4WVZA

Crystal structure of artificial crosslinked thiol dioxygenase g95c variant from pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
195
structure length
195
Chain Sequence
b'ILRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPGQITPVHDHRVWCLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol dioxygenase
publication title Substrate and pH-Dependent Kinetic Profile of 3-Mercaptopropionate Dioxygenase from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa bwhpsa021
molecule tags Oxidoreductase
total genus 48
structure length 195
sequence length 195
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4wvzA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4wvzA02
4ORFA 4HZFA 2DCTA 3E6BA 1J3QA 1J3PA 2MHFA 5LEKA 3CJXA 2XLGA 1DGRA 3L2HA 1LR5A 3DN7A 4O9EA 4Q0PA 4QGNA 3O14A 4JTNA 4I09A 2XKPA 2BNOA 4XEZA 5E16A 1LKNA 3ST7A 5C6CA 3H7YA 3DL3A 1ZZ8A 2B9UA 3ES1A 3C3VA 2D93A 3CF6E 4Z82A 5FPXA 4BIFA 3U0ZA 3RDIA 4B29A 3E6CC 4KU7A 1CX4A 2BEOA 5KHGA 3BU7A 5AVPA 1FI2A 4HMZA 2WSSH 3NJZA 1WLTA 5BV6A 4EV0A 4Q0QA 4BHPA 1QXRA 1ZNPA 1AQTA 4YXWH 4LTAA 1VR3A 5JR7B 1ZREA 4MGKE 1RTVA 4IEPA 4D7TA 3RNSA 4AVCA 1UW8A 2XLAA 4IEZA 3WW4A 4HBNA 3H9AA 1Y3TA 2D5HA 4DJGA 4E2GA 1G6NA 1SQ4A 1WGPA 4AQ6A 4Q29A 1LRHA 2E9QA 5T3NA 2HJIA 4Q0UA 1OD5A 1LB2A 2BNMA 1O3SA 4QGMA 3SCHA 1YLLA 3GBFA 4Z07A 3VHRA 1IPJA 1Q5OA 2OPKA 4XF0A 3UKNA 1O5LA 4OLLA 3ROUA 3EHKA 2IXCA 3KMHA 4MV2A 4WZCA 2Y0OA 5JCTA 2IXLA 3RZZA 2XL9A 1BSNA 1Y9QA 4HSJA 3U11A 4HVQA 1BSHA 2KXLA 3D0SA 3PLQA 2PHLA 3H1YA 4ZU5A 4JTOA 3USSA 5CU1A 4LUKA 2Q0AA 2GU9A 1CAUA 2ATFA 2MPFA 1X7NA 5I91A 3H3UA 3BCWA 4X6QB 2VECA 4AXOA 4X6RB 5EZWA 2OZ6A 1UIJA 3GYDA 4F7ZA 2UYBA 1FS0E 1YFYA 4R8HA 5KHIA 2FQPA 4WVZA 3I59A 3ETQA 4WBBA 3NKTA 4MGIE 3MDPA 4Q0VA 4JVAA 1YFXA 3D0JA 3FHIB 4GULA 4I02A 5HI0A 4MZUA 2QNKA 1CAUB 2UYAA 3IDCB 1WA4A 4LUMA 5JAXA 3RPQA 2PQQA 3KSCA 1ZRCA 3SXWA 3QOPA 3LWCA 1DGWA 4YRDA 2BGCA 4IEVA 4YNIA 2V7QH 4NVPA 4META 1TQ5A 3I59B 1RL3A 4IEYA 2PFWA 5K8SA 1HW5A 4HSLA 2OYZA 5D1IA 1ZX5A 5BY5A 3IWZA 4OFGA 2H6CA 4PIZA 3CLPA 3ELNA 2E5TA 2GAUA 2XHKA 1OMIA 4F8AA 4K8FA 4N9HA 3SCGA 1NYWA 3RYPA 5KHKA 1E79H 4IEOA 5KBFA 3H50A 2WFPA 3IDBB 3PNAA 1NE6A 1YUDA 5FLIA 1ZZBA 3TNQA 3RYRA 3E97A 3EFFK 1Q43A 3EO6A 2Z2SB 5KHHA 1XRUA 2XL7A 2EA7A 4XFHA 5C8WA 5JSOA 4IEQA 3QACA 1CAXA 2IC1A 2ZCWA 4L11A 2QVSB 3HIFA 3OD0A 4PIXA 1X8MA 3PVBB 3M70A 2PHDA 3NL1A 4DINB 4FAGA 2PYTA 4EWAA 3DV8A 2VPVA 1EP0A 3M3IA 1GQGA 2B5HA 4ZU7A 1QY4A 2ET1A 3MZHA 2BYVE 2XLFA 5I0SA 1IPKA 3LAGA 3LA7A 3U10A 3OCPA 1J59A 3EBRA 3SHRA 4ONUA 5FPZA 1CAXB 4J1WA 3CEWA 1NXMA 4LULA 1RUOA 5I8SA 1ZVFA 4IETA 5J48A 2EAAA 4XF1A 5LEJA 2CV6A 5I0TA 2UY8A 4I2OA 5EFUA 3E5UA 4UBGA 3IBMA 3E5XA 3FFQA 1ZRFA 3R6SA 3KGZA 4JV4A 2N7GA 3WW1A 4R52A 4RD7A 2CAUA 4MUVA 2EVXA 3FJSA 2Z69A 4XF4A 3D82A 3HT1A 1O7FA 4HN0A 4QX5A 1PMIA 3WW3A 3H8UA 1X8EA 1FXZA 4FBFA 3TNPB 1CAWA 3OGJA 4H7LA 2GC3A 2CK3H 4IEUA 3UKTA 1FT9A 4I3PA 4HVOA 4MH0E 4XETA 3S7EA 4MGYE 2XGXA 3JZVA 4HLTA 4PJYA 4YSFA 3NSTA 1JEKA 2K0GA 4XFIA 5FQ0A 5J7MA 4QM8A 3KGLA 2PAEA 4P9GA 4XF3A 4IESA 4KWJA 1OFNA 2XKOA 5LRSA 2GZWA 1YFWA 4KWLA 2ET7A 3E5QA 4IERA 3ACLA 4E2QA 1CAWB 5JSRA 4ZU4A 2QJVA 1XE7A 3LA3A 3H1MA 4Q0SA 4UXAA 3LA2A 1VJ2A 5I0RA 4XF9A 3BPZA 4AVBA 3S7IA 2UY9A 2HKXA 2O1QA 1XE8A 3EQEA 5FQ0B 3OF1A 4J1XA 2O8QA 1DZRA 2E5YA 1UCXA 2IXJA 2QCSB 1ZZ9A 3I54A 2BNNA 4MGZE 4LA2A 1CAVA 3I7DA 3G7DA 4QXKA 5E1RA 3HT2A 2PA7A 2K9ZA 3FZ3A 3UKVA 1PM7A 1H1IA 3MYXA 4D7SA 4LA3A 2IXHA 4EWDA 2P17A 3H1WA 4HN1A 5F1RA 2OZJA 2H6BA 3SCFA 5BUVA 1SFNA 2D40A 4FAHA 2PAKA 1ZRDA 4YARA 3EJKA 4O9GA 2JDIH 1CAVB 1VP6A 2D5FA 2IXKA 2PAMA 4QGLA 2OA2A 2ZKLA 2Q30A 4KL1A 4L2NA 5I0UA 2I45A 2IXIA 5FDBA 4FT8A 3MPBA 2GC1A 3WW2A 1O3RA 2WC2A 4BYYA 3DKWA 1ZZ7A 3B02A 2QDRA 1O3QA 3ES4A 3S0MA 3ZDSA 3H7JA 4XFFA 1Q3EA 4AQ2A 1NE4A 5FLJA 2GC2A 1OI6A 4TLFA 4KU8A 5KHJA 5JSPA 4XFBA 4IEWA 1I5ZA 3N4MA 4E2SA 2FMYA 4I0AA 2C0ZA 4AVAA 1EPZA 4PIYA 1O3TA 2B8MA 5J3UA 2MNGA 3FWEA 2F4PA 3OTFA 3LOIA 5BPXA 1J3RA 2ETEA 1I6XA 3NVCA 4LLOA 4XFGA 4A2UA 5I93A 1UPIA 4XFCA 3CL1A 1CGPA 3HQXA 4I0BA 1J58A 3NW4A 4N9IA 1H1MA 3KCCA 4XFAA 1QWRA 3CO2A 5BXXA 4LEJA 4UBHA 2XNDH 1UD1A 1V70A 4EROA 1EY2A 3SMHA 1RGSA 1YWKA 1ZZ6A 2GC0A 1QXJA 1UIKA 1X82A 1GQHA 1O4TA 2Q1ZB 5FLHA 3LZZA 3IIAA 1SEFA 1RC6A 4KWKA 1ZZCA 4MX3A 5I8YA 1IFPA 1NZCA 4HVRA 2QE7H 1J1LA 3RYKA 5FCCA 2CGPA 4I01A 1L3JA 3E6DA 2H0VA 3H3ZA 4QMAA 1YFUA 3FE5A 3FX3A 2Q4SA 5LRRA 1YHFA 4EWEA 3BALA 5I8TA 5CADA 1ZRRA 4YYOA 2CAVA 1DZTA 2W6JH 1RUNA 1O5UA 3PJSK 2V09A 2PTMA 4QM9A 1JUHA 3BB6A 4CYDA 1U12A 4IEXA 2GH2A 5CVRA 2VQAA 4BH9A 1EYBA
chains in the Genus database with same CATH superfamily
1GNHA 2Y33A 4ISRA 4AK3A 1J3PA 1AF9A 1NA1B 1RUJ3 4UOJA 3S5QA 5DAVA 1REFA 2H7HA 2WLQA 5A80A 4BQYA 3H7YA 2JB8A 2XPJA 3F95A 4ZKPA 2P2UA 4Z82A 1XYNA 1HGZA 2VMIA 3RDIA 2JDKA 1FI2A 4DO0A 2HEWF 3RMXA 2JG9A 1TMF1 4EV0A 3RZHA 4CP0A 2QDNA 4I2LC 1ZREA 1XBFA 3Q1MA 3OBZA 4JDOA 3VBUA 3FLRA 1SQ4A 4Q29A 5GJ6A 1QGKB 3SH3A 1L4AD 1OQEA 2WZR2 4DQAA 1C4RA 4Z07A 3SITA 2VC9A 1FPN3 5APSA 3L75J 5DABA 3ROUA 2ZABA 3NXSA 5JCTA 2MJZA 3D4KA 1XNTA 2RE9A 4HVQA 3FN9A 4R9DA 1S1CX 1ULDA 1POV1 1NZIA 4OUSA 5GLZA 4CUGA 2G1MA 1M8OB 5AVAA 4YVSC 3QWOC 2ARXA 4RQPA 1N73A 4RN5A 1LHWA 3JSVC 1TU3F 1VQ6P 2EXIA 1N7SA 1QOTA 4UW5A 4URTA 3RZGA 1AXKA 2VXRA 2QQIA 2I74A 4MZUA 3TF5A 3KM5A 4B4RA 5DDJ2 5FYYA 3WG3A 1SLLA 2XQXA 3CNAA 1SQQD 2K37A 4META 1VRBA 4DXTA 2W68A 1HW5A 2JJLA 3NMDA 4TT3H 3HUSB 3OPZA 1FV3A 2XHKA 1VALA 3T4HB 4IV1C 5FOBB 3AE3C 3OGRA 4Y1YA 3H6PA 3JQWA 3E97A 5BNQA 3EFFK 3BASA 2WNVA 3WP6A 5CISA 4O9BA 1PIXA 4GD4A 1MUUA 4TTGA 2WT2A 3OPTA 3AP4A 1XNDA 3JCIA 2D98A 3HBKA 4YGCA 2PHDA 3NL1A 3L72D 1EP0A 3HE5B 5B4NA 3M3QA 1S2BA 1ZOYC 3B00A 3J9SA 2YG0A 3WP3A 4AL9A 3SHRA 4CEYA 1OIPA 1QJZA 4NN0A 2E6VA 1BKZA 1ZVFA 1L0LK 2DU1A 3CLQA 1X9PA 1JN2P 4QAWA 4UBGA 1KEXA 2WZPP 3KXDA 5DAWA 3H1KE 4RD7A 4NIAA 3KLSA 4AEKA 1POV3 3DYOA 1W6PB 4XFJA 1YQ4C 3IAQA 4K21A 2KLVA 1UN1A 4IEUA 1NOHA 4XE9A 5FRAA 3FX0A 2XBO2 4NPMA 1JB0J 3ZOIA 3KB5A 1WMEA 2B89A 3NNLA 1G9DA 2ZX0A 5L7OB 1OW6A 3WOGA 1AX0A 1GBGA 3AM2A 4YTPC 3L4FA 3OEAA 4CEWC 3A3YB 5JLVA 4XF9A 3BPZA 1JNMA 1NLRA 2DVAA 3POJA 3V0BB 2QJKC 1T6GC 4O65A 2QEXP 3BRVB 1ZRTD 2E75D 2R5DA 2RM22 4IE4A 3I97A 2NYYA 3MYXA 2IXHA 5L9BA 1VBD2 1NYHA 2H6BA 2A6VA 4P9WA 3PDQA 1EC5A 2A75A 2FDKA 2JDMA 1ZV8A 1GUIA 4FI9A 3MF9A 1FDMA 1VBC3 5IK4A 3N7LA 1DFQA 3ZKUA 1PPJE 4YFWA 1W6OB 4XUQA 3AMMA 2AR6A 3J26N 3H7JA 1D7PM 4AQ2A 3L70D 2FXMA 1FZFA 2ZGSA 3WVJA 2L9LA 2DVBA 5APYA 2WL1A 5T54A 3ZLIA 2WSVA 3HD7A 1SPPA 3FWEA 5AVZB 2DVFA 1Y9MA 1WCDJ 4MXWB 1FYUA 1LU1A 2VTXJ 2B46X 3NVCA 3BTYA 2H43A 3OY8B 1N8RQ 4LPLA 2GP5A 1V6NA 4CEWB 1PMJX 4ISQA 1K73Q 1HQNA 2KK7A 2G8YA 1FZBA 1L0NJ 2KSJA 1RQVA 3MV01 4CDXC 3PVNA 3AP7A 4XUTA 3RZMA 1RMU1 5DAPA 4HXCA 1F8VA 2ZEYA 3BOWA 5CJ4A 3URFA 2WVRA 1F4AA 2A06E 2O01H 5FY7A 1P84I 3RWKX 1CIYA 3PRJA 3PUAA 3L74J 2A3XA 5IHRA 2FCVA 4AEMA 2W6JH 4GMP0 4LBQB 1L4AC 5CB7A 4N53A 1P84H 1NCQC 4Y26A 5H9QA 3AKRA 5JUVA 3HRNA 2GMEA 3WU2E 1MVQA 4H2AA 2F4LA 5HV0A 1ZBE3 1T6BX 2IBZD 5E88A 1VB4A 2RG4A 4LHLA 2X5IB 1BXHA 4E9KA 3KVAA 2QFEA 2WFF2 3C7EA 5C7GA 5EJ1B 4BLJA 4XJWA 5J96B 1F35A 5LK7B 1W9YA 5FO8B 3C1LA 2AH2A 5KXEA 2R1DA 2EIBA 3II6A 5AVSB 2I07B 1S2EA 1AXYA 1U0AA 1GNYA 3CX5E 2W5FA 2VQTA 1BE3E 4CCMA 4I0WB 3NWKA 3L2YA 2W8ZA 1M1JA 4OLLA 3HAGA 2HLEA 1JY3O 2WT0A 5FP3A 1MVEA 1T3UA 1OZHA 1ZMEC 2QZ2A 3T0AA 1D4M2 1KYOI 3SQOA 4F3JA 3BODA 1RMU3 3VL9A 1RHI1 4EOTA 4GH4C 4PD4I 1DGLA 5CCGA 3VUOA 2FD8A 1KYOH 2RR12 4KG0A 1AR71 2RS32 1GOGA 3ETPA 4PI0A 1Z7S3 3B71A 1UQXA 1MZ9A 1H6XA 3Q5RA 1YIJP 4PD4H 4XDPA 2L91A 5ANQA 1UY2A 3PUSA 3PTYA 3VKNA 1SBEA 3P8CE 4QKFA 5A7NA 1NGMB 2VY0A 3V0AB 4JCKA 3PNAA 3J8F1 4CPBD 3A21A 4K7JA 2W0XA 5FPLA 5APWA 3CX5H 4KJMA 1JY2O 2EA7A 3PP5A 5FOJB 2VMGA 1SQPE 2ZCWA 4PIXA 5JVVA 5A3MA 1WA6X 1QMJA 1OUXA 1CSBA 5D2AA 2VW0A 2XLFA 2W39A 1IPKA 5C9AC 3A7QA 4I7ZC 3VKOA 3WDWA 2K9JA 1MZ6A 1VMJA 2RDSA 1KILA 1M56D 2E75C 2JR8A 2W91A 4QPGB 3RWNA 2Y0DA 4XBLA 1NUKA 1A8MA 2JDAA 3ITKA 2NMOA 2OX0A 2Z69A 4ZXKA 3HT1A 4N6JA 4Q8LA 4YWAA 2WZ8A 1KQGB 4MH0E 1LTBC 2I2SA 4C1WA 1AR73 2HWF2 4HLTA 3J7NA 5GLUA 3PHMA 5CFDB 3RK3D 1VBE2 1OUSA 1F9KA 1LWUB 1GK6A 2J59M 4HFSA 3E5QA 4HL0A 5A7QA 4IERA 2DTYA 1OXZA 2Q8DA 3OJBA 1XE7A 1KDKA 2W83C 1WLCA 4YLZA 3O1VA 5FYHA 1DIPA 1HWTC 4CU6A 2HR3A 1DYKA 3H1LD 2K9ZA 1MR5A 1KB9E 1YTZT 3O0WA 2WA3A 2VGDA 3OEBA 3WF0A 4LGDE 1BBT2 2PAKA 1PIV3 4EN6B 1QJY1 4K1YA 3I3QA 4I7ZB 3ZYPA 5LZ6A 3ZYBA 2JDIH 3P3PA 1XNBA 2I45A 2AEFA 3MPBA 4LBKA 3I3BA 5LA9A 4QHBA 1RVF1 5KHJA 1XYPA 3AEFC 1O3TA 2ZAAA 2BFUL 5FXWA 1I6XA 1GP4A 3LSDA 2Q1FA 2W46A 5K9YA 3IB3A 1HRV1 2ZGMA 1OVPA 3NNGA 3DUIA 1BGYE 1HGVA 4MGSA 4RFT0 1LGHB 4IXLA 3NNFA 4C91A 2FCUA 1H8TA 2OYIC 5FYUA 4B4QA 2ZGOA 2QRXA 3G6EP 1JZ6A 3NRUA 3IN6A 2OUJA 4LK7A 2NPSA 4YG0A 1TME2 2A3YA 1LP1B 5FLHA 3LZZA 3V5BA 5FZIA 1EZVI 2HLOA 3RYKA 1KQFB 4UT5A 4XMIA 1JY3N 2H0VA 2TBVA 2CGNA 2A73B 5HV4A 1LENA 3I5CA 1NA1A 5BYNA 4BXSV 3BVHA 2OS2A 4GT1A 3O1TA 1U12A 2XVGA 2FYUD 5H9PA 1QJU3 1LTIC 1QJY3 1SQQJ 2UWCA 1GU5A 2QIWA 3L2HA 3WV6A 5GZDA 1LR5A 4JC1A 3TGUG 1R092 1NKGA 5ABJC 3F2ZA 2WNUB 4YW5A 3CI9A 1WMKA 5LA1A 1FNZA 4C0HA 1FZCC 1VMHA 1ULCA 2R6QA 4HMZA 3CWBD 1DF0A 1ZNPA 3KV5A 1RE4A 4MOAA 4D7TA 5FBZA 4DJGA 1GWMA 2KZJA 2E9QA 1NTME 1ASJ1 1JW6A 3AYCA 2IFNA 3L72J 4Q0UA 3RJRA 3PL0A 2VTXA 3M3EA 4MG2A 4M00A 1HRV3 1VAKA 2XJUA 1QQP3 3KMHA 1RUJ2 3ZMOA 2XKMA 1JZ5A 3RZZA 2R041 1Q2NA 2D3SA 1V6OA 2PHLA 2B87B 1IKPA 2ATFA 5IYYA 5DZEA 3VZOA 2XZRA 1U7MA 3CC2P 3KV9A 1U5IA 3M3OA 4F7ZA 1H8VA 5KLVD 4JVAA 2XJRA 4NHLA 3HUSA 3OGSA 5GTHE 4UFHA 4IEVA 4M0NA 3ZX7A 4YPCA 4HSLA 4Y99C 4AQSA 1WLWA 5A6ZA 3AKPA 4BB3A 1RXGA 1FZCB 1WCQA 1S0GA 5FLIA 2D2CB 2YZ4A 3HE5A 2C9NY 5T5JA 4COVA 4HKOA 2VCAA 3BI3A 5AVXB 4V2VA 2FYZA 1J1DC 4M3CB 1VPCA 1ODMA 1PPJG 4IV3B 1S5LX 4COZA 2N9BA 1X8MA 3PJYA 5T5OA 4LOSA 1UOFA 3RK3C 2FDIA 4B86A 3UK9A 1OFSA 1W28A 3LA7A 4QHZA 1ASJ3 1XE0A 4JQTA 3I56P 5LEJA 1NCRB 1W6PA 3AYDA 3BN6A 2ZVNB 4CSWA 3D70A 4JDMA 3IBMA 3AE8C 4A6OA 4WY4D 4JKKA 3L70J 3HOBA 1LU2A 5F32A 2KS1B 3D82A 2VOVA 4PBPA 1QU0A 3ZN5A 1K12A 1DGWX 1TMF2 2EIEA 2P67A 4PJYA 3FHQA 1NTKE 3OUJA 4P9GA 1WW6A 4KWJA 2A06G 1NTZD 3PUQA 3V0BA 1PHMA 4YW7A 2WO2A 3KZIE 4LIVA 4M3LA 4BOWA 1SLIA 5FZ6A 1AXZA 3QH6A 2D6KA 3LA3A 1NH4A 1AHSA 5FXXA 5GLTA 4LIUA 2WWJA 4LA2A 3ZYFA 2VMEA 4W50A 5F2WA 4Y20A 4D7SA 3KV4A 4EWDA 3VBHB 4CCCA 3WD5A 1SQBK 2OZJA 3M4FA 3AL6A 2WABA 5FY1A 4Y5TA 1MS5A 3WDVA 1W6OA 1ZRDA 1JOBA 3ZFGC 3ZSKA 4P5HA 3PTZA 2XONA 2YBPA 3AKTA 4PJ0E 2TEPA 2JX9A 1FATA 5APXA 3HPNA 1SLTA 2IXIA 5FDBA 1GNZA 2GC1A 4MXWA 2QDRA 3WF2A 1DD3A 3RZLA 3FXEA 3FL7A 1K5JA 1ND2B 3ZFFB 1NE4A 3B5ND 3JBG1 1JZ7A 3OY8A 4PIYA 2W1UA 4XUPA 4CEWA 4FOQA 1H0TB 2W92A 1ACCA 3LDRA 3KZIH 1L0NK 2EXHA 3WDUA 4LBNA 3IR9A 3IPVB 5DAQA 4KHXA 3EQ2A 4D6TE 1V00A 3KCCA 4XZPA 4OH8B 1IFIA 5FMCA 4UBHA 3R4UA 2SBAA 2QQMA 5JOXA 2JECA 1SQPK 1SVFA 1JYIA 1ZZ6A 1W8NA 2WAOA 5KWRA 5LB6A 4D3WA 4LBQA 1SHWB 5B66H 1IFPA 1HQLA 4ARXA 2QE7H 5FPVA 1J1LA 3DXUA 1ZP0C 4JPZB 2YC0A 3ZFGB 4JYBA 5C5TA 4QQHA 3VTPC 1PVXA 3ZYGA 3QH9A 2JIGA 1YQ5A 3T1MA 2W6BA 2FXPA 3WDTA 4Q4Y1 2AEYA 4BPZA 4RHV3 2X5IA 2DCTA 1JH5A 1RUI3 3CJXA 1Q82Q 1OWAA 3D5OA 5K0UC 4HKZH 1QL2A 4Y1UA 4DT0A 2HWD3 3SKVA 3H1IE 5GZEA 1U5ZA 5KAIH 1NU1E 4JGZC 4LT5A 1RUF1 4JF7A 4BCUA 4AQTA 3TSIA 1B09A 5FZMA 3JBG3 3WW4A 2J1RA 2LRPA 1TNFA 1W9SA 1LRHA 4ZMDA 2CNAA 2ZGQA 5JXGA 1OLMA 1KXGA 1IPJA 1LTGC 5FZ3A 1BCCD 5APAA 1P8JA 1REEA 2IX7C 2JENA 2QQKA 4JRLA 1Y9QA 4U3FG 3U11A 1ZBE2 2VNRA 3RVHA 4N78E 2ZZJA 3ZYJB 5CU1A 3BOPA 5I91A 4AFDA 2R3SA 2V4AA 3ALQA 2Y34A 5JDBA 1L0LG 4DRRA 1UOBA 4QPIC 3OD4A 1VQ8P 1BCXA 2ZOEB 1EUTA 2IVIB 4BISA 2DTWA 4O61A 4K35A 2WSCJ 1RF1B 3KT1A 3H1JE 2PFXA 5F37A 3ZR6A 4JHTA 3V0AA 5AW2B 3ECQA 3VBSC 1RUD3 3I59B 5K0UB 2FYNB 3IWZA 4PIZA 3B93A 2LXCB 1JO5A 4Q4Y3 3U1AA 5K7PA 1IFJA 4H44B 4WY4C 1R1A1 1E79H 2YY1A 1RMU2 3H0OA 1NE6A 3OGGA 4A6SA 1HV1A 5DG2A 3A22A 2XR4A 3GJAA 4NPLA 3EO6A 3GZUC 1PGOA 4B1LA 1L7LA 3ZKYA 4XUOA 3H1LJ 1Q56A 1RUF3 1SQVK 1ODNA 3U4SA 5A3WA 2VPVA 1V6JA 1JBCA 2IBZI 1QXPA 1FMD3 1QDOA 4OVEA 4Y1VA 1OHFA 4QPGA 1NXMA 2DFBA 2VZ1A 3HVDA 2WPVB 4MYEA 2R071 4GQ7A 2W94A 1ZW0A 3R6SA 1CPMA 3OOXA 2FY8A 1BGYG 3A23A 2IZ0A 1MQTC 4IL6H 1V9U1 2ZS6B 1MZFA 4C8DA 2HODB 1LWUA 1LOAA 5IVFA 3OGJA 4Y1XA 1AR61 4JZRA 2IPPA 1TVGA 2GZWA 3WHUA 4HETA 1LJ2A 5JSRA 2WT7B 4WY4B 2Y38A 2H0BA 1IK9A 1CZSA 1H0BA 4Q0SA 3MV11 3NO8A 5APUA 3LIHA 1DZQA 3OF1A 5GZCA 4W80A 2JWAA 1KZUB 5EP9A 5FUNA 2YUEA 3I54A 1OA4A 1YJLA 1R1A3 2ORXA 1R5LA 5E1RA 3HT2A 2P17A 1CD3G 1HB3A 4AHYA 5BUVA 1AR72 2D40A 3RSJA 1K8AQ 1XJAA 2J1TA 4BDVB 5T5LA 1GL2D 3LGRA 4RSUA 3UETA 1T2KD 2FYUJ 4LLFA 1YEWA 4Q4V1 3POWA 1BEV1 5FJKA 2J7MA 1MQTB 1SFCD 2QQPA 3POIA 1URXA 3O7OA 3H1HG 3L73J 2VZVA 1VBB3 1Y9GA 5GZFA 1FAVA 5JR2A 4MADA 4X8NA 5M1BA 2B8MA 3J8F2 1UIXA 2YGMA 5EJ3A 5IVCA 4FTSA 3VKFC 1KQSO 2W47A 3CWBJ 1NT0A 1EDIA 5CEHA 1V9U3 1PIV2 4LHNA 2D6MA 4YW3A 3CZUA 4CDQC 1U7JA 2IZ1A 1LP1A 3HQXA 4CP1A 4KWUA 2B7YA 3VMAA 4N9IA 4E4SA 2CU5A 1PGL1 1BMV1 2GN7A 2GM4A 1SLCA 3OBTA 5CMZA 1N86A 1EY2A 1RGSA 2XXZA 3ZR5A 1LHNA 1AA0A 1UIKA 5KLIC 1RIRA 1W0PA 1NZCA 4HVRA 5AW8B 4QX1A 4LKDA 5G05L 2RJLA 1CONA 1OPOA 2BJSA 1VRH3 3MGUA 3BALA 1SQQK 5L8RJ 5KLVJ 2N9YB 1AX2A 1IS6A 1KORA 2BCCJ 1JMMA 2BV4A 5IAXA 5F3CA 2WNUA 2XDVA 2VQAA 2HWE1 4IE5A 1EYBA 2A45I 1MZ5A 2HBUA 4W4ZA 1LT9C 1RB8G 3HNYM 1J3QA 3U4XA 4I6MC 5IWFA 4Q0PA 4ITCA 4JTNA 4EJRA 3I2IA 3H8OA 1DQ1A 2ADDA 3L74E 2A45H 3POSA 4NHXA 1KFNA 3C3VA 1FX5A 1J83A 1OXCA 4TZDA 1BEV3 4DUXA 4D8MA 5A1FA 4F83A 4H0LD 1GICA 2K2SA 2P1BA 2Q8CA 1QLED 4AVCA 1UW8A 4QX8A 2YIUB 3RZKA 4NOTA 1VIWB 1ZBA1 2B87A 1IK7A 3UESA 1O3SA 1YLLA 1QJY2 5IT6A 2OPKA 3T1LA 1VQNP 5DUXA 2G9FA 4QHOA 3NV2A 4MV2A 1UMZA 3GF6A 1E5RA 3AZWA 4GMP3 4HSJA 5FYZA 1QOSA 3LE0A 4YM3A 3PLQA 1CJPA 2FMDA 1NTKG 3GXUA 3G6JB 4ASKA 5IK5A 5B5EE 2JICA 4BQWA 5EZWA 4BQ1A 2RH0A 3ZXGA 3BTXA 3CMGA 1UF2C 4BMBA 1ULPA 3NKTA 2XV5A 4PLMA 3AFGA 1PGW1 2XJSA 4DOJA 2QNKA 1EAH3 1Q8OA 2WS93 3RPQA 3I2GA 2NMNA 1FZCA 3KWVA 4YRDA 2BOIA 3N9NA 1HRV2 3NAPC 1NTZJ 1OFCX 2H6CA 2HWE3 1NG0A 4XMAA 1C8M3 5C3OA 1PO13 2C0XA 4IV3A 3MUY1 2YFUA 3SFEC 2V4VA 1L7QA 3W67A 1WLDA 4FPYA 3PVEA 4PT6A 4IFMA 2Z2SB 2VZ3A 3TB0A 2JO1A 1W8WA 3OB8A 4WVVA 2LXBA 5IVBA 3QACA 4CPBA 2JE7A 1NCRA 2UU8A 4DINB 4RS5C 1OH4A 5ANNA 1GQGA 1RJ8A 3SH5A 3VL8A 1NLQA 2WBKA 1GU4A 1GKBA 1W99A 5B5EH 3J7HA 2FFDC 2O3JA 5KJ7D 1ND3C 5FY0A 2KS1A 2VZQA 2M0BA 3OJAB 1GZTA 3D6EA 5F3EA 4K40A 1W2TA 5EV7A 1Q86Q 2Q5TA 3GZTB 2O1KA 1LHVA 1KV4A 4FVVA 4EN7B 3A0NA 4OQ8A 2D3RA 5F3GA 4DB5A 3RGUA 3CCUP 1QEXA 2GN3A 2LUWA 4DS0A 2HWC3 2CL2A 1F15A 3NAPB 4XFIA 1GL2C 4W8JA 2QJPB 1T2KC 1OFNA 3CL3D 1ASJ2 1GYKA 4RL7A 4E2QA 3C2UA 2H8PD 1UYXA 1SFCC 1SDWA 1VQ7P 3LA2A 3AVSA 2Q1MA 4RR3B 1DP0A 1LHUA 3VBHA 1KS4A 3N9MA 4N43C 4E4DX 4AI8A 2R042 5BNNB 1A6CA 1BDDA 1GR3A 3ZXEA 4G3YC 2W90A 1OOPC 4OHYA 2ARCA 3KQ4B 5H9RA 3SCFA 5C8CB 4EN8B 1CI6B 1SDDB 1EV13 3AKQA 1UKRA 3H32B 1ND2A 4CU8A 5CZKA 2ZT9D 4HT1T 3ZFFA 2YXQB 4UW3A 2D5FA 2JEMA 5KR7A 2Q30A 4UB8H 4XTMA 1Q81Q 3ZVXA 5AVYB 1HKDA 1NO4A 1H0TA 3DKWA 1GFF2 3EB7A 3S0MA 2Z5IA 1W39A 3EXUA 1Q3EA 2R0FA 3NV1A 4CCDA 4XFBA 5JXJA 2BEQD 3MLLA 2XBO1 2CSGA 3IPVA 4MSVA 5FZDA 2E74D 1DQ5A 4DFSA 1VPHA 2PAJA 5EQUA 5F2SA 1PM4A 4LBJA 4XFCA 3CL1A 1OW8A 5FZKA 5IK8A 4IL7A 3C7FA 4FXKB 3CO2A 3K75B 4AVVA 1SFCB 3T2OA 1PV3A 4LEJA 2VMFA 1N1TA 3WLUA 2OTKE 2ENRA 3AE9C 3H25A 1BCCJ 5CBOA 3AEBC 1YWKA 2DDUA 3ZFGA 1QXJA 4BWNA 2HH9A 2Q1ZB 5CKNA 1OLME 1BZWA 5FYCA 1VBD1 1OOPB 3AZXA 2RN0A 1Q8VA 4H0LC 1EXJA 4YW1A 3WUCA 2VR4A 1YFUA 4CXYA 5E6HA 4INDA 1DZTA 3P3NA 3O8ZA 2IYPA 1VMFA 3D6ZA 1JUHA 3H1KD 3DPRB 4NR1A 1R64A 3E6BA 1BQPA 3OYWB 2Q9IA 3AP6A 5LA0A 1WD3A 2XKPA 5L73A 2QVAA 3MIDA 1UZVA 4CCKA 1IFMA 3PJQA 3VDDB 1COV1 1ZLLA 4IOIH 4BIFA 5F39A 1CX4A 4HYTB 2Y64A 3WNNA 5BV6A 4P9XA 5A1AA 1UX6A 4DMIA 1BLZA 4XXPA 4FSJA 3SISA 4E2GA 3W58A 5FUIA 3WUUA 3SSUA 4QQPA 5FO7B 4QWNA 1POQA 5FZLA 3T2QA 3GBFA 3VHRA 1E5WA 1LULA 2WWWA 1RUI2 2OGUA 2IXLA 5BNPC 1Q8PA 2QQVA 5FPAA 2XNXA 3ZYHA 4LKEA 1W8UA 5A3LA 2C0WA 2GU9A 1C8NA 1IFDA 1OQDA 3T0BA 4QB6A 2ZX4A 4XACA 4E8DA 4CE8A 1DG6A 1B35C 4Y24A 5A32B 4QU2A 3JBG2 5K0UA 3I59A 1YJKA 3LEGA 3B7MA 3FHIB 1E57A 1PPJD 4LOTA 4FPKA 1QJX1 2YBKA 3QH7A 3LQCA 1N3PA 1AVYA 3ZN4A 3SXWA 4Q4W3 2YMYA 4AVTA 2V7QH 4DPNA 1S0CA 4B7EA 5BY5A 4K20A 4AUWA 3GCXA 5LBFA 2E5TA 2GA1A 1GDTA 4N9HA 5CFCB 2HPCB 2PXJA 3IDBB 2BGPA 1HJGA 5GLVA 2RS51 2JG8C 3Q9OA 3CXHE 2RMU1 1QHDA 4XIKA 2Z5HA 4ZKUA 2QQJA 1COV3 5B4XA 3VZJA 1RUC3 4E4ZA 3GHGC 3PVBB 4J25A 1GZCA 5KXBA 4EDFA 3WR0A 3FC0A 1WW7A 5I0SA 2B9BA 1RUD2 3U10A 3EBRA 2A06D 3B5LB 4D69A 4Q4Y2 5A3TA 1RF0C 5AVVB 2HODA 2RS31 3I8TA 4PHZA 3E5XA 1HB2A 2E7TA 2QQUA 4GWJA 1B35B 3DCQA 3H42B 3Q2YA 2OUHA 3L37A 2EVXA 1H6YA 3FJSA 3VZKA 4Z2AA 3AJZA 3B69A 3N7JA 2OYHC 1RUF2 4G4FA 1FXZA 3TNPB 2WT7A 4WY4A 2P6HA 1W8ZA 3D3AA 1LOFC 1YCIA 2ZGUA 2ZT9C 2K0GA 1AR93 1FMD2 1LEMA 2QQOA 3SEEA 4C46A 1QJX3 1NWQA 3KD4A 2ET7A 3CCJP 1RH5B 2G9GA 2A70A 3L71J 3H1MA 3VD5A 1JUNA 1DGRN 4CUBA 1AJOA 3CX5D 2IFRA 2E74C 1BE3D 4MGZE 5BU5A 1KRIA 1HJFA 4H13D 3P6BA 3GHGB 2UWBA 1G1JA 3UKVA 4WM8C 1WW5A 1W5CE 2RS53 2OVUA 4HN1A 3L74G 2FYUK 2GNDA 2WIIB 2E7AA 1MQTA 3N35A 1O91A 5E89A 1CAVB 1ENXA 5BNOC 3POFA 1N47A 2IXKA 1ULOA 2JDZA 2ZKLA 3MW3A 2CYFA 1W8TA 4N53B 3I2DA 1L2PA 3JCUE 4GODA 3ILNA 4M0HA 5A1LA 3U78A 4UB6E 1OI6A 2WQ8A 1CZVA 1JMBA 1CQ9A 1R1A2 5FKBA 1N1VA 3A0BE 2XB6C 1JZ3A 4LLHA 3ZXJA 3MI8A 3P8CD 4P5YA 1JU3A 4LLOA 2A6XA 2A71A 4JKLA 2Y6FA 3OUHA 3VD4A 2Y6JA 4JX0A 2AXTE 2E33A 3MFAA 1SQXE 3GLMA 4Y4YA 1SQPD 2YU1A 1QVGO 5ACA1 1X82A 1O4TA 4WVWA 3MIWA 5JZGB 1MS0A 1BBT1 2WNEA 4GIFA 1UZYA 5A3UA 1GTWA 4FFIA 5KLVK 3H8RA 2QG4A 3B4SA 3K51A 4GZ9A 2JKVA 1ENRA 1RE3C 4W7YA 1ZRRA 1V9U2 1HH0A 5FV3A 4CYDA 1DEEG 3C8XA 4YGDA 1AR62 1EZVG 1SG3A 3PVOA 5A6QA 1Y7BA 1IG3A 2VRSA 1SZBA 1PX4A 5HCBA 2Y9ZA 1AYM3 1QH7A 2JWDA 3DN7A 4GAZA 2RJ2A 3CZJA 1M57D 4LO6B 4WVMB 2WTYA 2OW4A 3DL3A 3AE5C 4FTEA 4LITA 4P08A 4IL6X 5C4WB 1ZXGA 1PP9E 2VG9A 2YKQA 1YJNP 4XC9A 4M3CE 1VRH2 3WEZA 1FOD3 1N3QA 1ZN5A 2G4IA 1Q8QA 1CZQA 4EYUA 1YBKA 1JHNA 2YV8A 3P5BA 5LCWL 3PIGA 4FPJA 3G3ZA 1KB9D 3CDZB 4PBOA 2NQYA 1VF5D 4FPOB 1BSNA 1K5MC 1LTJC 1QF3A 2CPBA 1G86A 4LUKA 1PZ7A 3VN4A 3LSEA 1KD1Q 2KNCB 1BEV2 4SLIA 4H7MA 4X6QB 4J6GA 4PI2A 1U57A 5ACA3 1CX1A 1KILB 4PV1B 2UYBA 1M90Q 1G9FA 4XHBA 3VBOC 3CCQP 1DDLA 3MDPA 4Q0VA 1GZ9A 3RS6A 2W6AA 4I02A 2J1VA 3MGNA 3AP9A 3S57A 1FJPA 3ZXLA 3CHXA 1YI2P 1R091 3S9OA 4A7KA 1UY1A 2P2KA 1AJYA 2BU9A 3VBRB 3WG1A 2ARAA 4OFGA 4CDWB 1PGL2 1VAVA 1BMV2 5C3RA 3N9LA 1OMIA 1NYWA 4GKYA 5IVEA 1J1TA 4PCRA 1YI9A 2KM2A 1G8WA 2R32A 2OKXA 5L9RA 5KKZC 1BGYD 5SV5A 1MFZA 1E5IA 4IEQA 2FDFA 2JDYA 1RUJ1 1EAH2 2WS92 4HKLA 5FZFA 4QT6A 3W20A 3PURA 4KT0J 4CP9B 4AI0A 4Y33A 3ZFEC 4KG8A 3LAGA 4CP2A 4ONUA 3GG2A 1CAXB 4J1WA 5I8SA 4IETA 2HWE2 2GUVA 2QSIA 1W03A 5EFUA 1QNYA 2JDPA 1ENSA 5FAXA 5FZOB 1LOBA 5FBJA 3NAPA 3VBOB 4H13C 1N7SD 5FZ9A 4QB1A 1ULEA 1FPN1 4MLOA 5T50A 2Y6LA 3UGGA 1X8EA 1WRGA 3UKTA 1BYHA 3T4VA 4RR3A 2SPZA 1IOAA 4W6WA 1W9FA 5FWJA 4NIHA 2CY6A 2BOJA 5BNNA 2XKOA 4L75A 2Z42A 1PX3A 3CU7A 2VCMA 1R083 4BLIA 2KD7A 4OUEA 2DYCA 1POV0 1MKMA 3JU9A 5J1XA 3CC4P 5C8CA 2Y0CA 1HN1A 1NTMD 1UZZA 1CI6A 1F31A 3H32A 5FK8A 3A0HE 2W08A 3KHCA 1FAYA 1JYTA 4DIQA 1PGSA 4GWMA 1W2EA 3AFKA 5H9SA 3WQ1A 4K6BA 2YU2A 3ZFEB 3WX5A 5H2FE 1PGW2 1H2LA 1BJQA 2FCTA 3AMPA 3UL2A 1WD4A 3UIAA 3H1KJ 1YHQP 2R063 5I0UA 2WPRA 1FU1A 1S4CA 2BRTA 5TISE 4ZHNA 4LKFA 4U2AA 1ZZ7A 1S3JA 3ES4A 1OKOA 4H13B 4AE2A 2LR2A 3HMYA 4XPVA 2EIDA 3OPWA 4BQXA 4IEWA 3G71P 4Y5Z0 2P58A 4PDWC 1GW4A 1SFCA 4YM1A 1UOGA 3AX4A 2VAUA 3U1XA 3POYA 4P14A 3RFRA 3BCCJ 5FYVA 1CGPA 2Q3IA 4IE0A 2X29A 3ACGA 1OOPA 3L72G 3L73E 5BXXA 1FE6A 1WMXA 3HBZA 2VZTA 4KQ7A 3BTZA 1KFMA 1C1LA 1PGQA 5F5CA 5LW9A 1VE0A 4DNYA 1Q90D 4Z1VA 3AEEC 4KBBA 3PUHA 2O01J 3POEA 1IS5A 2ERFA 3DPRA 3E6DA 3TK1A 4NWWA 2BGOA 4IUGA 1S72P 3OYWA 5TISH 2FKWB 3FFZA 3CCLP 4ZXEA 1YJ9P 4OHZA 4XJAA 2YHJA 3ENRA 3VDDA 2Y8KA 2ID4A 1VF5C 2W95A 2QZ3A 3V2RA 4O9EA 1JY3P 2KYVA 4QGNA 3I2JA 2VOKA 2BNOA 5FZHA 3AEGC 1RJ7A 4Q5OA 1NTKD 4OQ9A 3PHLA 2BCCE 1RUE3 3JXSA 4IW3A 3VBFC 2Y6KA 1H88A 4NJ4A 3GF3A 3TGUE 5FJHA 4CA9A 4XZUG 4LTAA 4UAPA 2M3BA 1GQPA 1WKYA 1VBC1 3FWLA 4DEVA 1Y47A 3J7MA 3H9AA 1DIWA 1MPXA 4XCAA 2WA4A 2VW1A 3SCHA 4YVSB 3RZJA 3CIHA 4QQ2A 5CKQA 5A32A 4XJ8A 1WZXA 4ZU5A 4ZNCA 2JG9C 1X7NA 3THDA 3L70G 1CR7A 3LIGA 3ZSJA 5FUPA 5KHIA 2FQPA 3LEMA 4WBBA 5F7UA 2BVBA 2VNVA 1UYYA 3KSCA 2QUOA 4IV1B 5CFCA 2HPCA 1DGWA 1VF5B 2OQ6A 3MIHA 2WSFJ 5KXCA 2OTLP 4FPEA 2R1BA 2E76D 4RQPC 1N73C 3SCGA 2JDHA 3VP8A 1W6NB 2R16A 4IEOA 3V2PA 2JD9A 1N7SC 4ASWA 4XAEA 1YQ2A 4ET7A 3RYRA 4D6TD 1CESA 5AVUB 3T2TA 5KHHA 3U1CA 1LT1A 1WW4A 1BE3J 2OPWA 3CPWO 3OD0A 2IFWA 1DQ2A 1OW7A 1SQBJ 4Y20B 5FY4A 1ZBE1 2VTFA 1XSQA 4ZU7A 2B5HA 5FYIA 4FQ4A 1NHLA 3MZHA 3U59A 3CJIC 2J1UA 1B35A 5DPNA 2O14A 5JPMB 5DDJ3 3KS7A 4P00B 4LORA 2YPDA 2YO2A 1D2QA 1LNSA 1RUH1 2VZSA 1LCLA 4S2FA 1F5FA 4QD2A 1NJIQ 2WNVC 5DUWA 1PVC3 2B39A 1KC8Q 4MUVA 1SQXG 1COV2 1ULFA 4BQ3A 1PMIA 1XU1A 2RKLA 1YIPA 4FP3A 3GDBA 3CD6P 2WT1A 3HR9A 4L92A 3H1ID 4CEYC 4BA6A 2AENA 1UY0A 5J7MA 1QH6A 1NU1D 4MXVA 1DLLA 5FP7A 1VQLP 4IFFA 4I30A 5C70A 2QJKB 3SLIA 3PTRB 4Y28J 2JE9A 3GHGA 3KPEA 2E42A 1VJ2A 1Z7S1 4BK5A 3O1UA 2UY9A 1SQPJ 3VD9A 3SFDC 2WYFA 4GALA 1OLQA 2E5YA 5LBBA 1T8ZA 2JDUA 2C1FA 1CAVA 2LALA 4QKBA 1NY71 4CRQA 4AEDC 2W27A 5CAZA 1RF0A 1VLNA 1OVVA 2M3EA 1DCSA 3SEPA 1PM7A 5BVZA 2CWMA 5FPBA 4OHVA 5F1RA 1IZ3A 1OKQA 3CJIB 4N78D 2WDBA 1AR92 1W3XA 5A7PA 1JOJA 3U75A 1MS4A 2ZPXA 4O9GA 2BZDA 2EAKA 4QGLA 1QJX2 1PP9G 5IK7A 3FWNA 5J37A 4KL1A 4CXWA 3ZSEA 2A6ZA 3WP4A 2SLIA 1LOFA 2OQQA 5GTIE 1V0AA 3H1JD 2PMWB 1RUH3 1HBWA 2Y26A 2PGDA 3ACFA 3RK2D 3K4DA 2EF6A 1SCSA 3HEIA 1PNGA 2RS52 1J3RA 4CDXB 2RMU2 3ZXAC 3RRDA 2P5BA 4UFLA 1HX6A 2JB4A 3AE7C 4AAPA 5JZGA 1H1MA 5F5IA 3EWKA 1UD1A 2IZWA 3ON7A 1PZQA 4WBAA 3B3QE 1AX1A 3BVCA 5HBAA 2J1EA 2Z5WA 3W5MA 5CCHD 1RY3A 1L4AB 2BBAA 2VZPA 5I8YA 1S0EA 4XVHA 1LESA 5FCCA 1NCQB 1QNWA 3HN1A 4UW6A 3D6YA 5AW3B 3TYYA 4HONA 1MZEA 3WU2H 3MBWA 1FZAA 4EWEA 2XVLA 2FHRA 2VQUA 2CAVA 1G9CA 2WSFH 4BJ0A 3VD7A 1C3HA 3K48A 1A8DA 4WVMA 2ZACA 4NE9A 2MKVA 1W04A 4HZFA 3CX5I 4L8QA 5C4WA 2UWJE 1DGRA 3POBA 1UXXX 5FP8A 5FREA 2WO1A 3ST7A 2BEZF 4QQLA 3ZYRA 3NNJA 1ZM1A 1PIV1 2XDJA 4DEQA 3RL0D 4LXLA 4WV8A 4CUAA 1BGYJ 3OBAA 4Q0QA 2ZXQA 4GJYA 3T30A 3H1LG 4KNCA 5DG1A 2P4EA 1SQVJ 5AC91 1X22A 3O0VA 3WNKA 2KNCA 3QD6A 1YC61 3P7KA 4AW7A 1HRI3 4XF0A 2E76C 1RE3A 4GH4B 1AYM2 4TWTA 2DUOA 4WZCA 5GALA 2NPSD 1SBDA 1JZ8A 2QA4P 4COUA 1X50A 2KXLA 3MPPG 3AE2C 3BYWA 4S2DA 5CNAA 1XNAA 3HWJA 1H9PA 3HQUA 1KFUL 1LEDA 3WUTA 4PLOA 4U3FE 1IKQA 4LE3A 1PL5A 1HJ0A 3VBRA 2JJ6A 1YFXA 3D0JA 5HI0A 2WFF3 3FGAD 4CDWA 4LUMA 1L0LE 2Q5UA 2EALA 1QL1A 4BE3A 4YVWC 3LWCA 2Q3EA 2BGCA 4YNIA 2WYSA 4XURA 1UXZA 4GB31 2NZ9A 5K8SA 1YQ3C 1PNFA 4DZGA 3FLPA 2VMCA 5IJRA 3N9OA 2OTJP 5A70A 3AE1C 2A7AA 1WBLA 4XQ4A 5KBFA 1OVRA 4TN7A 4M4PA 4YZ3A 5ACA2 3T09A 1OD3A 4CP9A 1BK1A 1NTMJ 1G2CB 5FR3A 3BKZA 2YGLA 1R8EA 5FYSA 1ST8A 2PHFA 1QJU1 3A0KA 5C9AB 1CAXA 4DXRA 4XE5B 3USUB 2LTNA 4FFHA 1PFIA 1AUYA 1HXS1 4LBLA 2RR13 1D0GA 3M3IA 4KGQA 3TBDA 5APTA 3IIIA 1H89A 5FZOA 2E75B 2KLUA 1C28A 3OCPA 5AC93 3VBOA 1D4VB 4QDSA 4LULA 2FYUG 2GUSA 1D2SA 2C9LY 4V2WA 4HG6B 2YYOA 3ITQA 3I3EA 1ZRFA 3AEAC 1XSRA 1BHGA 2MEV1 3L73G 3WW1A 4R52A 4N7IA 2ZGNA 2JKXA 3VD3A 4AAXA 2ZHNA 1NQDA 1QQP1 4XJ9A 1AR83 4YVWB 3BPSA 1KB9I 2CK3H 3CWBG 1GOFA 3S7EA 3L74D 3NNMA 3ZYIB 1V6IA 3MUDA 4MGQA 2PAEA 5F9TA 5JI7A 2YC2A 1KB9H 1TG7A 3VB9A 2TUNA 2A6WA 4GB33 4BQ2A 4S2GA 1S0DA 3EQEA 1XE8A 2XWJB 4X8PA 1PGJA 2VBBA 1GZLA 2W1WA 3ZFEA 3VKMA 1FDIA 2QQLA 5FYBA 1ZZ9A 3RK2C 1BDCA 2PA7A 3WZ1A 4LA3A 4RGGA 1W0OA 3AECC 1XTCC 2XOMA 3ZIWA 3B9CA 3L71E 3M9BA 1SFNA 4FAHA 2VUDA 2ADEA 1Q8SA 5KLVG 1JUIA 3VDAA 2PP6A 4L73A 5C3QA 2BCCG 1DQ0A 3R4SA 2PAMA 4QX2A 1HXS3 1S4XA 3AMNA 1U5YA 5GM0A 1R082 1GWKA 4E8CA 1VBE3 3WSOA 2XU6A 4BYYA 4Q4X3 1KTMA 5FMOL 1IG0A 5CCHC 1GMJA 5D8AC 1UO9A 3I3MA 2ILMA 4AVAA 1JM0A 5EHDA 1NTKJ 3IN9A 1FOSF 1RITA 5LBCA 1W90A 2WPQA 3H1HE 2MEV3 2C9AA 2OYIB 3K46A 2WAAA 1JY2N 1UPIA 5I93A 1JYNA 4ZS2A 4AGGA 2E32A 5FZBA 5T55A 4OHXA 5JMOA 1HQWA 4PF5A 2C4XA 3MHZA 3DF0A 4KBZA 4MHUA 2AUYA 4OI0A 4LHKA 2AREA 1S5LE 4Q27A 2BVVA 3UYJA 3RL0C 2PHUA 4BWOA 4ASMB 2GNBA 2W1SA 2WPSA 3UJQA 3LOBA 3U37A 3DXTA 4AYUA 4Y1ZA 4PF1A 3WY6A 1YHFA 4QKNA 1FPN2 3PJSK 2PTMA 2KXPB 4JHZA 1O6UA 5ABJB 4IEXA 3WNLA 1ZA7A 2DUPA 5CKMA 2NPSC 1N1SA 2Y0IA 5FZ8A 2D6NA 5IVYA 1NTZG 4PLNA 5FMOS 3ORJA 1Y4WA 4L97A 2WUHA 2I1KA 5F5QA 2UWAA 5F3IA 2E7QA 5JWPA 4B29A 3E6CC 1ZA4A 5KHGA 1NA1C 4D6TJ 2WSSH 1H4GA 3V64A 2PHXA 1X9VA 1GZWA 4YXWH 2W2IA 4YVSA 5JR7B 3I55P 5F6LB 1Y3TA 1G6NA 5DZFA 4OCTA 4CDUC 1LB2A 2ZYGA 2ZFCA 4GOEA 5C71A 1UMIA 4LK6A 4ZS3A 4QXBA 2Y0OA 2J42A 4LBQD 4W6YA 4B3NA 5GTHH 1RUE2 2DCZA 4IV1A 3HD8B 3JB4C 5CYYA 1JCCA 2VO5A 4R8HA 1I5PA 3HE4A 1JS9A 4Y99B 4JQ0D 2HBTA 2JD4A 3TRSB 4R9CA 1BVP1 3FHAA 3VBFA 1W6NA 4XJZA 3QOPA 2RV9A 3H1IJ 2XJPA 2QE3A 1NU1J 2ZHLA 4FFFA 4FPLA 1Q7YQ 2HWB1 2DBIA 1GSLA 2NLRA 2VQ0A 4Z92B 1GU3A 3AJYA 1LGBA 2B42B 5IVVA 1W6QB 1J1DB 1CWPA 4L76A 5A7OA 4EN0A 4N3YB 4YM2A 3TNQA 3ZSLA 3VZLA 3RK3B 3W59A 2ZEXA 3HUSC 1H1AA 3MW2A 4S2HA 4RHV1 2VD7A 4XFHA 3KHUA 4OMCA 1RUI1 4K8RB 1DHKB 4UFJA 4CDUB 5A33A 2HWD1 4AZZA 3OUIA 1KJLA 2KI7B 2GNMA 5DUVA 4D7YA 4HB1A 1EDKA 4B8EA 3CEWA 1RUOA 1X79B 4GIQA 3VKLA 2CV6A 1Z56A 2J58A 3D8CA 3WDYA 1V6MA 3KGZA 4JV4A 2CTVA 3H1JJ 4XQDA 5HCFA 2CAUA 2ZXXA 2WQ4A 1LTTC 5JOWA 1XB9A 1UL9A 5F8PA 4QXCA 2WITA 4D6SA 1SFYA 4QPYA 3C9IA 3V4WA 1GD2E 3WCSA 3TEZA 1VBC2 2VCBA 4YW4A 3LFMA 1HN0A 2K1AA 1YFWA 2HEVF 2PN5A 2BASA 4UXAA 2F17A 1BCCG 2ORZA 2YFZA 4QDQA 2O1QA 1NLSA 5FQ0B 5AW1B 1PVC2 5L7OC 2HWB3 3CJIA 4PJ0H 4RGKA 2J1AA 3N36A 1DZRA 5IAVA 1UCXA 3THTA 2VZRA 4FCAA 2O8OA 4JKMA 1PGPA 1RUD1 5FK7A 1W8OA 1PK6C 1WBFA 1C1FA 2DCKA 4A7ZA 1NKNA 3EJKA 4GWIA 2NRGA 1TMF3 2P3JA 3CMEP 2E53A 4FT8A 3B02A 1A34A 3ZDSA 5FLJA 2GC2A 4CDXA 1EQ7A 1VQ9P 1GANA 3N9QA 1I5ZA 2G3AA 4L0PA 1KD7A 2Z4FA 4TXWA 1FMD1 4NAOA 1A02J 2BWAA 3PU8A 1QX8A 4YGEA 3LD8A 1UU5A 1GP5A 2W9XA 2RMZA 5FKCA 3C7GA 1O59A 3K3OA 4IDZA 1VQPP 4AEDA 1TNRA 1L4AA 2DCYA 3CXHD 1NCQA 2QQNA 2Y6GA 4OZXA 4QB2A 3SMHA 4P9LA 4FQZA 3LW5J 1LTSC 1RUH2 1H8AA 3BCCE 3L75E 4UFKA 1KILE 3F5HA 1PK6B 4WM7C 1ZR4A 4TYSA 3CCSP 2Q4SA 5LRRA 1TZOA 5I8TA 3QCWA 5GZGA 1YITP 1DU3D 3ZIXA 1UYPA 3GHNA 1IPSA 2BPA2 1RHZB 1OX3A 4OI4A 3Q8EA 1M06G 4JGZB 1KITA 5LEKA 4OGQD 1N1YA 2R44A 1HF9A 5E79E 1VL2A 4XEZA 5L19A 1LKNA 1VDFA 4DY3A 3M9HA 1HUCA 3FBMA 1DQ6A 4GKGA 1Z7S2 4RYDA 2GMMA 4XA4A 3IMNA 1P84E 4BRYB 3BU7A 3GCWA 4AGRA 5FZ1A 2WMMA 3KQRA 1RINA 4FXGB 4NPDA 3VMZA 4QXHA 4GH4A 2RDRA 4AYCA 4IEPA 2KZIA 5A3PA 1NY72 3S30A 1MS3A 2X5IC 4AQ6A 2D43A 1F4HA 5T3NA 1IQAA 5F6KA 2ZGPA 3PUIA 3A5TA 3VGIA 4KH9A 1VBB1 2B88A 1W06A 3AYAA 2IXCA 1S9KE 1HB4A 4QPIB 1VQ4P 3RL0g 1BSHA 2OARA 3GBWA 3ILFA 4XHXA 3O6QB 2MPFA 1W8HA 4WM7B 3H3UA 3WUVA 2FZ1A 3FBYA 1IQDC 4Y22B 1X9TA 3MICA 4LKSA 1YFYA 3CKHA 3BIEA 3VBSB 3Q8CA 4A42A 2M8RA 1NX9A 4H3WA 1CAUB 1K42A 3M3CA 5IFTA 4IGQA 2JE8A 5E79H 2V72A 3GMAA 2ZHKA 1HRI2 3B5NC 3B94A 1J84A 4LC1A 1G2CA 3KDPB 3M2MA 5D1IA 1AZDA 1KYOE 3UGFA 1NTMK 2FDGA 1VRH1 3L71G 5C9AA 3RYPA 5KHKA 3USUA 3G4SP 5AVTB 4PD4E 2WFPA 1YUDA 3CQOA 2VMHA 3BUCA 1D7MA 2ZYDA 2JDNA 5C8WA 4CXXA 2X10A 1SQXD 3HIFA 4XJUA 5GKAC 1USDA 2Q6QA 5FZCA 1XOYA 2Q1KA 3VDCA 2KR2A 3CC7P 3RJ2X 5M0TA 1K3IA 2CHHA 2C6SA 2KSEA 5FP4A 2WWSA 2WR9A 2W3JA 2EAAA 3PH0A 2VH9A 3WNPA 5A3NA 2YNYA 5E8AA 2ZBJA 4YVWA 3MW4A 3EFGA 1SQBE 1AL21 1RUG1 4K1ZA 4NMIA 5AFBA 3CBNA 1F5JA 3DYMA 2Q8OA 2VZUA 4N7UA 4AHXA 5I0DA 4FBFA 2KP8A 1GK4A 4NHKA 4GMP1 2BW8A 3KVBA 4QPGC 3ZN6B 4NIIA 3NSTA 3B5NB 2D2CD 1JTZX 2FZ2A 2PELA 4KI5M 1UZWA 1C5IA 1FJKA 5AC92 1US2A 3KHBA 1PP9D 2P7JA 3APBA 3ACLA 3LW5H 2Y60A 3GNEA 1AFOA 4NRMA 2H88C 2WZEA 4LR4A 5CFDC 1EAH1 2WS91 4Q1RA 1CW5A 1LWUC 4JRAA 3M0DC 1L0NE 3GM8A 3M9QA 3G7DA 4QXKA 2JIJA 1H1IA 1AR82 3H1WA 4YXDC 1MFTA 1JOCA 1C8M1 1HV0A 1PO11 1YQ8A 2BQPA 1W6MB 5C33A 1KN7A 4QX3A 4HKWA 1T6AA 3T97B 2CWSA 2ZXEB 2EIGA 2Y9YA 1S0JA 5C39A 1JMUB 4OMDA 1N2DC 4GB32 1NTKK 1WT6A 4L99A 2E26A 3T08A 2OYIA 3PU3A 3N4MA 4AHZA 1FZEA 5J3UA 4CDQB 3N4XA 2F4PA 3O1SA 3LOIA 4QX0A 4XBQA 1AL23 1RUG3 1ALYA 2ETEA 2X05A 1QJU2 2VBPA 5A3OA 5FY8A 1UZ0A 1IHMA 1RHI3 2X53S 4UI9L 2GSYA 5KLIB 1HXS2 2ZZQA 4OGQC 1K45A 1V70A 4EROA 4XUNA 4Q4X2 2ZX1A 4W65A 2D44A 1IJDB 3CCEP 3RI8A 1CZTA 3IIAA 3S5AA 1SEFA 2HWC1 3NV4A 3UJOA 3GZAA 3GBGA 5ABJA 3EMRA 1N3OA 2DVDA 2MEV2 4W6XA 2WN3A 1LT9B 5CADA 3N7KA 1YNAA 2XHNA 5CCHA 4UW4A 2GDFA 4AGVA 3J8F3 5D8AA 3O1OA 1PO21 1QQP2 4TSVA 3F89A 1JYVA 2GP3A 4LNVA 3AMHA 5CHXA 1S0FA 2PLV1 4Q1PA 4FPFA 3WNOA 4D6QA 2JP3A 3TYJA 1EZVE 3NKGA 2B9UA 3ES1A 2EXKA 1URQD 5DMYA 1J2JB 1EV11 4AFBA 2P3YA 2GNTA 2W1QA 4AHWA 1LGCA 1G9BA 5IFPA 4MVTA 5FYTA 3THCA 5AFEA 1SLQA 1A3KA 2WNUC 4RJTA 4LQRA 1H2MA 4RA0A 4ASVA 4OGQB 1CVNA 4U36A 2ZGLA 5AVRB 4JGYC 1Q5OA 2QM8A 1O5LA 2Q8EA 3JD71 4CU7A 1ENQA 2VCCA 2DWRA 2HYNA 2YXRB 3D0SA 2VE1A 1VBA1 3M7AA 4ZY9A 2LM3A 2K88A 4JTOA 1SQVE 1TEIA 3H3LA 4X6RB 4AFMA 1UIJA 4EE2A 2O0OA 2XG3A 1FS0E 1W9TA 5FZGA 4M4RA 1NU1K 1WA4A 4EYYQ 1W6QA 3AXEA 1ZRCA 2P37A 2V7QJ 3P32A 1PO23 1JODA 3MLJA 1JZ4A 3LB9A 1GWLA 4AFAA 4F8AA 2RJKA 3WXPA 4CDUA 2IVJA 4XCBA 3VLBB 2P6CA 3MUZ1 2PLV3 1KQLA 4RS5B 3L73D 3HN3A 2VNOA 1XRUA 3NQHA 2FFDB 3A2AA 1RVF3 1SLAA 3IDEA 1ND3B 2D2CC 2BFUS 2B4KA 3HJRA 2ZYAA 4JGYB 4YZ1A 1QY4A 3MZWB 3VHPA 1J59A 5FPZA 2V73A 3H1KG 4IV3C 4GOFA 5J48A 4OULA 2D6PA 3WDXA 3J7LA 3JD73 2ARBA 4BQ5A 3DYPA 1DH3A 2YROA 5A7WB 2N7GA 1IFNA 1XU2A 4NIDA 4AEJA 1VBA3 3ZXKA 1GL2B 3S6PA 2ZJSE 1NCRC 1REDA 3BRTB 3WQ7A 4MHRA 1W2OA 4H44D 1O8PA 2WSUA 4AG4A 2PRRA 1YIFA 4I3PA 2AEMA 4XETA 4AR2A 3SWFA 2GALA 2XGXA 1QIQA 3BCCG 3L75G 2RHPA 1JEKA 2YXSA 5FQ0A 3Q8FA 3KGLA 4N43B 2BCCD 3OG2A 3ZO0B 5K5GB 5JXIA 5J09A 3DGTA 1YRZA 4GA9A 3IF4A 3TGUD 2Y6HA 4HPKB 3INAA 5FO9B 2LROA 3N3HA 4AVBA 1S2KA 2WNOA 1M1KQ 3MIFA 2QCSB 2XJQA 1XPWA 2C9KA 4Q4W1 4L74A 3KQGA 1YQ6A 3D71A 3V2NA 1LTEA 2Z79A 3VMYA 3BATA 1CJDA 3I49A 3IMMA 3WUDA 4CZSA 3W68A 2IUWA 5KTBA 3VZMA 4Z8BA 4BU2A 3VBHC 3KZ4C 5A6XA 4YW2A 5LBEA 4XDOA 1LHOA 3WW2A 2YO3A 2P3IA 4ATEA 1WCKA 4HOOA 1RUC1 4COYA 1YYNA 2HWB2 3TN91 5T52A 4TLFA 1WMFA 4XDQA 4CCJA 3CCMP 1GW3A 4AVSA 2VMDA 1SQQE 4E2SA 5JIUA 3W5NA 2ZAHA 2I8DA 4A7YA 3OTFA 3O1MA 3U14A 2R043 5BPXA 2TNFA 2AYHA 1ND2C 3M0AA 3ZFFC 2WSEJ 3LIDA 4JQRA 1SLBA 4RHV2 5L7OA 2ITAA 2EICA 3HTKB 1UX7A 3E1F1 1XNCA 1NAYA 1I9RA 4ASLA 1UYZA 2PHRA 4B1MA 1X8YA 4LMFA 4AI2A 2WQYC 4K3AA 2O1JA 2BUKA 4XFAA 2KOGA 2HWD2 1XYOA 4H0LB 1PK6A 3MIBA 1OF3A 4N8MA 5CBLA 1UNBA 4HK9A 3L72E 3T0DA 1URQC 1GQHA 1EDJA 1KDMA 4V1PA 1RC6A 2RVAA 1ZZCA 2R3CA 3FUQA 1AR91 2AGSA 2CGPA 4IGPA 1S55A 1WCSA 2QBXA 1FC2C 3AB0A 3AMQA 3FE5A 4Q8KA 4JGZA 4LE4A 1DD4A 2G19A 4YG6A 2DBNA 2RS11 2V09A 2NZ2A 3RBXA 2P34A 3B8EB 5KJ7C 1LECA 5IATA 2V5YA 2BP6A 2C24A 2GH2A 5B66E 3I2FA 4CCOA 4I1LA 4BRYA 4C7RA 2FDJA 1APNA 2XLGA 4RFRB 1MEC1 3Q5SA 2K46A 5JPNB 3CCVP 2N1TD 5J36A 5E16A 3MIGA 4EQVA 4XTPA 2QQWA 3G9RA 3I3DA 3WCRA 5FPXA 3TWIA 2YDEA 4IE7A 3TN93 3NJZA 1WLTA 3K3NA 4BHPA 1AQTA 1BE3G 3TNUB 4OZOA 1SMVA 4QPIA 1SQXJ 2YPJA 1GLHA 2ZMKA 5BNPB 5CJ0A 4OYUA 1SQBG 2AXCA 1ZRIA 1OURA 3OSDA 3O6QA 5KAIE 3OA7A 1ZRTE 4WM7A 1LGNA 1JYCA 3W9AA 4LBOA 1OSGA 1O4YA 3WF1A 3QLQA 3ZXFA 1URQB 4Y22A 2VJXA 4NROA 3VBSA 5C3PA 1X36A 5SV8A 3H1YA 5FTTC 4HANA 1XTGB 1CAUA 1H4HA 1TE1B 4Y3OA 2VECA 1LOGA 2OZ6A 2ZA9A 4EI2A 3GYDA 3V65A 3TEWA 4FOVA 4WVZA 3B9IA 4MGIE 3BTAA 3CXHI 4GULA 1XC6A 2UYAA 3IDCB 3L70E 5AW7B 2AEZA 4M01A 1L0NG 1YTZI 3O1RA 3CXHH 1TQ5A 5FPUA 2RS13 3JQXA 4AF9A 2JG8B 5AW4B 1RF1C 1PP9J 4FTBA 3OBRA 5DJUB 3OW2O 5HCHA 1MEC3 1SQPG 1G7YA 3MFCA 2FYNC 3ASIA 3OAKA 1WCUA 3LIEA 2YB7A 3WP5A 1NXD1 4H44C 1IS4A 2C26A 3A7OA 4AOCA 1AYM1 4QDRA 4L11A 2QVSB 3C8VA 4FPGA 1ONAA 1STMA 3NJVA 3MTUE 3V4QA 1Y8AA 1LTAC 2XVKA 3WINE 2WRAA 2BYVE 2HG5D 1DX7A 2YMKA 3LDBA 2P10A 4XF1A 4GWNA 4WB4A 2FBWC 2ZMNA 1K05A 4C1XA 3AZYA 4I2OA 3MLKA 2OYHB 4R9BA 4C7NB 2EXJA 4CTEA 1FOD1 1DLCA 1UAIA 4CU9A 2ZT9B 3ZN6A 3B5NA 4BM8A 2WSEH 1S0BA 3VOPA 1GOHA 5JOYA 3RGBA 5FZEA 1KMIZ 2O01N 1H2KA 4QX5A 4HH2A 4DUWA 3IZOA 3T3YA 2XMLA 4H7LA 2CPSA 2IBZE 3JZVA 1JU4A 5LY1A 5L9VA 3P1IA 2KIKA 1CIWA 1QKQA 4YZ2A 5T5PA 4XF3A 3VHOA 5A7SA 4IL6E 3MO4A 4KWLA 5DXDA 4YPJA 2E74B 4BQ4A 1CAWB 5FXZA 4ZU4A 3N7MA 5APQA 1VBB2 4BK4A 4FPCA 1FZGA 4WM8B 2DFCA 2IDBA 1T3JA 2O8QA 1JZ2A 4OI2A 3MP7B 2IFMA 2AC1A 3UNPA 4XBNA 1W6MA 3I7DA 5BNOB 3SKJE 3JCUH 3T97A 1W2UA 4NUBA 2P1JA 4UB6H 1JYXA 1YXWA 1JTHB 4YARA 5FY5A 4XILA 3ZPOA 2DW3A 3ABVC 2QKDA 3A0BH 4U3FD 3LF7A 4UFIA 3AKSA 4CDQA 2D6LX 3NMBA 1FV2A 2WC2A 1WUVA 3AVRA 2YMZA 3KCYA 1W05A 1L0LD 5FP9A 3SC7X 3K5BA 2E43A 3T2PA 5JSPA 2ZX2A 2HEYF 2ZGKA 5LY2A 4I0AA 2XJTA 1Y9BA 2AXTH 4LBMA 1O4ZA 2BERA 1AVOA 4IQPA 1XNKA 4CCLA 4AI3A 3FLTA 5CFDA 3RMYA 4XFGA 2WQZC 1SQVG 3L9JT 3M0DA 1EUUA 1LOEA 3VHNA 3B01A 4D6RA 2YBSA 1A02F 4QPWA 2N1TC 3AE6C 1OQ1A 3N7NA 2V4HA 3C7HA 1CN1A 2GC0A 3ABZA 1LT9A 2RDNA 2VOXA 4CVUA 5TSWA 4NPEA 2AZ5A 4NPRA 4BZ4A 1KS5A 1I3HA 3Q8BA 2K3RA 1MS8A 1HVVA 2NP0A 4R4MA 2WN2A 1AL22 1BK0A 1RUG2 3K77A 1A78A 1AYN1 4XAAA 1IS3A 1HIXA 4CCEA 5ERLA 1R081 1RHI2 3AK0A 1O5UA 2ZGRA 5DQ0A 1UY3A 2JXAA 3IM0A 5DJTB 1QJEA 4G9SB 2MHFA 3L36A 1G9AA 2IWGB 3O14A 3AP5A 4I09A 5C6CA 1ZZ8A 2BBVA 2VVDA 4NWVA 3CF6E 1JI6A 3RK3E 5EPAA 5FY9A 2ZAEB 5AVPA 1NTMG 5L36A 5IW0A 2R061 2R073 3RNSA 4IEZA 2VUJA 4YFZA 4HBNA 1YYCA 3DEMA 1EDLA 2D5HA 2M5AB 1K04A 1K5MB 1OVUA 1LTJB 2VOWA 1OD5A 1C8M2 2BNMA 2N1TB 4CCNA 5HXMA 1UU4A 1PO12 3H1LE 4DXSA 4AI1A 1EXIA 4N90A 1D0HA 3UV9A 5FYMA 2YIUC 1AR63 3RQ0A 5LK5A 5KC5A 3I2OA 4DY5A 2NPIA 3L71D 2XWBB 2JWPA 3R0RA 4NHMA 4LO5B 3BU0A 1AV1A 4COWA 3AC0A 1DYPA 1X33A 3ETQA 3WNXA 2Q7CA 1GMMA 2WSCH 3VMXA 4JAAA 1H9WA 2PQQA 1AYN3 4FOYA 1G1IA 3EYPA 4RS5A 5KKZB 4LO4B 1W0NA 2OYZA 2AACA 3RBZA 3PLNA 3H1HD 3TGUJ 4P02B 2WO7A 2FFDA 4BMEA 1ND3A 3WF3A 1ZZBA 5GLWA 4JGYA 1Q43A 3KT4A 3TAYA 3WQ0A 5LATA 4NRPA 2VUAA 2HWC2 5CG9A 4XXAA 3E1IA 3GJBA 3NJYA 4Q4V3 2XL7A 3R4DB 5TJHA 2IC1A 4Q2FA 5AVWB 3VYIA 2D6OX 3M70A 5HPOA 1QGLA 4EWAA 5F5AA 1SQQG 2D3PA 3V56A 2VM9A 5A7WA 1PO22 2ZVOB 1RUE1 2BDRA 1IO4A 3IAOA 2A6YA 1GL2A 1FDOA 3ATGA 4HK8A 3WG2A 4DCKA 2UY8A 3SH4A 5HCAA 2DCJA 4H14A 1GP6A 3CCRP 1S1AA 3FFQA 1HB1A 2PLV2 2FYUE 4N43A 1MS9A 4XF4A 1EV12 5DUUA 3H8UA 2HYXA 4UFMA 1RVF2 2A3WA 4HPKA 5B2GB 4HVOA 3LKJA 3HNBM 1UOJA 4QM8A 3A0HH 4IESA 1VB2A 5LRSA 2YKPA 2ZJCA 2E31A 3CWBE 2CDOA 4FPHA 3I4IA 2J1SA 2QJVA 3AXDA 3JD72 5H2FH 1SCRA 2QJPC 2OYOA 1V6KA 4MN4C 4J1XA 1W8FA 3V2QA 1VBA2 2WINB 4M3CA 3E7KA 3TDKA 2VZOA 1IGOA 2VULA 2FBEA 4RR3C 5LA2A 3NTNA 4P9JA 5EYYA 4KGGA 4AWDA 5BNNC 2WZR1 2VUCA 3ZSMA 2ZTNA 3HQRA 5LWBA 2ZHMA 1VP6A 3O5SA 4UF0B 2VU9A 1PZ8A 5J98B 4LO8A 2CDPA 1BVVA 1ULGA 5C8CC 4FOWA 5KLVE 4PDWB 3HD7D 1UMHA 1UY4A 4L9BA 1US3A 3K4ZA 1O3QA 4LO7A 1VQOP 2XUEA 2JEEA 4XFFA 1ZBA3 1T2XA 5FFOC 3HTKA 2POHA 4C90A 1E5HA 4Z2WA 3IT8A 2C0ZA 1Z78A 3I2KA 2MNGA 4D6TG 4UB8E 1XQNA 5DDJ1 3ZMNA 1Z0HA 2BTVC 1RYYA 1GZWB 4IE6A 5FWEA 1UU6A 5EWSA 1J58A 3NW4A 1PVC1 1H2NA 2VOTA 4DXZA 4NAMA 3O12A 3UGHA 4E4HA 3FUOA 5LASA 2Y0EA 4AI9A 3IFMA 2GMPA 4SBVA 2OQ7A 4OUMA 3VBUC 1JY2P 3WMM0 1UWWA 4QU1A 4XABA 3H3ZA 3IAPA 4NIGA 4OWFA 3AL5A 1RQUA 2P3KA 1OT5A 4A7PA 1AL0G 2B45X 3HE4B 1M4WA 3LDKA 3M06A 4BH9A 2WZR3 3H1IG 4ORFA 3LPGA 3VBFB 4R4XA 1NU1G 5A6YA 3KYQA 2H89C 3LCPA 4GDOA 4W7ZA 3TNUA 3J4UH 3Q3DA 1AVBA 3DPRC 4Z1MH 4IGOA 3VZNA 4P9IA 2D93A 5BNPA 1MV8A 1SQXK 1NTZE 2BEOA 2PQSA 3L35A 4B7KA 1QXRA 1VR3A 4Q4W2 3O0XA 1NAEA 4FFGA 4Y4RA 1URQA 4ZPIA 4QQOA 3VDDC 3QBQA 1WGPA 1OH3A 4LJHA 2ZMLA 5A33B 2VL4A 4ES8A 2JG9B 3M8LA 4QGMA 1PMHX 5JXHA 3EHKA 4K3UA 1KFXL 3O1PA 3VBUB 5KC6A 5CCGD 2IBZG 5FMBA 1DQ4A 2X09A 5KJ7A 4BIOA 2Q0AA 2A1XA 4ZZ8A 1RUC2 2RM21 3H1JG 3TN92 1R5SA 1SS1A 2ZEZA 2JG8A 1QJFA 4ARYA 1QOOA 5JAXA 3NJXA 3JUUA 2KA3A 1W9WA 4RQPB 4GKXA 1N73B 3H8XA 4DZOA 1N7SB 4IEYA 2WO3A 2XUMA 1ZX5A 1OA3A 1OBNA 3RG0A 3CLPA 2GAUA 2C5DA 4K8FA 3ZDMA 2JKBA 2DV9A 3H50A 5IUQA 4WZFA 1QDCA 2NN8A 2R30A 2OXBA 4MGTA 3ACIA 3SWKA 5CG8A 1KJRA 1OF4A 3AZZA 1LNQA 5JSOA 4XW3A 1SACA 5CFCC 4Q26A 1ZYBA 2YKOA 1KQRA 2ZGTA 3P8MC 5C5UA 3ACHA 1NKZB 1VQ5P 2PYTA 3DV8A 2XBO3 2OYHA 1UKGA 4C7NA 2ET1A 3BCCD 3L75D 2WNVB 3MEPA 2R7EB 2RS12 1KILD 4PV1D 3HNMA 3N9PA 2DUQA 3TOJA 1O8SA 4U3FJ 5KAFE 4A3ZA 3KF5A 5FZ7A 1AJKA 2X8KA 2F6BA 1MEC2 2XQRA 1UIIA 1Y43B 2AEJA 1W2BO 3NV3A 1L0LJ 4CEYB 1RF1A 1HRI1 2ZEWA 2RM23 4IFDK 3ZDVA 3GF7A 1CAWA 2LKMA 3Q8AA 4JYCA 2HYKA 1VBD3 1FT9A 1OC1A 3MIEA 4YSFA 1YJWP 1IZNB 4EIJA 4WM8A 5BU8B 2VVFA 2ZX3A 5EFWB 1YQCA 3R4YA 1P84D 3AEDC 1W2AX 4BXLA 2UURA 1IC2A 4CUCA 3HD7C 4JDNA 3FXDA 5BNOA 4AEDB 5I0RA 4ZKTB 3W21A 1LOCA 2HKXA 2WFF1 1LODA 4DOUA 4UWDA 1JTHA 1OA2A 4Y5SA 2VW2A 1BCCE 2IYOA 2LS6A 1S9KD 2B9VA 2L5GB 3ILRA 1HTLC 5GTIH 2GH8A 4A3XA 3KCXA 4FP2A 2VBDA 4A41A 5KAFH 4RKUJ 4RO0A 2Z4EA 3LEIA 1VAMA 1SP4A 4XOGA 4L2NA 3ZM8A 2VNGA 1D4M1 3SNMA 2R0HA 4FO9A 2VXJA 3SWYA 3ZXDA 1PZ9A 5G04L 3IDAA 5FMDA 4YW6A 2A45G 5FIXA 1F2NA 3R05A 2WLPA 2RR11 4GJZA 2FMYA 4N53C 1EPZA 1JXNA 4C0BA 4QKDA 5FZAA 4H55A 4CPGA 3KV6A 1KYOD 3WF4A 2G9ZA 1SBFA 1FNYA 3LFIA 4PD4D 3HD7B 1SPPB 4YZ5A 4GXLA 2K9YA 2KUBA 3RI9A 3VP9A 2XNDH 4ZZ5A 3JB8A 1W2NA 2BWCA 5JMCA 3WNMA 1AR81 1UPSA 1JOPA 4AFCA 2V5DA 5AW0B 1LAJA 1FOD2 3U07A 4QMAA 1M1JC 3PIJA 4YM0A 5JZGC 5AW6B 2XH6A 5EIYB 4E27A 2WWUA 4RESB 4EN9B 3E1RA 4XYXA 1H30A 1SQBD 4LHSA 5AW5B 2RMU3 1NAFA 4OI1A 1ZR2A 5CCGC 4ZONA 1LJ7A 3UT0A 3H1HJ 3ZPYA 4YGBA 4XQWA 4B4PA 1D4M3 1WWYA 2M5AA 1K5MA 3U0ZA 3PMSA 1LTJA 5CIRA 4KU7A 2NM1A 2W52A 1K9MQ 1DEBA 2OIIA 3WHTA 2N1TA 1VQMP 3IKWA 4TLGA 2HWF1 2RS33 2E76B 4MGKE 1RTVA 5EYXA 2XLAA 1J1EC 1C57A 1VBE1 4BXFA 1AQ5A 4Q4X1 5C4WC 1WMDA 2HJIA 3Q5PA 1HLCA 1R1ZA 4NHYA 1RXFA 1L0ND 1JHJA 3X29B 3UKNA 3I2HA 4K9SA 4O7XA 4A4AA 3VDBA 2XL9A 1QVFO 4A45A 3MD0A 2OT7A 3USSA 3BCWA 4U7JA 5JIAA 3C7OA 4AXOA 4DRVA 1M1JB 1USEA 3THPA 5JI9A 5FZ0A 1OLRA 3MHVA 5AW9B 2R072 1YI7A 1JCDA 1M7LA 3DECA 1NQJA 3K4AA 3GALA 1KILC 4PV1C 3GGLA 1V6LA 4NVPA 1U5XA 1RL3A 2LW8A 2PFWA 4D94A 4PQ9A 3ELNA 1SFPA 2WZ7A 2D7FA 3BGAA 3CMAP 3S4RA 4RGAA 4P9YA 4HJGH 3VBRC 5EXOA 4PQQA 3WG4A 4CDWC 1J1EB 4JBZA 3M1HA 2KB7P 1X0TA 4WWIA 1C5HA 1S0IA 4NO4A 4M3CF 1GV9A 2QTWB 4XIOA 2I1JA 4FAGA 1AYN2 3DKQA 2HWF3 5DAXA 4A44A 3S1KA 5APVA 2RDQA 4OHWA 2ZKNA 5AVQB 4YG3A 2R5BA 1TME1 1YO8A 3LPFA 5I0TA 2PHWA 1I1EA 2DF7A 2J22A 3E5UA 2WJSA 4R4ZA 1CPNA 1JYWA 1FOSE 3A4UA 3FMGA 4Q4V2 2QM7A 1OVSA 1O7FA 3KF3A 4HN0A 1DBNA 3WW3A 2K9JB 4D0QA 4I3GA 2GC3A 1N7LA 4EZ4A 1BBT3 2R062 4MGYE 1EZVD 1MACA 1MS1A 3BIWE 1NTZK 3K2OA 3VV1A 1VQKP 2DURA 3RK2B 4ATFA 4R9AA 2YC4A 5JOZA 2WKKA 4OVNF 3S7IA 2R49A 2E63A 3PMEA 3KT7A 5FXVA 2IXJA 4URAA 5KXDA 1DYOA 3GHMA 5D21A 3AZVA 2BNNA 2A5ZA 4UF0A 1HJBA 2VVEA 3FZ3A 3TEYA 1FBMA 3AYEA 2PHTA 3V6IA 3MUDC 1XXNA 1H8TC 4NRQA 4PDWA 2DU0A 3WT3A 2FDHA 4MO3M 1KGYA 1SQVD 3WQBA 3GW6A 5FZ4A 2E51A 2OA2A 5D8AB 5K4LA 1L7RA 2QJYC 3M91A 1NVOA 1W3VA 2ES3A 1O3RA 5C3SA 5CA6A 1TME3 2D97A 4KU8A 5CBNA 5IVJA 2XJVA 5DZGA 1EPWA 5HXVA 2W87A 3VN0A 3JC22 1S5LH 4YZ4A 2HFED 4QX7A 3NFQA 4A2UA 1HDKA 4KMQA 4I0BA 1QWRA 3RL0B 4AQRD 3AE4C 4R4LA 4ES9A 1NOVA 2FXOA 3MF6A 3POGA 1RE4C 1ZBA2 1R093 3R2PA 4UYBA 4KWKA 4MX3A 3GZEA 4EZHA 2CGOA 3OGVA 5DN2A 4I01A 1L3JA 1H8TB 4NPFX 1E5SA 3FX3A 2NPSB 5ISLA 4YYOA 3LEKA 5EJZB 1RUNA 3TEXA 4DUVA 3ME2A 4QM9A 2DVGA 3BB6A 2QJYB 5CVRA 1OPMA 2J5UA
chains in the Genus database with same CATH topology
1MZ5A 4HZFA 1GNHA 4L8QA 4ISRA 5C4WA 1RB8G 4AK3A 1J3QA 1J3PA 1APNA 2XLGA 1DGRA 1AF9A 3U4XA 1NA1B 1RUJ3 1MEC1 4Q0PA 4ITCA 5JPNB 4JTNA 4EJRA 1REFA 1DQ1A 5J36A 2WLQA 3MIGA 5E16A 5FREA 4XTPA 3ST7A 3POSA 3H7YA 2XPJA 3C3VA 1FX5A 4QQLA 3ZYRA 1ZM1A 4TZDA 1PIV1 4Z82A 1BEV3 1XYNA 3WCRA 5FPXA 2VMIA 3RDIA 3TWIA 2YDEA 1FI2A 4WV8A 2HEWF 3TN93 4F83A 3RMXA 2JG9A 1GICA 3NJZA 1TMF1 1WLTA 4EV0A 4Q0QA 4BHPA 2K2SA 2QDNA 4CP0A 1AQTA 1ZREA 4AVCA 4KNCA 5DG1A 1UW8A 1SMVA 4QPIA 2YPJA 4JDOA 3VBUA 1GLHA 2ZMKA 5BNPB 3FLRA 1SQ4A 5AC91 4Q29A 5GJ6A 4NOTA 3SH3A 3O0VA 1VIWB 1OQEA 1ZBA1 2WZR2 4DQAA 1C4RA 1O3SA 3QD6A 4WM7A 1LGNA 1YLLA 4Z07A 3SITA 4AW7A 1JYCA 1FPN3 1QJY2 5IT6A 1HRI3 2OPKA 4XF0A 3T1LA 3W9AA 4GH4B 4LBOA 1AYM2 3ROUA 1OSGA 2ZABA 1O4YA 4TWTA 3QLQA 5DUXA 2G9FA 3ZXFA 3NV2A 2DUOA 4Y22A 4MV2A 4WZCA 5GALA 1SBDA 5JCTA 1UMZA 3GF6A 3D4KA 3AZWA 4GMP3 1X50A 4HSJA 2RE9A 3VBSA 4COUA 4HVQA 1QOSA 2KXLA 3MPPG 4R9DA 4YM3A 3PLQA 1X36A 1CJPA 5SV8A 3H1YA 5FTTC 2FMDA 1ULDA 1POV1 4HANA 1CAUA 3G6JB 4OUSA 1H4HA 4S2DA 5GLZA 5CNAA 5IK5A 1TE1B 2JICA 5AVAA 4YVSC 3HWJA 1H9PA 2VECA 2ARXA 4RQPA 1LOGA 5EZWA 4BQ1A 2OZ6A 2ZA9A 1KFUL 1LEDA 3GYDA 3ZXGA 1LHWA 1UF2C 4PLOA 1IKQA 4BMBA 3V65A 4LE3A 2EXIA 4FOVA 3VBRA 4WVZA 1QOTA 4UW5A 3B9IA 3NKTA 2JJ6A 4MGIE 4URTA 3BTAA 1YFXA 1AXKA 2VXRA 3D0JA 4PLMA 3AFGA 4GULA 1PGW1 5HI0A 2WFF3 2I74A 2XJSA 4MZUA 4CDWA 2QNKA 1EAH3 2UYAA 1Q8OA 2WS93 3IDCB 3KM5A 4B4RA 4LUMA 5DDJ2 3RPQA 2EALA 2NMNA 3WG3A 4M01A 4BE3A 4YVWC 1SLLA 3LWCA 4YRDA 3CNAA 2BGCA 4YNIA 4META 1TQ5A 1HRV2 4GB31 2RS13 2NZ9A 3NAPC 2W68A 5K8SA 3JQXA 1HW5A 1PNFA 4AF9A 2JG8B 4DZGA 3FLPA 3OPZA 2H6CA 2HWE3 1NG0A 4XMAA 1C8M3 1FV3A 2XHKA 1VALA 2A7AA 4FTBA