1S4XA

Nmr structure of the integrin b3 cytoplasmic domain in dpc micelles
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
KLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin beta-3
publication title Membrane-mediated structural transitions at the cytoplasmic face during integrin activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 10
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2004-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08725 Integrin_b_cyt Integrin beta cytoplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.630 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Integrin beta subunit, cytoplasmic domain 1s4xA00
1S4XA 1M8OB
chains in the Genus database with same CATH superfamily
1LT1A 2QM8A 2YKQA 1USEA 4N3YB 3H1HE 3GHGB 1T6AA 3JCUE 3H32B 1SFCD 2BCCD 4Y99C 1MZ9A 1S5LE 1NTME 2ZYDA 1LNQA 1NTZK 2YXQB 4I1LA 1Y8AA 3CMEP 1M1KQ 1L0NK 5CJ0A 4RJTA 1H8AA 4DCKA 4HB1A 5KJ7C 3H1JE 1PPJE 2WPVB 1SQQD 3L74J 3NMDA 1GL2A 2BEQD 4IFFA 3T97A 1VQKP 1FZCC 3VYIA 3U1CA 1FE6A 4D6TG 4I7ZC 2Q9IA 1T2KD 1SS1A 4UB8H 5AVSB 1PGOA 3Q5RA 3U59A 1LT9B 1H0TA 1KQFB 3AE4C 2OYOA 2ZAEB 1IFDA 1ZLLA 2V7QJ 1SQXE 4YXDC 1FDIA 3A0HE 3L75E 4K3AA 4HH2A 2FYNB 3V5BA 4YXWH 1IFPA 1KILA 3JCUH 3GHGA 1S72P 1SQQG 1GDTA 2QJKC 2FY8A 3H32A 1VF5C 1SP4A 1QVGO 2WT7B 1LTAC 1S5LH 3M0AA 1URQD 2PP6A 4OWFA 5KLVG 3L74D 1ZXGA 3IN6A 3CWBE 4C7RA 1VQPP 1DH3A 1U7JA 3R2PA 2JP3A 3MD0A 2YIUC 1J1EB 3C8VA 3BCCG 2H43A 4IFDK 2A06E 1N7LA 5CCGA 3RK3B 1Q86Q 1L0LK 5AVRB 3WUVA 5AVVB 1VQ9P 3KQGA 3SWFA 1OWAA 2QSIA 5B5EE 1KZUB 1S5LX 2J59M 2FXMA 3HTKB 1Q82Q 4H44C 3HD7C 3MIWA 2GA1A 2H7HA 3CC2P 1LT9A 1N7SD 2CPBA 1AQTA 1FAVA 5KKZC 1NTKE 1L2PA 3A0HH 5EFWB 1KB9D 1KYOI 3AEBC 4JPZB 1P84D 4O9BA 3V4WA 1SQVE 2ZFCA 3B5NB 1NU1K 2KUBA 5CCHA 1KYOE 4PJ0H 1HGZA 2AXTH 3L36A 4EDFA 1X9VA 1GK4A 2I8DA 5GTIE 5KLVK 3I56P 2E75B 2ZT9C 5KLIB 1PGPA 1H88A 3L70E 2PGDA 1N73C 3BVHA 2QE7H 2JO1A 4ZMDA 3G71P 1DEEG 1YQ4C 3V2QA 5B5EH 2WWWA 1USDA 1PP9J 1YITP 2W90A 3HTKA 4KT0J 2XNXA 4ASWA 2O1KA 1M56D 1SQBG 2Y9YA 1M1JB 1RF1C 1BCCG 1BDDA 1EC5A 1JY2N 2FYUJ 5AVZB 3AE2C 2OYHA 5DJUB 3KXDA 1LWUB 1VDFA 3CXHD 3AEEC 5KJ7D 1KV4A 1JY3P 1GTWA 3B5NA 3S1KA 1HWTC 1KB9I 1KYOH 3SFDC 3GMAA 3RK2B 1OIPA 4Z1MH 4JQ0D 1XTCC 3M9BA 3M9QA 3A7OA 1PP9D 2WZ7A 1NTZJ 2IFNA 4DZOA 2Q3EA 1QL1A 4N6JA 1X8YA 4ASVA 1HVVA 3U1AA 2B89A 1NAFA 1KD1Q 1A02F 2LKMA 3MUDA 2OTLP 2FXPA 2FYUD 1ZMEC 1FS0E 5APYA 2HYNA 4BRYB 4C46A 1VF5D 1M1JA 1RY3A 3S4RA 4GDOA 3G4SP 2JEEA 1MFZA 3HE5B 2YMKA 1RE4A 3MGNA 4HKZH 3USSA 1S3JA 3CCEP 2JWAA 3PLNA 2DW3A 3HUSB 2O3JA 1M90Q 3D6ZA 3CXHI 3M9HA 3ZDMA 1A02J 5C39A 3CCVP 2Q6QA 1SFCB 2JWDA 2ITAA 1NTZD 1CZQA 3PP5A 1QX8A 1NKZB 4WB4A 2FYUG 1S9KD 4W7ZA 3MHVA 4H44D 3HD7D 1GL2C 2K37A 1NWQA 2B87B 1JCDA 4N78E 3QH9A 3IAOA 2QVAA 2NZ2A 1N2DC 1W2EA 2LXCB 2E74B 1LTJB 1IC2A 5B66E 2D2CB 2GUSA 2IZ0A 3KHUA 2IDBA 1L0LJ 1KORA 4PD4D 1AFOA 3A2AA 3A0BE 4BRYA 1VQ6P 1NTZG 3G6EP 1DD3A 1KILC 2HODA 1S2EA 3L71D 3GHGC 2WSEJ 4D6TJ 1PGQA 4WY4B 1L0NG 2ZT9D 3CX5E 3D70A 3BATA 4R4LA 1AJYA 4L74A 3HUSA 3TGUJ 2V4HA 1Q2NA 3P8CD 1BGYE 2P7JA 1T8ZA 1ZRTE 5APUA 1M7LA 2OARA 3H1KJ 1NKNA 5CJ4A 1URQB 2E76C 5CCGC 4NPDA 2YXRB 1NU1J 3H1HG 1FZAA 1MV8A 4AQRD 1JTHB 1OW6A 2HPCB 1LTBC 1HJ0A 2R5BA 1IK9A 1L0LD 2WPRA 5KLVJ 1EZVI 3L71G 3PRJA 3VMXA 2E43A 1SQPE 4NPEA 1JEKA 4WWIA 5B66H 1LT9C 4HYTB 3BCCJ 3CCMP 1EZVE 1RHZB 2K3RA 1PPJG 4GOFA 3CMAP 4D6TD 1PFIA 3CCQP 1N8RQ 3RL0C 3Q3DA 4U3FD 2WMMA 3A0BH 4HJGH 3Q5SA 2KP8A 1N7SB 5AW1B 1K9MQ 2YO3A 2QJPB 3TGUD 1CI6B 3P7KA 4MN4C 2M3EA 4CPGA 4H13B 3L72E 3FXDA 2OYIA 3CX5H 4WY4A 3H1KD 1L4AA 2C0XA 2W8ZA 3S9OA 1NU1D 5TJHA 1JO5A 1L0LG 5CHXA 3LW5H 1JM0A 2M5AA 1PL5A 1NGMB 3L37A 4TLFA 1URQA 5KLVD 3RK3C 2O01H 1YQ3C 3IFMA 3VMAA 4U3FG 4Y28J 1KQLA 2HPCA 2QJYB 3BCCD 1E5WA 3CD6P 4L75A 1NTMK 3TGUG 3RGUA 1JUNA 5APWA 3EFGA 1SLQA 3L73G 3CWBG 2K88A 1G2CA 2R3CA 4BWNA 5AVQB 2H8PD 3H1KG 1BDCA 2J58A 2AEFA 3HRNA 3H6PA 1NU1G 1RF0A 1K05A 2OYHC 2B9BA 1X79B 2KIKA 3A3YB 4Y99B 3BRVB 1CI6A 3EWKA 1J1DC 1R5SA 3B5NC 1RQVA 3TF5A 5AW3B 3D71A 2KB7P 3H1LJ 1PZQA 2HG5D 1GL2D 1SQBJ 2WTYA 1OMIA 2JKVA 2BCCE 1IFMA 2IYOA 4WVZA 1BCCJ 2ZVNB 2YMYA 2POHA 2BASA 2E75C 3I5CA 5KLIC 1VQ7P 1HJBA 2RN0A 1SQXK 1FZGA 2A45G 1NH4A 1KN7A 3CLQA 1RE3A 1SQVG 1VQ5P 4WBAA 1OXZA 1GMJA 4TT3H 1LTIC 2NRGA 1DD4A 4I7ZB 3KZIE 1SQQE 1JOCA 3E1IA 4DT0A 3MUDC 1AA0A 1DX7A 1DIPA 1KILD 2NPSD 1HUCA 4EIJA 4BXLA 1OVRA 1T3UA 1EXJA 4IOIH 1QVFO 1WT6A 2N1TB 1M1JC 1GW3A 5AW5B 3ITKA 1W5CE 2A45I 1RE4C 1GZLA 3H1LD 3IF4A 2AEMA 1SQBD 4ZNCA 2QJKB 2L91A 1VF5B 2WT7A 3TDKA 1BCCD 1ZP0C 2RKLA 2E76D 3V2RA 5CCGD 2KLUA 1JY2P 3AE1C 3VTPC 1RH5B 3H1ID 1LTSC 4R4MA 2JDIH 2W27A 1NTKK 3TNUB 3L74E 4LGDE 3JC22 1PV3A 2R32A 2PAJA 2IX7C 1SQVK 1OVUA 1IJDB 3VN0A 3H1LG 3RL0D 2R5DA 2WSCH 2FXOA 1YTZT 3SSUA 4UB6E 1HTLC 1KTMA 3EFFK 3GLMA 5KAIE 1DEBA 3E7KA 3K5BA 3CCJP 4A7PA 5KKZB 2IBZD 1KQSO 3AE6C 5AVXB 1VQLP 3H1IG 2N1TA 2P1JA 3FGAD 1MFTA 2WPSA 2Y0CA 4OH8B 1OW7A 1Y47A 1P84I 4IFMA 4IL6E 4XA4A 4ZKPA 1J2JB 3HUSC 1KB9E 1P84E 4I2LC 5GTIH 1BSHA 1KQGB 3RK3D 1U57A 4KJMA 2OTKE 2ZT9B 3AE8C 4OGQC 2LR2A 5APVA 4B86A 2Z5IA 1FZBA 3D6YA 2KK7A 3CCRP 2Q3IA 1FZFA 3KDPB 2XDJA 3TNUA 2IBZG 1L0NJ 2Z4EA 3V2PA 1FJKA 1LTTC 5APXA 3O6QB 2AXCA 3C9IA 2E74C 1BE3J 2WSSH 1FC2C 2Y9ZA 2FYZA 5KTBA 1JMMA 1NVOA 5KAIH 1EDKA 1YI2P 4H0LC 3OA7A 2D2CC 3VMZA 4JYCA 3H1HJ 2L5GB 2PRRA 3N7NA 2V7QH 1QEXA 5AVTB 1LWUA 2H88C 5H2FE 3NFQA 1JY3O 4RESB 3P8MC 5L8RJ 3WU2E 3Q1MA 1AVOA 4JF7A 2KS1B 3L71J 5BU8B 2OYIC 1E79H 4WY4C 2E75D 1KMIZ 1L4AC 2KYVA 1OVVA 2PFXA 1S1CX 3CXHE 2ZJSE 3H1JJ 1KB9H 4NPFX 4W7YA 1P84H 3G9RA 1ZV8A 1SVFA 2Z5HA 1ZR4A 3HE4B 1Z56A 2KXPB 1L0ND 5APTA 1NYHA 1FDOA 4C7NB 3H25A 1NJIQ 1TU3F 4EOTA 1BE3D 3N4XA 2SPZA 1NAYA 2W6JH 3NXSA 2KLVA 4IL6X 3V6IA 3KYQA 1PP9E 3H1HD 3O6QA 2YKOA 5K5GB 3M0DA 4PV1C 3BASA 2YO2A 3L75J 1IO4A 2QIWA 1NTMD 2J5UA 2Q5UA 5AVUB 1JB0J 1RF0C 1YJ9P 5AW6B 2FFDB 2QRXA 3HE5A 5BU5A 2FYUE 4U3FJ 4XFJA 5H2FH 2P58A 2XKMA 3W68A 1GU4A 3H1JD 2C9LY 1PPJD 4EI2A 4H13C 3SFEC 1BE3G 3L73J 1SQPG 3CWBJ 1SFCA 1BSNA 1AV1A 3CXHH 1GK6A 1PIXA 2M3BA 1IFJA 1QLED 2FKWB 3HE4A 4RO0A 1GL2B 2B87A 4YPCA 1NTMG 1RE3C 1NTZE 2W6AA 2RMZA 1VQ4P 3JSVC 3MP7B 4GKGA 3AE7C 1LTGC 3L75D 4AYCA 1LTJA 1S9KE 1GU5A 4ZKUA 3H1JG 2IYPA 5AVYB 3VOPA 3G3ZA 2AEJA 2HR3A 1G1JA 3PHLA 1AQ5A 1Y9BA 1WMKA 1U7MA 1ZR2A 2FYNC 2KSJA 4PD4I 1LGHB 1SQVJ 2Y0DA 1KILB 3TSIA 2N9BA 5CCHC 3L73D 3CWBD 2FFDA 2NPSB 4OVNF 1FZEA 4PD4E 1RQUA 5APQA 2WPQA 2G8YA 2GM4A 2A06D 2KZIA 2ZYAA 4OGQD 1MKMA 4K35A 1SQXG 3L71E 3L70J 1SQPK 3L75G 1CSBA 2M8RA 1J1EC 3AE3C 3AEFC 3CC7P 2E76B 3RBZA 4LLHA 4AUWA 1X0TA 1FJPA 1JTHA 2E74D 3P8CE 2ZVOB 3AE9C 4H0LD 1NTKD 2D2CD 2KI7B 1YTZI 1HBWA 3CPWO 2ZYGA 1FDMA 2YNYA 2BCCG 1Q81Q 1SQVD 2A06G 3KPEA 3VP9A 1KYOD 1IFNA 1L0LE 3RL0B 1R5LA 4U7JA 3EQ2A 4WY4D 1L4AD 2N1TC 1N7SA 1M57D 4XE5B 3Q2YA 3CC4P 3MZWB 2O01N 2WSFJ 3L70D 2NPSA 4D6TE 2QEXP 3AEAC 4PD4H 4U3FE 2BEZF 2W6BA 4PJ0E 1GW4A 3M91A 2AXTE 2P2UA 3PH0A 4RKUJ 5AW8B 1HH0A 3TGUE 1NTKG 4DOJA 3L73E 2JJLA 3O8ZA 3A5TA 1KC8Q 3H1KE 1FZCB 3H1IJ 1CW5A 3P32A 5CBOA 1YBKA 2JR8A 3VP8A 3CI9A 1NU1E 2KNCB 3NTNA 2ZXEB 4PV1D 5KAFE 5AW7B 2VRSA 3BRTB 2QG4A 4EYYQ 5CMZA 4GT1A 5KLVE 3OJAB 3PTZA 1ZW0A 3IR9A 3GW6A 1H89A 1K73Q 3L70G 3II6A 3VMYA 2W83C 3QWOC 2OQQA 3BCCE 1X22A 3FXEA 1FOSF 3SWYA 4H13D 1N86A 2OYHB 3L74G 2O1JA 1LWUC 3R4YA 3ABVC 1QGKB 1FU1A 1J1DB 3L4FA 2WSEH 1OZHA 3FX0A 3CCLP 3B71A 1IZNB 3RK2C 1SQQK 3AEDC 1EDIA 2YIUB 1OFCX 3GF7A 5KJ7A 1GD2E 1UIXA 2K9YA 1UIIA 1FBMA 2QA4P 5GTHE 5M1BA 1VPCA 4LC1A 1W2BO 1FZCA 1KFNA 2WVRA 1YYCA 1VQMP 3SWKA 2IZ1A 4H44B 3HD7B 3KZIH 5DJTB 2KNCA 5KAFH 1YJWP 3Q5PA 2HLOA 5AW4B 2XZRA 3LIDA 3UIAA 1LJ2A 1NO4A 3MTUE 3M0DC 3W67A 2XU6A 5CCHD 3B8EB 3F5HA 4QMAA 2E5YA 2P67A 1PGJA 1VQNP 3CCSP 1KILE 3GG2A 2A45H 3PJSK 1JY2O 4M3LA 5TISE 2CPSA 3WMM0 1BGYJ 3I55P 3LW5J 1SFCC 2LXBA 3H1LE 1M8OB 5AVWB 1NOHA 1SQBE 2IFMA 2B88A 4N78D 1N73B 3AECC 2K9JB 5E79E 1JCCA 4GOEA 1BCCE 2GUVA 3OAKA 3TYYA 2O01J 5GTHH 4L76A 3LIEA 2G3AA 3H1IE 2OGUA 2HFED 3WUTA 5CBNA 2R44A 1YIJP 4JYBA 1LTJC 1SQPJ 3HD7A 3V4QA 1JNMA 5AW0B 4UB6H 2Y0EA 4KHXA 2N1TD 1RF1B 3TK1A 1JY3N 4I6MC 1EXIA 2QM7A 3B5ND 1T2KC 1K8AQ 3CX5D 2N9YB 3C1LA 2Q1KA 1G1IA 2YKPA 3GF3A 1ZN5A 1SQBK 2E5TA 1NTMJ 2IBZI 3WUUA 2HODB 1BGYD 2FFDC 1ZRTD 3L72J 2P10A 4IL6H 2RH0A 1EDLA 2IBZE 1S4XA 1LP1B 1VL2A 2XNDH 3F89A 1EDJA 4W80A 1Q90D 3RBXA 1PP9G 5TISH 4GIFA 2WSFH 2Q7CA 2WQYC 4DJGA 2E42A 1IFIA 1URQC 1N73A 4OGQB 5E79H 3M06A 2K9JA 1QL2A 1SQPD 2ZXXA 2WITA 1OX3A 3RK3E 3AE5C 1HF9A 1FOSE 1EZVD 1YJNP 3E1RA 3AEGC 2H89C 1AVYA 2IPPA 1BGYG 1VQOP 1SQXJ 3V2NA 2MJZA 3L35A 2I1KA 1EQ7A 1T3JA 4GODA 4L73A 4H0LB 3RL0g 1RF1A 2C0WA 3L72D 5AW9B 1WRGA 1D7MA 5BVZA 3FWLA 2OTJP 4JBZA 1N7SC 3RK2D 2QJPC 2UWJE 2KSEA 3FWNA 3WU2H 3CX5I 2XV5A 1YHQP 5APSA 2NPSC 2KS1A 2OYIB 1IK7A 1ZOYC 2MKVA 1L4AB 2K1AA 1LP1A 2BCCJ 3CCUP 1EZVG 1XTGB 1R8EA 1JMBA 2R3SA 1HGVA 2KZJA 2M0BA 4C7NA 3T97B 2M5AB 1OW8A 1VQ8P 1Q7YQ 1K04A 3L72G 1MUUA 1SQXD 1NHLA 5AW2B 2C9NY 4YTPC 2FYUK 2KOGA 1SQQJ 2WSCJ 4UB8E 2QJYC 1L0NE 1H0TB 2FBWC 3OW2O 2I1JA 1NTKJ 1KFMA 4PV1B 3CL3D 1BE3E 3B4SA 1G2CB 2CK3H
chains in the Genus database with same CATH topology
1S4XA 1M8OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4X A;  1M8O B; 
#chains in the Genus database with same CATH topology
 1LT1 A;  2QM8 A;  2YKQ A;  1USE A;  4N3Y B;  3H1H E;  3GHG B;  1T6A A;  3JCU E;  3H32 B;  1SFC D;  2BCC D;  4Y99 C;  1MZ9 A;  1S5L E;  1NTM E;  2ZYD A;  1LNQ A;  1NTZ K;  2YXQ B;  4I1L A;  1Y8A A;  3CME P;  1M1K Q;  1L0N K;  5CJ0 A;  4RJT A;  1H8A A;  4DCK A;  4HB1 A;  5KJ7 C;  3H1J E;  1PPJ E;  2WPV B;  1SQQ D;  3L74 J;  3NMD A;  1GL2 A;  2BEQ D;  4IFF A;  3T97 A;  1VQK P;  1FZC C;  3VYI A;  3U1C A;  1FE6 A;  4D6T G;  4I7Z C;  2Q9I A;  1T2K D;  1SS1 A;  4UB8 H;  5AVS B;  1PGO A;  3Q5R A;  3U59 A;  1LT9 B;  1H0T A;  1KQF B;  3AE4 C;  2OYO A;  2ZAE B;  1IFD A;  1ZLL A;  2V7Q J;  1SQX E;  4YXD C;  1FDI A;  3A0H E;  3L75 E;  4K3A A;  4HH2 A;  2FYN B;  3V5B A;  4YXW H;  1IFP A;  1KIL A;  3JCU H;  3GHG A;  1S72 P;  1SQQ G;  1GDT A;  2QJK C;  2FY8 A;  3H32 A;  1VF5 C;  1SP4 A;  1QVG O;  2WT7 B;  1LTA C;  1S5L H;  3M0A A;  1URQ D;  2PP6 A;  4OWF A;  5KLV G;  3L74 D;  1ZXG A;  3IN6 A;  3CWB E;  4C7R A;  1VQP P;  1DH3 A;  1U7J A;  3R2P A;  2JP3 A;  3MD0 A;  2YIU C;  1J1E B;  3C8V A;  3BCC G;  2H43 A;  4IFD K;  2A06 E;  1N7L A;  5CCG A;  3RK3 B;  1Q86 Q;  1L0L K;  5AVR B;  3WUV A;  5AVV B;  1VQ9 P;  3KQG A;  3SWF A;  1OWA A;  2QSI A;  5B5E E;  1KZU B;  1S5L X;  2J59 M;  2FXM A;  3HTK B;  1Q82 Q;  4H44 C;  3HD7 C;  3MIW A;  2GA1 A;  2H7H A;  3CC2 P;  1LT9 A;  1N7S D;  2CPB A;  1AQT A;  1FAV A;  5KKZ C;  1NTK E;  1L2P A;  3A0H H;  5EFW B;  1KB9 D;  1KYO I;  3AEB C;  4JPZ B;  1P84 D;  4O9B A;  3V4W A;  1SQV E;  2ZFC A;  3B5N B;  1NU1 K;  2KUB A;  5CCH A;  1KYO E;  4PJ0 H;  1HGZ A;  2AXT H;  3L36 A;  4EDF A;  1X9V A;  1GK4 A;  2I8D A;  5GTI E;  5KLV K;  3I56 P;  2E75 B;  2ZT9 C;  5KLI B;  1PGP A;  1H88 A;  3L70 E;  2PGD A;  1N73 C;  3BVH A;  2QE7 H;  2JO1 A;  4ZMD A;  3G71 P;  1DEE G;  1YQ4 C;  3V2Q A;  5B5E H;  2WWW A;  1USD A;  1PP9 J;  1YIT P;  2W90 A;  3HTK A;  4KT0 J;  2XNX A;  4ASW A;  2O1K A;  1M56 D;  1SQB G;  2Y9Y A;  1M1J B;  1RF1 C;  1BCC G;  1BDD A;  1EC5 A;  1JY2 N;  2FYU J;  5AVZ B;  3AE2 C;  2OYH A;  5DJU B;  3KXD A;  1LWU B;  1VDF A;  3CXH D;  3AEE C;  5KJ7 D;  1KV4 A;  1JY3 P;  1GTW A;  3B5N A;  3S1K A;  1HWT C;  1KB9 I;  1KYO H;  3SFD C;  3GMA A;  3RK2 B;  1OIP A;  4Z1M H;  4JQ0 D;  1XTC C;  3M9B A;  3M9Q A;  3A7O A;  1PP9 D;  2WZ7 A;  1NTZ J;  2IFN A;  4DZO A;  2Q3E A;  1QL1 A;  4N6J A;  1X8Y A;  4ASV A;  1HVV A;  3U1A A;  2B89 A;  1NAF A;  1KD1 Q;  1A02 F;  2LKM A;  3MUD A;  2OTL P;  2FXP A;  2FYU D;  1ZME C;  1FS0 E;  5APY A;  2HYN A;  4BRY B;  4C46 A;  1VF5 D;  1M1J A;  1RY3 A;  3S4R A;  4GDO A;  3G4S P;  2JEE A;  1MFZ A;  3HE5 B;  2YMK A;  1RE4 A;  3MGN A;  4HKZ H;  3USS A;  1S3J A;  3CCE P;  2JWA A;  3PLN A;  2DW3 A;  3HUS B;  2O3J A;  1M90 Q;  3D6Z A;  3CXH I;  3M9H A;  3ZDM A;  1A02 J;  5C39 A;  3CCV P;  2Q6Q A;  1SFC B;  2JWD A;  2ITA A;  1NTZ D;  1CZQ A;  3PP5 A;  1QX8 A;  1NKZ B;  4WB4 A;  2FYU G;  1S9K D;  4W7Z A;  3MHV A;  4H44 D;  3HD7 D;  1GL2 C;  2K37 A;  1NWQ A;  2B87 B;  1JCD A;  4N78 E;  3QH9 A;  3IAO A;  2QVA A;  2NZ2 A;  1N2D C;  1W2E A;  2LXC B;  2E74 B;  1LTJ B;  1IC2 A;  5B66 E;  2D2C B;  2GUS A;  2IZ0 A;  3KHU A;  2IDB A;  1L0L J;  1KOR A;  4PD4 D;  1AFO A;  3A2A A;  3A0B E;  4BRY A;  1VQ6 P;  1NTZ G;  3G6E P;  1DD3 A;  1KIL C;  2HOD A;  1S2E A;  3L71 D;  3GHG C;  2WSE J;  4D6T J;  1PGQ A;  4WY4 B;  1L0N G;  2ZT9 D;  3CX5 E;  3D70 A;  3BAT A;  4R4L A;  1AJY A;  4L74 A;  3HUS A;  3TGU J;  2V4H A;  1Q2N A;  3P8C D;  1BGY E;  2P7J A;  1T8Z A;  1ZRT E;  5APU A;  1M7L A;  2OAR A;  3H1K J;  1NKN A;  5CJ4 A;  1URQ B;  2E76 C;  5CCG C;  4NPD A;  2YXR B;  1NU1 J;  3H1H G;  1FZA A;  1MV8 A;  4AQR D;  1JTH B;  1OW6 A;  2HPC B;  1LTB C;  1HJ0 A;  2R5B A;  1IK9 A;  1L0L D;  2WPR A;  5KLV J;  1EZV I;  3L71 G;  3PRJ A;  3VMX A;  2E43 A;  1SQP E;  4NPE A;  1JEK A;  4WWI A;  5B66 H;  1LT9 C;  4HYT B;  3BCC J;  3CCM P;  1EZV E;  1RHZ B;  2K3R A;  1PPJ G;  4GOF A;  3CMA P;  4D6T D;  1PFI A;  3CCQ P;  1N8R Q;  3RL0 C;  3Q3D A;  4U3F D;  2WMM A;  3A0B H;  4HJG H;  3Q5S A;  2KP8 A;  1N7S B;  5AW1 B;  1K9M Q;  2YO3 A;  2QJP B;  3TGU D;  1CI6 B;  3P7K A;  4MN4 C;  2M3E A;  4CPG A;  4H13 B;  3L72 E;  3FXD A;  2OYI A;  3CX5 H;  4WY4 A;  3H1K D;  1L4A A;  2C0X A;  2W8Z A;  3S9O A;  1NU1 D;  5TJH A;  1JO5 A;  1L0L G;  5CHX A;  3LW5 H;  1JM0 A;  2M5A A;  1PL5 A;  1NGM B;  3L37 A;  4TLF A;  1URQ A;  5KLV D;  3RK3 C;  2O01 H;  1YQ3 C;  3IFM A;  3VMA A;  4U3F G;  4Y28 J;  1KQL A;  2HPC A;  2QJY B;  3BCC D;  1E5W A;  3CD6 P;  4L75 A;  1NTM K;  3TGU G;  3RGU A;  1JUN A;  5APW A;  3EFG A;  1SLQ A;  3L73 G;  3CWB G;  2K88 A;  1G2C A;  2R3C A;  4BWN A;  5AVQ B;  2H8P D;  3H1K G;  1BDC A;  2J58 A;  2AEF A;  3HRN A;  3H6P A;  1NU1 G;  1RF0 A;  1K05 A;  2OYH C;  2B9B A;  1X79 B;  2KIK A;  3A3Y B;  4Y99 B;  3BRV B;  1CI6 A;  3EWK A;  1J1D C;  1R5S A;  3B5N C;  1RQV A;  3TF5 A;  5AW3 B;  3D71 A;  2KB7 P;  3H1L J;  1PZQ A;  2HG5 D;  1GL2 D;  1SQB J;  2WTY A;  1OMI A;  2JKV A;  2BCC E;  1IFM A;  2IYO A;  4WVZ A;  1BCC J;  2ZVN B;  2YMY A;  2POH A;  2BAS A;  2E75 C;  3I5C A;  5KLI C;  1VQ7 P;  1HJB A;  2RN0 A;  1SQX K;  1FZG A;  2A45 G;  1NH4 A;  1KN7 A;  3CLQ A;  1RE3 A;  1SQV G;  1VQ5 P;  4WBA A;  1OXZ A;  1GMJ A;  4TT3 H;  1LTI C;  2NRG A;  1DD4 A;  4I7Z B;  3KZI E;  1SQQ E;  1JOC A;  3E1I A;  4DT0 A;  3MUD C;  1AA0 A;  1DX7 A;  1DIP A;  1KIL D;  2NPS D;  1HUC A;  4EIJ A;  4BXL A;  1OVR A;  1T3U A;  1EXJ A;  4IOI H;  1QVF O;  1WT6 A;  2N1T B;  1M1J C;  1GW3 A;  5AW5 B;  3ITK A;  1W5C E;  2A45 I;  1RE4 C;  1GZL A;  3H1L D;  3IF4 A;  2AEM A;  1SQB D;  4ZNC A;  2QJK B;  2L91 A;  1VF5 B;  2WT7 A;  3TDK A;  1BCC D;  1ZP0 C;  2RKL A;  2E76 D;  3V2R A;  5CCG D;  2KLU A;  1JY2 P;  3AE1 C;  3VTP C;  1RH5 B;  3H1I D;  1LTS C;  4R4M A;  2JDI H;  2W27 A;  1NTK K;  3TNU B;  3L74 E;  4LGD E;  3JC2 2;  1PV3 A;  2R32 A;  2PAJ A;  2IX7 C;  1SQV K;  1OVU A;  1IJD B;  3VN0 A;  3H1L G;  3RL0 D;  2R5D A;  2WSC H;  2FXO A;  1YTZ T;  3SSU A;  4UB6 E;  1HTL C;  1KTM A;  3EFF K;  3GLM A;  5KAI E;  1DEB A;  3E7K A;  3K5B A;  3CCJ P;  4A7P A;  5KKZ B;  2IBZ D;  1KQS O;  3AE6 C;  5AVX B;  1VQL P;  3H1I G;  2N1T A;  2P1J A;  3FGA D;  1MFT A;  2WPS A;  2Y0C A;  4OH8 B;  1OW7 A;  1Y47 A;  1P84 I;  4IFM A;  4IL6 E;  4XA4 A;  4ZKP A;  1J2J B;  3HUS C;  1KB9 E;  1P84 E;  4I2L C;  5GTI H;  1BSH A;  1KQG B;  3RK3 D;  1U57 A;  4KJM A;  2OTK E;  2ZT9 B;  3AE8 C;  4OGQ C;  2LR2 A;  5APV A;  4B86 A;  2Z5I A;  1FZB A;  3D6Y A;  2KK7 A;  3CCR P;  2Q3I A;  1FZF A;  3KDP B;  2XDJ A;  3TNU A;  2IBZ G;  1L0N J;  2Z4E A;  3V2P A;  1FJK A;  1LTT C;  5APX A;  3O6Q B;  2AXC A;  3C9I A;  2E74 C;  1BE3 J;  2WSS H;  1FC2 C;  2Y9Z A;  2FYZ A;  5KTB A;  1JMM A;  1NVO A;  5KAI H;  1EDK A;  1YI2 P;  4H0L C;  3OA7 A;  2D2C C;  3VMZ A;  4JYC A;  3H1H J;  2L5G B;  2PRR A;  3N7N A;  2V7Q H;  1QEX A;  5AVT B;  1LWU A;  2H88 C;  5H2F E;  3NFQ A;  1JY3 O;  4RES B;  3P8M C;  5L8R J;  3WU2 E;  3Q1M A;  1AVO A;  4JF7 A;  2KS1 B;  3L71 J;  5BU8 B;  2OYI C;  1E79 H;  4WY4 C;  2E75 D;  1KMI Z;  1L4A C;  2KYV A;  1OVV A;  2PFX A;  1S1C X;  3CXH E;  2ZJS E;  3H1J J;  1KB9 H;  4NPF X;  4W7Y A;  1P84 H;  3G9R A;  1ZV8 A;  1SVF A;  2Z5H A;  1ZR4 A;  3HE4 B;  1Z56 A;  2KXP B;  1L0N D;  5APT A;  1NYH A;  1FDO A;  4C7N B;  3H25 A;  1NJI Q;  1TU3 F;  4EOT A;  1BE3 D;  3N4X A;  2SPZ A;  1NAY A;  2W6J H;  3NXS A;  2KLV A;  4IL6 X;  3V6I A;  3KYQ A;  1PP9 E;  3H1H D;  3O6Q A;  2YKO A;  5K5G B;  3M0D A;  4PV1 C;  3BAS A;  2YO2 A;  3L75 J;  1IO4 A;  2QIW A;  1NTM D;  2J5U A;  2Q5U A;  5AVU B;  1JB0 J;  1RF0 C;  1YJ9 P;  5AW6 B;  2FFD B;  2QRX A;  3HE5 A;  5BU5 A;  2FYU E;  4U3F J;  4XFJ A;  5H2F H;  2P58 A;  2XKM A;  3W68 A;  1GU4 A;  3H1J D;  2C9L Y;  1PPJ D;  4EI2 A;  4H13 C;  3SFE C;  1BE3 G;  3L73 J;  1SQP G;  3CWB J;  1SFC A;  1BSN A;  1AV1 A;  3CXH H;  1GK6 A;  1PIX A;  2M3B A;  1IFJ A;  1QLE D;  2FKW B;  3HE4 A;  4RO0 A;  1GL2 B;  2B87 A;  4YPC A;  1NTM G;  1RE3 C;  1NTZ E;  2W6A A;  2RMZ A;  1VQ4 P;  3JSV C;  3MP7 B;  4GKG A;  3AE7 C;  1LTG C;  3L75 D;  4AYC A;  1LTJ A;  1S9K E;  1GU5 A;  4ZKU A;  3H1J G;  2IYP A;  5AVY B;  3VOP A;  3G3Z A;  2AEJ A;  2HR3 A;  1G1J A;  3PHL A;  1AQ5 A;  1Y9B A;  1WMK A;  1U7M A;  1ZR2 A;  2FYN C;  2KSJ A;  4PD4 I;  1LGH B;  1SQV J;  2Y0D A;  1KIL B;  3TSI A;  2N9B A;  5CCH C;  3L73 D;  3CWB D;  2FFD A;  2NPS B;  4OVN F;  1FZE A;  4PD4 E;  1RQU A;  5APQ A;  2WPQ A;  2G8Y A;  2GM4 A;  2A06 D;  2KZI A;  2ZYA A;  4OGQ D;  1MKM A;  4K35 A;  1SQX G;  3L71 E;  3L70 J;  1SQP K;  3L75 G;  1CSB A;  2M8R A;  1J1E C;  3AE3 C;  3AEF C;  3CC7 P;  2E76 B;  3RBZ A;  4LLH A;  4AUW A;  1X0T A;  1FJP A;  1JTH A;  2E74 D;  3P8C E;  2ZVO B;  3AE9 C;  4H0L D;  1NTK D;  2D2C D;  2KI7 B;  1YTZ I;  1HBW A;  3CPW O;  2ZYG A;  1FDM A;  2YNY A;  2BCC G;  1Q81 Q;  1SQV D;  2A06 G;  3KPE A;  3VP9 A;  1KYO D;  1IFN A;  1L0L E;  3RL0 B;  1R5L A;  4U7J A;  3EQ2 A;  4WY4 D;  1L4A D;  2N1T C;  1N7S A;  1M57 D;  4XE5 B;  3Q2Y A;  3CC4 P;  3MZW B;  2O01 N;  2WSF J;  3L70 D;  2NPS A;  4D6T E;  2QEX P;  3AEA C;  4PD4 H;  4U3F E;  2BEZ F;  2W6B A;  4PJ0 E;  1GW4 A;  3M91 A;  2AXT E;  2P2U A;  3PH0 A;  4RKU J;  5AW8 B;  1HH0 A;  3TGU E;  1NTK G;  4DOJ A;  3L73 E;  2JJL A;  3O8Z A;  3A5T A;  1KC8 Q;  3H1K E;  1FZC B;  3H1I J;  1CW5 A;  3P32 A;  5CBO A;  1YBK A;  2JR8 A;  3VP8 A;  3CI9 A;  1NU1 E;  2KNC B;  3NTN A;  2ZXE B;  4PV1 D;  5KAF E;  5AW7 B;  2VRS A;  3BRT B;  2QG4 A;  4EYY Q;  5CMZ A;  4GT1 A;  5KLV E;  3OJA B;  3PTZ A;  1ZW0 A;  3IR9 A;  3GW6 A;  1H89 A;  1K73 Q;  3L70 G;  3II6 A;  3VMY A;  2W83 C;  3QWO C;  2OQQ A;  3BCC E;  1X22 A;  3FXE A;  1FOS F;  3SWY A;  4H13 D;  1N86 A;  2OYH B;  3L74 G;  2O1J A;  1LWU C;  3R4Y A;  3ABV C;  1QGK B;  1FU1 A;  1J1D B;  3L4F A;  2WSE H;  1OZH A;  3FX0 A;  3CCL P;  3B71 A;  1IZN B;  3RK2 C;  1SQQ K;  3AED C;  1EDI A;  2YIU B;  1OFC X;  3GF7 A;  5KJ7 A;  1GD2 E;  1UIX A;  2K9Y A;  1UII A;  1FBM A;  2QA4 P;  5GTH E;  5M1B A;  1VPC A;  4LC1 A;  1W2B O;  1FZC A;  1KFN A;  2WVR A;  1YYC A;  1VQM P;  3SWK A;  2IZ1 A;  4H44 B;  3HD7 B;  3KZI H;  5DJT B;  2KNC A;  5KAF H;  1YJW P;  3Q5P A;  2HLO A;  5AW4 B;  2XZR A;  3LID A;  3UIA A;  1LJ2 A;  1NO4 A;  3MTU E;  3M0D C;  3W67 A;  2XU6 A;  5CCH D;  3B8E B;  3F5H A;  4QMA A;  2E5Y A;  2P67 A;  1PGJ A;  1VQN P;  3CCS P;  1KIL E;  3GG2 A;  2A45 H;  3PJS K;  1JY2 O;  4M3L A;  5TIS E;  2CPS A;  3WMM 0;  1BGY J;  3I55 P;  3LW5 J;  1SFC C;  2LXB A;  3H1L E;  1M8O B;  5AVW B;  1NOH A;  1SQB E;  2IFM A;  2B88 A;  4N78 D;  1N73 B;  3AEC C;  2K9J B;  5E79 E;  1JCC A;  4GOE A;  1BCC E;  2GUV A;  3OAK A;  3TYY A;  2O01 J;  5GTH H;  4L76 A;  3LIE A;  2G3A A;  3H1I E;  2OGU A;  2HFE D;  3WUT A;  5CBN A;  2R44 A;  1YIJ P;  4JYB A;  1LTJ C;  1SQP J;  3HD7 A;  3V4Q A;  1JNM A;  5AW0 B;  4UB6 H;  2Y0E A;  4KHX A;  2N1T D;  1RF1 B;  3TK1 A;  1JY3 N;  4I6M C;  1EXI A;  2QM7 A;  3B5N D;  1T2K C;  1K8A Q;  3CX5 D;  2N9Y B;  3C1L A;  2Q1K A;  1G1I A;  2YKP A;  3GF3 A;  1ZN5 A;  1SQB K;  2E5T A;  1NTM J;  2IBZ I;  3WUU A;  2HOD B;  1BGY D;  2FFD C;  1ZRT D;  3L72 J;  2P10 A;  4IL6 H;  2RH0 A;  1EDL A;  2IBZ E;  1S4X A;  1LP1 B;  1VL2 A;  2XND H;  3F89 A;  1EDJ A;  4W80 A;  1Q90 D;  3RBX A;  1PP9 G;  5TIS H;  4GIF A;  2WSF H;  2Q7C A;  2WQY C;  4DJG A;  2E42 A;  1IFI A;  1URQ C;  1N73 A;  4OGQ B;  5E79 H;  3M06 A;  2K9J A;  1QL2 A;  1SQP D;  2ZXX A;  2WIT A;  1OX3 A;  3RK3 E;  3AE5 C;  1HF9 A;  1FOS E;  1EZV D;  1YJN P;  3E1R A;  3AEG C;  2H89 C;  1AVY A;  2IPP A;  1BGY G;  1VQO P;  1SQX J;  3V2N A;  2MJZ A;  3L35 A;  2I1K A;  1EQ7 A;  1T3J A;  4GOD A;  4L73 A;  4H0L B;  3RL0 g;  1RF1 A;  2C0W A;  3L72 D;  5AW9 B;  1WRG A;  1D7M A;  5BVZ A;  3FWL A;  2OTJ P;  4JBZ A;  1N7S C;  3RK2 D;  2QJP C;  2UWJ E;  2KSE A;  3FWN A;  3WU2 H;  3CX5 I;  2XV5 A;  1YHQ P;  5APS A;  2NPS C;  2KS1 A;  2OYI B;  1IK7 A;  1ZOY C;  2MKV A;  1L4A B;  2K1A A;  1LP1 A;  2BCC J;  3CCU P;  1EZV G;  1XTG B;  1R8E A;  1JMB A;  2R3S A;  1HGV A;  2KZJ A;  2M0B A;  4C7N A;  3T97 B;  2M5A B;  1OW8 A;  1VQ8 P;  1Q7Y Q;  1K04 A;  3L72 G;  1MUU A;  1SQX D;  1NHL A;  5AW2 B;  2C9N Y;  4YTP C;  2FYU K;  2KOG A;  1SQQ J;  2WSC J;  4UB8 E;  2QJY C;  1L0N E;  1H0T B;  2FBW C;  3OW2 O;  2I1J A;  1NTK J;  1KFM A;  4PV1 B;  3CL3 D;  1BE3 E;  3B4S A;  1G2C B;  2CK3 H; 
#chains in the Genus database with same CATH homology
 1S4X A;  1M8O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...