1S4XA

Nmr structure of the integrin b3 cytoplasmic domain in dpc micelles
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
KLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Membrane-mediated structural transitions at the cytoplasmic face during integrin activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin beta-3
total genus 10
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2004-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08725 Integrin_b_cyt Integrin beta cytoplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.630 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Integrin beta subunit, cytoplasmic domain 1s4xA00
1M8OB 1S4XA
chains in the Genus database with same CATH superfamily
1IFDA 3L73D 1BE3E 1ZRTD 1P84I 2BCCG 2FYUG 3CCVP 2FBWC 2AEMA 1SQQE 3E7KA 5AW6B 1FZEA 2ITAA 5KLVD 1FZGA 1SQVE 2WSFJ 3MHVA 1NTKG 2QJPB 5KJ7C 1S9KD 3WU2H 1URQB 1X8YA 2KNCB 2E5YA 2KYVA 4IFDK 2NRGA 2K1AA 3A0HE 3CC2P 1GD2E 3AE7C 3EWKA 3H1KG 2B88A 1SLQA 2W8ZA 3RL0B 2IBZE 4BXLA 1L4AB 3AEDC 3H1JJ 1FC2C 1Q82Q 3PTZA 5AVXB 3H1HE 5KLVK 1IFPA 3SWFA 5KAFE 3A5TA 3GHGC 2W6AA 4NPFX 1LT1A 2C0WA 2E74C 3H1LG 1HF9A 1EZVD 1FZCC 4L73A 5H2FE 3HRNA 1FZCA 5CBOA 3SSUA 1CI6A 1NTMK 2QVAA 4M3LA 2KLUA 3VMAA 2D2CB 2WSCH 1PL5A 2Y9YA 3WUTA 4EDFA 5AVYB 1FOSF 3FWLA 1GZLA 2KLVA 1KILD 4WWIA 2YO3A 3CI9A 3V2PA 1MFTA 3WUUA 5CBNA 1KYOD 3N7NA 4U3FE 3S1KA 5KJ7A 3H1LJ 1KC8Q 1P84E 2R44A 3HD7D 2G8YA 2KI7B 1NYHA 4XE5B 3BCCG 3R4YA 3H32B 4JYBA 3TYYA 1S3JA 2E5TA 2E75D 3SFDC 1J1DB 1SQBG 3CL3D 4YXWH 3L4FA 5GTHE 1LT9A 1GU5A 2IZ0A 4LC1A 3HD7A 1JOCA 1USEA 2PFXA 1SQBJ 3P32A 1VQOP 1QX8A 2ZT9D 3RK2C 1S9KE 3D6ZA 4PD4H 3SWYA 4H44D 4H13C 3L72J 1X0TA 2JWDA 2LR2A 2UWJE 5AW5B 4D6TG 4WB4A 1LP1A 2A06E 3KYQA 5APWA 3RL0D 2Y0CA 4WY4B 3TSIA 2R3SA 1G1JA 5AVTB 1M1JB 2ZXXA 2BEQD 3L35A 3D71A 1BCCJ 3G6EP 2WSEJ 4DZOA 1K04A 4Z1MH 3CCSP 1RF1A 2FKWB 5AVSB 3A2AA 1N7SD 1SQBK 2I1KA 3V4WA 1PPJD 3CWBE 2NPSA 3PLNA 2YKQA 4OVNF 1L0LE 4YTPC 1T2KC 3A3YB 1SQBD 4KJMA 1FZBA 5KLIC 5TJHA 4ASVA 1J1DC 1X79B 2O01H 2K37A 2FXPA 3TF5A 2YIUB 3AE4C 3L70G 5AW2B 1UIIA 1JTHA 1BSNA 1BGYE 1SQVK 1X9VA 1ZV8A 1RF1C 3G3ZA 1NAYA 1TU3F 1ZXGA 1SQXJ 5KTBA 3CC4P 1OIPA 1PZQA 1NTMG 2PGDA 1SQPD 2M3EA 4UB8E 4W80A 4C7RA 2L91A 1JMBA 5APXA 3RBXA 2W27A 3CX5I 3JCUH 3V4QA 1T6AA 1KORA 1BCCE 1NU1D 1S4XA 1W5CE 1AA0A 4L76A 4AYCA 1NTKJ 3Q2YA 2OYIC 1CW5A 4WY4C 3MIWA 1LJ2A 3L75G 1H89A 4LLHA 5AW1B 4EI2A 1VQMP 3CXHH 5KLVG 1LTIC 2P7JA 1SQPJ 1S1CX 1SFCC 2R5BA 5KJ7D 2WT7A 1RF0A 3P8CE 2BCCD 2FYUD 3I55P 1HBWA 5AW4B 1FJPA 1OW8A 3BRTB 3L70D 3H1IG 3M9BA 2N1TB 1ZW0A 1WT6A 4L75A 1NTKK 1NAFA 3L74J 1RE4A 2P1JA 1KMIZ 3H1JE 1S5LE 2YXRB 1K73Q 2OYIB 1AVYA 3MGNA 1EXIA 2WMMA 1NHLA 4N3YB 1IFIA 5B66H 2FYUK 3BRVB 2O1KA 3LIDA 3GF3A 3EQ2A 5B5EH 3VP8A 1NU1G 3P8MC 4IOIH 4U3FD 3VN0A 1QEXA 1PFIA 1UIXA 3L75D 4OWFA 2D2CC 1L2PA 3FX0A 4GIFA 4JBZA 4NPDA 2IYOA 2IPPA 5CJ4A 1LTGC 2IFNA 3NFQA 1OMIA 4HB1A 3KHUA 4H0LB 1FDOA 1W2BO 3M0DC 4HKZH 3T97A 3U59A 2NPSD 1LTJC 4GDOA 1GU4A 3CMAP 4A7PA 4O9BA 2XDJA 1N73C 1PP9J 3HD7C 2H8PD 2PRRA 3ITKA 3VTPC 5CCGD 1KFNA 4H44B 1VQKP 1USDA 2CPBA 4JQ0D 2M3BA 2RMZA 1YJ9P 1DIPA 1FZAA 1T3JA 1Y8AA 3HE4A 5APSA 2E76B 3O6QA 3Q3DA 3AECC 2A45H 1IFJA 2IYPA 1GK6A 3GLMA 5CCHD 3Q5RA 1G2CA 1NJIQ 2V4HA 2FXMA 2OGUA 3A0HH 1SQQK 1YI2P 2QA4P 2HPCB 3S4RA 1VQ7P 1OVRA 1HGZA 1JY2O 1SP4A 2JJLA 2OYIA 3AEAC 1KB9D 3BATA 2NPSC 1KYOH 5TISH 1ZLLA 5EFWB 1S5LH 3H1IE 2Y0DA 1L0ND 1KB9H 4IL6H 4BWNA 1Q90D 3CCJP 2ZYAA 1VQNP 5KKZB 1VL2A 1RE3C 2FY8A 1LTAC 2JWAA 1BE3D 3KZIE 3L74D 2Q7CA 2XU6A 2Z4EA 1NTZE 1VF5B 4Y99C 3H1KJ 5KLVE 3GF7A 2QJYB 2QIWA 1L0NE 4GT1A 4PD4E 5DJTB 1KQFB 1XTGB 3L75E 2JP3A 1ZRTE 3V2RA 1XTCC 1KILE 1BCCG 3MTUE 2P58A 3M9HA 2YNYA 1SQVD 4H0LD 3CCMP 1ZMEC 3OJAB 2FYZA 2A45G 4PD4D 5DJUB 4AUWA 2AXCA 3MP7B 1OZHA 3P8CD 4IL6E 1M57D 1SQXE 1SS1A 2GM4A 3A7OA 3JSVC 4BRYA 1URQA 1LTTC 1NKZB 1SQPE 3C9IA 1HH0A 3L70E 2Y9ZA 1SQPG 3HUSB 5L8RJ 5AW7B 3V2QA 4MN4C 1SQXG 1Y47A 1NTZJ 2KB7P 1BCCD 5E79E 1VPCA 2AEJA 3CX5E 3RK3B 3VMZA 5BU5A 5K5GB 5KLIB 5CJ0A 5C39A 3IN6A 5H2FH 1M8OB 1JNMA 2OYHB 1AQ5A 3CXHE 5CCHC 1QVFO 2ZYGA 3EFGA 3L72D 2K9JB 3BCCJ 1OW7A 3AE3C 2HODB 2A06G 4GODA 1YTZT 1PV3A 2Q9IA 1HVVA 1L0NG 3B5NB 1MUUA 1FZCB 1CZQA 4RESB 2N1TD 3Q5SA 2KK7A 1NTZG 1L0LD 1ZP0C 4ZNCA 1PGPA 3L70J 1KILA 2O1JA 3CX5H 1A02J 3JC22 1HJ0A 1M7LA 2KSJA 3D70A 2CK3H 5APQA 1KTMA 3HUSC 3M91A 3MUDC 2C0XA 2WT7B 2WPRA 1QL2A 2JR8A 1T2KD 1AFOA 1KD1Q 1PGJA 2WPSA 3BCCE 4K3AA 1YQ4C 4DT0A 3GMAA 2G3AA 4RO0A 4RJTA 1GW4A 5B5EE 2YKPA 1EDIA 2HFED 3AE2C 1YYCA 1LT9B 3LW5H 1FOSE 3WU2E 3WUVA 5B66E 4K35A 3GHGA 3I5CA 2A06D 4HH2A 2P10A 1DEBA 1EXJA 3KPEA 5APYA 1CSBA 2H89C 2NZ2A 1JUNA 2C9NY 3IAOA 1LP1B 5AW9B 2JEEA 1IFMA 2B9BA 2SPZA 3CD6P 1T8ZA 3H1LE 1KQSO 2QJKC 1IK9A 2HLOA 3WMM0 5APUA 2M8RA 3NMDA 2H7HA 4U3FJ 1AJYA 1SFCD 1JY3N 4H0LC 4C46A 2NPSB 4C7NB 2FFDC 3PRJA 1N7SA 3HUSA 3L71D 1SFCA 2ZVOB 2B87A 2WSEH 4HYTB 1RF0C 3E1IA 3FWNA 3H1KE 2AEFA 2LXCB 1NU1E 3RL0C 5KLVJ 4WBAA 1KB9E 3VMXA 4XA4A 3V2NA 2N9YB 3F5HA 1PGQA 2QE7H 4N78E 3D6YA 1T3UA 2ZAEB 1OX3A 1JY2N 1GDTA 3L71J 1FS0E 3AE6C 5KAIH 3H1JG 1S72P 1HJBA 4GOFA 3O6QB 1VQ6P 1Q7YQ 3TNUB 1BE3G 2BCCE 2FYUE 4I1LA 5AW0B 2CPSA 3V6IA 1YJWP 2POHA 5AVUB 2H43A 2KS1B 1L0NJ 1QL1A 3HTKB 2QM8A 4JYCA 3L73J 3USSA 4PV1D 2OTJP 2Q3EA 1BSHA 4GKGA 2YMKA 1NU1J 3B71A 1NGMB 5AW8B 1K8AQ 1M1JC 1ZOYC 1RQUA 3FXDA 3H25A 2GA1A 1OWAA 2YMYA 2FFDB 3CPWO 1GL2A 1GW3A 2Z5HA 1AQTA 1KN7A 2ZT9B 1LTJA 4OGQB 1SQXD 3AEBC 4UB8H 1S2EA 5BVZA 3CMEP 2KZIA 2Q1KA 1JO5A 1NOHA 3AEGC 4Y99B 3IFMA 1H8AA 1YTZI 1IZNB 4NPEA 1NTME 1OVVA 2WSCJ 4ZKUA 2QSIA 1VQLP 2FYNC 4UB6E 5CCGA 1OFCX 1LGHB 2KZJA 1ZR4A 1RF1B 5TISE 2YKOA 1PIXA 3H1HJ 1BGYG 3L72G 1L0LK 2Q5UA 1MFZA 3MD0A 5AVQB 4B86A 2AXTH 5GTIH 1D7MA 1U7JA 1EDLA 2OYOA 4DJGA 1NTMD 5AVWB 1YJNP 3HE5B 4KHXA 1JEKA 3VMYA 1P84H 2KUBA 3M0AA 1L0LG 3VOPA 3NXSA 3MUDA 2ZJSE 3CWBG 3U1CA 1N8RQ 2WPQA 1EQ7A 2XZRA 2LXBA 1Q2NA 1VQ4P 1QVGO 1NTMJ 1Q81Q 1EZVI 1DEEG 3B4SA 4IL6X 1AVOA 2O3JA 4OGQC 2ZFCA 1IK7A 3M9QA 4OH8B 2WTYA 3L73G 4D6TE 2JDIH 2WWWA 1OVUA 2H88C 3QWOC 2QJYC 1L0NK 2K9JA 3H6PA 1FDMA 2PP6A 4PJ0E 3RBZA 2BASA 1H0TA 2OYHA 4EYYQ 3H1ID 2RKLA 1JY3O 2XNDH 1N7LA 2WQYC 3JCUE 3B5NC 3L71G 4H13D 1JY2P 2HODA 1LWUA 1JM0A 3G4SP 3TGUD 1SQBE 1JB0J 1G2CB 2K9YA 2HPCA 3II6A 1EDJA 3B5NA 3H1HD 1YBKA 3CX5D 2KS1A 3L36A 1ZR2A 4QMAA 1LTBC 1MKMA 2IBZD 5E79H 1JMMA 1CI6B 2ZYDA 3G9RA 4U3FG 2E42A 2Q3IA 3C8VA 1SQPK 1N7SC 3CXHD 1PP9G 3ABVC 1URQC 2BEZF 2OTKE 4L74A 1EDKA 1FJKA 2KP8A 2VRSA 3M0DA 4U7JA 1DD3A 4N78D 5CHXA 1VQ5P 1HTLC 2WSSH 3TGUJ 1GL2C 2B89A 1EZVE 3OAKA 1RQVA 4TT3H 1SQQD 3TDKA 3KDPB 1N73B 3K5BA 4H44C 1JCCA 2FYNB 1VQ9P 5CCHA 1DX7A 2E43A 2BCCJ 2FYUJ 3GHGB 2GUVA 2O01J 1R5LA 2HYNA 3RK3D 1J2JB 3H1HG 3L74G 3BASA 1HUCA 2MKVA 5GTHH 1GMJA 2E75C 3BCCD 3PH0A 4LGDE 1P84D 2M5AB 2IBZG 4H13B 3AE9C 2C9LY 3PJSK 1OXZA 4WY4D 4YPCA 4BRYB 5APTA 1PP9D 1URQD 2R5DA 1M1KQ 3H1JD 4C7NA 2KNCA 5APVA 4WY4A 1WRGA 1N7SB 2I8DA 2V7QH 1HWTC 1NTKE 3N4XA 1SQVG 1RH5B 2KSEA 2K3RA 3VYIA 3RL0g 1SQQG 1YIJP 1R5SA 3P7KA 4JPZB 2AXTE 5AVRB 5GTIE 2B87B 2QM7A 3L75J 1YHQP 5BU8B 2J5UA 2IZ1A 2N1TC 1LT9C 2ZVNB 2L5GB 1K05A 3B8EB 4XFJA 4CPGA 1FU1A 5CMZA 2W83C 3V5BA 2IDBA 2WZ7A 1GTWA 1Y9BA 2J58A 1IJDB 4OGQD 2N9BA 3AE8C 1GK4A 1M56D 2E74B 4IFFA 4EIJA 3AE1C 3I56P 1SQVJ 4ZKPA 3CLQA 2HG5D 1E79H 1FZFA 1HGVA 1IO4A 1NTZK 2XNXA 2Z5IA 2E75B 3LW5J 1EC5A 1KILB 2WSFH 1KFMA 3H1KD 1OW6A 3KQGA 3L74E 4PD4I 2QJKB 4PV1B 4W7ZA 3G71P 2QRXA 2W6BA 3FXEA 4D6TD 2KXPB 1BE3J 1LNQA 3AEEC 1KB9I 1KV4A 2W6JH 3CCEP 3CCLP 1KYOI 2XV5A 2QJPC 4DOJA 1U57A 1LTJB 1VQ8P 2GUSA 2QEXP 4ZMDA 1BGYJ 1FDIA 1JY3P 3RK3C 1GL2B 3H32A 3S9OA 1EZVG 1PGOA 1PPJG 2P2UA 3SWKA 1QGKB 3TK1A 1AV1A 4I2LC 1SQXK 2M0BA 2OYHC 2YIUC 3PP5A 3W67A 4D6TJ 3C1LA 4Y28J 1NKNA 1NVOA 4TLFA 5AVVB 1J1EB 1PP9E 1RE4C 4GOEA 2DW3A 2N1TA 1J1EC 4KT0J 1BDCA 3H1LD 2D2CD 4AQRD 1GL2D 3Q1MA 3OW2O 1IFNA 2HR3A 2WITA 1N2DC 4I7ZC 2E76C 1G1IA 1RY3A 2A45I 2I1JA 3HE5A 4N6JA 3VP9A 3CCRP 2WVRA 2QG4A 4R4MA 3SFEC 4PV1C 1Z56A 1SVFA 1KILC 3L71E 4ASWA 1MZ9A 3PHLA 3W68A 3QH9A 3GW6A 1KZUB 2R32A 1KQGB 1U7MA 3TGUE 1FBMA 1M1JA 1N86A 3TGUG 3CCUP 2PAJA 1SFCB 5KAFH 1WMKA 1NWQA 2R3CA 4HJGH 4PJ0H 1M90Q 2YXQB 1L4AA 3H1IJ 3L73E 3T97B 1RE3A 5KKZC 4EOTA 1A02F 2XKMA 3IF4A 3IR9A 1NH4A 1NO4A 1BDDA 3UIAA 1JTHB 1VF5C 3CCQP 3MZWB 2O01N 1Q86Q 1KYOE 3A0BE 2JKVA 1L4AD 1H88A 1YQ3C 3CC7P 5M1BA 3TNUA 4I6MC 1H0TB 2K88A 2KOGA 2IFMA 4WVZA 1VDFA 2OTLP 1LTSC 1QLED 2WPVB 3F89A 3HE4B 1FAVA 2W90A 3HTKA 1LWUB 1K9MQ 4YXDC 4DCKA 3Q5PA 1LWUC 1PPJE 3CWBD 5AW3B 3KXDA 3L72E 5KAIE 2IX7C 3RK3E 2IBZI 3NTNA 2MJZA 2OQQA 2RN0A 3A0BH 2RH0A 4RKUJ 3CXHI 3CWBJ 1SQQJ 1MV8A 3RGUA 1VQPP 2FFDA 1L0LJ 1W2EA 1JCDA 3EFFK 2YO2A 2JO1A 1BGYD 4UB6H 4IFMA 2LKMA 2ZT9C 3GG2A 3RK2D 1VF5D 1DD4A 2E76D 1S5LX 3AEFC 4W7YA 3U1AA 2FXOA 2Q6QA 1R8EA 1RHZB 2J59M 1L4AC 2P67A 3ZDMA 1YITP 1ZN5A 3HD7B 1NTKD 3FGAD 4JF7A 1FE6A 1IC2A 1X22A 3O8ZA 1N73A 3B5ND 5CCGC 2Y0EA 3BVHA 3RK2B 1DH3A 4I7ZB 5AVZB 2OARA 1E5WA 3R2PA 1NTZD 3E1RA 3OA7A 3LIEA 3M06A 3AE5C 2M5AA 1NU1K 2E74D 2V7QJ 2KIKA 3KZIH 3L37A 1KQLA 2ZXEB 4R4LA
chains in the Genus database with same CATH topology
1M8OB 1S4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M8O B;  1S4X A; 
#chains in the Genus database with same CATH topology
 1IFD A;  3L73 D;  1BE3 E;  1ZRT D;  1P84 I;  2BCC G;  2FYU G;  3CCV P;  2FBW C;  2AEM A;  1SQQ E;  3E7K A;  5AW6 B;  1FZE A;  2ITA A;  5KLV D;  1FZG A;  1SQV E;  2WSF J;  3MHV A;  1NTK G;  2QJP B;  5KJ7 C;  1S9K D;  3WU2 H;  1URQ B;  1X8Y A;  2KNC B;  2E5Y A;  2KYV A;  4IFD K;  2NRG A;  2K1A A;  3A0H E;  3CC2 P;  1GD2 E;  3AE7 C;  3EWK A;  3H1K G;  2B88 A;  1SLQ A;  2W8Z A;  3RL0 B;  2IBZ E;  4BXL A;  1L4A B;  3AED C;  3H1J J;  1FC2 C;  1Q82 Q;  3PTZ A;  5AVX B;  3H1H E;  5KLV K;  1IFP A;  3SWF A;  5KAF E;  3A5T A;  3GHG C;  2W6A A;  4NPF X;  1LT1 A;  2C0W A;  2E74 C;  3H1L G;  1HF9 A;  1EZV D;  1FZC C;  4L73 A;  5H2F E;  3HRN A;  1FZC A;  5CBO A;  3SSU A;  1CI6 A;  1NTM K;  2QVA A;  4M3L A;  2KLU A;  3VMA A;  2D2C B;  2WSC H;  1PL5 A;  2Y9Y A;  3WUT A;  4EDF A;  5AVY B;  1FOS F;  3FWL A;  1GZL A;  2KLV A;  1KIL D;  4WWI A;  2YO3 A;  3CI9 A;  3V2P A;  1MFT A;  3WUU A;  5CBN A;  1KYO D;  3N7N A;  4U3F E;  3S1K A;  5KJ7 A;  3H1L J;  1KC8 Q;  1P84 E;  2R44 A;  3HD7 D;  2G8Y A;  2KI7 B;  1NYH A;  4XE5 B;  3BCC G;  3R4Y A;  3H32 B;  4JYB A;  3TYY A;  1S3J A;  2E5T A;  2E75 D;  3SFD C;  1J1D B;  1SQB G;  3CL3 D;  4YXW H;  3L4F A;  5GTH E;  1LT9 A;  1GU5 A;  2IZ0 A;  4LC1 A;  3HD7 A;  1JOC A;  1USE A;  2PFX A;  1SQB J;  3P32 A;  1VQO P;  1QX8 A;  2ZT9 D;  3RK2 C;  1S9K E;  3D6Z A;  4PD4 H;  3SWY A;  4H44 D;  4H13 C;  3L72 J;  1X0T A;  2JWD A;  2LR2 A;  2UWJ E;  5AW5 B;  4D6T G;  4WB4 A;  1LP1 A;  2A06 E;  3KYQ A;  5APW A;  3RL0 D;  2Y0C A;  4WY4 B;  3TSI A;  2R3S A;  1G1J A;  5AVT B;  1M1J B;  2ZXX A;  2BEQ D;  3L35 A;  3D71 A;  1BCC J;  3G6E P;  2WSE J;  4DZO A;  1K04 A;  4Z1M H;  3CCS P;  1RF1 A;  2FKW B;  5AVS B;  3A2A A;  1N7S D;  1SQB K;  2I1K A;  3V4W A;  1PPJ D;  3CWB E;  2NPS A;  3PLN A;  2YKQ A;  4OVN F;  1L0L E;  4YTP C;  1T2K C;  3A3Y B;  1SQB D;  4KJM A;  1FZB A;  5KLI C;  5TJH A;  4ASV A;  1J1D C;  1X79 B;  2O01 H;  2K37 A;  2FXP A;  3TF5 A;  2YIU B;  3AE4 C;  3L70 G;  5AW2 B;  1UII A;  1JTH A;  1BSN A;  1BGY E;  1SQV K;  1X9V A;  1ZV8 A;  1RF1 C;  3G3Z A;  1NAY A;  1TU3 F;  1ZXG A;  1SQX J;  5KTB A;  3CC4 P;  1OIP A;  1PZQ A;  1NTM G;  2PGD A;  1SQP D;  2M3E A;  4UB8 E;  4W80 A;  4C7R A;  2L91 A;  1JMB A;  5APX A;  3RBX A;  2W27 A;  3CX5 I;  3JCU H;  3V4Q A;  1T6A A;  1KOR A;  1BCC E;  1NU1 D;  1S4X A;  1W5C E;  1AA0 A;  4L76 A;  4AYC A;  1NTK J;  3Q2Y A;  2OYI C;  1CW5 A;  4WY4 C;  3MIW A;  1LJ2 A;  3L75 G;  1H89 A;  4LLH A;  5AW1 B;  4EI2 A;  1VQM P;  3CXH H;  5KLV G;  1LTI C;  2P7J A;  1SQP J;  1S1C X;  1SFC C;  2R5B A;  5KJ7 D;  2WT7 A;  1RF0 A;  3P8C E;  2BCC D;  2FYU D;  3I55 P;  1HBW A;  5AW4 B;  1FJP A;  1OW8 A;  3BRT B;  3L70 D;  3H1I G;  3M9B A;  2N1T B;  1ZW0 A;  1WT6 A;  4L75 A;  1NTK K;  1NAF A;  3L74 J;  1RE4 A;  2P1J A;  1KMI Z;  3H1J E;  1S5L E;  2YXR B;  1K73 Q;  2OYI B;  1AVY A;  3MGN A;  1EXI A;  2WMM A;  1NHL A;  4N3Y B;  1IFI A;  5B66 H;  2FYU K;  3BRV B;  2O1K A;  3LID A;  3GF3 A;  3EQ2 A;  5B5E H;  3VP8 A;  1NU1 G;  3P8M C;  4IOI H;  4U3F D;  3VN0 A;  1QEX A;  1PFI A;  1UIX A;  3L75 D;  4OWF A;  2D2C C;  1L2P A;  3FX0 A;  4GIF A;  4JBZ A;  4NPD A;  2IYO A;  2IPP A;  5CJ4 A;  1LTG C;  2IFN A;  3NFQ A;  1OMI A;  4HB1 A;  3KHU A;  4H0L B;  1FDO A;  1W2B O;  3M0D C;  4HKZ H;  3T97 A;  3U59 A;  2NPS D;  1LTJ C;  4GDO A;  1GU4 A;  3CMA P;  4A7P A;  4O9B A;  2XDJ A;  1N73 C;  1PP9 J;  3HD7 C;  2H8P D;  2PRR A;  3ITK A;  3VTP C;  5CCG D;  1KFN A;  4H44 B;  1VQK P;  1USD A;  2CPB A;  4JQ0 D;  2M3B A;  2RMZ A;  1YJ9 P;  1DIP A;  1FZA A;  1T3J A;  1Y8A A;  3HE4 A;  5APS A;  2E76 B;  3O6Q A;  3Q3D A;  3AEC C;  2A45 H;  1IFJ A;  2IYP A;  1GK6 A;  3GLM A;  5CCH D;  3Q5R A;  1G2C A;  1NJI Q;  2V4H A;  2FXM A;  2OGU A;  3A0H H;  1SQQ K;  1YI2 P;  2QA4 P;  2HPC B;  3S4R A;  1VQ7 P;  1OVR A;  1HGZ A;  1JY2 O;  1SP4 A;  2JJL A;  2OYI A;  3AEA C;  1KB9 D;  3BAT A;  2NPS C;  1KYO H;  5TIS H;  1ZLL A;  5EFW B;  1S5L H;  3H1I E;  2Y0D A;  1L0N D;  1KB9 H;  4IL6 H;  4BWN A;  1Q90 D;  3CCJ P;  2ZYA A;  1VQN P;  5KKZ B;  1VL2 A;  1RE3 C;  2FY8 A;  1LTA C;  2JWA A;  1BE3 D;  3KZI E;  3L74 D;  2Q7C A;  2XU6 A;  2Z4E A;  1NTZ E;  1VF5 B;  4Y99 C;  3H1K J;  5KLV E;  3GF7 A;  2QJY B;  2QIW A;  1L0N E;  4GT1 A;  4PD4 E;  5DJT B;  1KQF B;  1XTG B;  3L75 E;  2JP3 A;  1ZRT E;  3V2R A;  1XTC C;  1KIL E;  1BCC G;  3MTU E;  2P58 A;  3M9H A;  2YNY A;  1SQV D;  4H0L D;  3CCM P;  1ZME C;  3OJA B;  2FYZ A;  2A45 G;  4PD4 D;  5DJU B;  4AUW A;  2AXC A;  3MP7 B;  1OZH A;  3P8C D;  4IL6 E;  1M57 D;  1SQX E;  1SS1 A;  2GM4 A;  3A7O A;  3JSV C;  4BRY A;  1URQ A;  1LTT C;  1NKZ B;  1SQP E;  3C9I A;  1HH0 A;  3L70 E;  2Y9Z A;  1SQP G;  3HUS B;  5L8R J;  5AW7 B;  3V2Q A;  4MN4 C;  1SQX G;  1Y47 A;  1NTZ J;  2KB7 P;  1BCC D;  5E79 E;  1VPC A;  2AEJ A;  3CX5 E;  3RK3 B;  3VMZ A;  5BU5 A;  5K5G B;  5KLI B;  5CJ0 A;  5C39 A;  3IN6 A;  5H2F H;  1M8O B;  1JNM A;  2OYH B;  1AQ5 A;  3CXH E;  5CCH C;  1QVF O;  2ZYG A;  3EFG A;  3L72 D;  2K9J B;  3BCC J;  1OW7 A;  3AE3 C;  2HOD B;  2A06 G;  4GOD A;  1YTZ T;  1PV3 A;  2Q9I A;  1HVV A;  1L0N G;  3B5N B;  1MUU A;  1FZC B;  1CZQ A;  4RES B;  2N1T D;  3Q5S A;  2KK7 A;  1NTZ G;  1L0L D;  1ZP0 C;  4ZNC A;  1PGP A;  3L70 J;  1KIL A;  2O1J A;  3CX5 H;  1A02 J;  3JC2 2;  1HJ0 A;  1M7L A;  2KSJ A;  3D70 A;  2CK3 H;  5APQ A;  1KTM A;  3HUS C;  3M91 A;  3MUD C;  2C0X A;  2WT7 B;  2WPR A;  1QL2 A;  2JR8 A;  1T2K D;  1AFO A;  1KD1 Q;  1PGJ A;  2WPS A;  3BCC E;  4K3A A;  1YQ4 C;  4DT0 A;  3GMA A;  2G3A A;  4RO0 A;  4RJT A;  1GW4 A;  5B5E E;  2YKP A;  1EDI A;  2HFE D;  3AE2 C;  1YYC A;  1LT9 B;  3LW5 H;  1FOS E;  3WU2 E;  3WUV A;  5B66 E;  4K35 A;  3GHG A;  3I5C A;  2A06 D;  4HH2 A;  2P10 A;  1DEB A;  1EXJ A;  3KPE A;  5APY A;  1CSB A;  2H89 C;  2NZ2 A;  1JUN A;  2C9N Y;  3IAO A;  1LP1 B;  5AW9 B;  2JEE A;  1IFM A;  2B9B A;  2SPZ A;  3CD6 P;  1T8Z A;  3H1L E;  1KQS O;  2QJK C;  1IK9 A;  2HLO A;  3WMM 0;  5APU A;  2M8R A;  3NMD A;  2H7H A;  4U3F J;  1AJY A;  1SFC D;  1JY3 N;  4H0L C;  4C46 A;  2NPS B;  4C7N B;  2FFD C;  3PRJ A;  1N7S A;  3HUS A;  3L71 D;  1SFC A;  2ZVO B;  2B87 A;  2WSE H;  4HYT B;  1RF0 C;  3E1I A;  3FWN A;  3H1K E;  2AEF A;  2LXC B;  1NU1 E;  3RL0 C;  5KLV J;  4WBA A;  1KB9 E;  3VMX A;  4XA4 A;  3V2N A;  2N9Y B;  3F5H A;  1PGQ A;  2QE7 H;  4N78 E;  3D6Y A;  1T3U A;  2ZAE B;  1OX3 A;  1JY2 N;  1GDT A;  3L71 J;  1FS0 E;  3AE6 C;  5KAI H;  3H1J G;  1S72 P;  1HJB A;  4GOF A;  3O6Q B;  1VQ6 P;  1Q7Y Q;  3TNU B;  1BE3 G;  2BCC E;  2FYU E;  4I1L A;  5AW0 B;  2CPS A;  3V6I A;  1YJW P;  2POH A;  5AVU B;  2H43 A;  2KS1 B;  1L0N J;  1QL1 A;  3HTK B;  2QM8 A;  4JYC A;  3L73 J;  3USS A;  4PV1 D;  2OTJ P;  2Q3E A;  1BSH A;  4GKG A;  2YMK A;  1NU1 J;  3B71 A;  1NGM B;  5AW8 B;  1K8A Q;  1M1J C;  1ZOY C;  1RQU A;  3FXD A;  3H25 A;  2GA1 A;  1OWA A;  2YMY A;  2FFD B;  3CPW O;  1GL2 A;  1GW3 A;  2Z5H A;  1AQT A;  1KN7 A;  2ZT9 B;  1LTJ A;  4OGQ B;  1SQX D;  3AEB C;  4UB8 H;  1S2E A;  5BVZ A;  3CME P;  2KZI A;  2Q1K A;  1JO5 A;  1NOH A;  3AEG C;  4Y99 B;  3IFM A;  1H8A A;  1YTZ I;  1IZN B;  4NPE A;  1NTM E;  1OVV A;  2WSC J;  4ZKU A;  2QSI A;  1VQL P;  2FYN C;  4UB6 E;  5CCG A;  1OFC X;  1LGH B;  2KZJ A;  1ZR4 A;  1RF1 B;  5TIS E;  2YKO A;  1PIX A;  3H1H J;  1BGY G;  3L72 G;  1L0L K;  2Q5U A;  1MFZ A;  3MD0 A;  5AVQ B;  4B86 A;  2AXT H;  5GTI H;  1D7M A;  1U7J A;  1EDL A;  2OYO A;  4DJG A;  1NTM D;  5AVW B;  1YJN P;  3HE5 B;  4KHX A;  1JEK A;  3VMY A;  1P84 H;  2KUB A;  3M0A A;  1L0L G;  3VOP A;  3NXS A;  3MUD A;  2ZJS E;  3CWB G;  3U1C A;  1N8R Q;  2WPQ A;  1EQ7 A;  2XZR A;  2LXB A;  1Q2N A;  1VQ4 P;  1QVG O;  1NTM J;  1Q81 Q;  1EZV I;  1DEE G;  3B4S A;  4IL6 X;  1AVO A;  2O3J A;  4OGQ C;  2ZFC A;  1IK7 A;  3M9Q A;  4OH8 B;  2WTY A;  3L73 G;  4D6T E;  2JDI H;  2WWW A;  1OVU A;  2H88 C;  3QWO C;  2QJY C;  1L0N K;  2K9J A;  3H6P A;  1FDM A;  2PP6 A;  4PJ0 E;  3RBZ A;  2BAS A;  1H0T A;  2OYH A;  4EYY Q;  3H1I D;  2RKL A;  1JY3 O;  2XND H;  1N7L A;  2WQY C;  3JCU E;  3B5N C;  3L71 G;  4H13 D;  1JY2 P;  2HOD A;  1LWU A;  1JM0 A;  3G4S P;  3TGU D;  1SQB E;  1JB0 J;  1G2C B;  2K9Y A;  2HPC A;  3II6 A;  1EDJ A;  3B5N A;  3H1H D;  1YBK A;  3CX5 D;  2KS1 A;  3L36 A;  1ZR2 A;  4QMA A;  1LTB C;  1MKM A;  2IBZ D;  5E79 H;  1JMM A;  1CI6 B;  2ZYD A;  3G9R A;  4U3F G;  2E42 A;  2Q3I A;  3C8V A;  1SQP K;  1N7S C;  3CXH D;  1PP9 G;  3ABV C;  1URQ C;  2BEZ F;  2OTK E;  4L74 A;  1EDK A;  1FJK A;  2KP8 A;  2VRS A;  3M0D A;  4U7J A;  1DD3 A;  4N78 D;  5CHX A;  1VQ5 P;  1HTL C;  2WSS H;  3TGU J;  1GL2 C;  2B89 A;  1EZV E;  3OAK A;  1RQV A;  4TT3 H;  1SQQ D;  3TDK A;  3KDP B;  1N73 B;  3K5B A;  4H44 C;  1JCC A;  2FYN B;  1VQ9 P;  5CCH A;  1DX7 A;  2E43 A;  2BCC J;  2FYU J;  3GHG B;  2GUV A;  2O01 J;  1R5L A;  2HYN A;  3RK3 D;  1J2J B;  3H1H G;  3L74 G;  3BAS A;  1HUC A;  2MKV A;  5GTH H;  1GMJ A;  2E75 C;  3BCC D;  3PH0 A;  4LGD E;  1P84 D;  2M5A B;  2IBZ G;  4H13 B;  3AE9 C;  2C9L Y;  3PJS K;  1OXZ A;  4WY4 D;  4YPC A;  4BRY B;  5APT A;  1PP9 D;  1URQ D;  2R5D A;  1M1K Q;  3H1J D;  4C7N A;  2KNC A;  5APV A;  4WY4 A;  1WRG A;  1N7S B;  2I8D A;  2V7Q H;  1HWT C;  1NTK E;  3N4X A;  1SQV G;  1RH5 B;  2KSE A;  2K3R A;  3VYI A;  3RL0 g;  1SQQ G;  1YIJ P;  1R5S A;  3P7K A;  4JPZ B;  2AXT E;  5AVR B;  5GTI E;  2B87 B;  2QM7 A;  3L75 J;  1YHQ P;  5BU8 B;  2J5U A;  2IZ1 A;  2N1T C;  1LT9 C;  2ZVN B;  2L5G B;  1K05 A;  3B8E B;  4XFJ A;  4CPG A;  1FU1 A;  5CMZ A;  2W83 C;  3V5B A;  2IDB A;  2WZ7 A;  1GTW A;  1Y9B A;  2J58 A;  1IJD B;  4OGQ D;  2N9B A;  3AE8 C;  1GK4 A;  1M56 D;  2E74 B;  4IFF A;  4EIJ A;  3AE1 C;  3I56 P;  1SQV J;  4ZKP A;  3CLQ A;  2HG5 D;  1E79 H;  1FZF A;  1HGV A;  1IO4 A;  1NTZ K;  2XNX A;  2Z5I A;  2E75 B;  3LW5 J;  1EC5 A;  1KIL B;  2WSF H;  1KFM A;  3H1K D;  1OW6 A;  3KQG A;  3L74 E;  4PD4 I;  2QJK B;  4PV1 B;  4W7Z A;  3G71 P;  2QRX A;  2W6B A;  3FXE A;  4D6T D;  2KXP B;  1BE3 J;  1LNQ A;  3AEE C;  1KB9 I;  1KV4 A;  2W6J H;  3CCE P;  3CCL P;  1KYO I;  2XV5 A;  2QJP C;  4DOJ A;  1U57 A;  1LTJ B;  1VQ8 P;  2GUS A;  2QEX P;  4ZMD A;  1BGY J;  1FDI A;  1JY3 P;  3RK3 C;  1GL2 B;  3H32 A;  3S9O A;  1EZV G;  1PGO A;  1PPJ G;  2P2U A;  3SWK A;  1QGK B;  3TK1 A;  1AV1 A;  4I2L C;  1SQX K;  2M0B A;  2OYH C;  2YIU C;  3PP5 A;  3W67 A;  4D6T J;  3C1L A;  4Y28 J;  1NKN A;  1NVO A;  4TLF A;  5AVV B;  1J1E B;  1PP9 E;  1RE4 C;  4GOE A;  2DW3 A;  2N1T A;  1J1E C;  4KT0 J;  1BDC A;  3H1L D;  2D2C D;  4AQR D;  1GL2 D;  3Q1M A;  3OW2 O;  1IFN A;  2HR3 A;  2WIT A;  1N2D C;  4I7Z C;  2E76 C;  1G1I A;  1RY3 A;  2A45 I;  2I1J A;  3HE5 A;  4N6J A;  3VP9 A;  3CCR P;  2WVR A;  2QG4 A;  4R4M A;  3SFE C;  4PV1 C;  1Z56 A;  1SVF A;  1KIL C;  3L71 E;  4ASW A;  1MZ9 A;  3PHL A;  3W68 A;  3QH9 A;  3GW6 A;  1KZU B;  2R32 A;  1KQG B;  1U7M A;  3TGU E;  1FBM A;  1M1J A;  1N86 A;  3TGU G;  3CCU P;  2PAJ A;  1SFC B;  5KAF H;  1WMK A;  1NWQ A;  2R3C A;  4HJG H;  4PJ0 H;  1M90 Q;  2YXQ B;  1L4A A;  3H1I J;  3L73 E;  3T97 B;  1RE3 A;  5KKZ C;  4EOT A;  1A02 F;  2XKM A;  3IF4 A;  3IR9 A;  1NH4 A;  1NO4 A;  1BDD A;  3UIA A;  1JTH B;  1VF5 C;  3CCQ P;  3MZW B;  2O01 N;  1Q86 Q;  1KYO E;  3A0B E;  2JKV A;  1L4A D;  1H88 A;  1YQ3 C;  3CC7 P;  5M1B A;  3TNU A;  4I6M C;  1H0T B;  2K88 A;  2KOG A;  2IFM A;  4WVZ A;  1VDF A;  2OTL P;  1LTS C;  1QLE D;  2WPV B;  3F89 A;  3HE4 B;  1FAV A;  2W90 A;  3HTK A;  1LWU B;  1K9M Q;  4YXD C;  4DCK A;  3Q5P A;  1LWU C;  1PPJ E;  3CWB D;  5AW3 B;  3KXD A;  3L72 E;  5KAI E;  2IX7 C;  3RK3 E;  2IBZ I;  3NTN A;  2MJZ A;  2OQQ A;  2RN0 A;  3A0B H;  2RH0 A;  4RKU J;  3CXH I;  3CWB J;  1SQQ J;  1MV8 A;  3RGU A;  1VQP P;  2FFD A;  1L0L J;  1W2E A;  1JCD A;  3EFF K;  2YO2 A;  2JO1 A;  1BGY D;  4UB6 H;  4IFM A;  2LKM A;  2ZT9 C;  3GG2 A;  3RK2 D;  1VF5 D;  1DD4 A;  2E76 D;  1S5L X;  3AEF C;  4W7Y A;  3U1A A;  2FXO A;  2Q6Q A;  1R8E A;  1RHZ B;  2J59 M;  1L4A C;  2P67 A;  3ZDM A;  1YIT P;  1ZN5 A;  3HD7 B;  1NTK D;  3FGA D;  4JF7 A;  1FE6 A;  1IC2 A;  1X22 A;  3O8Z A;  1N73 A;  3B5N D;  5CCG C;  2Y0E A;  3BVH A;  3RK2 B;  1DH3 A;  4I7Z B;  5AVZ B;  2OAR A;  1E5W A;  3R2P A;  1NTZ D;  3E1R A;  3OA7 A;  3LIE A;  3M06 A;  3AE5 C;  2M5A A;  1NU1 K;  2E74 D;  2V7Q J;  2KIK A;  3KZI H;  3L37 A;  1KQL A;  2ZXE B;  4R4L A; 
#chains in the Genus database with same CATH homology
 1M8O B;  1S4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...