1S4XA

Nmr structure of the integrin b3 cytoplasmic domain in dpc micelles
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
b'KLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin beta-3
molecule tags Cell adhesion
source organism Homo sapiens
publication title Membrane-mediated structural transitions at the cytoplasmic face during integrin activation.
pubmed doi rcsb
total genus 10
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2004-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08725 Integrin_b_cyt Integrin beta cytoplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.630 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Integrin beta subunit, cytoplasmic domain 1s4xA00
1M8OB 1S4XA
chains in the Genus database with same CATH superfamily
2N9YB 1SQBG 3L72J 1G2CB 1ZLLA 1KQFB 2B87A 2JDIH 2OARA 1K8AQ 2YO3A 2GUSA 1N7SD 1PL5A 4AYCA 4TLFA 2WSFH 4K35A 1DH3A 1FZGA 2IZ0A 1HGVA 1Y9BA 1YQ4C 2B87B 5CCHA 1GD2E 3SFDC 1N86A 4PJ0E 1VDFA 2JP3A 1GU5A 3M91A 1DEEG 2KS1A 2LKMA 1KFNA 2QVAA 3G4SP 1PGQA 1L0LD 1LWUA 1SQBE 1PPJE 2N9BA 1DD3A 1M1JA 2W27A 3Q3DA 1GU4A 3AEFC 4AUWA 5B66E 3CXHH 3C9IA 3L72G 1N8RQ 1NTKD 4M3LA 3S4RA 1EC5A 1G2CA 4HYTB 3CI9A 2A45I 3PP5A 1EXIA 2IFNA 3M9QA 1CSBA 1HGZA 4RO0A 3WU2E 3O8ZA 1RE3C 2O3JA 1LNQA 2YMKA 3LIDA 2E5TA 4YTPC 2WT7A 2AXTE 3L74J 1N73A 3VMXA 2O1JA 1SQVD 2YO2A 2W6AA 1KB9I 2XU6A 3HTKA 3V5BA 4OH8B 5KJ7A 1URQD 3H1HJ 1SQQJ 3B8EB 3H1HE 1EDKA 3KXDA 1SQXG 1W5CE 1NWQA 3L72E 5K5GB 1S9KD 1H0TA 4U3FG 2ZT9B 3HE5A 1RH5B 1PV3A 4EDFA 1ZRTD 2QRXA 4H44C 5AVSB 2IBZD 3A3YB 3L75J 1G1JA 2D2CB 1LTJC 3C8VA 3H6PA 3HE4A 2WSSH 4OGQD 3O6QB 2WSCJ 1OWAA 1FE6A 2J58A 4NPFX 2IX7C 1JO5A 4EIJA 2E5YA 3TSIA 4DCKA 1MFTA 1XTCC 4XA4A 3Q5RA 1NTMJ 3B5NC 3EWKA 3SWKA 2QA4P 1NU1K 3ABVC 3P8CE 2YIUB 2M5AA 1E79H 3SFEC 3RK3C 4CPGA 3VP8A 2VRSA 4IFMA 1SQBD 2QE7H 3AE9C 2ZYAA 3L73J 2Q9IA 4U7JA 2KSEA 1NTZG 2QJKC 5CJ0A 1L0LJ 4GT1A 1USEA 3WUTA 3PJSK 3B5NA 2FKWB 1JY3P 2FFDA 3CX5E 1IC2A 3HD7A 1PGOA 4PV1C 5KLVK 3D71A 2N1TC 1OVVA 3C1LA 1QL2A 1ZV8A 3CCRP 2Z4EA 2XV5A 3VP9A 2W8ZA 5APYA 1IFMA 2KNCB 3AE4C 1BGYJ 2KZJA 3K5BA 4HJGH 4WY4C 3W68A 1NVOA 3G9RA 3OW2O 3WU2H 4C46A 2POHA 2OYIB 1LTBC 3H1KJ 1S4XA 3S1KA 3TYYA 5AVQB 3L75G 3G71P 3CC7P 1ZR4A 1FZCA 1BGYG 1J1EB 2PGDA 2ZAEB 3LIEA 1KILD 3H1KD 1PGJA 3CPWO 1AQ5A 2W83C 1T3JA 4NPEA 4OGQC 3CWBG 1GL2C 1JEKA 3HUSC 4UB8H 3RK3B 1PGPA 2ITAA 3GMAA 3LW5H 1SQPK 1WMKA 2C0WA 1PFIA 1PIXA 3PH0A 2H43A 1Y8AA 1YTZT 1H88A 2KYVA 3AE8C 2WSEH 3H1IJ 2XNXA 1Q81Q 4WBAA 5AVZB 2AXCA 2IFMA 3P7KA 2FYNC 2L91A 4OVNF 2FXPA 2WPSA 1S5LH 3Q2YA 1FS0E 3VMZA 1VQPP 3A5TA 1YIJP 1L2PA 1BSNA 1GL2A 2FY8A 3HUSA 1NTMG 3MHVA 1FAVA 1M1JC 2P67A 1ZXGA 2ZYGA 3CX5H 1VF5C 4BXLA 4Y99B 2I8DA 4ASVA 2IBZG 1JB0J 1DIPA 2KS1B 3L70D 4N6JA 5AW7B 5CCGC 3TDKA 1RQVA 2BCCG 3H1JG 1FZCC 2RMZA 3B71A 4YXDC 4I6MC 1JTHB 1AA0A 5CCHC 1USDA 1URQA 1YHQP 2WITA 3H1HD 2N1TD 3L74E 2P1JA 3PLNA 4JYBA 1KC8Q 3VTPC 2OYHB 2HR3A 1K73Q 4B86A 3F89A 2XNDH 1VF5B 2FYUK 2R44A 3V4QA 1ZRTE 1KB9E 1SQQG 2OYIC 4D6TE 4KJMA 4EYYQ 1HBWA 1OFCX 2YIUC 1IJDB 1Q2NA 1FOSF 1KB9D 3CCEP 4L76A 1LTTC 1P84D 1KORA 1MFZA 3HD7D 1OW8A 3OA7A 1M57D 1PZQA 1QLED 3B5ND 2FYUG 3P32A 4H0LB 3BRTB 4PJ0H 1NU1E 1NYHA 1WT6A 2NRGA 1PPJD 3BASA 1YBKA 3BCCG 3CX5D 5B5EE 1RF1C 5KKZC 3W67A 3D6YA 2FYUD 5KAIH 1VQOP 3CMAP 1VL2A 2HODB 4EOTA 2OTJP 4TT3H 3H32A 1YI2P 1JMMA 2R5BA 2D2CD 3R4YA 1M8OB 3GHGC 1VQ6P 3L73E 1NHLA 1MKMA 1M1KQ 1KYOH 1AFOA 2P7JA 2V7QH 5APWA 2FXMA 3H1KG 5AW9B 1YYCA 2KUBA 3AEAC 5EFWB 3RK3E 4GDOA 2K9JA 3SWFA 2KZIA 1GK6A 3Q5SA 1N73B 4KHXA 3U59A 3CX5I 2XDJA 2KLUA 1RE4C 3IAOA 5APTA 3L4FA 5H2FE 1JTHA 3LW5J 5B66H 2UWJE 4R4MA 4IL6E 1N73C 1FC2C 1SQBJ 4OWFA 2IBZE 3QH9A 2IYOA 3RL0D 3H1KE 1ZMEC 1JUNA 1NGMB 3L71D 4IL6X 3KHUA 4Y99C 1R5LA 1GW4A 5AVRB 5APSA 5APXA 1VQ5P 2Q1KA 1Q86Q 3CMEP 3V2PA 4D6TD 1MUUA 1BCCJ 1JY2P 4UB6E 3L71G 1EZVG 5AVUB 1BE3J 1HF9A 2CK3H 1RQUA 3Q5PA 2JO1A 1NTMK 4H13D 4ZNCA 1YITP 1NU1J 2BEQD 3VMAA 2H7HA 1S5LX 3EFFK 2IBZI 3CXHD 1JMBA 1HVVA 1NTZE 2FXOA 1HWTC 1EQ7A 1IK9A 2E75B 5KAFE 1QGKB 2Z5HA 2E74D 1L0LK 1KILB 1Q90D 1SQQD 2WPRA 3IFMA 4HB1A 3A0HH 5E79H 3GG2A 3AEGC 2HODA 1NTZK 5DJTB 5AW2B 5M1BA 5CBOA 1FZEA 3IR9A 4QMAA 3OJAB 1RF0C 3TGUD 1GW3A 3CCSP 3CD6P 4GKGA 3BCCE 2KNCA 1WRGA 2QM8A 3AE7C 3H1IE 1U57A 3PRJA 1EZVI 1SQVG 5AW1B 2KOGA 1T3UA 4I1LA 1GMJA 3BCCD 1BE3G 1UIIA 1VQ7P 1VQ8P 2E76B 1SQXD 4JPZB 1DD4A 2A45G 3FWNA 1QVFO 5TISH 3KZIH 5AW6B 1IO4A 1R5SA 5H2FH 1MV8A 1BE3D 1RY3A 2G8YA 2QJKB 5C39A 1KFMA 3H1LJ 3RL0g 4JQ0D 2OTKE 1S9KE 3E7KA 3RK2D 3KQGA 3SWYA 1YJWP 3TK1A 1SQPE 1L0NJ 1G1IA 1QEXA 3MUDC 1EZVE 2M0BA 1RF0A 1L0NE 1ZOYC 1HTLC 2N1TB 2V7QJ 3MGNA 4DOJA 4ASWA 1R8EA 3HRNA 3FXEA 2PP6A 3E1RA 2WPQA 1KQGB 3V4WA 4LLHA 5KLIB 1N7SA 4I7ZB 4BRYB 3KPEA 4PD4D 1AV1A 1SLQA 1L0ND 2V4HA 4RKUJ 3V6IA 4ZMDA 2A06G 2M3EA 1NJIQ 4I2LC 4GOFA 4D6TJ 4EI2A 1GL2B 3HUSB 3CCVP 1JOCA 5AW3B 5KKZB 5B5EH 2CPBA 1L0NG 4H44D 3S9OA 3RBXA 1KB9H 3L71E 2RH0A 3NXSA 4IOIH 3WUVA 4C7NB 2FFDB 1FZFA 3IN6A 2IYPA 3B5NB 1VQLP 1OVRA 2RN0A 1LT9C 1TU3F 2Q7CA 5TJHA 3KDPB 3BCCJ 1SFCA 2Y9YA 5BVZA 1RF1B 3AEEC 3L70J 2FYUJ 3A0HE 1YQ3C 1IFNA 3H25A 1SFCC 2E42A 2KK7A 4PD4I 3H1LD 2GA1A 4H44B 2YNYA 1T2KC 4N3YB 4BRYA 3L75D 4Z1MH 1LGHB 1N7LA 1RHZB 4DZOA 1SVFA 2KIKA 3H1LE 1NAYA 2BASA 2QSIA 4JBZA 4ZKPA 3CCLP 1PP9D 3H1ID 1U7JA 1ZW0A 1X0TA 2WSCH 3MTUE 1EDJA 1LWUB 2WVRA 5AW0B 2ZT9D 1HJ0A 2PFXA 1LTIC 2ZVNB 1IFDA 3N4XA 5AVXB 1T6AA 2KI7B 4C7RA 3TGUJ 4PV1B 4PD4E 1LT1A 1JY3O 2MKVA 2Q3EA 3AE1C 3E1IA 1VQNP 1ZP0C 4PV1D 2HLOA 2JWDA 4MN4C 2HFED 1GZLA 1AVYA 1NH4A 3FX0A 3OAKA 3RL0C 5KLVE 3CCMP 2H88C 1KILE 3HTKB 1YTZI 1NU1G 3USSA 1FJKA 1OW7A 1KQSO 1FOSE 2WT7B 1LP1B 1BDDA 2DW3A 2WSEJ 1SQQK 1OZHA 3IF4A 1FDIA 2JKVA 4WB4A 1OW6A 1P84H 3L71J 5KLVD 3RBZA 3V2QA 2R5DA 3L70G 1K9MQ 2YKOA 3AECC 2WQYC 3CCJP 4U3FD 2FYNB 2WWWA 4C7NA 3MD0A 5KLVG 1SQVJ 2OYHA 3VN0A 2O01N 1AVOA 3U1AA 1A02J 1KYOD 1CI6B 4HKZH 1H89A 4IFFA 1OX3A 1DEBA 1KMIZ 1FZBA 1SQXK 3HE4B 1FDOA 3D70A 3M06A 2QG4A 3BATA 3CCQP 1T2KD 1NTKE 4OGQB 3CC4P 2IPPA 2HPCB 1M90Q 2W6JH 3AE5C 2CPSA 1H0TB 4W7YA 5DJUB 1J1EC 1LTSC 1H8AA 2HPCA 4HH2A 1KILA 1L0LE 3V2NA 1SP4A 2K37A 2LXCB 1IFIA 1W2EA 1S5LE 1NTKK 1ZN5A 4W80A 2B88A 2FFDC 4YPCA 4NPDA 3NMDA 5CCGA 1NTZD 2JWAA 1SS1A 2P2UA 3CXHE 3KYQA 3VYIA 3NFQA 1FZCB 2OYHC 3UIAA 5KAFH 1OXZA 3ZDMA 5KLVJ 1T8ZA 1YJNP 1BCCG 1ZR2A 2OYOA 2E43A 1JCDA 5APVA 5KJ7C 5KTBA 1NTZJ 1Y47A 1OIPA 3L35A 1FBMA 1JNMA 3GHGB 2NPSA 1KV4A 3KZIE 1M1JB 3L72D 5BU5A 2K9JB 1UIXA 2Y0EA 5CJ4A 2AEJA 1PP9G 1SQPJ 2QJYB 2R32A 2YXRB 1J1DC 1VPCA 4DT0A 2NPSD 1BGYD 2XZRA 2NZ2A 3M9BA 3MP7B 2Z5IA 4I7ZC 2Q5UA 1KYOI 3MZWB 2I1JA 3G3ZA 3VOPA 5TISE 2PAJA 4WY4D 2WTYA 1Q82Q 1GL2D 2Y9ZA 2ZVOB 5GTIH 1KN7A 3BVHA 2D2CC 5BU8B 2QJYC 3JC22 2SPZA 2AEFA 2R3CA 4U3FJ 3GHGA 1Z56A 4WY4A 3CL3D 2ZT9C 4U3FE 3A0BE 5AW8B 2J5UA 2K1AA 3FXDA 1U7MA 2N1TA 3BRVB 3H1HG 4UB8E 2R3SA 4IFDK 3HD7C 4YXWH 1KYOE 1NTMD 2NPSC 4JF7A 3G6EP 2C0XA 4RJTA 2Y0CA 1RF1A 2OGUA 3WMM0 1FU1A 2KXPB 3RK2C 1GTWA 1LT9A 3H1JD 3HD7B 4R4LA 2QEXP 1OMIA 3I56P 4UB6H 1VQMP 2M8RA 1FDMA 3NTNA 3MIWA 1SQQE 1GDTA 3AE2C 2W6BA 1JY2O 3JCUE 1VQ9P 4H13C 2Q6QA 5CMZA 1X8YA 1IFPA 5L8RJ 2ZJSE 1PPJG 1KILC 5GTHH 2K3RA 1K04A 2B9BA 2PRRA 1BE3E 3GLMA 5CCGD 1S72P 4N78D 1M7LA 2QJPC 1SQVE 1P84E 1VF5D 1SQXE 3H32B 3T97B 1BDCA 1URQB 1URQC 1SQPD 2M3BA 4L75A 4WWIA 2L5GB 5AVWB 2BCCJ 4W7ZA 3T97A 3U1CA 1VQ4P 4H0LC 5AVTB 4DJGA 4IL6H 4L74A 1JM0A 1PP9E 3GF7A 1BCCD 2MJZA 3O6QA 3TF5A 1LTAC 2J59M 1PP9J 1SQPG 2IDBA 4LGDE 4GODA 3V2RA 3A7OA 3HE5B 3D6ZA 3L75E 2E75C 1KTMA 4H0LD 1EDLA 2IZ1A 3M0AA 3RL0B 2WPVB 1S3JA 1P84I 2OQQA 1IK7A 3CWBD 1RE3A 1QX8A 3GF3A 2GM4A 1QL1A 1NKNA 2KLVA 3ITKA 1CZQA 2QJPB 3I5CA 5KLIC 1CI6A 1NO4A 2HYNA 1K05A 3JCUH 3JSVC 2WMMA 2GUVA 2WSFJ 3GW6A 2Y0DA 2E74C 2KP8A 2O01H 3CXHI 1BGYE 3CWBJ 3AE3C 3FGAD 4XE5B 1M56D 5AW5B 1FJPA 1X79B 4Y28J 3M9HA 4D6TG 2ZXXA 1SFCD 3VMYA 2W90A 2P58A 1LWUC 4AQRD 5CCHD 1W2BO 1E5WA 3PHLA 1XTGB 3II6A 1BSHA 2FYZA 4JYCA 1CW5A 1SQBK 4XFJA 4BWNA 5E79E 2E75D 1SQVK 2P10A 3EQ2A 1HJBA 5APQA 2OTLP 1NKZB 2E74B 2QM7A 1DX7A 3RK2B 3I55P 1S2EA 2BCCD 2K88A 1IZNB 3H1JJ 3L36A 4ZKUA 2YXQB 3CC2P 1LP1A 1LTGC 1SQXJ 3H1JE 1J2JB 2B89A 1SFCB 2XKMA 2K9YA 1EZVD 1HH0A 2YKPA 3TNUA 2JEEA 3H1LG 3N7NA 4KT0J 5CHXA 3SSUA 1AQTA 1LTJB 1NTME 1L0LG 2BEZF 2YMYA 5GTHE 1YJ9P 2YKQA 3PTZA 1LT9B 1FZAA 1L4AC 2G3AA 2QIWA 3AE6C 3L73G 1KQLA 1EDIA 5AVVB 1NTKJ 3RGUA 1Q7YQ 2O1KA 1N2DC 1NTKG 1QVGO 4GIFA 5KJ7D 5APUA 3RK3D 1KD1Q 4H13B 3H1IG 2JJLA 3FWLA 5GTIE 1L4AB 3L73D 3B4SA 5KAIE 2M5AB 2AEMA 1HUCA 2O01J 1RE4A 4LC1A 2H89C 2Q3IA 5CBNA 3AEDC 1VQKP 1AJYA 3AEBC 2JR8A 4WY4B 4A7PA 3L70E 2FYUE 3L37A 3EFGA 3A2AA 2HG5D 3P8MC 2LR2A 3CWBE 3M0DA 3TGUG 2I1KA 2OYIA 1N7SC 2C9LY 2C9NY 3TGUE 2H8PD 2ZYDA 1NOHA 4WVZA 1NU1D 1EXJA 1MZ9A 2WZ7A 1JCCA 1LTJA 3CCUP 2KSJA 1L4AD 5AVYB 1S1CX 3CLQA 2FBWC 1NAFA 4PD4H 2LXBA 3MUDA 2AXTH 1IFJA 1L0NK 1X9VA 1D7MA 2E76C 2RKLA 3M0DC 3P8CD 3QWOC 3R2PA 2KB7P 4K3AA 1BCCE 4RESB 1GK4A 1LJ2A 1X22A 3TNUB 3A0BH 1KZUB 3L74G 4GOEA 4O9BA 1N7SB 2A06D 2E76D 2A45H 3F5HA 3WUUA 2NPSB 4L73A 5AW4B 3Q1MA 2ZXEB 2A06E 4N78E 2BCCE 2ZFCA 1JY3N 3L74D 1A02F 1L4AA 1OVUA 1JY2N 1J1DB
chains in the Genus database with same CATH topology
1M8OB 1S4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M8O B;  1S4X A; 
#chains in the Genus database with same CATH topology
 2N9Y B;  1SQB G;  3L72 J;  1G2C B;  1ZLL A;  1KQF B;  2B87 A;  2JDI H;  2OAR A;  1K8A Q;  2YO3 A;  2GUS A;  1N7S D;  1PL5 A;  4AYC A;  4TLF A;  2WSF H;  4K35 A;  1DH3 A;  1FZG A;  2IZ0 A;  1HGV A;  1Y9B A;  1YQ4 C;  2B87 B;  5CCH A;  1GD2 E;  3SFD C;  1N86 A;  4PJ0 E;  1VDF A;  2JP3 A;  1GU5 A;  3M91 A;  1DEE G;  2KS1 A;  2LKM A;  1KFN A;  2QVA A;  3G4S P;  1PGQ A;  1L0L D;  1LWU A;  1SQB E;  1PPJ E;  2N9B A;  1DD3 A;  1M1J A;  2W27 A;  3Q3D A;  1GU4 A;  3AEF C;  4AUW A;  5B66 E;  3CXH H;  3C9I A;  3L72 G;  1N8R Q;  1NTK D;  4M3L A;  3S4R A;  1EC5 A;  1G2C A;  4HYT B;  3CI9 A;  2A45 I;  3PP5 A;  1EXI A;  2IFN A;  3M9Q A;  1CSB A;  1HGZ A;  4RO0 A;  3WU2 E;  3O8Z A;  1RE3 C;  2O3J A;  1LNQ A;  2YMK A;  3LID A;  2E5T A;  4YTP C;  2WT7 A;  2AXT E;  3L74 J;  1N73 A;  3VMX A;  2O1J A;  1SQV D;  2YO2 A;  2W6A A;  1KB9 I;  2XU6 A;  3HTK A;  3V5B A;  4OH8 B;  5KJ7 A;  1URQ D;  3H1H J;  1SQQ J;  3B8E B;  3H1H E;  1EDK A;  3KXD A;  1SQX G;  1W5C E;  1NWQ A;  3L72 E;  5K5G B;  1S9K D;  1H0T A;  4U3F G;  2ZT9 B;  3HE5 A;  1RH5 B;  1PV3 A;  4EDF A;  1ZRT D;  2QRX A;  4H44 C;  5AVS B;  2IBZ D;  3A3Y B;  3L75 J;  1G1J A;  2D2C B;  1LTJ C;  3C8V A;  3H6P A;  3HE4 A;  2WSS H;  4OGQ D;  3O6Q B;  2WSC J;  1OWA A;  1FE6 A;  2J58 A;  4NPF X;  2IX7 C;  1JO5 A;  4EIJ A;  2E5Y A;  3TSI A;  4DCK A;  1MFT A;  1XTC C;  4XA4 A;  3Q5R A;  1NTM J;  3B5N C;  3EWK A;  3SWK A;  2QA4 P;  1NU1 K;  3ABV C;  3P8C E;  2YIU B;  2M5A A;  1E79 H;  3SFE C;  3RK3 C;  4CPG A;  3VP8 A;  2VRS A;  4IFM A;  1SQB D;  2QE7 H;  3AE9 C;  2ZYA A;  3L73 J;  2Q9I A;  4U7J A;  2KSE A;  1NTZ G;  2QJK C;  5CJ0 A;  1L0L J;  4GT1 A;  1USE A;  3WUT A;  3PJS K;  3B5N A;  2FKW B;  1JY3 P;  2FFD A;  3CX5 E;  1IC2 A;  3HD7 A;  1PGO A;  4PV1 C;  5KLV K;  3D71 A;  2N1T C;  1OVV A;  3C1L A;  1QL2 A;  1ZV8 A;  3CCR P;  2Z4E A;  2XV5 A;  3VP9 A;  2W8Z A;  5APY A;  1IFM A;  2KNC B;  3AE4 C;  1BGY J;  2KZJ A;  3K5B A;  4HJG H;  4WY4 C;  3W68 A;  1NVO A;  3G9R A;  3OW2 O;  3WU2 H;  4C46 A;  2POH A;  2OYI B;  1LTB C;  3H1K J;  1S4X A;  3S1K A;  3TYY A;  5AVQ B;  3L75 G;  3G71 P;  3CC7 P;  1ZR4 A;  1FZC A;  1BGY G;  1J1E B;  2PGD A;  2ZAE B;  3LIE A;  1KIL D;  3H1K D;  1PGJ A;  3CPW O;  1AQ5 A;  2W83 C;  1T3J A;  4NPE A;  4OGQ C;  3CWB G;  1GL2 C;  1JEK A;  3HUS C;  4UB8 H;  3RK3 B;  1PGP A;  2ITA A;  3GMA A;  3LW5 H;  1SQP K;  1WMK A;  2C0W A;  1PFI A;  1PIX A;  3PH0 A;  2H43 A;  1Y8A A;  1YTZ T;  1H88 A;  2KYV A;  3AE8 C;  2WSE H;  3H1I J;  2XNX A;  1Q81 Q;  4WBA A;  5AVZ B;  2AXC A;  2IFM A;  3P7K A;  2FYN C;  2L91 A;  4OVN F;  2FXP A;  2WPS A;  1S5L H;  3Q2Y A;  1FS0 E;  3VMZ A;  1VQP P;  3A5T A;  1YIJ P;  1L2P A;  1BSN A;  1GL2 A;  2FY8 A;  3HUS A;  1NTM G;  3MHV A;  1FAV A;  1M1J C;  2P67 A;  1ZXG A;  2ZYG A;  3CX5 H;  1VF5 C;  4BXL A;  4Y99 B;  2I8D A;  4ASV A;  2IBZ G;  1JB0 J;  1DIP A;  2KS1 B;  3L70 D;  4N6J A;  5AW7 B;  5CCG C;  3TDK A;  1RQV A;  2BCC G;  3H1J G;  1FZC C;  2RMZ A;  3B71 A;  4YXD C;  4I6M C;  1JTH B;  1AA0 A;  5CCH C;  1USD A;  1URQ A;  1YHQ P;  2WIT A;  3H1H D;  2N1T D;  3L74 E;  2P1J A;  3PLN A;  4JYB A;  1KC8 Q;  3VTP C;  2OYH B;  2HR3 A;  1K73 Q;  4B86 A;  3F89 A;  2XND H;  1VF5 B;  2FYU K;  2R44 A;  3V4Q A;  1ZRT E;  1KB9 E;  1SQQ G;  2OYI C;  4D6T E;  4KJM A;  4EYY Q;  1HBW A;  1OFC X;  2YIU C;  1IJD B;  1Q2N A;  1FOS F;  1KB9 D;  3CCE P;  4L76 A;  1LTT C;  1P84 D;  1KOR A;  1MFZ A;  3HD7 D;  1OW8 A;  3OA7 A;  1M57 D;  1PZQ A;  1QLE D;  3B5N D;  2FYU G;  3P32 A;  4H0L B;  3BRT B;  4PJ0 H;  1NU1 E;  1NYH A;  1WT6 A;  2NRG A;  1PPJ D;  3BAS A;  1YBK A;  3BCC G;  3CX5 D;  5B5E E;  1RF1 C;  5KKZ C;  3W67 A;  3D6Y A;  2FYU D;  5KAI H;  1VQO P;  3CMA P;  1VL2 A;  2HOD B;  4EOT A;  2OTJ P;  4TT3 H;  3H32 A;  1YI2 P;  1JMM A;  2R5B A;  2D2C D;  3R4Y A;  1M8O B;  3GHG C;  1VQ6 P;  3L73 E;  1NHL A;  1MKM A;  1M1K Q;  1KYO H;  1AFO A;  2P7J A;  2V7Q H;  5APW A;  2FXM A;  3H1K G;  5AW9 B;  1YYC A;  2KUB A;  3AEA C;  5EFW B;  3RK3 E;  4GDO A;  2K9J A;  3SWF A;  2KZI A;  1GK6 A;  3Q5S A;  1N73 B;  4KHX A;  3U59 A;  3CX5 I;  2XDJ A;  2KLU A;  1RE4 C;  3IAO A;  5APT A;  3L4F A;  5H2F E;  1JTH A;  3LW5 J;  5B66 H;  2UWJ E;  4R4M A;  4IL6 E;  1N73 C;  1FC2 C;  1SQB J;  4OWF A;  2IBZ E;  3QH9 A;  2IYO A;  3RL0 D;  3H1K E;  1ZME C;  1JUN A;  1NGM B;  3L71 D;  4IL6 X;  3KHU A;  4Y99 C;  1R5L A;  1GW4 A;  5AVR B;  5APS A;  5APX A;  1VQ5 P;  2Q1K A;  1Q86 Q;  3CME P;  3V2P A;  4D6T D;  1MUU A;  1BCC J;  1JY2 P;  4UB6 E;  3L71 G;  1EZV G;  5AVU B;  1BE3 J;  1HF9 A;  2CK3 H;  1RQU A;  3Q5P A;  2JO1 A;  1NTM K;  4H13 D;  4ZNC A;  1YIT P;  1NU1 J;  2BEQ D;  3VMA A;  2H7H A;  1S5L X;  3EFF K;  2IBZ I;  3CXH D;  1JMB A;  1HVV A;  1NTZ E;  2FXO A;  1HWT C;  1EQ7 A;  1IK9 A;  2E75 B;  5KAF E;  1QGK B;  2Z5H A;  2E74 D;  1L0L K;  1KIL B;  1Q90 D;  1SQQ D;  2WPR A;  3IFM A;  4HB1 A;  3A0H H;  5E79 H;  3GG2 A;  3AEG C;  2HOD A;  1NTZ K;  5DJT B;  5AW2 B;  5M1B A;  5CBO A;  1FZE A;  3IR9 A;  4QMA A;  3OJA B;  1RF0 C;  3TGU D;  1GW3 A;  3CCS P;  3CD6 P;  4GKG A;  3BCC E;  2KNC A;  1WRG A;  2QM8 A;  3AE7 C;  3H1I E;  1U57 A;  3PRJ A;  1EZV I;  1SQV G;  5AW1 B;  2KOG A;  1T3U A;  4I1L A;  1GMJ A;  3BCC D;  1BE3 G;  1UII A;  1VQ7 P;  1VQ8 P;  2E76 B;  1SQX D;  4JPZ B;  1DD4 A;  2A45 G;  3FWN A;  1QVF O;  5TIS H;  3KZI H;  5AW6 B;  1IO4 A;  1R5S A;  5H2F H;  1MV8 A;  1BE3 D;  1RY3 A;  2G8Y A;  2QJK B;  5C39 A;  1KFM A;  3H1L J;  3RL0 g;  4JQ0 D;  2OTK E;  1S9K E;  3E7K A;  3RK2 D;  3KQG A;  3SWY A;  1YJW P;  3TK1 A;  1SQP E;  1L0N J;  1G1I A;  1QEX A;  3MUD C;  1EZV E;  2M0B A;  1RF0 A;  1L0N E;  1ZOY C;  1HTL C;  2N1T B;  2V7Q J;  3MGN A;  4DOJ A;  4ASW A;  1R8E A;  3HRN A;  3FXE A;  2PP6 A;  3E1R A;  2WPQ A;  1KQG B;  3V4W A;  4LLH A;  5KLI B;  1N7S A;  4I7Z B;  4BRY B;  3KPE A;  4PD4 D;  1AV1 A;  1SLQ A;  1L0N D;  2V4H A;  4RKU J;  3V6I A;  4ZMD A;  2A06 G;  2M3E A;  1NJI Q;  4I2L C;  4GOF A;  4D6T J;  4EI2 A;  1GL2 B;  3HUS B;  3CCV P;  1JOC A;  5AW3 B;  5KKZ B;  5B5E H;  2CPB A;  1L0N G;  4H44 D;  3S9O A;  3RBX A;  1KB9 H;  3L71 E;  2RH0 A;  3NXS A;  4IOI H;  3WUV A;  4C7N B;  2FFD B;  1FZF A;  3IN6 A;  2IYP A;  3B5N B;  1VQL P;  1OVR A;  2RN0 A;  1LT9 C;  1TU3 F;  2Q7C A;  5TJH A;  3KDP B;  3BCC J;  1SFC A;  2Y9Y A;  5BVZ A;  1RF1 B;  3AEE C;  3L70 J;  2FYU J;  3A0H E;  1YQ3 C;  1IFN A;  3H25 A;  1SFC C;  2E42 A;  2KK7 A;  4PD4 I;  3H1L D;  2GA1 A;  4H44 B;  2YNY A;  1T2K C;  4N3Y B;  4BRY A;  3L75 D;  4Z1M H;  1LGH B;  1N7L A;  1RHZ B;  4DZO A;  1SVF A;  2KIK A;  3H1L E;  1NAY A;  2BAS A;  2QSI A;  4JBZ A;  4ZKP A;  3CCL P;  1PP9 D;  3H1I D;  1U7J A;  1ZW0 A;  1X0T A;  2WSC H;  3MTU E;  1EDJ A;  1LWU B;  2WVR A;  5AW0 B;  2ZT9 D;  1HJ0 A;  2PFX A;  1LTI C;  2ZVN B;  1IFD A;  3N4X A;  5AVX B;  1T6A A;  2KI7 B;  4C7R A;  3TGU J;  4PV1 B;  4PD4 E;  1LT1 A;  1JY3 O;  2MKV A;  2Q3E A;  3AE1 C;  3E1I A;  1VQN P;  1ZP0 C;  4PV1 D;  2HLO A;  2JWD A;  4MN4 C;  2HFE D;  1GZL A;  1AVY A;  1NH4 A;  3FX0 A;  3OAK A;  3RL0 C;  5KLV E;  3CCM P;  2H88 C;  1KIL E;  3HTK B;  1YTZ I;  1NU1 G;  3USS A;  1FJK A;  1OW7 A;  1KQS O;  1FOS E;  2WT7 B;  1LP1 B;  1BDD A;  2DW3 A;  2WSE J;  1SQQ K;  1OZH A;  3IF4 A;  1FDI A;  2JKV A;  4WB4 A;  1OW6 A;  1P84 H;  3L71 J;  5KLV D;  3RBZ A;  3V2Q A;  2R5D A;  3L70 G;  1K9M Q;  2YKO A;  3AEC C;  2WQY C;  3CCJ P;  4U3F D;  2FYN B;  2WWW A;  4C7N A;  3MD0 A;  5KLV G;  1SQV J;  2OYH A;  3VN0 A;  2O01 N;  1AVO A;  3U1A A;  1A02 J;  1KYO D;  1CI6 B;  4HKZ H;  1H89 A;  4IFF A;  1OX3 A;  1DEB A;  1KMI Z;  1FZB A;  1SQX K;  3HE4 B;  1FDO A;  3D70 A;  3M06 A;  2QG4 A;  3BAT A;  3CCQ P;  1T2K D;  1NTK E;  4OGQ B;  3CC4 P;  2IPP A;  2HPC B;  1M90 Q;  2W6J H;  3AE5 C;  2CPS A;  1H0T B;  4W7Y A;  5DJU B;  1J1E C;  1LTS C;  1H8A A;  2HPC A;  4HH2 A;  1KIL A;  1L0L E;  3V2N A;  1SP4 A;  2K37 A;  2LXC B;  1IFI A;  1W2E A;  1S5L E;  1NTK K;  1ZN5 A;  4W80 A;  2B88 A;  2FFD C;  4YPC A;  4NPD A;  3NMD A;  5CCG A;  1NTZ D;  2JWA A;  1SS1 A;  2P2U A;  3CXH E;  3KYQ A;  3VYI A;  3NFQ A;  1FZC B;  2OYH C;  3UIA A;  5KAF H;  1OXZ A;  3ZDM A;  5KLV J;  1T8Z A;  1YJN P;  1BCC G;  1ZR2 A;  2OYO A;  2E43 A;  1JCD A;  5APV A;  5KJ7 C;  5KTB A;  1NTZ J;  1Y47 A;  1OIP A;  3L35 A;  1FBM A;  1JNM A;  3GHG B;  2NPS A;  1KV4 A;  3KZI E;  1M1J B;  3L72 D;  5BU5 A;  2K9J B;  1UIX A;  2Y0E A;  5CJ4 A;  2AEJ A;  1PP9 G;  1SQP J;  2QJY B;  2R32 A;  2YXR B;  1J1D C;  1VPC A;  4DT0 A;  2NPS D;  1BGY D;  2XZR A;  2NZ2 A;  3M9B A;  3MP7 B;  2Z5I A;  4I7Z C;  2Q5U A;  1KYO I;  3MZW B;  2I1J A;  3G3Z A;  3VOP A;  5TIS E;  2PAJ A;  4WY4 D;  2WTY A;  1Q82 Q;  1GL2 D;  2Y9Z A;  2ZVO B;  5GTI H;  1KN7 A;  3BVH A;  2D2C C;  5BU8 B;  2QJY C;  3JC2 2;  2SPZ A;  2AEF A;  2R3C A;  4U3F J;  3GHG A;  1Z56 A;  4WY4 A;  3CL3 D;  2ZT9 C;  4U3F E;  3A0B E;  5AW8 B;  2J5U A;  2K1A A;  3FXD A;  1U7M A;  2N1T A;  3BRV B;  3H1H G;  4UB8 E;  2R3S A;  4IFD K;  3HD7 C;  4YXW H;  1KYO E;  1NTM D;  2NPS C;  4JF7 A;  3G6E P;  2C0X A;  4RJT A;  2Y0C A;  1RF1 A;  2OGU A;  3WMM 0;  1FU1 A;  2KXP B;  3RK2 C;  1GTW A;  1LT9 A;  3H1J D;  3HD7 B;  4R4L A;  2QEX P;  1OMI A;  3I56 P;  4UB6 H;  1VQM P;  2M8R A;  1FDM A;  3NTN A;  3MIW A;  1SQQ E;  1GDT A;  3AE2 C;  2W6B A;  1JY2 O;  3JCU E;  1VQ9 P;  4H13 C;  2Q6Q A;  5CMZ A;  1X8Y A;  1IFP A;  5L8R J;  2ZJS E;  1PPJ G;  1KIL C;  5GTH H;  2K3R A;  1K04 A;  2B9B A;  2PRR A;  1BE3 E;  3GLM A;  5CCG D;  1S72 P;  4N78 D;  1M7L A;  2QJP C;  1SQV E;  1P84 E;  1VF5 D;  1SQX E;  3H32 B;  3T97 B;  1BDC A;  1URQ B;  1URQ C;  1SQP D;  2M3B A;  4L75 A;  4WWI A;  2L5G B;  5AVW B;  2BCC J;  4W7Z A;  3T97 A;  3U1C A;  1VQ4 P;  4H0L C;  5AVT B;  4DJG A;  4IL6 H;  4L74 A;  1JM0 A;  1PP9 E;  3GF7 A;  1BCC D;  2MJZ A;  3O6Q A;  3TF5 A;  1LTA C;  2J59 M;  1PP9 J;  1SQP G;  2IDB A;  4LGD E;  4GOD A;  3V2R A;  3A7O A;  3HE5 B;  3D6Z A;  3L75 E;  2E75 C;  1KTM A;  4H0L D;  1EDL A;  2IZ1 A;  3M0A A;  3RL0 B;  2WPV B;  1S3J A;  1P84 I;  2OQQ A;  1IK7 A;  3CWB D;  1RE3 A;  1QX8 A;  3GF3 A;  2GM4 A;  1QL1 A;  1NKN A;  2KLV A;  3ITK A;  1CZQ A;  2QJP B;  3I5C A;  5KLI C;  1CI6 A;  1NO4 A;  2HYN A;  1K05 A;  3JCU H;  3JSV C;  2WMM A;  2GUV A;  2WSF J;  3GW6 A;  2Y0D A;  2E74 C;  2KP8 A;  2O01 H;  3CXH I;  1BGY E;  3CWB J;  3AE3 C;  3FGA D;  4XE5 B;  1M56 D;  5AW5 B;  1FJP A;  1X79 B;  4Y28 J;  3M9H A;  4D6T G;  2ZXX A;  1SFC D;  3VMY A;  2W90 A;  2P58 A;  1LWU C;  4AQR D;  5CCH D;  1W2B O;  1E5W A;  3PHL A;  1XTG B;  3II6 A;  1BSH A;  2FYZ A;  4JYC A;  1CW5 A;  1SQB K;  4XFJ A;  4BWN A;  5E79 E;  2E75 D;  1SQV K;  2P10 A;  3EQ2 A;  1HJB A;  5APQ A;  2OTL P;  1NKZ B;  2E74 B;  2QM7 A;  1DX7 A;  3RK2 B;  3I55 P;  1S2E A;  2BCC D;  2K88 A;  1IZN B;  3H1J J;  3L36 A;  4ZKU A;  2YXQ B;  3CC2 P;  1LP1 A;  1LTG C;  1SQX J;  3H1J E;  1J2J B;  2B89 A;  1SFC B;  2XKM A;  2K9Y A;  1EZV D;  1HH0 A;  2YKP A;  3TNU A;  2JEE A;  3H1L G;  3N7N A;  4KT0 J;  5CHX A;  3SSU A;  1AQT A;  1LTJ B;  1NTM E;  1L0L G;  2BEZ F;  2YMY A;  5GTH E;  1YJ9 P;  2YKQ A;  3PTZ A;  1LT9 B;  1FZA A;  1L4A C;  2G3A A;  2QIW A;  3AE6 C;  3L73 G;  1KQL A;  1EDI A;  5AVV B;  1NTK J;  3RGU A;  1Q7Y Q;  2O1K A;  1N2D C;  1NTK G;  1QVG O;  4GIF A;  5KJ7 D;  5APU A;  3RK3 D;  1KD1 Q;  4H13 B;  3H1I G;  2JJL A;  3FWL A;  5GTI E;  1L4A B;  3L73 D;  3B4S A;  5KAI E;  2M5A B;  2AEM A;  1HUC A;  2O01 J;  1RE4 A;  4LC1 A;  2H89 C;  2Q3I A;  5CBN A;  3AED C;  1VQK P;  1AJY A;  3AEB C;  2JR8 A;  4WY4 B;  4A7P A;  3L70 E;  2FYU E;  3L37 A;  3EFG A;  3A2A A;  2HG5 D;  3P8M C;  2LR2 A;  3CWB E;  3M0D A;  3TGU G;  2I1K A;  2OYI A;  1N7S C;  2C9L Y;  2C9N Y;  3TGU E;  2H8P D;  2ZYD A;  1NOH A;  4WVZ A;  1NU1 D;  1EXJ A;  1MZ9 A;  2WZ7 A;  1JCC A;  1LTJ A;  3CCU P;  2KSJ A;  1L4A D;  5AVY B;  1S1C X;  3CLQ A;  2FBW C;  1NAF A;  4PD4 H;  2LXB A;  3MUD A;  2AXT H;  1IFJ A;  1L0N K;  1X9V A;  1D7M A;  2E76 C;  2RKL A;  3M0D C;  3P8C D;  3QWO C;  3R2P A;  2KB7 P;  4K3A A;  1BCC E;  4RES B;  1GK4 A;  1LJ2 A;  1X22 A;  3TNU B;  3A0B H;  1KZU B;  3L74 G;  4GOE A;  4O9B A;  1N7S B;  2A06 D;  2E76 D;  2A45 H;  3F5H A;  3WUU A;  2NPS B;  4L73 A;  5AW4 B;  3Q1M A;  2ZXE B;  2A06 E;  4N78 E;  2BCC E;  2ZFC A;  1JY3 N;  3L74 D;  1A02 F;  1L4A A;  1OVU A;  1JY2 N;  1J1D B; 
#chains in the Genus database with same CATH homology
 1M8O B;  1S4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...