1S4XA

Nmr structure of the integrin b3 cytoplasmic domain in dpc micelles
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
KLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Integrin beta-3
publication title Membrane-mediated structural transitions at the cytoplasmic face during integrin activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2004-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08725 Integrin_b_cyt Integrin beta cytoplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.630 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Integrin beta subunit, cytoplasmic domain 1s4xA00
1S4XA 1M8OB
chains in the Genus database with same CATH superfamily
3H1LJ 3LIDA 1FZFA 3S4RA 1M8OB 1FZCC 3H1IE 2ZT9B 1XTCC 2ZFCA 2H88C 1HWTC 2JKVA 4GDOA 4D6TJ 2OYIA 2FFDC 4L73A 1KYOH 1USEA 5KAFE 1L0NK 4OGQB 2O01J 3LW5J 5K5GB 1YBKA 5L8RJ 2HPCA 3A2AA 4WY4A 1SQXE 1FDMA 5KLVD 1G2CB 1ZMEC 4W80A 3QWOC 3VMYA 1H0TA 1TU3F 3PP5A 1JMMA 2QA4P 2B87B 1T3UA 3CXHE 3HUSA 1M56D 4YXWH 1NTZD 1S2EA 3B5NB 1PV3A 4GIFA 1YJWP 1NTKG 5CJ0A 5B5EE 2V4HA 1SFCB 5B66H 1N73B 3CCSP 1KQSO 1ZOYC 1QX8A 1OVRA 1BCCJ 3WU2H 3L4FA 1NTMG 1ZRTD 3CLQA 2LKMA 1WRGA 2E74C 2OYIC 2OTKE 1NAYA 1HH0A 4H13D 3CCQP 1L4AB 3TGUJ 1SS1A 2C9NY 1NO4A 2FY8A 1YQ3C 2KLVA 2YXRB 3U59A 3RK2D 3M9QA 1GMJA 4H0LB 1U7MA 3TNUB 1NTKD 2OGUA 4WY4C 1FOSE 2E5TA 2OYHA 2ZVOB 3KHUA 2QJKC 3FWNA 1JOCA 4B86A 4UB6H 1RF1B 3HUSC 3SSUA 1H8AA 3RGUA 1OVUA 2XV5A 2O01N 2Z5IA 3GLMA 3FXDA 2ZXEB 1N73A 2KNCB 1PPJE 2FYUD 1EZVE 2ZT9C 3SWFA 3CCEP 2XKMA 3AE5C 3I55P 1BSNA 3A0BE 3N4XA 5GTIH 1FJKA 2HODA 2Y0EA 3AEEC 2V7QH 2R3CA 2Y9YA 1S5LX 4PD4E 4OGQC 3FXEA 5GTHE 4OWFA 3L73D 2OYHC 1EDJA 1DD3A 3TNUA 3S9OA 3RBXA 1M1JA 3VTPC 3MUDA 1ZW0A 1RF1A 2LXCB 1MKMA 5AW3B 5APYA 4C7NB 1T6AA 2JEEA 3L75E 1SFCC 2YO3A 1N73C 4R4MA 2P58A 1BE3D 1PP9G 1A02J 1QEXA 2N9YB 1NU1G 1W5CE 3BRVB 3V6IA 1KB9D 3L74J 2PFXA 3H1LD 1OIPA 1SQBE 4WY4D 5TJHA 2BASA 1L0NG 3B8EB 1L4AC 1Y8AA 1UIXA 1LTBC 1SQVK 5AW5B 2ZVNB 1MZ9A 3Q1MA 1FS0E 1KQLA 5AW9B 4EDFA 1M1JC 1SQVJ 3MUDC 4D6TD 3CWBE 1RF1C 1KZUB 2ZT9D 2JO1A 1JY2P 4IFFA 4JYCA 2KUBA 3TK1A 2OTJP 2BCCE 4WBAA 1DD4A 2M3BA 1L0ND 4K35A 3L72G 3D71A 2WVRA 4IL6X 1GW4A 1FAVA 1NYHA 4N3YB 2WSFH 1MFTA 1FC2C 1VDFA 2RN0A 4JBZA 4OVNF 2IFNA 3HD7B 4Y99B 1HGZA 3CCJP 5AVZB 1N2DC 3SWYA 3AE2C 4ZKUA 2FYNB 1AA0A 4K3AA 3D70A 1JUNA 1FZAA 1A02F 2R5DA 2PGDA 3B5ND 3L74E 4GOFA 3H1HE 2K9JB 2O1KA 4Z1MH 1SFCD 2WPQA 3RBZA 1K04A 3M0DA 3TGUD 2XDJA 1SQPG 3NFQA 2B9BA 3BCCJ 2GM4A 1VQ6P 2Z4EA 2IBZE 3CCLP 1OMIA 3L70E 2P67A 3MP7B 1AVYA 5AVTB 1L2PA 2YNYA 3IFMA 3A7OA 1P84D 4I7ZC 1L0LE 3H1KJ 1L4AD 1NOHA 2J58A 4H0LD 1CZQA 4UB8E 1S3JA 1P84I 3RK3D 4N78D 2HFED 2KP8A 1QL1A 5EFWB 3JSVC 1VQNP 3Q3DA 2A06D 1BGYE 3GG2A 1IFMA 3HTKB 4IL6H 2AXTE 1YTZI 5AVQB 3V2NA 2WSCH 5AW7B 3M0DC 1VQ5P 2K9JA 1KILE 2M5AA 3P8MC 2YMKA 1MV8A 3NMDA 3P8CD 3F89A 2XU6A 1FZBA 3C8VA 2KS1B 2QIWA 4IFMA 1DEEG 3H1IJ 3V4WA 1X22A 3L71G 1OFCX 2P10A 3A3YB 3K5BA 3MHVA 2FBWC 2G8YA 3BCCE 2KB7P 1WT6A 1RY3A 1SQXK 1CI6B 2P1JA 4Y99C 4JQ0D 5AVVB 2HG5D 1IK7A 1EXJA 1RE4A 2Q3IA 1SQXJ 3AEBC 3D6ZA 1XTGB 4EYYQ 4U3FG 1UIIA 2WPSA 3PHLA 3L71D 1VQMP 3MZWB 3UIAA 1SQQK 3M9BA 1Z56A 1AV1A 5KTBA 1EDLA 4AUWA 1HJBA 2KS1A 2WMMA 3AE7C 1NGMB 2WQYC 2AEJA 1SQVD 2CK3H 1OW6A 1GU5A 1LT1A 2KOGA 5AVUB 3JCUH 5AW6B 4HH2A 3GF7A 5KLVG 4BXLA 3H1JG 3GF3A 3A0HH 4DZOA 3G6EP 1KFNA 2Y9ZA 3Q2YA 1URQD 4U3FD 1NTZG 2SPZA 3VMXA 1LTGC 2BEQD 3T97B 1NTME 1RE4C 3KDPB 2K88A 3BRTB 2OYOA 2FXPA 1W2BO 3IN6A 2I1KA 2W6BA 3H6PA 1NKZB 5AW2B 3H32A 5APQA 1HUCA 3H1JD 1R5SA 3CC2P 1IK9A 3HD7D 2IZ1A 2XNDH 1D7MA 2E75B 3KZIH 2L91A 5APTA 5TISH 4C7RA 2E76B 2ZYGA 1ZR2A 2QRXA 3M9HA 1KYOE 1KB9H 3WUUA 1CSBA 4JPZB 1KMIZ 4DT0A 2I8DA 1K9MQ 2W6JH 1ZR4A 1FDOA 4YTPC 1N7SD 2A45I 1YIJP 2OARA 3KZIE 1GDTA 1SLQA 2N1TB 2FYUG 4A7PA 5TISE 3V2QA 1S1CX 3Q5SA 5B66E 3AEGC 2Y0DA 3KQGA 3L75J 2QG4A 3N7NA 3RK3B 3SFEC 1M1KQ 2B89A 3WU2E 1N8RQ 1FOSF 2O01H 2GUSA 3LW5H 1G2CA 3EQ2A 5AW4B 1VF5B 2KZIA 1OWAA 2B87A 4PV1D 3L73G 4ZKPA 5CCHD 1X8YA 3B5NA 1SQBJ 5CBNA 3TSIA 2FXMA 3V2RA 2WT7B 3H1ID 3GHGB 1SFCA 1J1EB 1SP4A 1PP9E 1J1DB 2Q7CA 1T8ZA 1NU1E 1ZN5A 4UB6E 2NRGA 1FDIA 3AE3C 2RMZA 3CD6P 2KXPB 1BE3G 1SQQG 3CWBJ 2N1TA 1L4AA 1YI2P 2QJPB 3GW6A 3HE4B 2KLUA 2AEFA 3H1LG 3E1RA 1MFZA 3S1KA 2BCCJ 1SQXD 1RE3C 2M3EA 3CMAP 1HTLC 3G9RA 5AVSB 3CC7P 4GODA 4DCKA 5GTIE 3PRJA 1HGVA 2IYOA 2P7JA 3CXHD 1P84H 3CCRP 1FU1A 3B5NC 2OTLP 2XZRA 3RL0g 3A5TA 5KAIH 2E76C 4DJGA 2KSEA 4TT3H 1NHLA 2FKWB 4D6TG 4W7ZA 1GZLA 3CXHI 1G1JA 3GHGA 1EQ7A 1LJ2A 1SQQD 1LT9B 1PFIA 2KNCA 3L72E 5APUA 4AQRD 3EFGA 3H1HJ 4L75A 5AW1B 1PPJG 3EFFK 2WSFJ 2N1TC 2JR8A 1S4XA 3Q5PA 2QVAA 5KAIE 2M0BA 1W2EA 1L0LK 2ZXXA 3U1AA 2JWDA 1KB9I 2PAJA 3AE1C 2WSEJ 3AEDC 4W7YA 1ZLLA 3HE4A 1PGPA 3L70J 4H0LC 5AW8B 1URQB 3L37A 2C9LY 3RK3C 3HE5B 4XFJA 4ASVA 4N78E 1L0LJ 4I6MC 1BCCG 1ZXGA 2R5BA 1VF5C 1SQPE 1EC5A 1X0TA 1S5LH 1AJYA 5APWA 4NPFX 1KILB 1RQUA 4C7NA 4LC1A 1BDDA 1JCDA 3GHGC 3CC4P 1PPJD 3TGUG 1EZVD 1J1EC 2IDBA 5KJ7D 1J1DC 1BGYJ 2W90A 1GK6A 3OW2O 2PP6A 1LWUB 1VQ9P 1JY2N 1U7JA 4XA4A 1BCCD 4PD4D 3VP9A 2E75D 1M90Q 1PIXA 2K37A 1URQA 1RF0A 2E76D 1JY3P 3HE5A 2JWAA 2A06G 3KXDA 1N7SB 4L74A 3AE8C 2J5UA 3MD0A 2WSCJ 1LNQA 2JDIH 3L75D 4LLHA 1AQ5A 3L71E 1KQGB 2NZ2A 1Q90D 5KLIB 2N1TD 5APXA 3CCVP 2Q5UA 1YJNP 1RHZB 1LTJB 2W27A 3IF4A 1JY3N 2Q9IA 2KK7A 2N9BA 2QJYB 4PV1B 3HD7A 5H2FH 1ZV8A 3EWKA 4HJGH 4LGDE 5KKZB 4PJ0H 1JY2O 5C39A 1VQ8P 1VF5D 2R44A 1FZCB 1NKNA 2QM8A 1URQC 2BEZF 1RF0C 2W83C 1SVFA 5AW0B 1LP1B 1Q7YQ 5AVXB 1JO5A 3C9IA 3TDKA 1KV4A 1NTKJ 1N7SA 4ZMDA 2WSSH 3CCMP 1FJPA 1NTMK 3L74G 1IFIA 1E79H 2KIKA 4WVZA 1K8AQ 2BCCD 2FFDB 1OVVA 3BASA 3KYQA 2VRSA 2A45H 1PZQA 1NTMJ 4IL6E 4IOIH 1S9KD 2Y0CA 5KLVE 5CJ4A 1LTJA 3H1JE 1JY3O 1LWUC 4Y28J 2C0XA 2H89C 3HD7C 3D6YA 1SQVG 1U57A 1NTZE 4QMAA 3R2PA 4EIJA 2O1JA 5CCHA 2FYNC 1KD1Q 2MJZA 1J2JB 3I56P 5AVWB 2Z5HA 2IFMA 3L74D 5E79H 3NXSA 3HTKA 1JTHB 3H1HD 1VQKP 1IFJA 2P2UA 1LP1A 3VYIA 4DOJA 1BGYG 3MIWA 1ZRTE 2GUVA 1N7SC 2E74B 3QH9A 1BDCA 4GT1A 1Y47A 4L76A 3IR9A 2IBZD 3L70D 1QL2A 3AEFC 1E5WA 1HBWA 5CMZA 5CCGD 3R4YA 3II6A 1L0LD 2Q1KA 2NPSB 2H8PD 5KLIC 1NTKE 3L35A 1G1IA 2IZ0A 1LTJC 1H0TB 3VMZA 3O8ZA 1T2KC 1LTSC 3P7KA 5DJUB 1VQ7P 2QJYC 1CI6A 4PV1C 1USDA 1LGHB 5CCHC 1YHQP 4O9BA 5KKZC 3BCCG 1BGYD 1DEBA 1YJ9P 5KAFH 2A45G 3AE4C 3WUTA 3CX5D 1H88A 1GU4A 2FYUE 4I2LC 3JCUE 1JTHA 3F5HA 2HR3A 1EDIA 1GL2B 3O6QB 1KILD 3H1KG 4BRYB 1N86A 2J59M 3A0HE 2IYPA 1QLED 2CPSA 1YYCA 3CX5I 4RJTA 1IFPA 1NU1K 3CXHH 1AQTA 1YTZT 3I5CA 5AVRB 1QVFO 2C0WA 1PP9J 1AVOA 5B5EH 3VOPA 2H43A 1Q86Q 4JYBA 4YXDC 1NU1J 4ASWA 1T3JA 4HB1A 4WWIA 2YO2A 1RQVA 3OAKA 2NPSA 2OYHB 3L73E 3BCCD 3FGAD 1OW7A 4HKZH 5M1BA 1L0NJ 3ZDMA 3RL0B 4WB4A 2K9YA 3H1KD 2YIUB 1R8EA 4NPEA 3T97A 4NPDA 2E5YA 3H1IG 1NJIQ 1BE3E 1M7LA 5KJ7A 5BU5A 1SQQE 2V7QJ 2WPRA 2HODB 3O6QA 1GL2A 4BRYA 1NWQA 2ZJSE 1KB9E 3W68A 3H1LE 3E1IA 5CBOA 3V4QA 1FZGA 3LIEA 1SQBK 3E7KA 1RE3A 1T2KD 3CPWO 3L72J 2E42A 3SFDC 2NPSC 2ZYAA 1IZNB 4EI2A 5DJTB 1SQXG 1M1JB 2IX7C 3A0BH 3CCUP 1RH5B 1FE6A 1KC8Q 4D6TE 2POHA 3M91A 2MKVA 1PGQA 2GA1A 3V5BA 1KFMA 1IJDB 1NTMD 1SQPK 4AYCA 1N7LA 1QGKB 3CMEP 2ZAEB 4PD4H 2AEMA 4I1LA 2D2CB 2UWJE 1VL2A 5KJ7C 5GTHH 1VQOP 2YKOA 1L0NE 1FZEA 1SQPJ 1IFNA 1CW5A 4TLFA 1GL2C 3G3ZA 3WMM0 4OH8B 1MUUA 1X9VA 1HF9A 1PL5A 3B4SA 4H44B 2YKQA 2I1JA 3PH0A 1BCCE 5BU8B 3OJAB 2E75C 1DX7A 4HYTB 2JJLA 2YKPA 2QSIA 1EXIA 1OZHA 3L36A 4CPGA 1KYOD 1R5LA 2WT7A 1GK4A 3TGUE 3AE6C 3RL0C 3MGNA 1VPCA 4RESB 3U1CA 4IFDK 3WUVA 4GKGA 2YIUC 2FXOA 1KYOI 2E74D 2HYNA 3B71A 1IFDA 4I7ZB 5AVYB 1EZVG 2QM7A 3Q5RA 1P84E 1Q2NA 1AFOA 1EDKA 3G71P 1KQFB 2NPSD 1YQ4C 1LTIC 4RO0A 1PGJA 3RK3E 1HVVA 3L71J 3GMAA 3M06A 1IC2A 2KZJA 3M0AA 2A06E 3ITKA 5APVA 5BVZA 3IAOA 3SWKA 1JM0A 2QEXP 1OW8A 1GTWA 3PTZA 2R32A 1DIPA 3PLNA 4RKUJ 3H25A 3P32A 1PP9D 3VMAA 1K05A 3P8CE 1LT9A 1GW3A 1NU1D 1GL2D 4EOTA 2KSJA 3L75G 4BWNA 3BVHA 3FX0A 4U3FJ 5CCGA 1EZVI 2M8RA 2Q6QA 2D2CC 1DH3A 1S72P 1S5LE 1GD2E 1JNMA 2QJPC 4ZNCA 1S9KE 4OGQD 1JB0J 1SQBG 2K3RA 2RKLA 1K73Q 5KLVK 2WSEH 4H44C 3VP8A 1VQ4P 4PD4I 2YXQB 2B88A 1VQPP 5CHXA 1NTZK 3RL0D 3PJSK 2WWWA 5KLVJ 3H1JJ 1Y9BA 4U7JA 2M5AB 3CI9A 3CWBG 2DW3A 1KILA 1NTZJ 3JC22 4UB8H 2KYVA 1LT9C 3L72D 3CL3D 2XNXA 4H13B 1LTTC 1HJ0A 5CCGC 2BCCG 2PRRA 1SQBD 4XE5B 1OXZA 2QE7H 3RK2B 3G4SP 2G3AA 1LWUA 1SQVE 2AXTH 3CX5H 1PGOA 4M3LA 4KJMA 1WMKA 2FYZA 1NTKK 2WZ7A 1LTAC 3MTUE 2O3JA 1YITP 4U3FE 2H7HA 4KHXA 4C46A 1FBMA 3CWBD 2IPPA 1IO4A 1SQPD 3W67A 3USSA 4N6JA 3CX5E 5H2FE 3VN0A 3H1HG 2W8ZA 3TF5A 4PJ0E 1JEKA 1KILC 1Q81Q 2FYUK 2W6AA 2D2CD 2OQQA 1KN7A 2LR2A 3TYYA 2L5GB 2IBZG 2ZYDA 1M57D 3L70G 3BATA 1QVGO 2E43A 2WITA 1BSHA 1JCCA 2FYUJ 3HRNA 1L0LG 1X79B 2R3SA 2RH0A 1NAFA 4H44D 4R4LA 3AECC 4YPCA 2WPVB 1NH4A 4MN4C 1FZCA 3KPEA 3AE9C 2KI7B 2AXCA 3H1KE 2Q3EA 1ZP0C 3L73J 1KORA 4JF7A 4GOEA 2OYIB 2YMYA 3AEAC 1KTMA 4KT0J 2JP3A 1Q82Q 2CPBA 2WTYA 2FFDA 3H32B 3FWLA 1OX3A 2LXBA 5E79E 3NTNA 2HPCB 1JMBA 2IBZI 1VQLP 4WY4B 2HLOA 1H89A 4H13C 2QJKB 1BE3J 1NVOA 3C1LA 1SQQJ 3HUSB 3RK2C 3ABVC 2K1AA 3OA7A 5APSA 2ITAA 3V2PA
chains in the Genus database with same CATH topology
1S4XA 1M8OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4X A;  1M8O B; 
#chains in the Genus database with same CATH topology
 3H1L J;  3LID A;  1FZF A;  3S4R A;  1M8O B;  1FZC C;  3H1I E;  2ZT9 B;  1XTC C;  2ZFC A;  2H88 C;  1HWT C;  2JKV A;  4GDO A;  4D6T J;  2OYI A;  2FFD C;  4L73 A;  1KYO H;  1USE A;  5KAF E;  1L0N K;  4OGQ B;  2O01 J;  3LW5 J;  5K5G B;  1YBK A;  5L8R J;  2HPC A;  3A2A A;  4WY4 A;  1SQX E;  1FDM A;  5KLV D;  1G2C B;  1ZME C;  4W80 A;  3QWO C;  3VMY A;  1H0T A;  1TU3 F;  3PP5 A;  1JMM A;  2QA4 P;  2B87 B;  1T3U A;  3CXH E;  3HUS A;  1M56 D;  4YXW H;  1NTZ D;  1S2E A;  3B5N B;  1PV3 A;  4GIF A;  1YJW P;  1NTK G;  5CJ0 A;  5B5E E;  2V4H A;  1SFC B;  5B66 H;  1N73 B;  3CCS P;  1KQS O;  1ZOY C;  1QX8 A;  1OVR A;  1BCC J;  3WU2 H;  3L4F A;  1NTM G;  1ZRT D;  3CLQ A;  2LKM A;  1WRG A;  2E74 C;  2OYI C;  2OTK E;  1NAY A;  1HH0 A;  4H13 D;  3CCQ P;  1L4A B;  3TGU J;  1SS1 A;  2C9N Y;  1NO4 A;  2FY8 A;  1YQ3 C;  2KLV A;  2YXR B;  3U59 A;  3RK2 D;  3M9Q A;  1GMJ A;  4H0L B;  1U7M A;  3TNU B;  1NTK D;  2OGU A;  4WY4 C;  1FOS E;  2E5T A;  2OYH A;  2ZVO B;  3KHU A;  2QJK C;  3FWN A;  1JOC A;  4B86 A;  4UB6 H;  1RF1 B;  3HUS C;  3SSU A;  1H8A A;  3RGU A;  1OVU A;  2XV5 A;  2O01 N;  2Z5I A;  3GLM A;  3FXD A;  2ZXE B;  1N73 A;  2KNC B;  1PPJ E;  2FYU D;  1EZV E;  2ZT9 C;  3SWF A;  3CCE P;  2XKM A;  3AE5 C;  3I55 P;  1BSN A;  3A0B E;  3N4X A;  5GTI H;  1FJK A;  2HOD A;  2Y0E A;  3AEE C;  2V7Q H;  2R3C A;  2Y9Y A;  1S5L X;  4PD4 E;  4OGQ C;  3FXE A;  5GTH E;  4OWF A;  3L73 D;  2OYH C;  1EDJ A;  1DD3 A;  3TNU A;  3S9O A;  3RBX A;  1M1J A;  3VTP C;  3MUD A;  1ZW0 A;  1RF1 A;  2LXC B;  1MKM A;  5AW3 B;  5APY A;  4C7N B;  1T6A A;  2JEE A;  3L75 E;  1SFC C;  2YO3 A;  1N73 C;  4R4M A;  2P58 A;  1BE3 D;  1PP9 G;  1A02 J;  1QEX A;  2N9Y B;  1NU1 G;  1W5C E;  3BRV B;  3V6I A;  1KB9 D;  3L74 J;  2PFX A;  3H1L D;  1OIP A;  1SQB E;  4WY4 D;  5TJH A;  2BAS A;  1L0N G;  3B8E B;  1L4A C;  1Y8A A;  1UIX A;  1LTB C;  1SQV K;  5AW5 B;  2ZVN B;  1MZ9 A;  3Q1M A;  1FS0 E;  1KQL A;  5AW9 B;  4EDF A;  1M1J C;  1SQV J;  3MUD C;  4D6T D;  3CWB E;  1RF1 C;  1KZU B;  2ZT9 D;  2JO1 A;  1JY2 P;  4IFF A;  4JYC A;  2KUB A;  3TK1 A;  2OTJ P;  2BCC E;  4WBA A;  1DD4 A;  2M3B A;  1L0N D;  4K35 A;  3L72 G;  3D71 A;  2WVR A;  4IL6 X;  1GW4 A;  1FAV A;  1NYH A;  4N3Y B;  2WSF H;  1MFT A;  1FC2 C;  1VDF A;  2RN0 A;  4JBZ A;  4OVN F;  2IFN A;  3HD7 B;  4Y99 B;  1HGZ A;  3CCJ P;  5AVZ B;  1N2D C;  3SWY A;  3AE2 C;  4ZKU A;  2FYN B;  1AA0 A;  4K3A A;  3D70 A;  1JUN A;  1FZA A;  1A02 F;  2R5D A;  2PGD A;  3B5N D;  3L74 E;  4GOF A;  3H1H E;  2K9J B;  2O1K A;  4Z1M H;  1SFC D;  2WPQ A;  3RBZ A;  1K04 A;  3M0D A;  3TGU D;  2XDJ A;  1SQP G;  3NFQ A;  2B9B A;  3BCC J;  2GM4 A;  1VQ6 P;  2Z4E A;  2IBZ E;  3CCL P;  1OMI A;  3L70 E;  2P67 A;  3MP7 B;  1AVY A;  5AVT B;  1L2P A;  2YNY A;  3IFM A;  3A7O A;  1P84 D;  4I7Z C;  1L0L E;  3H1K J;  1L4A D;  1NOH A;  2J58 A;  4H0L D;  1CZQ A;  4UB8 E;  1S3J A;  1P84 I;  3RK3 D;  4N78 D;  2HFE D;  2KP8 A;  1QL1 A;  5EFW B;  3JSV C;  1VQN P;  3Q3D A;  2A06 D;  1BGY E;  3GG2 A;  1IFM A;  3HTK B;  4IL6 H;  2AXT E;  1YTZ I;  5AVQ B;  3V2N A;  2WSC H;  5AW7 B;  3M0D C;  1VQ5 P;  2K9J A;  1KIL E;  2M5A A;  3P8M C;  2YMK A;  1MV8 A;  3NMD A;  3P8C D;  3F89 A;  2XU6 A;  1FZB A;  3C8V A;  2KS1 B;  2QIW A;  4IFM A;  1DEE G;  3H1I J;  3V4W A;  1X22 A;  3L71 G;  1OFC X;  2P10 A;  3A3Y B;  3K5B A;  3MHV A;  2FBW C;  2G8Y A;  3BCC E;  2KB7 P;  1WT6 A;  1RY3 A;  1SQX K;  1CI6 B;  2P1J A;  4Y99 C;  4JQ0 D;  5AVV B;  2HG5 D;  1IK7 A;  1EXJ A;  1RE4 A;  2Q3I A;  1SQX J;  3AEB C;  3D6Z A;  1XTG B;  4EYY Q;  4U3F G;  1UII A;  2WPS A;  3PHL A;  3L71 D;  1VQM P;  3MZW B;  3UIA A;  1SQQ K;  3M9B A;  1Z56 A;  1AV1 A;  5KTB A;  1EDL A;  4AUW A;  1HJB A;  2KS1 A;  2WMM A;  3AE7 C;  1NGM B;  2WQY C;  2AEJ A;  1SQV D;  2CK3 H;  1OW6 A;  1GU5 A;  1LT1 A;  2KOG A;  5AVU B;  3JCU H;  5AW6 B;  4HH2 A;  3GF7 A;  5KLV G;  4BXL A;  3H1J G;  3GF3 A;  3A0H H;  4DZO A;  3G6E P;  1KFN A;  2Y9Z A;  3Q2Y A;  1URQ D;  4U3F D;  1NTZ G;  2SPZ A;  3VMX A;  1LTG C;  2BEQ D;  3T97 B;  1NTM E;  1RE4 C;  3KDP B;  2K88 A;  3BRT B;  2OYO A;  2FXP A;  1W2B O;  3IN6 A;  2I1K A;  2W6B A;  3H6P A;  1NKZ B;  5AW2 B;  3H32 A;  5APQ A;  1HUC A;  3H1J D;  1R5S A;  3CC2 P;  1IK9 A;  3HD7 D;  2IZ1 A;  2XND H;  1D7M A;  2E75 B;  3KZI H;  2L91 A;  5APT A;  5TIS H;  4C7R A;  2E76 B;  2ZYG A;  1ZR2 A;  2QRX A;  3M9H A;  1KYO E;  1KB9 H;  3WUU A;  1CSB A;  4JPZ B;  1KMI Z;  4DT0 A;  2I8D A;  1K9M Q;  2W6J H;  1ZR4 A;  1FDO A;  4YTP C;  1N7S D;  2A45 I;  1YIJ P;  2OAR A;  3KZI E;  1GDT A;  1SLQ A;  2N1T B;  2FYU G;  4A7P A;  5TIS E;  3V2Q A;  1S1C X;  3Q5S A;  5B66 E;  3AEG C;  2Y0D A;  3KQG A;  3L75 J;  2QG4 A;  3N7N A;  3RK3 B;  3SFE C;  1M1K Q;  2B89 A;  3WU2 E;  1N8R Q;  1FOS F;  2O01 H;  2GUS A;  3LW5 H;  1G2C A;  3EQ2 A;  5AW4 B;  1VF5 B;  2KZI A;  1OWA A;  2B87 A;  4PV1 D;  3L73 G;  4ZKP A;  5CCH D;  1X8Y A;  3B5N A;  1SQB J;  5CBN A;  3TSI A;  2FXM A;  3V2R A;  2WT7 B;  3H1I D;  3GHG B;  1SFC A;  1J1E B;  1SP4 A;  1PP9 E;  1J1D B;  2Q7C A;  1T8Z A;  1NU1 E;  1ZN5 A;  4UB6 E;  2NRG A;  1FDI A;  3AE3 C;  2RMZ A;  3CD6 P;  2KXP B;  1BE3 G;  1SQQ G;  3CWB J;  2N1T A;  1L4A A;  1YI2 P;  2QJP B;  3GW6 A;  3HE4 B;  2KLU A;  2AEF A;  3H1L G;  3E1R A;  1MFZ A;  3S1K A;  2BCC J;  1SQX D;  1RE3 C;  2M3E A;  3CMA P;  1HTL C;  3G9R A;  5AVS B;  3CC7 P;  4GOD A;  4DCK A;  5GTI E;  3PRJ A;  1HGV A;  2IYO A;  2P7J A;  3CXH D;  1P84 H;  3CCR P;  1FU1 A;  3B5N C;  2OTL P;  2XZR A;  3RL0 g;  3A5T A;  5KAI H;  2E76 C;  4DJG A;  2KSE A;  4TT3 H;  1NHL A;  2FKW B;  4D6T G;  4W7Z A;  1GZL A;  3CXH I;  1G1J A;  3GHG A;  1EQ7 A;  1LJ2 A;  1SQQ D;  1LT9 B;  1PFI A;  2KNC A;  3L72 E;  5APU A;  4AQR D;  3EFG A;  3H1H J;  4L75 A;  5AW1 B;  1PPJ G;  3EFF K;  2WSF J;  2N1T C;  2JR8 A;  1S4X A;  3Q5P A;  2QVA A;  5KAI E;  2M0B A;  1W2E A;  1L0L K;  2ZXX A;  3U1A A;  2JWD A;  1KB9 I;  2PAJ A;  3AE1 C;  2WSE J;  3AED C;  4W7Y A;  1ZLL A;  3HE4 A;  1PGP A;  3L70 J;  4H0L C;  5AW8 B;  1URQ B;  3L37 A;  2C9L Y;  3RK3 C;  3HE5 B;  4XFJ A;  4ASV A;  4N78 E;  1L0L J;  4I6M C;  1BCC G;  1ZXG A;  2R5B A;  1VF5 C;  1SQP E;  1EC5 A;  1X0T A;  1S5L H;  1AJY A;  5APW A;  4NPF X;  1KIL B;  1RQU A;  4C7N A;  4LC1 A;  1BDD A;  1JCD A;  3GHG C;  3CC4 P;  1PPJ D;  3TGU G;  1EZV D;  1J1E C;  2IDB A;  5KJ7 D;  1J1D C;  1BGY J;  2W90 A;  1GK6 A;  3OW2 O;  2PP6 A;  1LWU B;  1VQ9 P;  1JY2 N;  1U7J A;  4XA4 A;  1BCC D;  4PD4 D;  3VP9 A;  2E75 D;  1M90 Q;  1PIX A;  2K37 A;  1URQ A;  1RF0 A;  2E76 D;  1JY3 P;  3HE5 A;  2JWA A;  2A06 G;  3KXD A;  1N7S B;  4L74 A;  3AE8 C;  2J5U A;  3MD0 A;  2WSC J;  1LNQ A;  2JDI H;  3L75 D;  4LLH A;  1AQ5 A;  3L71 E;  1KQG B;  2NZ2 A;  1Q90 D;  5KLI B;  2N1T D;  5APX A;  3CCV P;  2Q5U A;  1YJN P;  1RHZ B;  1LTJ B;  2W27 A;  3IF4 A;  1JY3 N;  2Q9I A;  2KK7 A;  2N9B A;  2QJY B;  4PV1 B;  3HD7 A;  5H2F H;  1ZV8 A;  3EWK A;  4HJG H;  4LGD E;  5KKZ B;  4PJ0 H;  1JY2 O;  5C39 A;  1VQ8 P;  1VF5 D;  2R44 A;  1FZC B;  1NKN A;  2QM8 A;  1URQ C;  2BEZ F;  1RF0 C;  2W83 C;  1SVF A;  5AW0 B;  1LP1 B;  1Q7Y Q;  5AVX B;  1JO5 A;  3C9I A;  3TDK A;  1KV4 A;  1NTK J;  1N7S A;  4ZMD A;  2WSS H;  3CCM P;  1FJP A;  1NTM K;  3L74 G;  1IFI A;  1E79 H;  2KIK A;  4WVZ A;  1K8A Q;  2BCC D;  2FFD B;  1OVV A;  3BAS A;  3KYQ A;  2VRS A;  2A45 H;  1PZQ A;  1NTM J;  4IL6 E;  4IOI H;  1S9K D;  2Y0C A;  5KLV E;  5CJ4 A;  1LTJ A;  3H1J E;  1JY3 O;  1LWU C;  4Y28 J;  2C0X A;  2H89 C;  3HD7 C;  3D6Y A;  1SQV G;  1U57 A;  1NTZ E;  4QMA A;  3R2P A;  4EIJ A;  2O1J A;  5CCH A;  2FYN C;  1KD1 Q;  2MJZ A;  1J2J B;  3I56 P;  5AVW B;  2Z5H A;  2IFM A;  3L74 D;  5E79 H;  3NXS A;  3HTK A;  1JTH B;  3H1H D;  1VQK P;  1IFJ A;  2P2U A;  1LP1 A;  3VYI A;  4DOJ A;  1BGY G;  3MIW A;  1ZRT E;  2GUV A;  1N7S C;  2E74 B;  3QH9 A;  1BDC A;  4GT1 A;  1Y47 A;  4L76 A;  3IR9 A;  2IBZ D;  3L70 D;  1QL2 A;  3AEF C;  1E5W A;  1HBW A;  5CMZ A;  5CCG D;  3R4Y A;  3II6 A;  1L0L D;  2Q1K A;  2NPS B;  2H8P D;  5KLI C;  1NTK E;  3L35 A;  1G1I A;  2IZ0 A;  1LTJ C;  1H0T B;  3VMZ A;  3O8Z A;  1T2K C;  1LTS C;  3P7K A;  5DJU B;  1VQ7 P;  2QJY C;  1CI6 A;  4PV1 C;  1USD A;  1LGH B;  5CCH C;  1YHQ P;  4O9B A;  5KKZ C;  3BCC G;  1BGY D;  1DEB A;  1YJ9 P;  5KAF H;  2A45 G;  3AE4 C;  3WUT A;  3CX5 D;  1H88 A;  1GU4 A;  2FYU E;  4I2L C;  3JCU E;  1JTH A;  3F5H A;  2HR3 A;  1EDI A;  1GL2 B;  3O6Q B;  1KIL D;  3H1K G;  4BRY B;  1N86 A;  2J59 M;  3A0H E;  2IYP A;  1QLE D;  2CPS A;  1YYC A;  3CX5 I;  4RJT A;  1IFP A;  1NU1 K;  3CXH H;  1AQT A;  1YTZ T;  3I5C A;  5AVR B;  1QVF O;  2C0W A;  1PP9 J;  1AVO A;  5B5E H;  3VOP A;  2H43 A;  1Q86 Q;  4JYB A;  4YXD C;  1NU1 J;  4ASW A;  1T3J A;  4HB1 A;  4WWI A;  2YO2 A;  1RQV A;  3OAK A;  2NPS A;  2OYH B;  3L73 E;  3BCC D;  3FGA D;  1OW7 A;  4HKZ H;  5M1B A;  1L0N J;  3ZDM A;  3RL0 B;  4WB4 A;  2K9Y A;  3H1K D;  2YIU B;  1R8E A;  4NPE A;  3T97 A;  4NPD A;  2E5Y A;  3H1I G;  1NJI Q;  1BE3 E;  1M7L A;  5KJ7 A;  5BU5 A;  1SQQ E;  2V7Q J;  2WPR A;  2HOD B;  3O6Q A;  1GL2 A;  4BRY A;  1NWQ A;  2ZJS E;  1KB9 E;  3W68 A;  3H1L E;  3E1I A;  5CBO A;  3V4Q A;  1FZG A;  3LIE A;  1SQB K;  3E7K A;  1RE3 A;  1T2K D;  3CPW O;  3L72 J;  2E42 A;  3SFD C;  2NPS C;  2ZYA A;  1IZN B;  4EI2 A;  5DJT B;  1SQX G;  1M1J B;  2IX7 C;  3A0B H;  3CCU P;  1RH5 B;  1FE6 A;  1KC8 Q;  4D6T E;  2POH A;  3M91 A;  2MKV A;  1PGQ A;  2GA1 A;  3V5B A;  1KFM A;  1IJD B;  1NTM D;  1SQP K;  4AYC A;  1N7L A;  1QGK B;  3CME P;  2ZAE B;  4PD4 H;  2AEM A;  4I1L A;  2D2C B;  2UWJ E;  1VL2 A;  5KJ7 C;  5GTH H;  1VQO P;  2YKO A;  1L0N E;  1FZE A;  1SQP J;  1IFN A;  1CW5 A;  4TLF A;  1GL2 C;  3G3Z A;  3WMM 0;  4OH8 B;  1MUU A;  1X9V A;  1HF9 A;  1PL5 A;  3B4S A;  4H44 B;  2YKQ A;  2I1J A;  3PH0 A;  1BCC E;  5BU8 B;  3OJA B;  2E75 C;  1DX7 A;  4HYT B;  2JJL A;  2YKP A;  2QSI A;  1EXI A;  1OZH A;  3L36 A;  4CPG A;  1KYO D;  1R5L A;  2WT7 A;  1GK4 A;  3TGU E;  3AE6 C;  3RL0 C;  3MGN A;  1VPC A;  4RES B;  3U1C A;  4IFD K;  3WUV A;  4GKG A;  2YIU C;  2FXO A;  1KYO I;  2E74 D;  2HYN A;  3B71 A;  1IFD A;  4I7Z B;  5AVY B;  1EZV G;  2QM7 A;  3Q5R A;  1P84 E;  1Q2N A;  1AFO A;  1EDK A;  3G71 P;  1KQF B;  2NPS D;  1YQ4 C;  1LTI C;  4RO0 A;  1PGJ A;  3RK3 E;  1HVV A;  3L71 J;  3GMA A;  3M06 A;  1IC2 A;  2KZJ A;  3M0A A;  2A06 E;  3ITK A;  5APV A;  5BVZ A;  3IAO A;  3SWK A;  1JM0 A;  2QEX P;  1OW8 A;  1GTW A;  3PTZ A;  2R32 A;  1DIP A;  3PLN A;  4RKU J;  3H25 A;  3P32 A;  1PP9 D;  3VMA A;  1K05 A;  3P8C E;  1LT9 A;  1GW3 A;  1NU1 D;  1GL2 D;  4EOT A;  2KSJ A;  3L75 G;  4BWN A;  3BVH A;  3FX0 A;  4U3F J;  5CCG A;  1EZV I;  2M8R A;  2Q6Q A;  2D2C C;  1DH3 A;  1S72 P;  1S5L E;  1GD2 E;  1JNM A;  2QJP C;  4ZNC A;  1S9K E;  4OGQ D;  1JB0 J;  1SQB G;  2K3R A;  2RKL A;  1K73 Q;  5KLV K;  2WSE H;  4H44 C;  3VP8 A;  1VQ4 P;  4PD4 I;  2YXQ B;  2B88 A;  1VQP P;  5CHX A;  1NTZ K;  3RL0 D;  3PJS K;  2WWW A;  5KLV J;  3H1J J;  1Y9B A;  4U7J A;  2M5A B;  3CI9 A;  3CWB G;  2DW3 A;  1KIL A;  1NTZ J;  3JC2 2;  4UB8 H;  2KYV A;  1LT9 C;  3L72 D;  3CL3 D;  2XNX A;  4H13 B;  1LTT C;  1HJ0 A;  5CCG C;  2BCC G;  2PRR A;  1SQB D;  4XE5 B;  1OXZ A;  2QE7 H;  3RK2 B;  3G4S P;  2G3A A;  1LWU A;  1SQV E;  2AXT H;  3CX5 H;  1PGO A;  4M3L A;  4KJM A;  1WMK A;  2FYZ A;  1NTK K;  2WZ7 A;  1LTA C;  3MTU E;  2O3J A;  1YIT P;  4U3F E;  2H7H A;  4KHX A;  4C46 A;  1FBM A;  3CWB D;  2IPP A;  1IO4 A;  1SQP D;  3W67 A;  3USS A;  4N6J A;  3CX5 E;  5H2F E;  3VN0 A;  3H1H G;  2W8Z A;  3TF5 A;  4PJ0 E;  1JEK A;  1KIL C;  1Q81 Q;  2FYU K;  2W6A A;  2D2C D;  2OQQ A;  1KN7 A;  2LR2 A;  3TYY A;  2L5G B;  2IBZ G;  2ZYD A;  1M57 D;  3L70 G;  3BAT A;  1QVG O;  2E43 A;  2WIT A;  1BSH A;  1JCC A;  2FYU J;  3HRN A;  1L0L G;  1X79 B;  2R3S A;  2RH0 A;  1NAF A;  4H44 D;  4R4L A;  3AEC C;  4YPC A;  2WPV B;  1NH4 A;  4MN4 C;  1FZC A;  3KPE A;  3AE9 C;  2KI7 B;  2AXC A;  3H1K E;  2Q3E A;  1ZP0 C;  3L73 J;  1KOR A;  4JF7 A;  4GOE A;  2OYI B;  2YMY A;  3AEA C;  1KTM A;  4KT0 J;  2JP3 A;  1Q82 Q;  2CPB A;  2WTY A;  2FFD A;  3H32 B;  3FWL A;  1OX3 A;  2LXB A;  5E79 E;  3NTN A;  2HPC B;  1JMB A;  2IBZ I;  1VQL P;  4WY4 B;  2HLO A;  1H89 A;  4H13 C;  2QJK B;  1BE3 J;  1NVO A;  3C1L A;  1SQQ J;  3HUS B;  3RK2 C;  3ABV C;  2K1A A;  3OA7 A;  5APS A;  2ITA A;  3V2P A; 
#chains in the Genus database with same CATH homology
 1S4X A;  1M8O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...