4WVZA

Crystal structure of artificial crosslinked thiol dioxygenase g95c variant from pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
195
structure length
195
Chain Sequence
ILRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPGQITPVHDHRVWCLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol dioxygenase
publication title Substrate and pH-Dependent Kinetic Profile of 3-Mercaptopropionate Dioxygenase from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa bwhpsa021
molecule tags Oxidoreductase
total genus 48
structure length 195
sequence length 195
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4wvzA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4wvzA02
1CAVB 4IEVA 5I8YA 3I54A 3SHRA 4BH9A 4PIYA 4IEPA 1NYWA 4YYOA 1OD5A 2N7GA 1IFPA 2OZ6A 3U0ZA 3QACA 2KXLA 1ZZ9A 3OTFA 2IXJA 4EV0A 3LA7A 2Z69A 4XF9A 5I0SA 3RYPA 1YFUA 1ZZ8A 4QM9A 5BV6A 3FWEA 1UIJA 4J1XA 4IEUA 4XF3A 1NXMA 1CGPA 4I3PA 5JAXA 2BGCA 1Y3TA 4PIXA 1QXJA 1RGSA 2WFPA 1X8EA 1O7FA 5C8WA 1DGWA 2Q4SA 3OD0A 1J3QA 3BALA 5I8SA 3OCPA 2MHFA 5I0UA 5I0TA 5BPXA 1E79H 2BNOA 3H7JA 3EHKA 1CAXA 4LA2A 5JSRA 4A2UA 4YSFA 1FS0E 2OYZA 1YUDA 2DCTA 1CX4A 3WW4A 3BPZA 3SCGA 4MGIE 4BYYA 2QJVA 4R8HA 4FBFA 3DKWA 4HSJA 1XE7A 2BNNA 3H7YA 4MH0E 2PAEA 3VHRA 2O8QA 2PTMA 4XFBA 4Q29A 2W6JH 2IXLA 3D0JA 3H1YA 1ZVFA 3S0MA 3RYKA 5E1RA 3FFQA 2PHLA 2XHKA 1QWRA 1J3RA 1YLLA 4YNIA 4IEZA 1BSNA 2WSSH 2ZKLA 4CYDA 2BYVE 3HT2A 5FLHA 3LA3A 2GC3A 4AVBA 5KBFA 3I7DA 4I0AA 4I2OA 1O3TA 4HVOA 1PM7A 2XKOA 1DZTA 3KMHA 5E16A 4BHPA 4Z82A 3EO6A 1VP6A 3U11A 4XF0A 3UKVA 1UD1A 3GYDA 1FXZA 4XF4A 4LLOA 2GC1A 2CAVA 4JTOA 5EFUA 2UYBA 5I8TA 2Y0OA 1Q43A 4KWKA 4IEQA 4N9HA 3SMHA 2IXHA 3MDPA 4I0BA 1ZZ6A 3PNAA 3E6CC 3EBRA 4LUKA 1JEKA 4HLTA 4QX5A 3DN7A 4Q0PA 2QCSB 1G6NA 2XL9A 4LA3A 1YHFA 3ES4A 2Z2SB 3L2HA 2GH2A 4NVPA 2B8MA 3MYXA 3H50A 5KHIA 1RUOA 2K0GA 1J3PA 2QDRA 2VQAA 4MX3A 4XFCA 2F4PA 2H6BA 2HJIA 4FAHA 1NZCA 5CADA 5F1RA 3ETQA 3FJSA 3KCCA 2E9QA 3E6DA 3JZVA 4JTNA 4LEJA 1EPZA 2MPFA 2XKPA 3TNPB 4XFAA 2O1QA 3KGZA 2PHDA 3M3IA 3ZDSA 3I59A 3EFFK 5FLIA 3U10A 1CAVA 5JSPA 1Q3EA 2D5HA 2GAUA 1RC6A 3IBMA 1H1MA 2OZJA 3NKTA 3SCFA 3GBFA 2XLGA 5FQ0B 3KSCA 4LTAA 2D40A 3FE5A 4AXOA 3PVBB 1CAXB 5D1IA 4PJYA 4XFIA 2C0ZA 2V09A 4I02A 3TNQA 4MGYE 2FMYA 1LB2A 1H1IA 3ELNA 3RNSA 3S7IA 2GZWA 1RTVA 4YRDA 3ES1A 3N4MA 3UKNA 5BY5A 4XF1A 3DL3A 5J3UA 2PYTA 3IIAA 4KU8A 5KHKA 1LKNA 2GU9A 1X7NA 3NSTA 3E5UA 4H7LA 1ZRCA 3ROUA 5JR7B 4WBBA 4UXAA 2E5YA 4FT8A 4KL1A 3CL1A 4META 3B02A 1XRUA 4IEYA 1IPKA 5EZWA 2H0VA 5C6CA 4E2QA 1J58A 4FAGA 1O4TA 3CO2A 1NE6A 3NL1A 4X6QB 5I0RA 1I6XA 1LRHA 4E2GA 2UY8A 1SEFA 1AQTA 2QVSB 3H1MA 2CK3H 5LRSA 2VPVA 4QGLA 3RPQA 4YARA 4MGZE 4LULA 1LR5A 2PAKA 3CEWA 2CV6A 3FX3A 1DZRA 5KHHA 1YFWA 3MPBA 2GC0A 2GC2A 2H6CA 4P9GA 1CAWB 2UY9A 4ZU7A 4Q0UA 2PA7A 1WGPA 5I93A 2OA2A 4RD7A 1ZRRA 1TQ5A 4WZCA 4IETA 3FZ3A 1CAUB 4I09A 3ACLA 2ZCWA 4PIZA 1NE4A 1HW5A 4HMZA 1RUNA 4XFFA 1UIKA 1OMIA 1X8MA 3WW3A 5KHJA 4Z07A 3IDCB 1EY2A 4QGNA 5FPXA 4EWDA 4Q0QA 4B29A 1UPIA 1YFXA 4KU7A 3ST7A 1DGRA 3E6BA 3UKTA 3HIFA 4ORFA 3D82A 3SCHA 5KHGA 1ZZCA 4QXKA 4D7TA 1JUHA 4O9EA 3EJKA 4R52A 2CGPA 3PJSK 5FLJA 1PMIA 3E97A 3LWCA 5JCTA 5HI0A 3CF6E 5I91A 1FI2A 3IDBB 1O3RA 2QE7H 3RYRA 4UBGA 3IWZA 3H1WA 1SQ4A 1I5ZA 4DINB 1EYBA 3CLPA 4E2SA 4ZU5A 1O3QA 3BCWA 3I59B 1OI6A 4I01A 3D0SA 4ZU4A 3E5XA 4Q0SA 3R6SA 5CVRA 4KWLA 1ZREA 3H3UA 4LUMA 3PLQA 4IERA 3RDIA 1ZZBA 2IXIA 4GULA 3NW4A 4HSLA 4JV4A 3H8UA 1IPJA 4MV2A 4XETA 4OLLA 4L11A 1ZZ7A 1BSHA 4HZFA 4XFGA 1Q5OA 4MUVA 4QGMA 2E5TA 2JDIH 3CJXA 4IEXA 4N9IA 1O5UA 2XLAA 3S7EA 2B5HA 4XEZA 2XNDH 3C3VA 5JSOA 1O3SA 3EQEA 1J1LA 2UYAA 1GQGA 2ATFA 3QOPA 2EAAA 3DV8A 4UBHA 4ONUA 1O5LA 2PFWA 4XFHA 5FDBA 4F7ZA 2XL7A 1Y9QA 1RL3A 4JVAA 4AQ2A 2XLFA 4D7SA 2I45A 1OFNA 2XGXA 4IEOA 5FQ0A 1GQHA 1WLTA 1QY4A 2PAMA 2QNKA 4OFGA 5J7MA 1YWKA 2K9ZA 3LA2A 2EVXA 3BU7A 3MZHA 3LOIA 1UCXA 1V70A 3RZZA 1UW8A 3BB6A 2P17A 4EWEA 4O9GA 1ZRFA 2CAUA 3O14A 4IEWA 1QXRA 2FQPA 2ETEA 4J1WA 4EWAA 2BEOA 4QMAA 4HN1A 5J48A 1ZNPA 5FCCA 2MNGA 2V7QH 5T3NA 3M70A 3LZZA 2D93A 1J59A 4YXWH 3HT1A 5BUVA 3USSA 1VR3A 1X82A 4HVQA 2IXCA 4EROA 4AVCA 1ZX5A 2VECA 3KGLA 4HBNA 4MZUA 4DJGA 2Q1ZB 2B9UA 3NJZA 1VJ2A 3NVCA 4L2NA 1WA4A 3OGJA 1SFNA 4Q0VA 2IC1A 5CU1A 2WC2A 3H3ZA 4IESA 2Q30A 2Q0AA 1ZRDA 3FHIB 4X6RB 5BXXA 3LAGA 5K8SA 2D5FA 1U12A 4MGKE 5AVPA 4WVZA 1EP0A 1CAWA 5LEKA 3HQXA 5FPZA 2OPKA 4F8AA 3OF1A 3SXWA 4AVAA 2EA7A 2ET7A 1XE8A 4TLFA 3H9AA 4AQ6A 2BNMA 1CAUA 1L3JA 5LRRA 4KWJA 4BIFA 3E5QA 4QM8A 4HN0A 3WW1A 5LEJA 1FT9A 2HKXA 4HVRA 3G7DA 3WW2A 1YFYA 2PQQA 2ET1A 2IXKA 4K8FA
chains in the Genus database with same CATH superfamily
4LBQD 2BV4A 3CXHD 5F5AA 5J96B 4UOJA 5GLTA 3OEBA 4XACA 2WWSA 1NTZJ 5APXA 2A06G 3AP5A 1QGKB 5JAXA 3GF7A 2OYIA 5F5QA 2AC1A 3VHOA 5B4NA 1Y3TA 1W04A 2HWE1 4PIXA 3PU8A 1UL9A 1O7FA 5LCWL 4B3NA 2CHHA 2ADEA 3ZFGC 3N7NA 2A6YA 1FDMA 3MUDC 4GMP3 1YUDA 2DCTA 1CX4A 3BPZA 3KHBA 3JUUA 1ASJ1 3IAQA 3CWBD 1XE7A 4MH0E 3T09A 1CX1A 1SQBJ 3S5AA 1PZ8A 2R1BA 3NRUA 5E1RA 4AUWA 2XHKA 5APUA 3FWNA 1QH7A 2VUJA 1REDA 4JQTA 4A7KA 3UK9A 4AVBA 3WDYA 2Y6LA 3I55P 3U11A 3P3PA 5FXZA 1KB9I 4XTPA 1AUYA 5LASA 2D2CD 1IC2A 2JD9A 4BCUA 1TME3 5LA1A 2FYZA 4P02B 3TRSB 4B4QA 2OX0A 3U78A 1G6NA 5F37A 3OOXA 5A70A 2ZEZA 2Z2SB 1BVVA 4CEWA 4AL9A 3DUIA 1JMUB 3TN92 1K5MC 3H50A 3ZSKA 1GLHA 1VALA 1N3PA 2JE9A 4LORA 3RK3C 4CEYC 1DG6A 3B5NC 4KJMA 3E6DA 5LA2A 2W91A 1RUG3 5D21A 5F7UA 2PXJA 5CFDB 1AYN1 3BUCA 4Y1VA 4ZS2A 5BNNB 3WVJA 2E74C 2CYFA 2AREA 1PMHX 4LT5A 3C7GA 1JHNA 1XSRA 2JB4A 1NZIA 1ULFA 2JR8A 1NO4A 1L7RA 3ELNA 4GQ7A 1FZFA 2NP0A 2GNMA 1ULDA 5F3EA 3RL0B 3ZDMA 1OW8A 4U2AA 4H2AA 3PUQA 2A3YA 1VBE1 3VBSB 4AE2A 1PVC2 2F6BA 5HCBA 5C4WC 5FTTC 3MLLA 4L99A 5LBBA 1F35A 1D0GA 2JDKA 5FUPA 3CIHA 4N53A 1X79B 1A78A 1RVF2 1YQ4C 1S1CX 2VPVA 4XUPA 1GZWA 4WM8C 1J2JB 3WUTA 2C9KA 3ZXJA 3B9CA 1KC8Q 2H6CA 4ASWA 1LENA 4LO5B 3OBTA 5DZFA 3THPA 3R4YA 1H6YA 1SPPA 2PAJA 4PIZA 3DPRA 1UIKA 3JD71 4QGNA 3KQ4B 1RUI1 1VIWB 4B29A 1G9AA 2VNOA 3E1F1 2DU1A 4XDQA 4NHXA 1W06A 4D6TG 3LIHA 4R52A 1GP6A 3C7HA 3RK2B 4ASKA 2VZSA 4BXLA 3WNNA 1VBD1 2R043 5C5UA 2D2CC 3GZEA 1W2NA 4H7MA 1E5IA 3LPFA 2XNDH 1SFCB 2C24A 4YFWA 2BOIA 2EAAA 4OYUA 3HR9A 3Q8BA 1KDKA 4JAAA 4F7ZA 3CXHE 3FHAA 1S55A 5JPNB 1OFNA 1OT5A 3V4QA 1JZ7A 2J5UA 3W59A 1TNFA 3T4HB 2R0HA 4XVHA 4NO4A 1V70A 4I7ZC 1UW8A 2RS33 1KD1Q 1SVFA 1PGSA 1XYNA 3SITA 2HWD1 4Q1PA 4JCKA 1GBGA 2PHXA 2OYHB 1UNBA 4AVTA 3O5SA 1S0BA 1JYTA 1N7LA 5LA9A 3H1HJ 1VQ9P 3CC7P 2P58A 2VECA 3VBOC 2DU0A 1BJQA 1JTHA 4PDWC 3CCRP 2NPIA 1LHWA 1VB2A 3AE7C 3WU2H 5B66E 1ZRDA 1LP1B 5BXXA 3KCYA 3NXSA 1SQVK 1PO23 3VMXA 4PV1B 4DRVA 3IFMA 5FPUA 4UW5A 4AFCA 5CFCA 1W99A 2ZFCA 5BNQA 2A06D 3MIDA 1YFYA 1KYOI 3II6A 4IOIH 3R0RA 3L4FA 5GZCA 2R1DA 1JYXA 4D8MA 4Q4X3 3ZFEB 1S0IA 4FQZA 3W68A 4F3JA 1GWMA 2ZXXA 4M3CF 4OI1A 2IXJA 5FYBA 2PLV1 3VL8A 2HLOA 1P84E 1C8M2 3LD8A 1HRI1 2FHRA 1UIJA 5CFDA 2BCCD 1M4WA 1V9U3 5KLVJ 5BNNA 4C8DA 2VCAA 1VBA3 4DZGA 4H13D 1S2EA 1DIWA 3WZ1A 3AL5A 2TUNA 2LW8A 3OCPA 2IZ1A 3M91A 3ZYBA 5JSRA 3DYMA 1F8VA 4IW3A 2ZZQA 3UETA 3NAPB 3CCSP 3KWVA 2ZKNA 3CI9A 1GK4A 4XFBA 3VBSA 4UAPA 3D0JA 3PIGA 1ZVFA 4KT0J 1TE1B 3CHXA 4BIOA 4MOAA 5H9PA 1J3RA 3VOPA 4OHZA 2VZRA 2ZKLA 1QF3A 2L91A 1O3TA 4L92A 4Z82A 4UB6H 2CAVA 3H32B 1F15A 2JX9A 1MVQA 1RUC3 4GDOA 2E63A 4AFBA 5KLIB 3M7AA 4IEQA 2WRAA 3I4IA 1OUXA 5K7PA 3EWKA 2QCSB 5IJRA 3TEYA 2DFCA 2HWB1 4MO3M 4CZSA 1IG0A 2R063 1OOPC 5DJTB 2W1UA 3KHUA 1OSGA 4H44B 2Y9ZA 1NZCA 5AW2B 2C9NY 1ND3A 4CCLA 4LJHA 2WDBA 4OHWA 4XFAA 5GZEA 5J36A 3L37A 4NROA 1ENQA 2JB8A 1BVP1 1LWUB 2Q8OA 2QJPB 4FOQA 1MFZA 4DFSA 5IW0A 2C0ZA 3ZXDA 2E43A 2XXZA 5FUNA 1QOSA 4BMBA 5A7OA 1NUKA 3V64A 5DN2A 2W39A 4PD4D 3UKNA 1QX8A 2WS92 1ZBA3 1Z7S1 3ROUA 4BQ4A 4NIDA 2RM22 1J58A 4C90A 3ZN6A 1PVXA 3PTYA 4H13C 5FXWA 3K48A 1HB1A 5JR2A 3KT1A 2P10A 4W4ZA 2WN3A 2EIEA 3MPBA 1EAH3 2BEQD 1OF4A 2OYHA 2YIUB 2PA7A 3VMZA 1WGPA 3FC0A 4QX7A 4JBZA 2ZABA 4XFFA 1W8ZA 1MEC3 4NHLA 3T1MA 2ZX4A 5FYTA 1LTGC 3ST7A 2X53S 2E53A 1JYWA 2JG9B 1TG7A 1GOFA 4CDUB 3PJSK 1N73C 4OI0A 1VRH3 1ODNA 3OUJA 2P2KA 4Q4W2 4IFDK 2IYOA 5EHDA 4DUVA 2XNXA 5E8AA 4Q0SA 2Q5UA 4QHBA 1FOD3 1E5SA 1NTMK 4CP0A 1XE0A 3W67A 2XJRA 4YTPC 1YJLA 1L0ND 4N9IA 3S7EA 3NQHA 2RS51 3A0BH 2CPSA 5A6ZA 3H1JG 1O3SA 1FZBA 2A06E 2XUMA 1RINA 3ZSMA 1NKZB 3WDXA 3THDA 2XL7A 2RN0A 2P2UA 1AVYA 3MW4A 3IN6A 1RMU1 1N1SA 1RUJ2 3B3QE 1GYKA 2PAMA 3W21A 3RJ2X 4W80A 2G3AA 1O4ZA 3V56A 4W6XA 5L9BA 1UAIA 4HXCA 3BB6A 1L4AB 2WN2A 5BNPC 1XU1A 2ETEA 3NAPA 3GZAA 2P3JA 2A1XA 2D44A 5AVVB 3JCUH 2V5DA 5JZGB 3POFA 4GB32 1SBDA 3ZXGA 5FBZA 3INAA 3U1CA 1PMJX 4DEVA 5F6KA 4A44A 1ZYBA 3H3ZA 1YQ8A 2ZGLA 3A23A 4MGKE 4MVTA 2XBO2 3H32A 1CAWA 2AEFA 3DYPA 2ET7A 2KSJA 3VDCA 1IOAA 1FZCC 4S2HA 2X10A 2AZ5A 2C6SA 1NYHA 3RZMA 3SEEA 2WNVA 3WW2A 3O1OA 3H1LJ 2W52A 3NTNA 2KLVA 1OD5A 4EJRA 1RUD1 2WO1A 4RS5C 4AFMA 5BV6A 3R4SA 1RHI2 4QPWA 3LE0A 4B1MA 2WZR2 1QEXA 4FP3A 3CU7A 2JWPA 2FYUK 1DGWA 3L72J 3VHNA 3DF0A 5GM0A 1U0AA 1CW5A 3NNGA 4R4XA 2CNAA 2RDQA 1A02F 1H9WA 3O1VA 3B00A 5IVFA 5C39A 1OQ1A 3DKWA 3G6EP 1OKOA 1NTKJ 4AEDB 5CKNA 2O8QA 5FZGA 3KVBA 2W46A 4Y1XA 4CPBA 3AJZA 1VAMA 1W8OA 1XC6A 3S5QA 4AAXA 2WSSH 4OHXA 5A6YA 4B7EA 3AKQA 3CCQP 4CSWA 3O0WA 5L9RA 4XDPA 3I3MA 4XJ8A 4PF5A 5JI9A 2LUWA 3GZUC 4XIKA 3VKOA 5FJKA 5EFUA 1SQPK 1PIV1 2Y0OA 3HN1A 1GP4A 4R9BA 4AHZA 3KV5A 4XAEA 1QJY2 3RZJA 5AVRB 1JEKA 5IVCA 5H9SA 4WY4B 2ZA9A 1JZ6A 2VW1A 3MHZA 5AVQB 1AR72 1US3A 4TXWA 2BEZF 1OPOA 1ZM1A 5CCGA 3GBWA 2A45H 2ID4A 4BA6A 2XMLA 4L75A 1DF0A 2JG9A 3V0AA 2KR2A 4H0LB 3ETQA 3KCCA 1T2KD 1IFJA 2LXCB 2KS1A 2MPFA 2XKPA 1G2CB 1UKGA 1HBWA 4JGYA 2B39A 2PHDA 1RUF1 1CJDA 5FLIA 1YQ2A 1F4HA 4JHTA 3GALA 1YIFA 1OXCA 5IFPA 3I2OA 2R5BA 5D1IA 4XFIA 3AEDC 5KAFE 1ZV8A 1PGPA 2XJVA 3ES1A 3RJRA 1UMHA 4LO6B 1Z78A 1K04A 2Z5WA 1L0NE 1R081 3KT4A 1SQVJ 1ZRCA 3PLNA 1PGW1 1GW3A 2JJLA 3OGRA 3T0DA 3UESA 1HV0A 2QFEA 1CJPA 1AR92 1DQ4A 4RHV2 3HUSB 1HRV1 4JGZB 4MGZE 3L70J 1BGYJ 3VBRB 2ZAEB 5A33B 5JUVA 1DZRA 1XNCA 1D7PM 1OVRA 3H25A 4RESB 3VBHC 1S0DA 2OA2A 3AXEA 1LTJB 1N3QA 4RA0A 5JZGA 1S5LX 1F5FA 2ZCWA 3AMHA 5HCFA 3WW3A 1X9VA 2QUOA 1LGBA 1Y8AA 4Z07A 5FBJA 1SLIA 4V2VA 3VZKA 1BCCD 4QDRA 3L75G 3VDAA 3RGUA 4LO4B 3WXPA 4LK7A 4AW7A 4IQPA 3LWCA 5JCTA 2HODB 5F5IA 4Q8LA 2RG4A 4XTMA 1NA1B 4I01A 1DLCA 1SQQG 4HKWA 3PLQA 3GXUA 4CEWC 4P5YA 2G9ZA 1W0PA 3H8UA 1S0GA 1JZ5A 3CJIC 4GT1A 3O0VA 4YVWB 2AACA 4AF9A 1VQ4P 3VD7A 1D4M3 2BDRA 1IPSA 1JU4A 5FDBA 1NTZD 3CX5H 1JZ8A 4RO0A 1RXFA 2JDYA 4GWJA 1WUVA 5CKMA 4LBLA 5KC5A 1PHMA 4ZKUA 3DEMA 1UU6A 2WA4A 3BU7A 3RZZA 2YMKA 5I0DA 2WYSA 3KT7A 1SLQA 2WZ8A 4FSJA 1QQP1 1I5PA 1PNGA 5A32A 3OG2A 4AEDA 2VNRA 4QX2A 4YM1A 1KZUB 1W2UA 3LZZA 4JDOA 4ZXKA 4XE9A 2WQ4A 1LNSA 1WCQA 2D98A 4DCKA 1OH3A 4N53C 2M5AB 4NMIA 5JXHA 2HR3A 1XJAA 2Q30A 2E76D 1GQPA 4QHZA 2H8PD 4KGGA 2Y33A 2P1BA 1HJFA 5GTHE 1DGWX 4AVAA 2JXAA 2R32A 1NCRB 5LRRA 4BIFA 2C5DA 4YG6A 3NNLA 2Z4EA 3DPRC 1B35B 5FZ7A 3J9SA 5I8YA 2ZX0A 3Q8EA 4MSVA 2RS13 3I54A 1VBC2 3A21A 3AE9C 1NYWA 4IFMA 2HEVF 1HIXA 4LKSA 5FOJB 1OURA 3R2PA 1G2CA 1LOEA 5A3TA 2X5IB 3F5HA 5J37A 4Z1VA 4QKFA 2WO2A 4AOCA 5I8SA 1KQRA 2O14A 3AE6C 1O6UA 5TSWA 3EHKA 4EDFA 2A75A 1EV13 1S9KD 3SCGA 1BEV2 5D8AB 5ANNA 4FPEA 3U37A 2GDFA 2QZ2A 2C4XA 3WY6A 2WAAA 1CESA 2IXLA 4QU2A 3H1YA 3K77A 1VQOP 1J84A 4OZXA 4TLGA 1I9RA 2ERFA 3MIEA 1FBMA 2OKXA 1PPJG 1QKQA 4C0BA 5FLHA 5B66H 4C7RA 3HUSA 4KI5M 1PM4A 5GLWA 2B7YA 1GU4A 3J7MA 3MLJA 5DG1A 3VBRA 1PK6C 1HXS3 4K35A 4LLOA 5A33A 1Y9BA 1OA2A 1Q43A 2Y9YA 2B4KA 3PNAA 4LLHA 2M8RA 4AGVA 1WMFA 4DT0A 3MIWA 5AC92 1HN0A 2HWF2 2VW0A 3L2HA 3ITKA 3U75A 1JS9A 4Y20B 1JN2P 4MXWB 2R071 1KITA 4L97A 2WZ7A 1HF9A 1MFTA 3C1LA 1P84H 3TSIA 4FI9A 4BLJA 1ZBE3 1AYM2 3R4UA 3WV6A 2E76C 2NLRA 4CCDA 5CFCC 2XV5A 2GH8A 3HOBA 1NA1A 1W5CE 1VAVA 3EFFK 4FFIA 5AFEA 3U10A 1GL2D 3GDBA 3T2TA 3OYWB 3ZSEA 4YZ5A 3V4WA 3B4SA 1EZVI 3MIBA 2P6HA 3H1JE 4AXOA 2QQIA 4YW1A 4XOGA 1CAXB 2ZAHA 1BK0A 1LTAC 1N8RQ 1I1EA 3FLTA 4Y1YA 1VBB1 5K0UB 5CFDC 4NIHA 2EXKA 2BWAA 4KU8A 1LKNA 1EC5A 2E5YA 5C3SA 1XRUA 3KHCA 1W6QB 4E2QA 1HB3A 4G9SB 4Q27A 1F9KA 1CQ9A 3RGBA 1D7MA 1RUE2 4LULA 1C4RA 1XNTA 3VBSC 2QRXA 1AXYA 3HJRA 1N7SD 2ZJCA 4NN0A 1W2EA 4GMP1 4KBBA 1N1VA 4I09A 1BBT2 1QJU3 3MV11 4CTEA 5KR7A 1RUNA 3BCCD 2M5AA 1X8MA 2FYUJ 1X8YA 3PDQA 5FPXA 2NMNA 4DS0A 3E6BA 4A3XA 1M06G 4D7TA 1Y9GA 4B4PA 1H30A 2YY1A 3IDBB 1O3RA 1NCRA 5FYCA 3VDDB 4ZU5A 1HVVA 1QIQA 1W2TA 3GM8A 4LLFA 2GA1A 2LTNA 4YZ4A 4GULA 1PL5A 1AL22 1B35A 1FPN2 1VBE3 3NW4A 5H9RA 3E1IA 3MF6A 5FWEA 1GNHA 3L71D 2QVAA 3B5LB 3BATA 3IZOA 2JDMA 5JXGA 2P7JA 1TME1 1AR63 3OUHA 4P9JA 1LU1A 1ND3C 1NU1D 4UF0A 2IZ0A 4FOVA 2J1UA 1DZQA 3RFRA 1QJX2 4Y22B 5ACA2 4JVAA 1SQPJ 1AL0G 3O6QA 2GN7A 3J7NA 1UWWA 4HYTB 4BB3A 4HT1T 1RUG1 1BYHA 1GL2C 1DGRN 4O9GA 3O14A 4IEWA 5D8AA 3BYWA 1PP9G 1LJ7A 4CDWB 2IYPA 4EWAA 5T54A 1YXWA 5L73A 4I6MC 5GLVA 2EXHA 4BQ5A 3IMNA 1SDDB 3LFIA 1S9KE 1KILA 1SQXD 1OVUA 4EROA 1HN1A 1G9CA 4GOEA 2Q1ZB 1VJ2A 1JZ2A 1YJ9P 2WABA 5CBLA 2YKPA 2NYYA 3JB8A 4GD4A 3VMAA 2AENA 1S72P 2UWBA 5LEKA 1W6NB 2XVKA 1Q8PA 2OYHC 1EDJA 2OS2A 3O7OA 4O7XA 1L3JA 2XBO1 4Q4V3 2POHA 5F3IA 1FNYA 1N7SC 3O1TA 1G86A 4Y20A 1UMIA 4MXWA 2FDIA 2YKOA 3M9BA 4FPCA 5C70A 1CPNA 2WFF3 2M0BA 1CZTA 1CZVA 2XHNA 5FZAA 1EDKA 2Z69A 2PHRA 1YFUA 1ZZ8A 2YMYA 1MZ5A 2ZGPA 1Y9MA 2KSEA 4XHXA 2Q5TA 4NPEA 4P9IA 4YW6A 3P3NA 3OYWA 2WFPA 4PQ9A 1X8EA 4URTA 5FWJA 1L0LK 1HDKA 4BPZA 1DQ6A 3DXUA 3I2GA 3H7JA 1XXNA 1CAXA 3CWBJ 2HPCA 2N1TA 3ENRA 1XBFA 4YSFA 4HKLA 4PJ0E 4CPBD 5HCHA 5FPAA 2HG5D 2R041 5K0UA 4OMDA 4CXYA 1S0JA 2W6JH 3KF5A 3K4ZA 3S6PA 4QXHA 1W6QA 4G4FA 1LHOA 3ACHA 2BP6A 4Y26A 3IAPA 3HT2A 1RUH2 2IBZI 1F5JA 4I2OA 3T2OA 1ZN5A 1DZTA 1ND2B 2ZGTA 4BHPA 4COYA 5ABJA 1HB4A 4MN4C 1SS1A 1HQLA 3T3YA 3H8RA 4WWIA 5IVJA 4H14A 1QHDA 5FZEA 1FX5A 2RS31 3T0BA 2HBUA 2WJSA 2XL9A 3KDPB 4RSUA 4LA3A 1KB9E 1KYOD 3L75E 2O1KA 3D3AA 1ZXGA 2FDHA 2QDRA 2ZEWA 1KMIZ 1R1A2 4B8EA 2ZMLA 4K21A 2QIWA 5KLIC 4ZKPA 1UQXA 1MV8A 1N2DC 1SQQE 4FPGA 1YI9A 4AHYA 2WNVC 1F4AA 2FXPA 3PP5A 2IWGB 3S30A 2VCCA 4LBJA 4QB6A 1PO21 1H4GA 1LECA 2FBWC 4QHOA 1G9FA 2QTWB 1S5LE 5HXMA 2WSFH 5FZHA 3N4MA 1VRBA 2ARCA 1RXGA 5LBCA 2VMFA 1VQNP 5LBEA 3L71E 4Y22A 4Q4X1 2J1EA 2OUJA 1ZR2A 4CCCA 3ZYJB 1X7NA 3VD3A 1Q8SA 3KV4A 1W6PA 1AFOA 4UT5A 2BASA 3CO2A 3TWIA 3URFA 5FZDA 4X6QB 1V9U1 4E2GA 3V6IA 3RSJA 1ZMEC 1HQNA 1VBA1 4LHKA 1EXJA 2QM7A 5LZ6A 1UY3A 4DUXA 1PO13 3A4UA 4CDWA 2ZX3A 1VF5B 1WLCA 3R4DB 4FXGB 2YYOA 2YU1A 3ON7A 3TEWA 4PLNA 1SQBG 3NMDA 1PX3A 3BTAA 5KAIE 4XQWA 5FPVA 3WUDA 1KV4A 2I8DA 3HIFA 4LKFA 2J1SA 1BDDA 3AEEC 5CIRA 4XCAA 4N43B 4K6BA 4FFFA 2Y6HA 2E31A 2Y6JA 5FLJA 5G04L 2M3EA 4DINB 3MI8A 2XPJA 2KXPB 5BU5A 2W2IA 5FMOL 2DCYA 3FUQA 1TMF2 1CZSA 5CZKA 3OGVA 1KFUL 1RUC1 4M3CB 3UYJA 5AW9B 2VOXA 4CDQA 2DVGA 5KAFH 4IEXA 1KQSO 2JG9C 4BQ3A 1CR7A 1TEIA 3V0BB 2WZEA 2ZGSA 3BRVB 1WMKA 2WVRA 4GWIA 4JGYC 2FFDC 4AG4A 2R061 1Y9QA 2JECA 1YI2P 1Q8QA 2XKMA 1BK1A 4CPGA 3Q3DA 5HCAA 4QQOA 3HBZA 4FTSA 2CDOA 4WBAA 1H6XA 1KQFB 2JKBA 1POV3 5FY8A 3VBUB 1E5RA 3CLQA 3FXEA 1URQB 3S4RA 3WF4A 4LIVA 5T55A 4W65A 3SKVA 1DD4A 2MNGA 5IK5A 2D3SA 2D93A 2ZJSE 1VR3A 3HTKA 3LSDA 2OVUA 3GF3A 2GSYA 4YM2A 5A1LA 4CCNA 2VJXA 1W3VA 3AYCA 2NZ9A 2O8OA 1ZBA1 5EPAA 4Q4Y3 5EP9A 4RGGA 4NAMA 1K12A 4L0PA 1G1IA 1GUIA 4XXPA 4DY5A 2GUVA 3HD8B 2K1AA 1WMEA 2JWAA 2I07B 1OLMA 1DEEG 1SLAA 1AA0A 1DX7A 2JE8A 5EWSA 3SQOA 3JQXA 5BNOB 1LGHB 2JDNA 2B42B 1BMV2 1W8TA 5ERLA 4FPJA 2V4VA 1EAH1 1UZZA 1NGMB 4BXFA 4QX3A 2VGDA 2BGOA 3CCEP 2BCCJ 1AR82 1JW6A 4L9BA 4Y1UA 2Z79A 1KYOE 4BMEA 4RJTA 3RYPA 4I2LC 2WPRA 4PI0A 3CMAP 1JYVA 3M8LA 2VMIA 1MEC1 1VB4A 1WMXA 5AVYB 4R4ZA 4COZA 2DF7A 5AVSB 2W1SA 4ARXA 5GZFA 2W94A 5L19A 3IR9A 1B09A 3K75B 1H2KA 2GP3A 5FZ4A 1VRH1 1N3OA 1UYXA 1HLCA 3WW4A 2FCUA 2QJVA 4Z2AA 4NUBA 1IHMA 1FOD1 5FZIA 5JIAA 3C7EA 1H2NA 1QMJA 1WD4A 2B9VA 2QQVA 2XJQA 3RRDA 4Y28J 4MGTA 4KBZA 4ES9A 1GZLA 1SLBA 2BYVE 2AGSA 1A34A 1NTZK 5JLVA 3MW2A 3CNAA 4JF7A 3IDEA 1VP6A 4XF0A 1H2MA 4EQVA 4RQPB 4AEDC 5GTHH 1NLQA 3HWJA 1GP5A 4NWWA 1GOHA 1FZEA 3VBFC 1GW4A 1VMFA 1WW4A 3O1RA 1PGL1 2V4AA 3DN7A 1S0FA 1YHFA 4GA9A 2Q1FA 4BWOA 2B8MA 3H1HG 3NO8A 1EUUA 4MX3A 4N43A 1SQBK 4N3YB 5GJ6A 4R9AA 2K2SA 1P8JA 4MG2A 1EPZA 1DU3D 1MS3A 5IAXA 5AVAA 2DURA 3W5MA 1ZRIA 2WSFJ 4LHSA 5E6HA 2W6AA 5TJHA 4CDXB 3HE5B 1SCRA 2XLGA 3J8F2 5FQ0B 4M3CA 3HNBM 3IKWA 4TT3H 5AW5B 3FE5A 3NKGA 1UX6A 2HFED 4XUQA 3VKLA 5DDJ2 2DVFA 1R64A 3V0BA 5DPNA 1VQ5P 3K3OA 2Z42A 3L9JT 3UGFA 2R30A 1NQJA 3BTXA 2R3CA 4HETA 4Y99B 5JR7B 3Q5RA 1EUTA 3J7LA 3CL1A 5KLVG 2WBKA 3AB0A 3FL7A 2N9BA 4JZRA 4XBQA 3WQ7A 1PP9E 4XPVA 3KQRA 2M3BA 5FMDA 2QJYB 3VBUA 2IDBA 4SBVA 1URQA 1SFPA 1JOCA 4KHXA 5C9AB 3LGRA 5KHHA 1K05A 3A0HE 5M0TA 4Q0UA 3TN93 2HWC2 5CJ4A 5I93A 4IGPA 4WZCA 1S4CA 5LK7B 3EFGA 1ALYA 3ME2A 3LEMA 3HUSC 1BXHA 5JOYA 4UB6E 4M01A 4XUNA 1XNBA 2X09A 1NHLA 4J6GA 1PIXA 2EICA 4MLOA 3SH3A 3TF5A 1JH5A 3IWZA 3H1WA 4Y5TA 5DAVA 4OUEA 3PMEA 4M0NA 4E2SA 5KXBA 1O3QA 2WSCJ 3LQCA 3B71A 4A7ZA 3Q5PA 1L0NJ 5IT6A 3KF3A 5BNOA 1R083 4P9LA 3DKQA 1Q56A 4XETA 5FZKA 1M1JB 4MUVA 2YXRB 3LDKA 3FWLA 2E5TA 3AKPA 1O5UA 3UJQA 5LK5A 5K9YA 2C9LY 1PVC3 2VAUA 4YM3A 4L8QA 4AAPA 4NPLA 3BOPA 2VTXJ 1EZVG 1RVF3 4PBPA 4IGQA 3PUAA 4COWA 2DCZA 2A5ZA 2E33A 4QDSA 1Z56A 4EWEA 2DWRA 4QXCA 3L74D 2Q3IA 2G19A 1KILD 1XU2A 1IQAA 3TGUD 5FCCA 2E7QA 2V7QH 2RDSA 5CYYA 4MGSA 4C0HA 3Q9OA 4YWAA 3VHPA 2JEMA 1NOHA 1N1TA 3UGGA 5FZ1A 4YGEA 1SCSA 5IATA 2WC2A 1Q82Q 2KD7A 5DAWA 3T2QA 2MEV2 3AMNA 4RQPA 4WVZA 3GHGA 2D3PA 2DFBA 2EA7A 1XE8A 3V65A 2PHUA 3AZWA 3CCJP 5HXVA 1NY71 3WW1A 2VBPA 4IEVA 5A3OA 1UY4A 2Q7CA 1JY2O 1OHFA 1GZCA 5EYYA 1IFPA 3CXHI 1H2LA 4IDZA 3K4AA 1SACA 4EV0A 1UYYA 4AVSA 4EOTA 4JYCA 4AFDA 2N1TD 4WM7B 1B35C 1YYCA 4CDXA 2J58A 1CIYA 3OD0A 4TSVA 3M4FA 5FPLA 4LA2A 4ZNCA 4JQ0D 2OTJP 2R0FA 3PIJA 5C3PA 5EQUA 1OWAA 2BRTA 4R4MA 3PURA 3ZLIA 1T3JA 4AEKA 2Y6GA 4K3AA 4RKUJ 4Q29A 2ARXA 1DBNA 3H1IG 3KVAA 2X29A 2PHLA 2BVBA 3QCWA 3C7FA 2AEJA 5FFOC 4EN6B 3JCIA 5BVZA 1NU1K 5KKZB 1WA6X 2DUQA 5EJ3A 2R6QA 1W8WA 2WLQA 5FYSA 4D6QA 5D8AC 3CMGA 4GH4A 5KLVK 4TTGA 1O8SA 1FXZA 4ZZ5A 3JCUE 1VPCA 4Y5Z0 1S0EA 2C9AA 5IAVA 4I0BA 4N7UA 1LTTC 1KILC 2JE7A 3N7KA 3WNLA 4DNYA 3ZR5A 2EXIA 1R5SA 2FYNB 2GH2A 2OW4A 5AW1B 1T8ZA 1FOSE 1LESA 1C8M3 3ZFGB 1FC2C 3VKNA 1SQXK 4E4SA 4Y1ZA 2W1QA 4LEJA 1OFCX 4R9CA 3AE8C 1RJ7A 4AZZA 4UB8E 1MACA 3FBMA 1LJ2A 3N9PA 2RMU2 1CAVA 1XOYA 2QSIA 2YPJA 3MZWB 2WA3A 1J83A 4WVVA 4CXXA 1IQDC 1M1JA 3CX5D 1W9YA 2W0XA 4PJ0H 5L7OB 3RZHA 3D5OA 3LF7A 1USEA 1ENXA 2RS11 3ZX7A 1ENSA 4S2GA 1MS0A 2BERA 2YBPA 1OUSA 1JY3O 3R05A 2H0VA 4JRLA 4GKXA 2JP3A 2N1TC 4TYSA 3AC0A 2Q3EA 1GWKA 3NL1A 3L72G 5I0RA 4NIGA 2UY8A 2VZUA 3H1MA 1LGNA 2RR12 1WCDJ 4JHZA 5K0UC 4QWNA 4OGQC 2Q6QA 3RK3B 5GKAC 1HUCA 4CEYB 4LOTA 2KOGA 1R092 4DIQA 1NTKG 1O4YA 2F17A 1ZRRA 1EV11 4HK9A 1BCCJ 1KB9H 1KILE 2IBZG 5T5JA 4K1ZA 2XJTA 2XZRA 4Z8BA 3TGUE 2E74B 4NIAA 4AQRD 3BODA 3D6EA 5ABJC 4GWNA 5J1XA 3AE4C 1ACCA 1COV2 4OWFA 1PMIA 3DYOA 5HI0A 2XQRA 1WCKA 5F39A 4LBQB 3N7MA 5FAXA 3R6SA 4ZU4A 2TBVA 2P3IA 3AK0A 3ZFFC 4QPGA 1L7QA 2BUKA 1HXS1 2O01J 3NJVA 3IF4A 4LHNA 3H42B 5C4WB 5H9QA 2WS93 1S5LH 2XLAA 4P08A 2B5HA 4XEZA 2PN5A 3BRTB 4ONUA 3PVOA 2RM23 4WM8B 2Y38A 4M3LA 2A6VA 3A22A 3THCA 1T6GC 1DQ5A 2QNKA 5KC6A 4IE5A 1D4M2 2HLEA 2C0WA 1ZBE1 4C91A 3ZN4A 1K3IA 3MIHA 4AI1A 2EXJA 2ZACA 4FPLA 2V4HA 2EIBA 3OJBA 1NAFA 2ZGKA 5DXDA 1KRIA 5A7SA 3LIEA 5IK7A 1TZOA 3N4XA 3WEZA 4OULA 5IVVA 4ASMB 2FDJA 3M70A 2CU5A 1R1ZA 3VD4A 4YZ3A 3BTZA 1X82A 1LODA 5KAIH 1SQVG 4OZOA 1LOFC 1MKMA 3KGLA 4DJGA 3NV4A 3GZTB 4LQRA 3TEXA 3PH0A 2JDAA 2D2CB 4HOOA 1DEBA 4Q4W3 1YCIA 1RQVA 4DQAA 2D5FA 2GP5A 2YG0A 3VL9A 3JBG2 1JBCA 5F2WA 5CCHD 1UN1A 2DTYA 5LATA 1S4XA 3AEAC 1BGYG 2QJKC 5H2FE 1JOPA 5FKCA 1K8AQ 1LOAA 2GALA 1P84D 1FT9A 2HKXA 4LE4A 3BPSA 2J7MA 3SC7X 1GZTA 3VZOA 3SHRA 2K88A 1UZVA 3WG3A 1UX7A 3BASA 2P67A 2X05A 3MUDA 4I7ZB 1HJBA 1RUJ3 3ZO0B 1QJU1 3L73G 1MS9A 3FWEA 4J1XA 1DP0A 1IFIA 2WNOA 1APNA 3W9AA 3TB0A 5GZDA 3P7KA 2LXBA 5C8WA 1J3QA 3A2AA 3H1ID 4CDQC 4ZMDA 4ZPIA 2R44A 2EIDA 3LSEA 5L7OA 3ZR6A 2OXBA 4PDWB 2QQJA 3C8XA 4D3WA 3TEZA 3BVHA 1CVNA 1MQTB 3X29B 4R8HA 2I1KA 4GB33 4ZONA 2ZGQA 3FBYA 3VHRA 3CX5E 3ZXEA 4LIUA 3IMMA 4AI0A 1QNWA 3U1XA 1OVPA 3S0MA 4TWTA 1NH4A 1AR61 2XVGA 1MPXA 1UZ0A 1O91A 4B1LA 2XBO3 1BSNA 4LPLA 4CYDA 4BRYB 2VCMA 3LA3A 1FMD2 4QQLA 4KG8A 3LCPA 4W6WA 4K20A 1JI6A 1D4VB 1Q81Q 3ZKUA 1ULEA 2GC1A 4CEYA 1OF3A 1MS4A 4XAAA 3ZXKA 1U5XA 2IXHA 1YTZT 2WO7A 3WP5A 3K46A 2XDJA 2J1VA 1NTKK 2B9BA 1J3PA 2VQAA 1RHI3 1C28A 4FAHA 1DFQA 2WZR3 5AFBA 4EYUA 1RE3A 3AP9A 1KYOH 2CGOA 1WW7A 2V72A 4BJ0A 3PUSA 2HWE2 4LBQA 3M3IA 2HYKA 4BDVB 1Q3EA 4O9BA 4MGQA 5CCHC 2WSUA 3NKTA 4CP1A 3VB9A 3FLRA 5E88A 3O12A 1QVGO 3PVBB 2WWJA 4UFKA 1U5IA 1ASJ2 3WR0A 4Q4V1 3H0OA 2YO3A 2YPDA 4PD4I 1KD7A 2PYTA 1UU5A 4WM8A 1FE6A 4OMCA 2WYFA 2Y6KA 4GXLA 1KJLA 2WFF1 3N9MA 1URQD 4F83A 2AH2A 5KXCA 3RBZA 1W6MB 2H89C 2QVSB 1OOPB 1QJY3 2J22A 4YARA 3PMSA 1PGOA 1VQ6P 2CV6A 2VNGA 4N78E 1AR73 2KZJA 5KJ7A 2GC0A 2VC9A 2W90A 1RF1C 3BCCJ 1DLLA 4W50A 3HAGA 2GM4A 1HW5A 2AEMA 2BW8A 5KHJA 3PHMA 4LK6A 4P9WA 2IFMA 5FKBA 3WNPA 2E75D 2Y26A 1W39A 4COUA 5KHGA 2Y6FA 4O9EA 5JDBA 1NTMG 3QD6A 3OGSA 1AYN2 3M9QA 4URAA 2CL2A 1J1DC 4NRQA 3PRJA 1G9DA 2P3KA 1OI6A 3WX5A 3L71J 1OLME 5CVRA 4LUMA 3G9RA 3I3QA 5EIYB 4S2FA 4MV2A 4HZFA 1STMA 4R9DA 1NU1J 2WAOA 1H1AA 4N43C 5T52A 1N86A 2UYAA 4H13B 1V6KA 3OPTA 4D7SA 1PGJA 1AR93 4RHV3 1QY4A 4UFLA 2YXSA 1OBNA 4W8JA 2W1WA 2J42A 3SFDC 3MZHA 1SZBA 1S3JA 1A8MA 4UW4A 4PDWA 1QXRA 3WQ0A 1DIPA 3Q1MA 1MQTA 1MZ6A 1NVOA 2ZMKA 2QQNA 3H1IE 2BEOA 3A0HH 4YW3A 4IV1C 4BQWA 1SQXJ 1OLQA 5FP8A 4GIQA 3JD72 2IXCA 3K5BA 1RUI2 4AVCA 2YDEA 1VQMP 4L2NA 1W05A 3AZZA 1AX0A 5A7PA 3O1PA 4D94A 3N7JA 1QVFO 4HKOA 3BVCA 1URQC 1QDCA 1EP0A 2D7FA 2QQOA 1S1AA 3H1KG 2ENRA 4XJZA 3N9QA 4RGAA 1VBD2 5APQA 1X50A 3POJA 4XJ9A 4QM8A 1QJZA 5E79E 4RFT0 1S2KA 4PLMA 3ZKYA 1PO11 1POQA 1LT1A 2QE3A 1PNFA 1JYNA 3F89A 3WNOA 2FYUG 3U0ZA 3QACA 2W5FA 3MUY1 5FIXA 3MFCA 3NJYA 4LKEA 4XF9A 5AW0B 2E75C 1CIWA 4AYCA 1H8AA 5BNPB 1R8EA 4G3YC 4OHVA 3HEIA 3BALA 3A0KA 4WV8A 3IAOA 5I0UA 2GUSA 1SFCA 1FNZA 4M3CE 1JZ4A 2MKVA 3GGLA 1QOOA 2JKVA 3WSOA 4MADA 5BYNA 2JG8B 2XVLA 2HWD2 3NNFA 5A1FA 4DXTA 4DRRA 3APBA 3LDBA 4C46A 1SQPG 1FZCB 2DVDA 4XUOA 4YNIA 5JI7A 3AJYA 4XYXA 5SV8A 3N9LA 4FO9A 3PL0A 1DHKB 1YJKA 4PCRA 2FXOA 4D6TD 5FRAA 1DDLA 2NPSD 1H0TB 2VY0A 2BQPA 4N9HA 4NPMA 1VBC3 1POV1 4LUKA 5D2AA 3ZPYA 4QD2A 5FO7B 4GIFA 2VUAA 4FQ4A 5DUUA 1ZR4A 1ENRA 1LP1A 5KHIA 1LTBC 5F3GA 3BTYA 4Z92B 2NN8A 4QB1A 4AGGA 4XQ4A 2PLV2 4CVUA 2H6BA 3AE3C 3GHGC 4BLIA 1WW6A 1HRI2 4NPRA 3ZYPA 5CBNA 4QQ2A 4JTNA 2K9JB 2XWBB 1IZNB 4C7NB 2FKWB 4A6SA 2O1QA 4CCOA 2ARBA 2HYXA 5EV7A 2YHJA 4Q4Y1 3OUIA 1FV2A 4IL6H 3ZFEA 1R5LA 2W68A 2QQKA 2BBAA 1BEV3 3I97A 3KSCA 1OVVA 1GMMA 1SDWA 2VXRA 3MF9A 1LB2A 4MGYE 2FMYA 4FPKA 4YW4A 4Q5OA 4UWDA 2FD8A 4XF1A 4NPDA 3USUB 2WITA 4OQ8A 1YJWP 2WPQA 3NSTA 4HB1A 1XTCC 3G3ZA 4CDXC 4QDQA 2VRSA 4WBBA 4UI9L 4XIOA 4HONA 2H88C 1O4TA 2VBBA 5FXXA 3LFMA 4XMAA 1I6XA 1LRHA 1URXA 1G7YA 1AHSA 2OQ6A 2RKLA 3MFAA 3CWBG 3T2PA 2VCBA 2CSGA 5AC93 2RDNA 3ECQA 2HWF3 3GNEA 2GC2A 1F2NA 2JD4A 4Y99C 1NTMD 1SQVE 2HWB2 4IETA 1CAUB 3ETPA 3PJQA 4A3ZA 2WSEH 1R091 1O59A 4XXAA 1FYUA 1AYM3 2HH9A 1LT9C 2QJYC 4GH4C 4CA9A 1ULCA 3SCHA 1ZZCA 2Q1MA 1BGYE 4GODA 2Y8KA 4XJAA 2ILMA 4YG0A 1RH5B 2DUOA 1GOGA 4HPKB 4UB8H 4DB5A 4LHLA 5BU8B 4CCEA 1UOJA 2WLPA 3I59B 4QPIC 3O1MA 1OIPA 2NPSC 2PHWA 5DUWA 4DZOA 2A6WA 3GF6A 3KZ4C 2B87B 4OLLA 4LNVA 2VMHA 2WT1A 3L73E 5JSOA 3HD7B 1V6LA 3GHMA 4S2DA 5CMZA 1D2QA 2WSVA 2Q8DA 1Z7S2 2XG3A 5BNPA 1MZFA 2QQPA 2XWJB 3I5CA 1EXIA 1LWUA 2XLFA 2RDRA 1W28A 5C3RA 3VBHB 1WWYA 2KI7B 3LA2A 1M1JC 3LOIA 1RUE3 2BZDA 3N3HA 5EFWB 1LOBA 2OTKE 2JG8A 1BBT3 4QMAA 3HVDA 1SBFA 1BZWA 3G4SP 3ALQA 1KGYA 2AXCA 4AYUA 3HT1A 3H1KD 1IFMA 5K5GB 5ANQA 3QWOC 2Y0EA 4HVQA 3VV1A 1E5WA 1FZCA 4RFRB 3D70A 3MIFA 4FPHA 4WVWA 4AR2A 3WCRA 3NVCA 1NAYA 1LHVA 1GWLA 4Y24A 3P5BA 5FY5A 4OHYA 1GD2E 2Q0AA 1JXNA 5AVPA 3CJIB 4NWVA 4DPNA 4F8AA 2RJLA 1AL23 1FPN3 1KQLA 2OTLP 3VGIA 4CP2A 1MS5A 1HH0A 1AZDA 4D6TE 2PQQA 4HFSA 4PF1A 5DG2A 3MD0A 3SNMA 2RS52 2C26A 2W95A 4UFMA 4YM0A 1QJX3 3TN91 2OZ6A 4CDUA 3OGGA 5ACA3 2QBXA 3LW5H 2K9JA 2D6OX 1PZ7A 4QM9A 3GG2A 2QA4P 4FOWA 3A3YB 1RMU2 1M57D 4I3PA 2D3RA 3JU9A 2LROA 4QPGC 1MUUA 1YC61 4AI8A 2MHFA 3AKSA 3VP8A 4YZ2A 2JKXA 4NAOA 1T6BX 2RHPA 5EXOA 2BFUL 3MIGA 1QJEA 2OYZA 3QH6A 2D97A 2GMEA 5A6QA 1WW5A 4IGOA 4FBFA 1JB0J 3SFEC 5FP4A 4HSJA 1TNRA 2OYIC 4P9XA 3ZXAC 2VTXA 3USUA 2B46X 4W7YA 4GKYA 2LALA 1W2OA 5C3OA 1PVC1 3VKMA 1L4AA 4JKMA 5FY4A 1Y7BA 2XKOA 1E5HA 5FYMA 4DOJA 2VH9A 2A7AA 2RVAA 2Y0DA 1RVF1 4XF4A 1JUNA 2UYBA 3HPNA 5H2FH 4P14A 3ORJA 3UNPA 2NM1A 3MGUA 1BDCA 2R7EB 4WVMB 2VM9A 3P8CD 4V1PA 1JZ3A 3CZUA 2P34A 1RUD2 2JDHA 1NTME 1RUOA 3M06A 1OW6A 1C5HA 3AM2A 5CADA 3H1JD 1M1KQ 4HPKA 1RF0A 5LBFA 1UMZA 3GCWA 5AW6B 3CD6P 4CXWA 3I59A 1SFYA 2FMDA 1RC6A 2FYNC 1J1EC 3GBFA 4QT6A 4J25A 3OAKA 1IK7A 2B87A 3RZKA 5FMOS 5LW9A 4QX1A 1KORA 4A42A 4CUGA 2A6ZA 2WIIB 4I02A 3S7IA 3HD7A 3IDAA 3WQ1A 3AVSA 4AK3A 3GCXA 4NE9A 2AYHA 5CAZA 1PZQA 1RJ8A 5BY5A 1IS3A 4E9KA 2BCCG 3V2PA 1T2KC 1LCLA 4OI4A 1PK6B 5CG8A 1RUH3 3RWKX 1KFNA 3RBXA 4FT8A 4META 3VBHA 2RV9A 3AP7A 4BE3A 5GLZA 2VMDA 5KJ7D 5L7OC 2YV8A 1JTHB 2WSEJ 2WINB 1C3HA 3C2UA 4KG0A 4LO8A 5JXJA 2HYNA 1PIV2 2PAKA 5CJ0A 3POIA 2WNUB 3VP9A 4ZU7A 2XDVA 3HRNA 2E76B 3FZ3A 1MZ9A 5JOWA 1G8WA 1NT0A 1RITA 1R1A3 1L7LA 5CFCB 1FAVA 1L2PA 1EY2A 1UPIA 5IFTA 5FZ0A 1WCSA 5A7WB 3H1KE 2WNEA 2ZGUA 1BE3G 1GFF2 3KQGA 2VG9A 3CJIA 3EJKA 3CL3D 2LKMA 1VE0A 3E97A 5F9TA 3AMPA 1FI2A 1RUF2 2YXQB 3RYRA 3VZLA 1SQ4A 1I5ZA 4WY4A 4YZ1A 5FO8B 1XNKA 2XH6A 3E5XA 3ILFA 3H3UA 4GZ9A 4A6OA 5LY1A 4UFIA 1W8HA 2VZTA 2FYUE 1TU3F 4M4PA 4XFGA 4L74A 4QGMA 2QEXP 4U36A 3QLQA 1RE3C 1JY3N 3U14A 4HK8A 1CPMA 3L2YA 1R082 1YQCA 4NHKA 3PU3A 1PGW2 4COVA 1C8M1 2Q8EA 4IV3B 2AUYA 5IVBA 1GU3A 3RL0D 4IEOA 1GQHA 2QZ3A 2VOKA 5J7MA 2D6PA 4E8DA 2KLUA 2BWCA 5FK8A 1OD3A 3L74J 3UL2A 4EN7B 1HRV2 3WF0A 3TGUJ 3IB3A 3VN4A 1OX3A 4QQHA 2OUHA 1SQPE 4CP9B 2ZYAA 1ODMA 1UZYA 3WDVA 2CDPA 3ZIWA 2XJSA 2IPPA 3SLIA 1FZAA 3M1HA 5CU1A 1SFNA 4JGZA 3AE1C 3SWFA 4KH9A 4X6RB 1HJ0A 4EIJA 4AFAA 3N7LA 1HX6A 1ZA7A 1NCQB 2CWSA 5KJ7C 3RK3E 1TMF3 1LTJA 1ND3B 3LW5J 1X36A 4OUSA 2FZ2A 1E57A 4Q8KA 4U3FG 1LTIC 4WVMA 3ZPOA 3RK2D 1OVSA 4WZFA 5JVVA 3OBAA 4PIYA 4XZUG 1QU0A 5L8RJ 3FN9A 3IN9A 5DZEA 2HODA 1L0LG 1GL2B 3P8CE 1DQ0A 2G9GA 1AJYA 2WT7B 3P1IA 1SFCD 1CGPA 2BU9A 3AX4A 3AP6A 3VYIA 1H8TB 2ZZJA 3WF2A 4JRAA 3VMYA 3K3NA 1T3UA 3POGA 4YVWA 5I0TA 3JXSA 1L0NG 2DBNA 4D0QA 1QQP2 4BU2A 3ZN6B 1XB9A 3CKHA 1FJKA 5BNNC 4Q1RA 1KS4A 1N47A 1PK6A 5J98B 2ZBJA 2H43A 2WS91 2PELA 3RYKA 3KV9A 3I2HA 1O8PA 4B7KA 2L9LA 4QQPA 4IEZA 3AE2C 3CWBE 3RL0C 2RM21 5CISA 2UWAA 1N7SB 1KB9D 1MQTC 2I1JA 4ZKTB 4EI2A 2UWJE 3L75D 1UD1A 3GBGA 1JCDA 2WNUA 1CD3G 2YU2A 5DQ0A 2WWWA 3BI3A 4LMFA 3JSVC 5E79H 5FZFA 1M56D 1H88A 5F5CA 4XILA 4FTEA 3ES4A 4A7YA 1RHZB 1SQQD 1AR83 5FP3A 3AKRA 4M0HA 4PV1D 2WWUA 1W0OA 2A6XA 2ZMNA 3PTRB 4GMP0 4XDOA 1UY2A 5A7WA 3O1UA 2VMGA 1XQNA 3ILNA 5F1RA 4KGQA 4N8MA 4OUMA 1UOBA 2YC2A 2G1MA 4M4RA 2YROA 4E4ZA 4Q4W1 2KYVA 1IS5A 3IBMA 1JYCA 3QH9A 2VNVA 2DCJA 2ZS6B 2ITAA 1VLNA 2D40A 1KS5A 1X9PA 5L36A 3PVEA 3RK2C 3OB8A 2CGNA 4HANA 2X5IA 1GICA 4OCTA 1DYOA 1W9FA 4H3WA 2XJPA 3MO4A 2WZPP 4IV3A 1JU3A 4CUCA 4L76A 1K5JA 2J1RA 3B02A 4M00A 4TN7A 1RUJ1 5EZWA 1SFCC 1DYPA 1UYZA 3AFGA 1NE6A 2R5DA 2W27A 5M1BA 2YBKA 4YGCA 3ZYGA 4EN0A 3U1AA 4YVSB 3RVHA 3WQBA 3B8EB 4I3GA 5F32A 3CEWA 2K3RA 1YFWA 1BE3D 3C9IA 1CAWB 4CP9A 3POBA 1QDOA 3C7OA 1KEXA 3L36A 5GLUA 4K3UA 2OGUA 1H9PA 2VVDA 4YXDC 5EJZB 2R072 5FPBA 4GB31 2WNVB 4Q0QA 4CU9A 3WLUA 2QQMA 2WL1A 3UKTA 2ZOEB 4ORFA 3D82A 3BOWA 1NG0A 1NCQA 3MICA 3TOJA 3CF6E 1WRGA 4UFJA 3J8F3 4H44D 1W9WA 5TISE 2RE9A 1FATA 4LBNA 3T4VA 4KWLA 1UXXX 2GN3A 1ZREA 2PP6A 3RDIA 1ZZBA 1D0HA 2IXIA 5DDJ3 3VKFC 4CCJA 3QBQA 2MJZA 1OZHA 2K37A 1NAEA 1C1LA 3KD4A 1UO9A 3WNMA 1IK9A 1VBB2 4PV1C 1YRZA 1GL2A 1UKRA 3ZXFA 2WT7A 1V6MA 1KJRA 5APSA 1H8TA 3T97B 4BZ4A 1RHI1 3ZFEC 2WZR1 3WG1A 1G9BA 2OQQA 5GALA 2I74A 3CPWO 4FCAA 4QKDA 1PPJD 2P17A 4DXSA 4JQRA 2Y60A 2HWC3 1GU5A 1Y43B 3B9IA 5APTA 1L0NK 3WP3A 3ZM8A 4QX8A 2ZEXA 3G6JB 5JOZA 3WF3A 3OW2O 3RZGA 3MHVA 2E26A 2QQWA 2LS6A 4EZHA 2CPBA 4U3FD 4Q0VA 3NAPC 2VQTA 4IESA 1N7SA 3T1LA 1XTGB 4IL6X 2ZHNA 2ZX1A 4K40A 5FY9A 5CCGD 3OF1A 3V0AB 5C5TA 1L0LD 3ITQA 2P37A 4AQ6A 2E51A 2VU9A 2KS1B 2VW2A 5FY1A 5LEJA 4JGYB 2FFDB 5FYIA 1QJY1 2ET1A 3HN3A 3SKJE 5CEHA 2ADDA 1AR71 1TME2 1BCCG 2LR2A 3ZSJA 2JEEA 5CNAA 5EYXA 4BXSV 3VDDA 2E7TA 1RQUA 3FUOA 2F4LA 5JOXA 4PLOA 3H1IJ 1FV3A 2BGCA 2SBAA 3B7MA 1RGSA 1RE4A 3PTZA 4H44C 1RUG2 4FVVA 3KYQA 2BNOA 5FZBA 2CTVA 2BCCE 2ORZA 5A1AA 4RN5A 2WPVB 3AYDA 2ARAA 5LA0A 1NTZG 3LEIA 2E32A 4DEQA 1L4AD 4YGDA 1LWUC 3NV3A 4JKLA 2QJPC 2MEV3 1JOJA 1MVEA 4E4DX 2W6BA 3PUHA 2J1TA 2GC3A 1JODA 2JG8C 1PM7A 4YVSA 1AR91 4DOUA 4RHV1 2PHFA 1JMMA 3UKVA 1HWTC 3GYDA 4R4LA 1WZXA 5I8TA 3N9NA 3WNKA 4ATFA 1YQ5A 3E6CC 4AHWA 2W08A 5FZ9A 2B89A 1BE3E 2EF6A 2AEYA 2F4PA 1QJFA 3KS7A 1W6NA 4PHZA 3K51A 2HEWF 2YIUC 1GANA 4K8RB 3M0DA 1OQEA 4HH2A 3ZSLA 3CBNA 5AVUB 2OT7A 3Q8CA 4QXBA 1SBEA 2DBIA 5CG9A 5C8CB 5CCGC 3SEPA 4AEJA 2GAUA 3HD7D 1U57A 4YW7A 2NRGA 1AXZA 3SCFA 2JDPA 1AF9A 3ACFA 2LM3A 3NMBA 1A6CA 4CDUC 2YGLA 5FY7A 1LEDA 1NKNA 2VBDA 1H1IA 2R042 4BQYA 2H7HA 2RH0A 4YRDA 1US2A 5ISLA 1PP9D 3DL3A 4IE4A 5A32B 1VDFA 2YUEA 3UT0A 3T97A 3E5UA 3VBFB 1UYPA 4ZXEA 5FYUA 2ZT9B 3LKJA 2ZX2A 3DCQA 4PD4E 1CZQA 1MR5A 3IT8A 3HNYM 1SEFA 1QL1A 2CK3H 1QL2A 3M9HA 4QGLA 4LBOA 3M3CA 2BBVA 4GKGA 5AVWB 5APAA 4BISA 2RS32 1XYOA 1PPJE 4A7PA 3DECA 2Y0IA 2FDKA 3ACLA 1L4AC 2V5YA 4FXKB 1ND2A 2G8YA 1NJIQ 2Y34A 4WY4D 1W2AX 2RMU3 2A70A 2XOMA 2ZYGA 3ZDVA 3D71A 5JZGC 4XJUA 4U3FE 3OSDA 4CCMA 5T50A 4H0LD 4INDA 1EQ7A 4D6RA 2VMCA 3LDRA 2FFDA 5JMCA 1Q2NA 5C7GA 3J26N 1DH3A 1PO22 1W2BO 4HSLA 4YFZA 3RMXA 1IPJA 1L0LE 1IFNA 3KM5A 1DD3A 3CJXA 1OC1A 2ZHKA 3MLKA 3C3VA 3FHQA 5K4LA 1VBC1 1JCCA 4XZPA 1W8NA 1RF0C 1IFDA 2VVEA 2ZEYA 4Q4X2 3DV8A 3GLMA 4MHRA 2I2SA 4XFHA 2FY8A 4YG3A 2IZWA 1LULA 1RL3A 1ZA4A 3M2MA 2EIGA 5DJUB 1OW7A 3WF1A 1RIRA 4OFGA 2RR13 2A3XA 1YIPA 1V9U2 4LO7A 4BM8A 3ZYIB 1VBA2 3HD7C 1H0BA 3I2JA 5IVYA 1R093 2FQPA 1IKQA 4PT6A 1BEV1 4HN1A 5J48A 3FMGA 4TZDA 1OKQA 1UY0A 4YXWH 5BUVA 3GMAA 3J7HA 5B4XA 2GNBA 3V2RA 3WCSA 3P6BA 2LRPA 5FYVA 2YZ4A 1ZX5A 4HBNA 4MZUA 3GW6A 1COV3 1HJGA 2UURA 5F6LB 3FHIB 1CWPA 4ASVA 3LAGA 1W0NA 3ZVXA 4Y4RA 3WD5A 4BOWA 1NLRA 3L73J 3HQXA 2OPKA 5LY2A 2IFNA 3AL6A 4TLFA 2A45I 1F31A 3E5QA 3AP4A 3NV2A 2C0XA 3VTPC 1G1JA 1RUC2 3BCCG 1ZNPA 5DAPA 5AC91 2HWF1 2KK7A 1IZ3A 2XUEA 3D4KA 2JO1A 2PHTA 4ES8A 2X8KA 3ASIA 3OTFA 1W8UA 2R062 3O8ZA 1W6OB 3LA7A 4E4HA 4WY4C 2G4IA 1XPWA 4IE6A 3ATGA 1AYM1 3I2FA 5C8CA 1UPSA 2VVFA 4RR3B 5KXDA 3L71G 5BPXA 5FOBB 1E79H 1K73Q 4H0LC 4NOTA 2DUPA 3UJOA 1A8DA 3KV6A 5GZGA 2SLIA 4A2UA 3CC2P 5C3QA 4D69A 5FYHA 4E27A 1NU1G 2P4EA 2BNNA 4OH8B 2BPA2 2PAEA 1JY2P 2ZGRA 2UWCA 3KB5A 1UZWA 3VBFA 4XABA 1QWRA 1SQBD 1ZBA2 1X33A 3HMYA 3JBG3 4D6TJ 1EPWA 4AWDA 1AX1A 1YJNP 2AEZA 3NNJA 2YB7A 1AV1A 3AYEA 4GJYA 2GNTA 2WQYC 1RUE1 3SMHA 3MDPA 1ZZ6A 1X22A 3WHTA 3EBRA 4QX5A 1SQXG 1VL2A 4SLIA 5F8PA 1DCSA 4NVPA 1EAH2 4DY3A 3BIWE 1BBT1 4JGZC 3HNMA 4XBLA 3BKZA 2FZ1A 3VBRC 2K0GA 1N1YA 1KFMA 1NLSA 3UV9A 2VQ0A 4XFCA 4Y3OA 3AEFC 1HQWA 1VQLP 3FJSA 1MEC2 3KCXA 1W9TA 1LTJC 3TNPB 4BQXA 4UF0B 3CXHH 3POYA 5FZ8A 2D5HA 3MV01 3I2DA 5FZCA 1VRH2 1V6NA 2VMEA 3O6QB 3HQUA 1BLZA 1JYIA 4QB2A 1AL21 1FPN1 4PJYA 1QXPA 3CX5I 1A02J 5GTIE 4Q26A 1BQPA 1RYYA 1FOD2 1OPMA 3I8TA 1NA1C 3J4UH 5FXVA 4NPFX 5KHKA 4P9YA 4H7LA 3D6YA 3HBKA 1DQ2A 3VZNA 1QJX1 1FMD3 3AEBC 4KL1A 5ACA1 1NOVA 4YVWC 3KZIE 4XUTA 1AJKA 1KILB 2QQLA 4EN8B 3W20A 4CCKA 5A3PA 2ZVNB 2ZGOA 2VO5A 3EMRA 3RPQA 1NTMJ 2PFXA 4NHMA 2VL4A 1LR5A 3WT3A 1PGL2 2FBEA 5DMYA 2WO3A 4IFFA 3OEAA 2UY9A 5IVEA 2NQYA 1C57A 4HMZA 2IFWA 3IDCB 2ZYDA 2DDUA 4AQSA 2G9FA 2HWE3 4LGDE 1AVOA 3O0XA 1SP4A 2VZQA 1VMHA 3B01A 2WNUC 1JY3P 3LOBA 5I91A 1K45A 2AR6A 3POSA 3D0SA 1VPHA 1BCCE 1HV1A 1ASJ3 2R16A 1YBKA 2H0BA 3VN0A 5KXEA 2B45X 5L9VA 4NR1A 2P5BA 4L11A 5FYZA 4PI2A 2VTFA 2RMZA 4C1WA 2BGPA 2HPCB 2N1TB 1NCRC 1YQ3C 2KB7P 1W6OA 1I3HA 2AXTE 1SQQK 4Z1MH 3V2QA 2E6VA 1O5LA 2JIGA 2PFWA 1KN7A 3I56P 1LHUA 4BQ2A 4IL6E 1IG3A 3HE5A 4OGQB 2I45A 3U59A 5FQ0A 1REEA 4RR3A 1UXZA 2O0OA 1C1FA 5AVXB 4LR4A 4OVEA 2ORXA 2D6LX 3TDKA 1ZRFA 1NTZE 3K4DA 2EAKA 2X5IC 3IPVB 3H1KJ 4FFHA 2ZXQA 4NHYA 5ABJB 4JDNA 3L35A 4IV3C 3OA7A 3AZYA 3IIIA 2IVIB 3AEGC 4FOYA 2VZOA 3WNXA 3POWA 1WLDA 5JXIA 3NJZA 1AYN3 1NX9A 1WA4A 1YEWA 3ZFFB 3H1HD 4MXVA 3WHUA 1RUH1 2IVJA 2WR9A 3ZIXA 5C9AA 1GK6A 2PMWB 3MUZ1 3SISA 4BQ1A 5FPZA 1SQBE 2E7AA 1LOCA 3WP4A 5AVTB 2YFUA 5TISH 4P5HA 1QLED 1C8NA 2IFRA 2A73B 2ZGMA 1P84I 2FDFA 3SWKA 1ULOA 1QGLA 5AW3B 4IEPA 2N7GA 4D6SA 1V6JA 1GNZA 2D43A 2FCTA 1NCQC 2KXLA 1ZZ9A 3SSUA 4FP2A 4ZS3A 3A5TA 1R1A1 1MZEA 4AGRA 3H3LA 1VQ8P 3JQWA 1NXMA 4IXLA 1YNAA 3THTA 3GJBA 4EE2A 3T08A 2Q4SA 5B5EE 5KLVD 1PV3A 1QH6A 1VQ7P 3N36A 3A7QA 1VAKA 4KWUA 3H1LG 3AXDA 1PFIA 1W6PB 4CE8A 5A6XA 1WKYA 4IUGA 4OQ9A 4LITA 5FO9B 1M8OB 4BYYA 1SLTA 5LB6A 4GWMA 3S1KA 3JD73 2QG4A 1RUI3 1YHQP 1Q8OA 1H8TC 4JKKA 5G05L 1HGVA 3RWNA 1BHGA 2QJKB 4RL7A 1IS4A 3I3BA 4A45A 3LPGA 2WT0A 5DAQA 4RGKA 3ZYHA 1K5MB 3I7DA 2L5GB 3G71P 5FP9A 1VBD3 3KMHA 3RMYA 3EO6A 1YTZI 1ONAA 3Q5SA 3V5BA 3B5NB 2VOTA 1NY72 3BU0A 1JNMA 3ZMNA 3EB7A 4HLTA 1PZ9A 4AQTA 1GNYA 1S0CA 3LEKA 3I2KA 3MYXA 3H1JJ 2D6MA 3H8OA 4IE7A 4CDQB 4YW2A 4FPFA 4CRQA 4QKNA 3CCMP 4QAWA 1GR3A 3ZN5A 3ABVC 3AFKA 1JHJA 3OY8B 4LKDA 3PJYA 1MS1A 1EZVD 4AHXA 1H1MA 4GJZA 4MHUA 2HWD3 1TVGA 3AZVA 1TMF1 3ZMOA 1DYKA 3JC22 3H8XA 2EALA 4UFHA 5FK7A 4K7JA 3VDDC 2OARA 2DV9A 4WM7A 3IIAA 4OVNF 2V7QJ 4YGBA 2KUBA 1RE4C 1IGOA 4N78D 3SH4A 4IEYA 3HTKB 3NWKA 1HB2A 1OQDA 3OPZA 3M3OA 5CKQA 2W87A 5A3LA 4CUBA 3LEGA 5DZGA 2WQ8A 3IPVA 2HEYF 4N7IA 3M3QA 5FP7A 5JIUA 4ZZ8A 1X0TA 1GZ9A 2Y64A 3P32A 3AYAA 1VMJA 3AVRA 4BWNA 2PLV3 3PUIA 1JOBA 1NE4A 1HRI3 1IO4A 4AVVA 3QH7A 4X8NA 5CB7A 4EWDA 1Q7YQ 1YFXA 2UU8A 3ZFFA 4CDWC 4KU7A 4YVSC 3UGHA 2W9XA 1WLWA 3RZLA 1LNQA 1JUHA 4NIIA 4JYBA 3Q8AA 2CGPA 3L70G 4WB4A 2RJ2A 4OI2A 2NZ2A 2QE7H 2VULA 3BCCE 3H1HE 1FAYA 5IWFA 3BCWA 3I3DA 1JM0A 5JWPA 1BKZA 4YPJA 3ZFGA 1ZZ7A 3RL0g 1BSHA 4DUWA 1BMV1 1V00A 3VZJA 1UF2C 3M0DC 1GQGA 4QU1A 1UIIA 4DMIA 4E8CA 2RS12 3VDBA 1AR81 3LB9A 1SLCA 1V0AA 5FJHA 1LHNA 4AQ2A 1WLTA 1OH4A 2RJKA 1RF1B 2A71A 4LE3A 2K9ZA 4PQQA 4PD4H 2YC4A 2J1AA 3VBOB 2WPSA 1HKDA 4YW5A 1NU1E 1PX4A 5FR3A 4QKBA 1LOFA 2DYCA 2CAUA 4D7YA 5HV0A 1HGZA 2OYOA 3ABZA 2HWB3 2XONA 5KLVE 2BFUS 2JDZA 3FXDA 5IK8A 4HJGH 2VZ3A 1J59A 1EV12 1RY3A 1REFA 3ZXLA 3USSA 5FMCA 1VF5D 2JDUA 1K42A 4I0WB 1J1DB 3PHLA 5HPOA 2OQ7A 1XNAA 1UOFA 1XNDA 4XJWA 1K5MA 2VXJA 2VOWA 3I49A 3WDUA 4CU7A 3B5NA 4IE0A 4H55A 3O1SA 2QKDA 2PGDA 1SQXE 2BNMA 2GMMA 4RYDA 3W5NA 1HXS2 4HVRA 1OLRA 1DGLA 3WMM0 1OA3A 2K9YA 2IXKA 1ND2C 2J59M 1BCXA 2R3SA 3SWYA 1Z7S3 3TYYA 2DW3A 1YIJP 3H1LD 3CC4P 3C8VA 1LU2A 3OY8A 2A3WA 2WSCH 4XF3A 2JENA 2QQUA 5HV4A 4O65A 1ULGA 5A3WA 5C33A 5A3MA 5AVZB 5APYA 4X8PA 2SPZA 1W9SA 1ZBE2 4IV1B 4CU6A 2O1JA 5APWA 5C4WA 3OPWA 3I3EA 3Q8FA 5A3UA 4ARYA 3J8F1 2XJUA 1FZGA 4O61A 3L72D 1EDIA 2FCVA 1VQKP 1EZVE 3P8MC 5EJ1B 2ZT9D 5DDJ1 3DXTA 1MS8A 2PTMA 4K1YA 5DAXA 2QM8A 4JPZB 3MP7B 1NTKD 5FZ3A 1GDTA 3FFQA 4YPCA 4A4AA 3BIEA 1YLLA 3ZYRA 3JB4C 2IBZD 3L75J 3HQRA 5KBFA 4HVOA 3L74G 2ZHLA 2FDGA 1JTZX 3TGUG 3ACGA 2DCKA 3EXUA 2Z5IA 4AI2A 1SQQJ 4Y4YA 3IM0A 2RS53 2BVVA 5FREA 2E75B 2HWC1 4Q0PA 2VQUA 1XYPA 3N35A 2WQZC 2PQSA 2ZGNA 3F2ZA 5CCHA 3H6PA 1VF5C 1RMU3 2YC0A 1QJU2 3VD5A 2HJIA 1T2XA 1Z0HA 4ASLA 3MBWA 2A45G 4C1XA 1IJDB 5SV5A 1M7LA 5CA6A 2VZ1A 1LEMA 1KTMA 5JSPA 4HG6B 2VZPA 2ES3A 4DO0A 3B94A 2TEPA 3AZXA 1LAJA 4ITCA 3TNQA 3RNSA 1RTVA 1VBE2 1GTWA 1H8VA 4XQDA 4W6YA 5J3UA 1Y47A 2ZVOB 4KNCA 1Q90D 1QOTA 1AR62 5C8CC 2DVAA 1U7JA 4HL0A 3WUUA 3RI9A 2N9YB 1ULPA 2YO2A 3TBDA 1RF1A 1IPKA 1WD3A 5C6CA 1SQVD 4FFGA 4FAGA 2VUDA 2VE1A 3VBOA 1M90Q 2GMPA 1KQGB 4JDMA 1IS6A 1BE3J 4UW3A 1AVBA 4NJ4A 4GALA 3AKTA 3CZJA 3MGNA 1LTEA 1SG3A 1KDMA 3KXDA 1N73B 3GHGB 3L70D 1BGYD 2WUHA 1RUD3 5JPMB 3EYPA 5T5PA 4RD7A 2ZT9C 4BK4A 5T5OA 1CI6B 3WUVA 4BRYA 4NRPA 1OMIA 3AECC 2WKKA 3VBUC 2WT2A 1DGRA 4KMQA 3WU2E 2MEV1 4XA4A 3I2IA 3ACIA 3WG4A 4KQ7A 1FDIA 3L73D 5DUXA 3CLPA 4B86A 5F3CA 5E89A 2W83C 3LIGA 1V6IA 3ILRA 2CY6A 2PRRA 2CWMA 4JV4A 2KNCB 2HBTA 3F95A 3N9OA 2JWDA 1FDOA 4Q4V2 3NV1A 2JDIH 2D6NA 3OBZA 5GTIH 5A3NA 3EQEA 4AI9A 3SH5A 5DUVA 3KLSA 3CCVP 4N90A 3QOPA 1SMVA 5JMOA 4UBHA 2YGMA 2Y0CA 1AXKA 4LBKA 1J1TA 5BNOC 3CQOA 4Q2FA 2WFF2 3H1LE 1OXZA 4XFJA 2XGXA 4QX0A 4IV1A 3KZIH 1ZRTD 2YBSA 1YI7A 1PIV3 1JMBA 1K9MQ 1LOGA 2O3JA 1UIXA 5FZOB 5J09A 3A0NA 1T6AA 2GNDA 1LT9B 4I1LA 2BTVC 5FUIA 4GH4B 5FZLA 5FMBA 4Y5SA 4ATEA 5T3NA 3MW3A 1S2BA 3L72E 1NQDA 4XE5B 5A80A 4U3FJ 3T30A 1W6MA 3TNUB 4A41A 4ET7A 4QPIB 1ZOYC 3RS6A 4QPYA 2NPSB 3OGJA 3WDWA 1OOPA 1W03A 4UYBA 1RUF3 1ZW0A 5AW8B 1L0LJ 2XU6A 1NTKE 4EN9B 2YKQA 2WTYA 1U12A 3LIDA 3VD9A 1WMDA 2VOVA 1WT6A 2IBZE 3SXWA 4RS5B 3H9AA 2XR4A 2W3JA 4KWJA 4ISQA 4HN0A 4LBMA 3WDTA 5B2GB 3D6ZA 3G7DA 5IUQA 1XSQA 1CAVB 3D8CA 1POV0 3MPPG 5AW7B 2YFZA 4RQPC 4BH9A 4P00B 2KZIA 5IHRA 1AQ5A 1Q86Q 4YYOA 2ZTNA 5F2SA 2K46A 2XQXA 3B69A 2AXTH 3AE5C 3OBRA 5I0SA 3NFQA 1W3XA 4IEUA 2JJ6A 2W47A 3S57A 5KWRA 1Q8VA 1H89A 1HRV3 2BJSA 5A7NA 1X9TA 1QXJA 3HE4B 2RMU1 2O01H 4CU8A 4EZ4A 4AI3A 3NJXA 4XW3A 2IUWA 3VLBB 2OIIA 3RG0A 1FS0E 4MGIE 2WMMA 3H7YA 1GMJA 1LGCA 5APVA 1FJPA 5IK4A 3AMQA 5KTBA 2DVBA 4RR3C 4ZY9A 3U07A 5CHXA 3A7OA 3MEPA 3ZOIA 3B93A 4UW6A 2TNFA 4I0AA 4U7JA 1FOSF 5A7QA 5E16A 1WCUA 2RR11 2Z4FA 4JTOA 1N73A 3M3EA 1HTLC 4AEMA 2OPWA 4KWKA 3GJAA 2ZHMA 3WOGA 5C71A 2KP8A 3U4XA 2YMZA 5T5LA 1PO12 1CI6A 2IX7C 2ZXEB 2O01N 3NNMA 3RI8A 4QPGB 1WBLA 3L70E 5C9AC 2JIJA 1UY1A 5HBAA 1U5ZA 1D2SA 4FPYA 2E9QA 4PBOA 3JZVA 1H4HA 1QNYA 4N6JA 4XURA 1COV1 3KGZA 3V2NA 3ZDSA 5FZ6A 2OYIB 1QQP3 2XB6C 5B5EH 1JO5A 2OZJA 1ZP0C 2VR4A 2KNCA 2E42A 3WUCA 2VD7A 4LTAA 1SLLA 5AW4B 2ZAAA 1CONA 1YYNA 1PP9J 2V09A 2DTWA 2GZWA 4OGQD 3A0BE 4XHBA 2QDNA 3U4SA 3PVNA 3VZMA 1GKBA 3CMEP 3POEA 1LTSC 1IKPA 2FXMA 2GU9A 3OJAB 5IYYA 4UXAA 2P6CA 3CCLP 4DXZA 3FGAD 1D4M1 1JUIA 2KM2A 4LXLA 5FZOA 1USDA 1AQTA 1U5YA 5LRSA 3M0AA 4HKZH 2P3YA 3TAYA 4LC1A 1LT9A 1ZRTE 1CSBA 3FX3A 1W90A 1DQ1A 3WG2A 4P9GA 3T0AA 1TQ5A 1Y4WA 4GOFA 3TNUA 4K9SA 4I30A 4QPIA 3FLPA 4CEWB 2V73A 1SHWB 2NPSA 3CCUP 1RB8G 4W7ZA 2C1FA 3EQ2A 3WP6A 1AX2A 1J1EB 1KXGA 4QXKA 2FYUD 1YITP 1H0TA 2D6KA 2KIKA 1OFSA 3FFZA 5FY0A 4L73A 4RS5A 4NRMA 1VQPP 2P1JA 1NKGA 4UBGA 4Q4Y2 1EYBA 3JBG1 3TK1A 4BK5A 2Q1KA 4Z2WA 3E7KA 4IERA 5FZMA 3KPEA 4XC9A 3RQ0A 1W8FA 4GAZA 1Q5OA 3FX0A 1U7MA 3S9OA 3WINE 2ZPXA 4C7NA 4V2WA 1J1LA 4FTBA 2ATFA 4IL7A 4JX0A 4Y33A 3OD4A 1CN1A 1C5IA 2VZVA 1ZLLA 2W92A 1FU1A 5FV3A 3VUOA 1A3KA 3BGAA 4DXRA 3UIAA 4CUAA 3K2OA 1OA4A 3HE4A 1PGQA 4EYYQ 1GSLA 1YWKA 1GV9A 5FYYA 4B4RA 2EVXA 1SQPD 1UCXA 5CBOA 2KA3A 4N53B 2Q9IA 4YLZA 4XMIA 4FPOB 4ISRA 2YNYA 1GZWB 2NMOA 4J1WA 3ZYFA 4WM7C 3CDZB 1EDLA 1UOGA 2R49A 4ZHNA 2R073 4XCBA 5DABA 1V6OA 2B88A 5LWBA 1UU4A 3RK3D 3BN6A 1SPPB 1WBFA 3DPRB 3L74E 3B5ND 2B9UA 3MTUE 2IC1A 1YQ6A 2BOJA 3TYJA 3Q2YA 1YO8A 1ST8A 5K8SA 4JC1A 1JY2N 1FMD1 2E74D 2Q8CA 3W58A 4LOSA 2Z5HA 1AJOA 4XBNA 4MYEA 2VUCA 3E1RA 1CAUA 3DGTA 1NXD1 5KKZC 2JICA 3GHNA 1NWQA 3AMMA 2W8ZA 1VBB3 4K8FA 1KFXL
chains in the Genus database with same CATH topology
5AC91 4LBQD 1G86A 2QE3A 2HWF1 4Y20A 1IZ3A 3D4KA 1PNFA 2PHTA 4MXWA 4ES8A 2X8KA 4FPCA 5J96B 3U0ZA 1CPNA 3QACA 2WFF3 3ASIA 3OTFA 5GLTA 3MFCA 2R062 2WWSA 1W6OB 3LA7A 2Z69A 4XF9A 2PHRA 1YFUA 1ZZ8A 1CIWA 1MZ5A 2G4IA 5BNPB 2ZGPA 3AP5A 3ATGA 1AYM1 4XHXA 5JAXA 2Q5TA 4P9IA 5F5QA 4G3YC 3VHOA 1Y3TA 5C8CA 4OHVA 2HWE1 4PIXA 3P3NA 1UPSA 3OYWA 1UL9A 2WFPA 4PQ9A 1X8EA 1O7FA 2VVFA 4URTA 4B3NA 3BALA 3ZFGC 3A0KA 4WV8A 4RR3B 5I0UA 2A6YA 5KXDA 5BPXA 1HDKA 5FOBB 1E79H 4BPZA 1DQ6A 1FNZA 3H7JA 4M3CE 4NOTA 1XXNA 2DUPA 1CAXA 3UJOA 1A8DA 5GZGA 2SLIA 4GMP3 3ENRA 4A2UA 4YSFA 4HKLA 1QOOA 1YUDA 2DCTA 1CX4A 3BPZA 4D69A 3JUUA 5BYNA 2JG8B 2XVLA 4E27A 2HWD2 1ASJ1 2R041 5K0UA 1XE7A 2BNNA 4MH0E 2BPA2 2PAEA 1S0JA 2ZGRA 2W6JH 1PZ8A 2R1BA 2UWCA 3KB5A 3S6PA 3VBFA 4DRRA 5E1RA 3APBA 2XHKA 1W6QA 4G4FA 1QWRA 2DVDA 1LHOA 5JI7A 4YNIA 1ZBA2 3AJYA 4Y26A 1X33A 3HMYA 1QH7A 3HT2A 1RUH2 2VUJA 3JBG3 1REDA 4XYXA 1EPWA 4A7KA 5SV8A 3UK9A 1F5JA 4AVBA 3WDYA 4I2OA 4FO9A 4AWDA 1AX1A 1DZTA 1ND2B 2ZGTA 4BHPA 4COYA 5ABJA 1DHKB 3U11A 1YJKA 4PCRA 3P3PA 4XTPA 3AYEA 5FRAA 1AUYA 1DDLA 1HQLA 2GNTA 2VY0A 4H14A 1RUE1 2BQPA 1QHDA 4N9HA 3SMHA 3MDPA 4BCUA 1FX5A 1ZZ6A 1TME3 3WHTA 3EBRA 1VBC3 1POV1 4LUKA 3TRSB 3ZPYA 2RS31 4QD2A 4B4QA 5FO7B 4QX5A 2WJSA 1G6NA 2XL9A 4RSUA 2VUAA 4FQ4A 5DUUA 4LA3A 4SLIA 2Z2SB 1BVVA 4NVPA 1EAH2 4CEWA 4DY3A 1ENRA 3BIWE 3DUIA 1BBT1 4JGZC 3TN92 1K5MC 3H50A 4XBLA 3ZSKA 5KHIA 1GLHA 2FZ1A 3VBRC 1VALA 1N3PA 2JE9A 4Z92B 2K0GA 2NN8A 2QDRA 1N1YA 4AGGA 4XQ4A 4CEYC 1NLSA 2PLV2 3UV9A 2VQ0A 4XFCA 1DG6A 1R1A2 2H6BA 4B8EA 4BLIA 1WW6A 2ZMLA 1HQWA 1HRI2 4NPRA 3FJSA 4K21A 3E6DA 1MEC2 3ZYPA 3KCXA 4QQ2A 4JTNA 2XWBB 3TNPB 1RUG3 2O1QA 5CFDB 4FPGA 1AYN1