA 3MV11 5IJRA 3TEYA 1LAJA 1K5MB 2DFBA 4L97A 4MOAA 4E4HA 4N43B 1NTKE 4QQPA 1H1MA 1YI9A 4KI5M 1YQ5A 3GXUA 1YTZI 2C9KA 3KB5A 2XJPA 3FHAA 3PL0A 2QQUA 5F5QA 2OQ7A 5FP7A 1AR63 4UFKA 1YQ8A 5JXIA 3Q5RA 3BI3A 1PGJA 3RBXA 3HTKA 4W80A 2ES3A 2ZEXA 1YYCA 2VBPA 4PJYA 3MICA 3GF7A 3DF0A 1DQ1A 3KT1A 1B35A 3WW2A 3AEEC 1S55A 5JOXA 1ZA4A 1P84H 2BGPA 2G3AA 4NAMA 3BU0A 1OQDA 2WO1A 2C6SA 4HSJA 1D7MA 3SH4A 5CG9A 1Q8OA 1GQHA 5EYXA 2QJPC 1RUJ3 4GMP0 2VZOA 1MQTC 1RF1C 1ENXA 3M3CA 3BUCA 2CDPA 2RE9A 3CWBG 1AQ5A 1R091 4QB1A 2KIKA 2JDHA 4QX0A 3H1KG 5FJHA 1SQBJ 1X9VA 2XDJA 2ARCA 2C5DA 3M06A 1JMBA 3K5BA 1GZTA 3RK3E 1ZV8A 2WYSA 2X5IC 5BNQA 5DMYA 5A3UA 5LZ6A 4PDWB 2PQSA 4AEKA 1NYWA 5FZ4A 1VAKA 1NO4A 3L70D 1L0LD 1ACCA 1MEC3 1TU3F 1UYPA 1CAUB 2Y6GA 3MPBA 2HWC1 3POGA 5EJ3A 1PGW1 4CU9A 1ZRFA 2FXPA 1HB2A 4MHRA 5GTIE 4IE0A 4LKSA 4A3ZA 4AAPA 1LGNA 3OG2A 5GTIH 4RR3C 3NNGA 5FMOL 3C2UA 5GLZA 1YI2P 2IC1A 4SBVA 3LSDA 4P00B 5EWSA 1NCQC 1UU6A 1K12A 2ZOEB 2WAOA 2Q3EA 2YBSA 1AR91 1HQNA 1CIYA 3DYMA 1LOBA 3NSTA 5CFDB 4BMBA 4UBHA 1WBLA 3ME2A 4KGGA 4NR1A 4CCJA 4XXPA 2DW3A 3VDDB 3E1RA 3MI8A 2DBIA 2NRGA 1VALA 1K3IA 2AUYA 1TMF2 3NAPC 4HONA 2K2SA 2QZ2A 3C3VA 3ACLA 5L36A 3CU7A 1GUIA 1EUTA 4TZDA 3ACIA 2PAJA 3ELNA 3VBHA 2QFEA 2QQNA 5KC6A 2E42A 1LGCA 2EF6A 3FHIB 4MXWA 1RHZB 4XFBA 3ZXGA 3N4MA 4M00A 1FOD2 4NPRA 1UW8A 3N7MA 3GG2A 4FPGA 3TGUJ 2WITA 1VRH1 3AXEA 3GBFA 4EIJA 1I1EA 2ZX1A 5B4XA 2FCUA 3I8TA 3ZKYA 1DF0A 5J96B 1Q2NA 4M0NA 4QXKA 4URAA 4M3CE 2JKBA 4I0AA 4LBJA 2YKOA 3O0VA 4RQPA 2G1MA 3T1LA 2DCZA 1RHI3 2JE7A 5BU8B 3FLRA 3K2OA 4QGLA 2Y33A 3NRUA 1POQA 1W2AX 3SISA 1G9BA 4UI9L 5J37A 1GU5A 2E74D 3POIA 5FZOA 2UWCA 1RUC2 3MLLA 4KT0J 2VC9A 4COWA 3KPEA 1AHSA 4AVVA 1IKQA 3V6IA 5T5LA 4L92A 2Q1ZB 4OI1A 4HYTB 3M0DC 4P02B 1S5LH 1UKGA 1RUD1 2W08A 2XGXA 3GNEA 3GZTB 1QH7A 5A6YA 2WSEJ 2I45A 3V0BB 4CUGA 5A1FA 2NP0A 1VL2A 4GWJA 1LT9C 1NU1G 2GNTA 2HWB1 5H2FH 4QPIB 1APNA 1UY1A 1AXYA 2RHPA 1ASJ3 3AL6A 2HKXA 4XUQA 1W04A 4FXKB 4LO8A 3ZSMA 1QL1A 1URQB 3ZN6B 5FZHA 2R6QA 5L7OA 2HWF2 2PA7A 1SQXG 2WNUB 5K5GB 1S4CA 5CB7A 2K1AA 3JCUE 4LGDE 2GN7A 2KNCA 3II6A 3L72E 1QDCA 4XABA 2QVSB 3L71J 1W9SA 4RHV1 1YXWA 4XFCA 5FZ0A 5H9RA 4AI3A 5HV0A 2VECA 4XUPA 3WDWA 5FUNA 4LUMA 4LA3A 5AW4B 1P8JA 3BALA 5APTA 3IKWA 1WMXA 3D70A 5FCCA 4L11A 3LGRA 3THCA 3EWKA 1UYXA 2MPFA 4KU7A 1VQ8P 1H6YA 4BRYA 1N1SA 4XOGA 4Y1ZA 3VDAA 3V4WA 3B7MA 3VKFC 2FYUG 4AG4A 3J8F2 2Y6JA 4IE7A 4DIQA 5BV6A 5DAQA 3O1UA 3K77A 2KP8A 4DZGA 1PFIA 3T2PA 2ZAAA 3VKMA 1VBE1 2D44A 2MNGA 3WEZA 3SWFA 5FBJA 1JYXA 5F3IA 3JBG1 4F8AA 4Y1XA 3JBG3 4EQVA 3C8VA 3J4UH 5B66E 3E6DA 1DD3A 1D0HA 1W90A 1VBE3 2P67A 2UY8A 2WS93 3DYOA 4IUGA 4OZOA 2VUJA 5F32A 1DYPA 2WABA 2N1TC 3AC0A 3P8CE 3LA7A 3WUTA 4CDWA 4KNCA 1FI2A 2R043 5JCTA 1NOHA 3TNUB 4AQRD 1K5JA 1S0JA 2B9UA 2ZGMA 3P3PA 3CCRP 1N73B 4OZXA 4J6GA 4IEUA 4Y24A 4YVWA 5FZ8A 4MN4C 2KUBA 3L75D 1QJU1 1KYOI 1O8PA 3LPFA 4C91A 3I49A 1F4HA 4RHV3 2EAAA 2HWB2 1LOAA 4QM9A 3ILFA 4Q0PA 3WHTA 3AP5A 1VF5B 2FZ1A 1X79B 1BQPA 1AJKA 1OVSA 2LS6A 3OY8B 2FCTA 3QD6A 3GALA 2W95A 3H3ZA 1Q86Q 3JQWA 4W6XA 4IERA 3VZNA 1ASJ1 2WPRA 1MZEA 1IFPA 1GMMA 3MBWA 4ASKA 1DH3A 3WMM0 3WQ0A 4COVA 3L2HA 3EFFK 3DXTA 4XCAA 1ZZ6A 4EN9B 1FNYA 2QJPB 1VBC2 4U2AA 1VLNA 4DOUA 1V00A 4BQ4A 3QH6A 4ORFA 3K51A 4BOWA 5IVYA 4YZ1A 4KBBA 4LMFA 2MKVA 3FBMA 2GNDA 1W6NB 2DCYA 1MZFA 4WVZA 1PK6C 2WZR2 2ZGTA 1UX6A 1XYOA 1URQC 3NXSA 3FZ3A 4QX8A 3VZMA 3EQ2A 1LHOA 4YG3A 1MPXA 1S3JA 2CY6A 3B9IA 1YJWP 1I6XA 2ZBJA 4OUEA 1OOPC 5FYUA 1QJY1 3WG3A 3WW1A 2OYIC 2WC2A 2Y6KA 2ZZJA 1IZ3A 3WDYA 3WP3A 4CUCA 2BZDA 3H1LD 1XU1A 1ND3B 2J22A 1H8TA 3OUHA 4MX3A 3RZMA 1VBD2 1NTMJ 4RSUA 4PF5A 2I07B 2O1KA 1AF9A 1Y4WA 3OPWA 4ARYA 3IF4A 3R05A 1JZ8A 1RUOA 1DQ2A 3Q8CA 3PLNA 1LWUA 4YM1A 3PTRB 3H7YA 4IQPA 1HF9A 3B9CA 5T55A 4AHWA 1K45A 1DQ0A 2WLQA 5APXA 3ZXDA 2HH9A 3GJAA 2IXHA 2ZT9C 4AXOA 3M3IA 4Q2FA 4Y1UA 2P37A 3BTAA 3SLIA 1PO21 4DUXA 1JZ5A 1SBDA 2ITAA 2Z69A 4NIHA 4AI0A 1H2MA 3RZLA 3E97A 1LGHB 5IYYA 1QL2A 5IAXA 3O0XA 1UOJA 3D6YA 2FYZA 1W6PB 3ZIWA 4D7YA 1BBT1 3C7FA 4PHZA 5A70A 1LESA 2EXJA 2M3BA 2YXRB 3G4SP 2G19A 2ZEWA 3H1LJ 3ILRA 4QX5A 4W65A 1SQBG 2ADEA 3LPGA 1RF0C 3V4QA 1GANA 1OURA 3I4IA 4I01A 3HT2A 3PUSA 3N9LA 4HVRA 4A42A 1PV3A 5JZGC 3A4UA 4LBOA 4YLZA 3V65A 3HNYM 1SQXJ 1Q8QA 1JM0A 3KV4A 1V6IA 2JDZA 3N9PA 1C5HA 4HKLA 4LE3A 5DDJ2 2C9NY 2RMZA 5C3RA 4DJGA 5LRSA 3POYA 2B46X 2W8ZA 1PZQA 1RQUA 5FP8A 1ZRCA 2Q9IA 1W2TA 1PIV1 2IBZI 3ALQA 3FC0A 3ZSEA 1W0OA 4IEVA 1EDKA 4UF0A 1W8HA 4CDUB 3UV9A 4RN5A 1R093 3ILNA 4Q0UA 4XFFA 2VZ1A 2RJLA 5GZDA 2VZPA 3HQXA 4QHZA 2ZHLA 3ZSKA 1W0NA 2WN3A 2BEZF 2X53S 2C26A 3QACA 4XURA 4BQWA 4Z8BA 4G9SB 5I91A 5K9YA 1VB4A 4CDQC 1SQPG 2EALA 2FHRA 5C70A 2OYOA 2Q1KA 3FL7A 4OI2A 5T5JA 2VOVA 3EB7A 4ASVA 2XJTA 3ZYIB 3AE7C 1ZBA3 1OQ1A 2BBAA 1VAMA 1TME2 2CL2A 2N9YB 3QLQA 4FPEA 1SFPA 4WM8C 1IC2A 3A0HH 3K48A 4QX2A 4LQRA 3ZXJA 1VBB3 1W2OA 1URXA 3POSA 5C7GA 4FTSA 1AR61 4PDWA 3BTZA 1F9KA 1QJX2 3HVDA 1GLHA 4NWVA 4QX3A 4LO5B 5C5TA 1K5MA 4M3CF 3OYWA 5CYYA 3GM8A 3VOPA 4FI9A 4Y33A 4LBMA 4CVUA 3A3YB 1LOGA 2RG4A 1Y3TA 1KFMA 3DL3A 3MUY1 2B45X 5JAXA 1FT9A 3CCVP 3WVJA 3GCWA 1JTZX 2XJUA 3OCPA 1XNBA 2BTVC 5KTBA 5CFDA 2D6LX 1S0IA 3SH3A 1OIPA 3F89A 1HB3A 4QT6A 2WZEA 3APBA 2RS31 2QKDA 4YRDA 1WD3A 1B35B 5GLVA 3T09A 1HRV3 1BGYE 3CCUP 2XB6C 4R9AA 3DPRA 3AYEA 4XMAA 1S0DA 3PHMA 4E4DX 2A6WA 1JZ7A 5CNAA 2WL1A 1QIQA 2E6VA 1HV1A 5FZ7A 1EDLA 3USUA 4P9IA 5J48A 1QOSA 1RUF2 2VVDA 5KHGA 5KLVE 1T2KC 5FY4A 5AW1B 2O01N 3N7LA 1RVF1 2DVFA 3L35A 1LOFA 2QQOA 1FZCA 3AJYA 1NTMG 2OGUA 4QD2A 4BXFA 2BCCJ 3ACFA 4GB33 3VYIA 3AKPA 5A7WA 4XHBA 2VD7A 1I5ZA 2DUOA 2FDIA 1SFCA 2Z42A 1YO8A 1TMF3 5EHDA 5JIUA 3CXHE 1VBA2 5J3UA 3CCSP 3ZYGA 2UU8A 2VVEA 3LFIA 3U14A 2ZZQA 5A3TA 1ZVFA 5F39A 5FREA 4EROA 2GSYA 4BQYA 2YDEA 3O6QA 1WMFA 3WF0A 1FS0E 1TNFA 1KILD 2FFDC 2VUDA 5JI7A 3CX5E 4H44C 5DAWA 1W8UA 2YG0A 2N1TD 2RS11 1LP1A 3RYKA 3T2QA 4GH4C 1HQWA 3CBNA 3ZFEA 4CCMA 1AVOA 1DQ5A 1WLCA 4MXWB 4DY5A 5AFEA 1CZQA 3L73G 5IW0A 2D6PA 3OTFA 4LO4B 5A7SA 5LBCA 5DUWA 4FCAA 2VMFA 2WSFJ 1NTMD 2YNYA 1AXKA 4LLFA 2D3PA 2GZWA 2MEV2 2KSJA 3MHZA 1MZ5A 3CCMP 5CVRA 3ZFFB 4H13B 4R9DA 2XZRA 2RS12 5LATA 3O1RA 3NQHA 3KCYA 3CJXA 4UFMA 2V7QJ 4XZUG 3ZPOA 5A33A 4AVBA 4XBNA 2JG9A 2WR9A 4AI8A 5JPNB 3H1IG 2PLV1 3CIHA 1S2EA 3RK3C 4QKDA 5CADA 4WY4B 4LHNA 3DUIA 1R082 3B02A 4J1XA 4KWKA 3VBFC 3R6SA 4Q0VA 4Z1VA 3TGUE 4QU1A 4QXBA 1RUNA 4N7IA 3EQEA 1DU3D 1E5SA 1XQNA 5FLIA 2OQQA 4XFJA 3G71P 4CU7A 1MS8A 2RN0A 1NH4A 1A8MA 2WNEA 2ZGUA 1IO4A 3ZSJA 4D6RA 3RGUA 4GOFA 2IXIA 1OF4A 3M9HA 4QPYA 5FKBA 2P1BA 3VL9A 4LBQD 4RR3A 5K4LA 3DKQA 2A73B 2OT7A 1L0LJ 3H1JG 1SHWB 3H3LA 1DHKB 5C8WA 5CCHC 3PUQA 4RS5C 1HQLA 2CPBA 1U5IA 1SBEA 3R4YA 5FMCA 1FZEA 4XFIA 5I0UA 3RK3B 1MEC2 4AEDA 3CC4P 1NTZD 2HODA 1C5IA 3AP4A 3OW2O 1EV11 2W1WA 2Y60A 3MGUA 2VR4A 4H2AA 4BK5A 1QQP1 3W68A 1SQQJ 4FOWA 3VZJA 2HODB 4I6MC 4EN8B 5EIYB 2W1QA 5CJ4A 2P6CA 5F3GA 3SH5A 5I8TA 2NPSB 1UOGA 1PO22 5JUVA 1NLQA 1JW6A 1XC6A 4YYOA 3U07A 3A22A 4TLGA 3WP5A 3I55P 1OH4A 2YXSA 4AW7A 4CEYB 1DD4A 3PURA 3FBYA 5EPAA 2QJKC 2E31A 3OY8A 1YBKA 1AJYA 4JBZA 1V6KA 3DGTA 1SFYA 3B01A 1MS5A 1GWKA 3VBFB 5FZBA 3U4SA 2V73A 4INDA 5AVZB 2FFDB 1AQTA 3CMEP 1FDMA 1SQBE 5AVWB 1ENQA 2A3WA 2IXCA 2KD7A 2WWSA 4XUNA 3U78A 3RZHA 3U1CA 3ZOIA 4NHLA 4AZZA 5A6ZA 3LZZA 2NPSD 4GMP1 4XTMA 2VAUA 2A45G 1HWTC 4ZXEA 4Q4Y2 3PH0A 4HK8A 3OD4A 2WNVB 4CDWB 1VQNP 3KYQA 1W03A 3H32B 1VQMP 2VTXA 1JY3N 4MSVA 2AEJA 3B5ND 1L0NK 2DU1A 4JRAA 4NVPA 5DG2A 5CKQA 4AL9A 1AX2A 2KK7A 3KXDA 3HJRA 1MUUA 5KLIB 3KDPB 5DDJ1 1EDJA 5BPXA 5SV5A 1PO11 3CEWA 3RFRA 3TF5A 3JXSA 1REEA 4B1MA 1Y9BA 5APSA 2LALA 5FYHA 2VGDA 4IL6E 1H0TA 2AEMA 2N1TB 2XG3A 3RGBA 5G04L 4H0LB 1OH3A 4M01A 2ZHKA 1B35C 1CAWB 5TJHA 3B00A 3CC7P 4XCBA 1Q8PA 4KH9A 4OWFA 2RS32 3KS7A 4I0BA 5ANQA 4DY3A 2WKKA 3ZFGC 2A7AA 3L74G 2QQLA 1RXGA 3M4FA 2WFF3 4HFSA 4LBKA 2MHFA 2A75A 2JWDA 4B4RA 1IG3A 2CV6A 1ULFA 4XILA 3LEKA 3LEIA 1LCLA 2G9FA 4FPKA 1PGSA 2ZGSA 1U5XA 1IK9A 4Z07A 1T2XA 3TN91 3B3QE 1MFZA 2FDGA 5F9TA 1RUF1 1KYOE 2Y8KA 1BBT2 5F1RA 1OLQA 1RY3A 1YC61 3GW6A 2Y34A 3KVAA 2E75D 3RMYA 3WF2A 3KV5A 4BMEA 3C7EA 4CDXA 2FKWB 3FXEA 1CAVA 2WINB 3U59A 3JD71 5AW2B 4CCCA 1EDIA 2R49A 1VIWB 1Z0HA 1MR5A 3NJYA 5FQ0A 2VQUA 1N73A 4YVWB 3KMHA 4A4AA 5EQUA 2JD4A 1H0BA 4HVOA 4QKFA 2HWD1 2D3SA 3B69A 4IETA 5D8AB 3RWNA 3ZFGA 1W8TA 1Q8VA 2YYOA 4AQ2A 1ULGA 2VO5A 3L2YA 5A6QA 1M4WA 1JUIA 1OPMA 2WSFH 2FBWC 3JBG2 2CGPA 3M3OA 4CDUA 1GL2A 3AXDA 4K8RB 3T4HB 2IBZE 2HLOA 2LR2A 4Y99C 1F31A 1UCXA 1X36A 2DVBA 4NROA 4AVTA 2WNVC 3O12A 1UZVA 3DCQA 1BMV1 5APUA 3AEGC 1S5LE 2Q8EA 1RGSA 1A78A 1W8NA 2ADDA 3H7JA 4FTEA 5IVCA 1M8OB 3H1KJ 3LA3A 1XYNA 5AVRB 3OUJA 2Q30A 3CWBJ 3FJSA 3IIIA 4A6OA 5A1AA 3TK1A 2V5YA 3IN6A 2AC1A 2V09A 2ZEZA 2X09A 4XIOA 1OKOA 3FUQA 4JAAA 3L70J 5CJ0A 1EAH2 1WRGA 1OW7A 1O91A 1PM7A 3AX4A 3IBMA 4B29A 2GMMA 2IXLA 3H1KD 2KOGA 1ZBE1 1L4AA 1NWQA 2HJIA 2E51A 4RESB 3Q8AA 2R3SA 3T0AA 1ZLLA 5J1XA 1PP9G 4HSLA 1SQBD 2TBVA 4MV2A 3VBUA 4BHPA 2MJZA 3TNQA 1SLBA 3JZVA 4N43A 5FP3A 3E5UA 4YVWC 1EAH1 4PBPA 2LM3A 1BE3J 2JB8A 2VOWA 2W52A 4BA6A 4EN6B 4MGKE 4U3FG 2B87A 4H13D 1CI6A 1A8DA 3C9IA 2JG9C 3MW3A 3O1MA 1UY3A 5FYTA 1V6MA 5HCBA 2ZGLA 1BXHA 2YMZA 1W05A 1RMU1 4H7LA 3JC22 4MADA 5AC93 4AVSA 1U5ZA 2DUPA 1BVP1 2WT7B 3ZYBA 1P84E 2BQPA 4YM2A 3HD7B 3EJKA 2WT1A 3PJQA 1SLQA 5FY7A 3FMGA 1GP4A 1PHMA 2J1SA 3ABZA 3BASA 1UN1A 4MUVA 4U36A 2RVAA 5A7NA 1PL5A 3IR9A 1YITP 2W2IA 2J1UA 2VY0A 1N1VA 1UAIA 2XBO2 4N90A 4IFFA 1HH0A 1S4XA 1KQRA 4B8EA 2JG9B 2SPZA 4YW7A 1QH6A 4LO7A 2YBKA 3ACHA 2G4IA 4NIIA 1L0NJ 2JECA 2B7YA 1LODA 1FZCB 2Q8OA 4OVEA 3WV6A 4PD4H 3RK3D 4MVTA 4U3FD 2JDIH 4NHYA 1SLLA 4W7YA 1HXS2 2YU1A 4P5YA 1KQFB 1C8M3 1VBC1 1O6UA 1YQ6A 1RF1B 4SLIA 4DB5A 4AYUA 3RL0D 2XKPA 4I30A 4DXZA 1PPJD 5C4WC 1CX4A 2JDKA 2DWRA 2BW8A 3HE4A 3INAA 2OYHA 2LXCB 2WLPA 4YNIA 5EFWB 3W20A 3W59A 3O6QB 1BSNA 3AM2A 3O5SA 5ABJC 5B66H 1UL9A 4AFCA 1BGYG 1AL23 4HJGH 2JEEA 4N6JA 2ID4A 1KQLA 1KC8Q 1VBD1 4D7SA 5IK5A 2GAUA 4OYUA 1KXGA 3LF7A 4E2QA 4QGMA 3KHUA 1LKNA 1OXZA 3MW2A 4QDSA 5FR3A 4CXXA 4AQSA 1J1DC 2LUWA 3B5NA 1SBFA 1MQTA 3ECQA 4ZY9A 1KMIZ 4BU2A 3H1HD 2YGLA 4PI0A 3JQXA 2RS51 1AVBA 2WZR1 1W9YA 5A6XA 5C33A 1E79H 1SCSA 5DZFA 3RDIA 3H1LE 4BRYB 2PAKA 4AAXA 2DFCA 4IEXA 3U0ZA 1PGL2 4TN7A 3PU3A 4FP3A 2Y64A 4GD4A 2Y6HA 3ZFEC 2C24A 4AHXA 2VOTA 1H9PA 5HV4A 3VMZA 2ZT9D 5E79H 1KDMA 1LHNA 1V6OA 4AI1A 4DEQA 2BCCD 3MPPG 4HLTA 3SMHA 2QQMA 2XKMA 4EJRA 3AE5C 2B39A 4MGTA 1US2A 3OD0A 4NRMA 5AC91 4GOEA 1BCXA 5CHXA 1NX9A 1RMU3 1XRUA 4QPGA 5FP9A 3VKOA 3FWEA 4QPIA 1WLTA 4COYA 3M0AA 1GZ9A 3S1KA 3VP9A 2RR13 4OUSA 4WVMA 2Y38A 3AEAC 1TQ5A 1F8VA 5GJ6A 4UOJA 1M1JC 3K4DA 4AF9A 3V0BA 3KZ4C 1IS4A 1PO12 2W5FA 4QDQA 1LTEA 4WVMB 1HJ0A 4CDQA 5C5UA 2Q8DA 1J84A 3ORJA 2DU0A 1EAH3 2I2SA 1RUH3 2WN2A 1Y9MA 1UMZA 3DEMA 4O65A 3ZM8A 2QRXA 1WLDA 2B9BA 1PP9E 1SCRA 1SDDB 1VB2A 4MGSA 1ND2A 3AMMA 3MIWA 5FO9B 3L73D 5M1BA 4BE3A 1XNTA 3ZYJB 1ZBE3 3HBZA 2KZJA 2R062 1FMD1 3TNPB 1VQ9P 4EOTA 1XE0A 4IV1A 1QY4A 1XNDA 2CHHA 3WG1A 1CQ9A 1JHNA 1R092 2OUJA 3HR9A 4IGPA 4BPZA 1H89A 4PD4I 1W6MB 1OVRA 3HUSA 1LNQA 4H13C 5KAFH 5C71A 1ZN5A 2QEXP 1GV9A 3RZZA 3WDVA 3SEEA 4BJ0A 4QKBA 1HJBA 1W6QB 5F3CA 2Q8CA 4WY4D 1UPSA 2FMDA 1TME3 1L7LA 4ISQA 1JUNA 3KGLA 4AR2A 3H32A 1TG7A 1KYOH 3H6PA 1J3PA 3LB9A 2XJVA 4K6BA 4QX1A 3DN7A 3AZZA 3I97A 5IATA 1O8SA 3M0DA 2GN3A 1GZCA 4RKUJ 2WWJA 3DPRC 1QJX3 2FBEA 2VQ0A 3QCWA 3OOXA 4BQ3A 4LE4A 5IFPA 1AA0A 3M8LA 2IFWA 3HIFA 4WZCA 4FPYA 4B3NA 4LBLA 5A32A 4M3CB 5HXMA 3POJA 1C8NA 1MS4A 2D6OX 2VCBA 2YROA 4ZZ5A 2BASA 2YIUB 3GZEA 3ZN4A 1XSQA 1SQQE 2RMU1 5EXOA 1NLSA 1RUC1 1UNBA 3VP8A 1T8ZA 4YM3A 1K8AQ 3IDBB 1OC1A 3RJRA 1GOFA 4M0HA 1UIJA 2WVRA 1QOOA 1JTHA 3F2ZA 4Y22B 5APAA 3E7KA 5CAZA 1HDKA 2W46A 3N36A 4R4LA 1LTIC 3CKHA 5FYZA 1JXNA 1FAYA 5EYYA 5FBZA 1DZQA 1NCRC 2QZ3A 4F7ZA 2XBO1 3ITQA 4P9GA 1H2LA 4RO0A 4GJZA 1W8OA
chains in the Genus database with same CATH topology
3AK0A 4HETA 3WHUA 2PHDA 1NXD1 2ZGQA 4XEZA 4L8QA 1GNHA 2ZKNA 5HCAA 3TYJA 4Q4V2 4XIKA 3ZDSA 1WW6A 5CFDC 2R0HA 5A32B 4KG0A 5E16A 4XJ8A 1KS5A 5H9QA 3ENRA 4JQRA 2QDNA 4CYDA 2QDRA 2BWAA 1JBCA 3LAGA 5TSWA 3V64A 1Q3EA 2JENA 1H1IA 2ZHNA 5C9AA 1POV3 2ZMLA 4PDWC 2D43A 2CGOA 1G86A 1RMU2 3GYDA 2ARBA 1O3TA 1QOTA 3MYXA 1U0AA 1LOFC 4Y20B 4PQ9A 5C8CC 4CDXB 2PAEA 2CK3H 3UJOA 2CYFA 1XNCA 1MS9A 4FSJA 3CJIA 3U4XA 5BNNA 1H8TC 2ZACA 1ZBE2 3MIBA 1KFXL 1WGPA 1CONA 1EV13 4N9HA 2CNAA 5FPZA 5BXXA 1ZREA 5H9SA 2BWCA 2NZ9A 2A6XA 3KGZA 4N53C 1EYBA 3TAYA 1BMV1 1NZCA 3AKTA 2WQ4A 3OPZA 3D0JA 1KRIA 1YIPA 4YW3A 3CJIC 3RYRA 2RMU3 5FMOS 3M1HA 5GLWA 4S2FA 4ASMB 1RUG2 2B5HA 4QHBA 3PMEA 2ZGOA 1NOVA 1SMVA 2BEOA 4BQ1A 1AL0G 2IXKA 1GICA 2IWGB 5AC92 4FPLA 1HW5A 1T6GC 4Q4W3 1ZNPA 3VKLA 5ACA1 1OLRA 4YG6A 3JCIA 4NOTA 2VOKA 1NQDA 1SDWA 5F6KA 4C1WA 4LUKA 4KL1A 4UW5A 4IL7A 1EPWA 4AQTA 1ZZCA 3DPRB 4YW4A 4OHYA 4LO6B 1KDKA 3OGJA 3PVBB 1D4M2 4XTPA 1NE6A 2Z2SB 1YJKA 3HT1A 4CP1A 2WT2A 5I8YA 2R30A 3A0KA 2WIIB 1FMD3 4MYEA 2W6JH 1I3HA 4LR4A 2H6CA 5E8AA 1Q5OA 1YIFA 1CJPA 3PVOA 1WCSA 4NN0A 4YG0A 2ZX2A 4FO9A 1H2KA 5JMCA 1CVNA 4B7KA 1WA4A 2DCJA 2OUHA 4FOQA 4NO4A 1W6QA 2VOXA 4G4FA 2HWF3 4DNYA 3VDDA 2CGNA 2WSUA 5CBLA 2AENA 2FZ2A 4JGZC 3RRDA 1OA4A 2ZHMA 1WBFA 3UKNA 2PHXA 1UKRA 2OZJA 5LRRA 4JGZB 1X33A 1NCRA 2GC2A 2UWAA 4GULA 3BB6A 2HWD2 2E5YA 1RINA 3VZMA 4V1PA 5T5PA 5C8CB 3USUB 4PCRA 1QXJA 4YSFA 1KFUL 2NMOA 1QGLA 5E88A 1BEV2 1AR83 1H2NA 3VBOC 4YVSC 4Q1RA 1GYKA 3OBRA 5AVAA 1G6NA 1S0EA 4OFGA 5FO7B 4AVCA 4E27A 1XYPA 1O7FA 3KLSA 2R061 2E63A 1OMIA 3H8UA 3RI9A 4ZU7A 1BK1A 1KJLA 1FPN2 4MGYE 4CDXC 2ZGPA 1RHI2 5C4WA 4MGZE 3WT3A 5IK4A 5JZGB 2Y0IA 5FLJA 4AFBA