1S4XA

Nmr structure of the integrin b3 cytoplasmic domain in dpc micelles
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
KLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Membrane-mediated structural transitions at the cytoplasmic face during integrin activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin beta-3
total genus 10
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2004-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08725 Integrin_b_cyt Integrin beta cytoplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.630 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Integrin beta subunit, cytoplasmic domain 1s4xA00
1M8OB 1S4XA
chains in the Genus database with same CATH superfamily
1SQPJ 1D7MA 1EDJA 3C8VA 1L0LK 2I1KA 3WUUA 1JMBA 1G1JA 5GTHE 2E5YA 5B5EE 1SQVK 2WSEJ 1BCCE 2M0BA 3W67A 3CCJP 3CC7P 2FXOA 1EXJA 1M1JC 3JCUE 2W90A 1ZXGA 3CI9A 1L0LD 4PJ0E 4D6TG 3P7KA 1DH3A 2A45I 1KFMA 1X9VA 3GMAA 4I2LC 2RMZA 3L37A 2GM4A 2Z5HA 4NPFX 5KAFE 3RBZA 1R5SA 1YQ3C 2L5GB 5KLVG 3L70G 1PP9G 1PV3A 2HYNA 2QJPC 2ZXXA 3FXDA 3FWNA 2KS1A 3KXDA 3QH9A 1LWUB 3RK3D 2POHA 3CCRP 5E79H 3MD0A 2H7HA 1LTJB 1URQB 2Y0EA 2IBZI 3G3ZA 1ZR4A 1DX7A 1RE3A 1NU1G 3H1IE 2IZ1A 1PGOA 1PGPA 3U1CA 1J1EC 3NMDA 4HYTB 1QX8A 2XNDH 3M91A 1JY3P 1BGYE 2ZYGA 3L73D 2HR3A 4GIFA 2FYNC 3AE3C 1DEBA 3RK2C 1SQXJ 4JYCA 2Z5IA 5CBOA 1FOSF 1VQLP 3TYYA 1YIJP 3P8MC 1Y47A 1T8ZA 5APVA 2CPBA 3EQ2A 1FZEA 5AW4B 1MUUA 1NTZD 5CCGD 3KHUA 5KLVD 4DJGA 1LTJA 2Y9YA 2OYIC 1LP1B 1WMKA 1KB9H 3V6IA 2Q3IA 3MUDA 2IBZD 1PP9J 2J59M 4LGDE 2WT7B 1NOHA 3B4SA 5KKZC 1OW7A 4OH8B 1KFNA 3TNUB 1T3JA 3VOPA 1IFDA 3B5ND 1IFIA 3F89A 3KDPB 1IO4A 1J1DB 2OGUA 1ZP0C 1NKZB 3EFFK 4L76A 5CJ4A 3WU2E 1RY3A 2P10A 1LTAC 1KMIZ 1L4AB 3L73G 1GU5A 1PGJA 3O8ZA 3EFGA 3HD7C 3L74G 2JR8A 1T6AA 2PGDA 2QIWA 2XDJA 2ZJSE 3Q1MA 2KUBA 3NFQA 1BDCA 1KD1Q 4L74A 4R4LA 1RQUA 2A45G 2BCCD 3II6A 2KLVA 1HJ0A 1KILA 4UB8H 1QGKB 2N1TA 5CCHC 5CCHD 1NHLA 1NTKJ 2WVRA 1FZCB 2E42A 3H1LJ 1GDTA 1MV8A 1SQBD 3MP7B 4RKUJ 3V5BA 3WU2H 5B66H 1FDOA 2H88C 3R2PA 4WB4A 4YXWH 3RK2D 1IK7A 1OVUA 1PPJG 5AVXB 2K88A 3CWBE 3I5CA 1BGYG 1N86A 1PGQA 2KYVA 2WPQA 4IL6H 4WVZA 1FZCC 1ZR2A 1KB9D 3E7KA 2A45H 3CC2P 5AW0B 1KORA 2YO2A 3H1LG 2K9JB 3V2RA 1FJPA 2YXRB 1KN7A 2G3AA 2ZAEB 3M0AA 3MHVA 1L2PA 4WBAA 2KSEA 1FZCA 4K3AA 4JPZB 1IC2A 5AVVB 4BRYA 1LP1A 3LIDA 1QLED 3QWOC 4AUWA 3ITKA 1H0TB 1NTMJ 1P84I 5KKZB 1E5WA 3BASA 3AE9C 3AEGC 3IAOA 2PRRA 2YKPA 4NPEA 4ZKPA 3I56P 3TNUA 1IZNB 1QVFO 1RE3C 1SFCD 1KILC 1WT6A 4D6TE 2QEXP 1ZRTE 2WSSH 2BASA 2FYUD 3SWKA 1Q90D 1FZAA 1X0TA 4IOIH 2Y9ZA 2FYUE 1MZ9A 2RKLA 2XU6A 1BGYJ 1NH4A 1NAFA 5E79E 3RK3E 2K9YA 2H89C 1S9KD 3HD7A 1BE3D 1SQVE 2FYNB 3AE6C 3T97B 2FYUK 1EC5A 4BRYB 1GL2A 5CJ0A 1NTME 1JNMA 1OZHA 2E76D 3M9HA 5TISH 1EDLA 1H0TA 2QJYB 1LTIC 3B8EB 1KYOD 1GL2D 3H1HD 1PFIA 1M57D 3HE5B 1GK6A 4LLHA 1BE3J 3S9OA 1T2KD 1IFJA 1MFTA 2QJKB 2E76B 2O01H 3H1KE 4IL6E 1JB0J 4PJ0H 2I8DA 4Y28J 2Q7CA 1JCCA 1JY2P 3B71A 3ABVC 5B5EH 1N7SC 3MUDC 3TGUE 1VQKP 1SQVD 1P84H 1SQBK 2KXPB 2V7QJ 4MN4C 1OIPA 2HPCA 5AW2B 1LTJC 4H0LD 3H1HJ 1NTZG 3RK3B 1AVYA 4C7NA 1SQPK 1X79B 2AXTH 3IFMA 3IN6A 3FXEA 3E1IA 2HODB 2XKMA 3CWBD 2O3JA 3PP5A 4H13B 2JEEA 3OA7A 5H2FE 5KLVJ 1LGHB 3H1JJ 4DCKA 2H8PD 2K9JA 3AE7C 3WMM0 4RJTA 1SQXE 1U57A 1U7JA 2KZIA 4GOEA 3WUTA 1USDA 2QJKC 3A7OA 1KC8Q 1LTTC 2LKMA 2FFDA 4BXLA 2W6AA 2KP8A 3H1HG 3CX5H 2XZRA 3CXHD 1H8AA 4I7ZC 5AVSB 5AW8B 3USSA 3U59A 3AEDC 1M56D 1NTKG 1KILD 1SQXG 2IPPA 3L71D 2ZXEB 2JP3A 1QVGO 1H88A 1N73B 3D70A 2OYHA 4IFDK 1HUCA 3CX5I 4ZNCA 1OVRA 4C7NB 1BCCJ 3GG2A 5C39A 2PP6A 1N2DC 3Q5SA 2WITA 2KIKA 1G1IA 3L71J 1HWTC 1Y8AA 1KB9E 1VQOP 1IFPA 4H0LC 3LIEA 1JMMA 1XTCC 3O6QA 2IFNA 1N7LA 1K8AQ 3SWFA 3VN0A 3Q5PA 1KQSO 1IFNA 1N7SB 1MFZA 1OW6A 1L0NK 2D2CC 1BCCD 4TT3H 4D6TJ 3L72J 1VF5C 1HH0A 2MKVA 2YMKA 3CMEP 3V4WA 1K73Q 4LC1A 3A0HE 2IYOA 2NPSB 3L70J 1NTMG 1DIPA 3CL3D 1J2JB 3H32B 5APUA 3H1LD 2HLOA 2OYIB 1ZRTD 1JOCA 4XA4A 1YQ4C 1URQD 1DD4A 4WY4A 1SQVG 2YMYA 3BCCJ 2B89A 1M7LA 4N78E 1BSHA 1HGZA 4H13D 1TU3F 1URQA 3CWBJ 3H1KJ 4WY4D 3VMAA 4ASWA 1Q2NA 1JM0A 1PP9D 1LT1A 1SQQK 4GDOA 3RK2B 1RF1A 1N73C 1CI6A 3S1KA 2GA1A 1Q81Q 3TGUJ 2ZVOB 1EQ7A 4NPDA 3H1HE 2MJZA 5L8RJ 1SQQD 5DJUB 2ZVNB 1S5LH 5CCGC 4AYCA 3PRJA 1EDIA 1YBKA 3BCCG 1BE3G 2KZJA 2QRXA 5CMZA 1QEXA 4DT0A 1VDFA 2C9NY 4U3FG 5GTHH 1DEEG 1NTZE 1R5LA 1S2EA 2W8ZA 1NTZK 5TISE 4RESB 2E74B 3CLQA 1LWUC 3TGUG 1JY3O 1S72P 3U1AA 3D6ZA 3OW2O 4EIJA 3V2PA 1RE4A 2NZ2A 3AEFC 1M1KQ 2QG4A 1HVVA 2JJLA 2Q5UA 1FE6A 1PL5A 4QMAA 5AVWB 2WTYA 3O6QB 3KPEA 4DOJA 1JCDA 3BVHA 2FYUJ 1L4AD 3H1KG 1N7SD 3R4YA 4YXDC 3Q2YA 3L73J 3OJAB 2R32A 1KQLA 2QM8A 3A0BH 3L75D 1NKNA 5KJ7C 1SP4A 3JC22 1KQFB 3CCSP 1GZLA 2NPSA 1YJWP 1Q7YQ 2A06D 3HE4B 1NJIQ 1KTMA 1VF5D 2C0WA 2FYUG 3L75J 5AVQB 4ASVA 4BWNA 3CCEP 5AW9B 1EXIA 2E75B 5B66E 2XNXA 1JY3N 1SQPD 1DD3A 3GW6A 1SFCC 3JSVC 3VMYA 1XTGB 3L73E 1FC2C 3PH0A 2KNCB 5KLVK 2B9BA 2WZ7A 3B5NA 3L35A 3KQGA 1OX3A 2AEMA 3GHGC 1M8OB 1GTWA 2KLUA 2FYZA 1CI6B 3M9QA 4JBZA 2LR2A 3VP9A 4C46A 2JDIH 4RO0A 1SQBG 3VTPC 2AXTE 1EDKA 1NWQA 5KLIB 2HFED 3HE4A 4Y99B 5CBNA 3GF7A 2C0XA 2BEQD 3TSIA 4PD4D 4ZMDA 2KS1B 1M90Q 2LXBA 3H1LE 3K5BA 3MZWB 2M8RA 3HUSA 5K5GB 4PD4E 2CK3H 1LT9B 5APTA 1PPJE 1VPCA 3RGUA 1AV1A 1KYOI 1NU1D 2KNCA 2B87B 4KHXA 4Y99C 4JYBA 3AEEC 3H1ID 2O01N 4EI2A 2ZFCA 2O1KA 5TJHA 5BU8B 3TGUD 1GK4A 2R5BA 2P7JA 1LTGC 2WSEH 2N9YB 5AW5B 1JTHA 1GD2E 2HG5D 3MTUE 4EDFA 2NRGA 4GOFA 5KJ7D 1RF1C 1X8YA 1L0NJ 3SSUA 1URQC 2V7QH 2OQQA 3N7NA 3CPWO 1OFCX 2QM7A 1NAYA 1SQXD 3L74E 3M9BA 3P32A 3G6EP 1BE3E 2P2UA 2W27A 1VQ8P 1NU1K 4N78D 1GL2B 2BEZF 3Q3DA 5GTIE 1YITP 1FOSE 1JO5A 2Q9IA 3L70E 2FKWB 1J1DC 1E79H 3M0DC 3CCVP 1PZQA 3HE5A 3L74J 4N6JA 2PAJA 1RF0A 1YJNP 4GKGA 2KOGA 2P58A 3PLNA 4PV1C 2WT7A 2QJYC 1EZVD 2FBWC 1S3JA 2FXPA 1HTLC 1SVFA 3NXSA 3SFEC 4EYYQ 1EZVE 4ZKUA 2QA4P 3Q5RA 2N9BA 4R4MA 2OTKE 1NTMK 4PD4I 3GLMA 1BDDA 4HKZH 1LT9C 2GUSA 5KAFH 5AVUB 1YI2P 3AEAC 3AE5C 5AW7B 1L4AA 1QL1A 1P84E 2QSIA 5APXA 2BCCG 2IBZE 2J58A 2K1AA 4IFFA 3SWYA 1NGMB 2OTJP 2D2CD 1KV4A 2R5DA 3H6PA 4W7ZA 1S5LE 1GW4A 3H1KD 2E74C 1UIIA 4H13C 2WPVB 3MGNA 4HJGH 1L4AC 5AVTB 3V2NA 5CCGA 2OYHC 1FZFA 1VQ9P 3H25A 2FFDB 3HTKA 1LT9A 2N1TB 1VF5B 2ZT9C 3FWLA 3L75G 1NO4A 3CCLP 2XV5A 3A3YB 3I55P 5M1BA 2Q1KA 2B87A 1YHQP 3D6YA 5CHXA 2P67A 1JEKA 3TF5A 2BCCJ 2AXCA 1KILE 1N73A 3CC4P 1NU1E 3H1IG 1KB9I 3P8CD 4H44B 1T3UA 5APYA 1JTHB 1OW8A 2Q3EA 4U3FE 4H0LB 2ZT9B 4WY4C 3M0DA 1GU4A 1YTZI 4OVNF 3VMXA 1UIXA 3CCMP 2WSCJ 3BRTB 1VQ7P 1SQBJ 2WMMA 3SFDC 5KAIE 2YKOA 1AQ5A 3CXHH 4N3YB 3A0HH 1EZVI 2ITAA 1YTZT 1S1CX 2YIUC 4EOTA 2KSJA 4PV1D 1AA0A 4UB6E 1N7SA 3L74D 3PJSK 3CCUP 3M06A 2LXCB 2WSFH 3P8CE 1ZW0A 1YYCA 2A06E 1G2CB 2P1JA 2YXQB 3TDKA 3ZDMA 1CZQA 2KI7B 3FGAD 4PV1B 5AW6B 1AJYA 3IR9A 4U7JA 3L4FA 2YIUB 2WSCH 3CX5D 4HB1A 1NTZJ 1AQTA 4IFMA 4JQ0D 3W68A 3CD6P 1EZVG 2ZYAA 5APWA 1ZOYC 1Z56A 2JWDA 2IX7C 3RL0B 1AVOA 2Y0CA 4K35A 1L0NG 4WWIA 3HD7B 2IDBA 3HUSC 3PHLA 3VMZA 3CMAP 4W7YA 1FDIA 4AQRD 1T2KC 2WWWA 2QJPB 3H1JD 4I1LA 2OTLP 2E43A 1G2CA 3CX5E 3AE8C 2O1JA 5KAIH 2CPSA 1MKMA 1X22A 5BVZA 2FFDC 1L0LG 4UB8E 1SQPG 3A2AA 3RL0g 4D6TD 1A02F 1USEA 2W83C 3V4QA 2KK7A 1FAVA 2NPSD 5APQA 2I1JA 4M3LA 1RF0C 2RN0A 2ZYDA 2E74D 3B5NC 3KYQA 3LW5J 4YTPC 3RBXA 3TK1A 1VQ6P 4H44D 4OGQC 2HPCB 1FDMA 4I6MC 4C7RA 2QE7H 2J5UA 3C1LA 2YKQA 1SQQG 1VL2A 1HBWA 5AW3B 2V4HA 1S5LX 1L0LJ 4CPGA 1OVVA 1R8EA 1SQXK 1FU1A 4U3FD 3VYIA 3JCUH 2HODA 4I7ZB 3CXHI 4OGQB 1J1EB 2L91A 2FXMA 3AE2C 3L72G 1VQ5P 1Q82Q 1NU1J 3UIAA 1LJ2A 4XE5B 5AW1B 2WPSA 1KILB 2M3EA 1NTKD 3L71G 1HJBA 1W5CE 3HRNA 1KYOH 1SQQJ 3L71E 2JKVA 3A0BE 3BATA 3AE1C 1SQBE 5APSA 1GL2C 2IZ0A 1LTSC 1PIXA 2JWAA 2N1TC 3PTZA 1OMIA 5AVYB 5CCHA 5KTBA 1JY2O 3BCCD 2E75C 2IFMA 2Y0DA 2E75D 4GODA 2JO1A 3H1IJ 1IFMA 3FX0A 3L72E 2IYPA 3RL0C 1QL2A 2SPZA 1HGVA 1FZBA 2ZT9D 3A5TA 1IJDB 4GT1A 4W80A 3EWKA 1SQQE 1OWAA 4JF7A 1FS0E 3B5NB 2O01J 2E5TA 2M5AA 2G8YA 2R44A 3G4SP 2Q6QA 3H1JG 1K04A 1L0LE 3IF4A 3GHGA 1LTBC 5KLIC 3BRVB 2GUVA 3H1JE 4OWFA 1VQ4P 1NVOA 1K9MQ 2AEFA 4B86A 4DZOA 3AECC 1SFCA 2R3SA 1U7MA 2FY8A 1Q86Q 4TLFA 1KYOE 2PFXA 3E1RA 5BU5A 2D2CB 2M3BA 3CCQP 5AVRB 1VQMP 3H32A 2OYIA 1FBMA 3AE4C 3HUSB 2DW3A 4WY4B 4Z1MH 3OAKA 1ZMEC 2B88A 2NPSC 3F5HA 1HF9A 1S9KE 1L0NE 3G9RA 1H89A 3KZIH 2OARA 1BSNA 4U3FJ 3RL0D 3T97A 5KJ7A 1RF1B 3AEBC 2W6BA 1WRGA 3GHGB 1IK9A 3L36A 3VP8A 1SS1A 1ZLLA 1FZGA 2YNYA 1M1JB 1LNQA 1BGYD 1S4XA 2QVAA 1ZN5A 2N1TD 2VRSA 2A06G 2UWJE 3BCCE 3KZIE 4IL6X 4A7PA 3GF3A 3N4XA 1SQVJ 1A02J 1RE4C 1ZV8A 2WPRA 1FJKA 2K3RA 4YPCA 1NTKE 3G71P 3CWBG 1L0ND 1KQGB 2WQYC 1RQVA 4XFJA 1LWUA 5DJTB 1VQPP 1N8RQ 1NTKK 1YJ9P 1NTMD 5EFWB 4KJMA 5GTIH 1NYHA 4L75A 3V2QA 2C9LY 1GW3A 1RHZB 2RH0A 2W6JH 4L73A 4O9BA 3RK3C 3D71A 1M1JA 1SLQA 5AVZB 2R3CA 1K05A 2YO3A 2H43A 4UB6H 4H44C 4OGQD 3S4RA 4KT0J 1W2BO 1W2EA 1SQPE 2M5AB 3L75E 3CXHE 1PP9E 2E76C 2OYOA 1KZUB 5KLVE 1VQNP 1PPJD 2AEJA 2WSFJ 1RH5B 1CSBA 1P84D 3HD7D 3L70D 2OYHB 1SFCB 3NTNA 2BCCE 2IBZG 2KB7P 3WUVA 2Z4EA 3LW5H 3L72D 1AFOA 5H2FH 1CW5A 4PD4H 1GMJA 1BCCG 1JY2N 3MIWA 3HTKB 1JUNA 3C9IA 1Y9BA 2K37A 1OXZA 4HH2A
chains in the Genus database with same CATH topology
1M8OB 1S4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M8O B;  1S4X A; 
#chains in the Genus database with same CATH topology
 1SQP J;  1D7M A;  1EDJ A;  3C8V A;  1L0L K;  2I1K A;  3WUU A;  1JMB A;  1G1J A;  5GTH E;  2E5Y A;  5B5E E;  1SQV K;  2WSE J;  1BCC E;  2M0B A;  3W67 A;  3CCJ P;  3CC7 P;  2FXO A;  1EXJ A;  1M1J C;  3JCU E;  2W90 A;  1ZXG A;  3CI9 A;  1L0L D;  4PJ0 E;  4D6T G;  3P7K A;  1DH3 A;  2A45 I;  1KFM A;  1X9V A;  3GMA A;  4I2L C;  2RMZ A;  3L37 A;  2GM4 A;  2Z5H A;  4NPF X;  5KAF E;  3RBZ A;  1R5S A;  1YQ3 C;  2L5G B;  5KLV G;  3L70 G;  1PP9 G;  1PV3 A;  2HYN A;  2QJP C;  2ZXX A;  3FXD A;  3FWN A;  2KS1 A;  3KXD A;  3QH9 A;  1LWU B;  3RK3 D;  2POH A;  3CCR P;  5E79 H;  3MD0 A;  2H7H A;  1LTJ B;  1URQ B;  2Y0E A;  2IBZ I;  3G3Z A;  1ZR4 A;  1DX7 A;  1RE3 A;  1NU1 G;  3H1I E;  2IZ1 A;  1PGO A;  1PGP A;  3U1C A;  1J1E C;  3NMD A;  4HYT B;  1QX8 A;  2XND H;  3M91 A;  1JY3 P;  1BGY E;  2ZYG A;  3L73 D;  2HR3 A;  4GIF A;  2FYN C;  3AE3 C;  1DEB A;  3RK2 C;  1SQX J;  4JYC A;  2Z5I A;  5CBO A;  1FOS F;  1VQL P;  3TYY A;  1YIJ P;  3P8M C;  1Y47 A;  1T8Z A;  5APV A;  2CPB A;  3EQ2 A;  1FZE A;  5AW4 B;  1MUU A;  1NTZ D;  5CCG D;  3KHU A;  5KLV D;  4DJG A;  1LTJ A;  2Y9Y A;  2OYI C;  1LP1 B;  1WMK A;  1KB9 H;  3V6I A;  2Q3I A;  3MUD A;  2IBZ D;  1PP9 J;  2J59 M;  4LGD E;  2WT7 B;  1NOH A;  3B4S A;  5KKZ C;  1OW7 A;  4OH8 B;  1KFN A;  3TNU B;  1T3J A;  3VOP A;  1IFD A;  3B5N D;  1IFI A;  3F89 A;  3KDP B;  1IO4 A;  1J1D B;  2OGU A;  1ZP0 C;  1NKZ B;  3EFF K;  4L76 A;  5CJ4 A;  3WU2 E;  1RY3 A;  2P10 A;  1LTA C;  1KMI Z;  1L4A B;  3L73 G;  1GU5 A;  1PGJ A;  3O8Z A;  3EFG A;  3HD7 C;  3L74 G;  2JR8 A;  1T6A A;  2PGD A;  2QIW A;  2XDJ A;  2ZJS E;  3Q1M A;  2KUB A;  3NFQ A;  1BDC A;  1KD1 Q;  4L74 A;  4R4L A;  1RQU A;  2A45 G;  2BCC D;  3II6 A;  2KLV A;  1HJ0 A;  1KIL A;  4UB8 H;  1QGK B;  2N1T A;  5CCH C;  5CCH D;  1NHL A;  1NTK J;  2WVR A;  1FZC B;  2E42 A;  3H1L J;  1GDT A;  1MV8 A;  1SQB D;  3MP7 B;  4RKU J;  3V5B A;  3WU2 H;  5B66 H;  1FDO A;  2H88 C;  3R2P A;  4WB4 A;  4YXW H;  3RK2 D;  1IK7 A;  1OVU A;  1PPJ G;  5AVX B;  2K88 A;  3CWB E;  3I5C A;  1BGY G;  1N86 A;  1PGQ A;  2KYV A;  2WPQ A;  4IL6 H;  4WVZ A;  1FZC C;  1ZR2 A;  1KB9 D;  3E7K A;  2A45 H;  3CC2 P;  5AW0 B;  1KOR A;  2YO2 A;  3H1L G;  2K9J B;  3V2R A;  1FJP A;  2YXR B;  1KN7 A;  2G3A A;  2ZAE B;  3M0A A;  3MHV A;  1L2P A;  4WBA A;  2KSE A;  1FZC A;  4K3A A;  4JPZ B;  1IC2 A;  5AVV B;  4BRY A;  1LP1 A;  3LID A;  1QLE D;  3QWO C;  4AUW A;  3ITK A;  1H0T B;  1NTM J;  1P84 I;  5KKZ B;  1E5W A;  3BAS A;  3AE9 C;  3AEG C;  3IAO A;  2PRR A;  2YKP A;  4NPE A;  4ZKP A;  3I56 P;  3TNU A;  1IZN B;  1QVF O;  1RE3 C;  1SFC D;  1KIL C;  1WT6 A;  4D6T E;  2QEX P;  1ZRT E;  2WSS H;  2BAS A;  2FYU D;  3SWK A;  1Q90 D;  1FZA A;  1X0T A;  4IOI H;  2Y9Z A;  2FYU E;  1MZ9 A;  2RKL A;  2XU6 A;  1BGY J;  1NH4 A;  1NAF A;  5E79 E;  3RK3 E;  2K9Y A;  2H89 C;  1S9K D;  3HD7 A;  1BE3 D;  1SQV E;  2FYN B;  3AE6 C;  3T97 B;  2FYU K;  1EC5 A;  4BRY B;  1GL2 A;  5CJ0 A;  1NTM E;  1JNM A;  1OZH A;  2E76 D;  3M9H A;  5TIS H;  1EDL A;  1H0T A;  2QJY B;  1LTI C;  3B8E B;  1KYO D;  1GL2 D;  3H1H D;  1PFI A;  1M57 D;  3HE5 B;  1GK6 A;  4LLH A;  1BE3 J;  3S9O A;  1T2K D;  1IFJ A;  1MFT A;  2QJK B;  2E76 B;  2O01 H;  3H1K E;  4IL6 E;  1JB0 J;  4PJ0 H;  2I8D A;  4Y28 J;  2Q7C A;  1JCC A;  1JY2 P;  3B71 A;  3ABV C;  5B5E H;  1N7S C;  3MUD C;  3TGU E;  1VQK P;  1SQV D;  1P84 H;  1SQB K;  2KXP B;  2V7Q J;  4MN4 C;  1OIP A;  2HPC A;  5AW2 B;  1LTJ C;  4H0L D;  3H1H J;  1NTZ G;  3RK3 B;  1AVY A;  4C7N A;  1SQP K;  1X79 B;  2AXT H;  3IFM A;  3IN6 A;  3FXE A;  3E1I A;  2HOD B;  2XKM A;  3CWB D;  2O3J A;  3PP5 A;  4H13 B;  2JEE A;  3OA7 A;  5H2F E;  5KLV J;  1LGH B;  3H1J J;  4DCK A;  2H8P D;  2K9J A;  3AE7 C;  3WMM 0;  4RJT A;  1SQX E;  1U57 A;  1U7J A;  2KZI A;  4GOE A;  3WUT A;  1USD A;  2QJK C;  3A7O A;  1KC8 Q;  1LTT C;  2LKM A;  2FFD A;  4BXL A;  2W6A A;  2KP8 A;  3H1H G;  3CX5 H;  2XZR A;  3CXH D;  1H8A A;  4I7Z C;  5AVS B;  5AW8 B;  3USS A;  3U59 A;  3AED C;  1M56 D;  1NTK G;  1KIL D;  1SQX G;  2IPP A;  3L71 D;  2ZXE B;  2JP3 A;  1QVG O;  1H88 A;  1N73 B;  3D70 A;  2OYH A;  4IFD K;  1HUC A;  3CX5 I;  4ZNC A;  1OVR A;  4C7N B;  1BCC J;  3GG2 A;  5C39 A;  2PP6 A;  1N2D C;  3Q5S A;  2WIT A;  2KIK A;  1G1I A;  3L71 J;  1HWT C;  1Y8A A;  1KB9 E;  1VQO P;  1IFP A;  4H0L C;  3LIE A;  1JMM A;  1XTC C;  3O6Q A;  2IFN A;  1N7L A;  1K8A Q;  3SWF A;  3VN0 A;  3Q5P A;  1KQS O;  1IFN A;  1N7S B;  1MFZ A;  1OW6 A;  1L0N K;  2D2C C;  1BCC D;  4TT3 H;  4D6T J;  3L72 J;  1VF5 C;  1HH0 A;  2MKV A;  2YMK A;  3CME P;  3V4W A;  1K73 Q;  4LC1 A;  3A0H E;  2IYO A;  2NPS B;  3L70 J;  1NTM G;  1DIP A;  3CL3 D;  1J2J B;  3H32 B;  5APU A;  3H1L D;  2HLO A;  2OYI B;  1ZRT D;  1JOC A;  4XA4 A;  1YQ4 C;  1URQ D;  1DD4 A;  4WY4 A;  1SQV G;  2YMY A;  3BCC J;  2B89 A;  1M7L A;  4N78 E;  1BSH A;  1HGZ A;  4H13 D;  1TU3 F;  1URQ A;  3CWB J;  3H1K J;  4WY4 D;  3VMA A;  4ASW A;  1Q2N A;  1JM0 A;  1PP9 D;  1LT1 A;  1SQQ K;  4GDO A;  3RK2 B;  1RF1 A;  1N73 C;  1CI6 A;  3S1K A;  2GA1 A;  1Q81 Q;  3TGU J;  2ZVO B;  1EQ7 A;  4NPD A;  3H1H E;  2MJZ A;  5L8R J;  1SQQ D;  5DJU B;  2ZVN B;  1S5L H;  5CCG C;  4AYC A;  3PRJ A;  1EDI A;  1YBK A;  3BCC G;  1BE3 G;  2KZJ A;  2QRX A;  5CMZ A;  1QEX A;  4DT0 A;  1VDF A;  2C9N Y;  4U3F G;  5GTH H;  1DEE G;  1NTZ E;  1R5L A;  1S2E A;  2W8Z A;  1NTZ K;  5TIS E;  4RES B;  2E74 B;  3CLQ A;  1LWU C;  3TGU G;  1JY3 O;  1S72 P;  3U1A A;  3D6Z A;  3OW2 O;  4EIJ A;  3V2P A;  1RE4 A;  2NZ2 A;  3AEF C;  1M1K Q;  2QG4 A;  1HVV A;  2JJL A;  2Q5U A;  1FE6 A;  1PL5 A;  4QMA A;  5AVW B;  2WTY A;  3O6Q B;  3KPE A;  4DOJ A;  1JCD A;  3BVH A;  2FYU J;  1L4A D;  3H1K G;  1N7S D;  3R4Y A;  4YXD C;  3Q2Y A;  3L73 J;  3OJA B;  2R32 A;  1KQL A;  2QM8 A;  3A0B H;  3L75 D;  1NKN A;  5KJ7 C;  1SP4 A;  3JC2 2;  1KQF B;  3CCS P;  1GZL A;  2NPS A;  1YJW P;  1Q7Y Q;  2A06 D;  3HE4 B;  1NJI Q;  1KTM A;  1VF5 D;  2C0W A;  2FYU G;  3L75 J;  5AVQ B;  4ASV A;  4BWN A;  3CCE P;  5AW9 B;  1EXI A;  2E75 B;  5B66 E;  2XNX A;  1JY3 N;  1SQP D;  1DD3 A;  3GW6 A;  1SFC C;  3JSV C;  3VMY A;  1XTG B;  3L73 E;  1FC2 C;  3PH0 A;  2KNC B;  5KLV K;  2B9B A;  2WZ7 A;  3B5N A;  3L35 A;  3KQG A;  1OX3 A;  2AEM A;  3GHG C;  1M8O B;  1GTW A;  2KLU A;  2FYZ A;  1CI6 B;  3M9Q A;  4JBZ A;  2LR2 A;  3VP9 A;  4C46 A;  2JDI H;  4RO0 A;  1SQB G;  3VTP C;  2AXT E;  1EDK A;  1NWQ A;  5KLI B;  2HFE D;  3HE4 A;  4Y99 B;  5CBN A;  3GF7 A;  2C0X A;  2BEQ D;  3TSI A;  4PD4 D;  4ZMD A;  2KS1 B;  1M90 Q;  2LXB A;  3H1L E;  3K5B A;  3MZW B;  2M8R A;  3HUS A;  5K5G B;  4PD4 E;  2CK3 H;  1LT9 B;  5APT A;  1PPJ E;  1VPC A;  3RGU A;  1AV1 A;  1KYO I;  1NU1 D;  2KNC A;  2B87 B;  4KHX A;  4Y99 C;  4JYB A;  3AEE C;  3H1I D;  2O01 N;  4EI2 A;  2ZFC A;  2O1K A;  5TJH A;  5BU8 B;  3TGU D;  1GK4 A;  2R5B A;  2P7J A;  1LTG C;  2WSE H;  2N9Y B;  5AW5 B;  1JTH A;  1GD2 E;  2HG5 D;  3MTU E;  4EDF A;  2NRG A;  4GOF A;  5KJ7 D;  1RF1 C;  1X8Y A;  1L0N J;  3SSU A;  1URQ C;  2V7Q H;  2OQQ A;  3N7N A;  3CPW O;  1OFC X;  2QM7 A;  1NAY A;  1SQX D;  3L74 E;  3M9B A;  3P32 A;  3G6E P;  1BE3 E;  2P2U A;  2W27 A;  1VQ8 P;  1NU1 K;  4N78 D;  1GL2 B;  2BEZ F;  3Q3D A;  5GTI E;  1YIT P;  1FOS E;  1JO5 A;  2Q9I A;  3L70 E;  2FKW B;  1J1D C;  1E79 H;  3M0D C;  3CCV P;  1PZQ A;  3HE5 A;  3L74 J;  4N6J A;  2PAJ A;  1RF0 A;  1YJN P;  4GKG A;  2KOG A;  2P58 A;  3PLN A;  4PV1 C;  2WT7 A;  2QJY C;  1EZV D;  2FBW C;  1S3J A;  2FXP A;  1HTL C;  1SVF A;  3NXS A;  3SFE C;  4EYY Q;  1EZV E;  4ZKU A;  2QA4 P;  3Q5R A;  2N9B A;  4R4M A;  2OTK E;  1NTM K;  4PD4 I;  3GLM A;  1BDD A;  4HKZ H;  1LT9 C;  2GUS A;  5KAF H;  5AVU B;  1YI2 P;  3AEA C;  3AE5 C;  5AW7 B;  1L4A A;  1QL1 A;  1P84 E;  2QSI A;  5APX A;  2BCC G;  2IBZ E;  2J58 A;  2K1A A;  4IFF A;  3SWY A;  1NGM B;  2OTJ P;  2D2C D;  1KV4 A;  2R5D A;  3H6P A;  4W7Z A;  1S5L E;  1GW4 A;  3H1K D;  2E74 C;  1UII A;  4H13 C;  2WPV B;  3MGN A;  4HJG H;  1L4A C;  5AVT B;  3V2N A;  5CCG A;  2OYH C;  1FZF A;  1VQ9 P;  3H25 A;  2FFD B;  3HTK A;  1LT9 A;  2N1T B;  1VF5 B;  2ZT9 C;  3FWL A;  3L75 G;  1NO4 A;  3CCL P;  2XV5 A;  3A3Y B;  3I55 P;  5M1B A;  2Q1K A;  2B87 A;  1YHQ P;  3D6Y A;  5CHX A;  2P67 A;  1JEK A;  3TF5 A;  2BCC J;  2AXC A;  1KIL E;  1N73 A;  3CC4 P;  1NU1 E;  3H1I G;  1KB9 I;  3P8C D;  4H44 B;  1T3U A;  5APY A;  1JTH B;  1OW8 A;  2Q3E A;  4U3F E;  4H0L B;  2ZT9 B;  4WY4 C;  3M0D A;  1GU4 A;  1YTZ I;  4OVN F;  3VMX A;  1UIX A;  3CCM P;  2WSC J;  3BRT B;  1VQ7 P;  1SQB J;  2WMM A;  3SFD C;  5KAI E;  2YKO A;  1AQ5 A;  3CXH H;  4N3Y B;  3A0H H;  1EZV I;  2ITA A;  1YTZ T;  1S1C X;  2YIU C;  4EOT A;  2KSJ A;  4PV1 D;  1AA0 A;  4UB6 E;  1N7S A;  3L74 D;  3PJS K;  3CCU P;  3M06 A;  2LXC B;  2WSF H;  3P8C E;  1ZW0 A;  1YYC A;  2A06 E;  1G2C B;  2P1J A;  2YXQ B;  3TDK A;  3ZDM A;  1CZQ A;  2KI7 B;  3FGA D;  4PV1 B;  5AW6 B;  1AJY A;  3IR9 A;  4U7J A;  3L4F A;  2YIU B;  2WSC H;  3CX5 D;  4HB1 A;  1NTZ J;  1AQT A;  4IFM A;  4JQ0 D;  3W68 A;  3CD6 P;  1EZV G;  2ZYA A;  5APW A;  1ZOY C;  1Z56 A;  2JWD A;  2IX7 C;  3RL0 B;  1AVO A;  2Y0C A;  4K35 A;  1L0N G;  4WWI A;  3HD7 B;  2IDB A;  3HUS C;  3PHL A;  3VMZ A;  3CMA P;  4W7Y A;  1FDI A;  4AQR D;  1T2K C;  2WWW A;  2QJP B;  3H1J D;  4I1L A;  2OTL P;  2E43 A;  1G2C A;  3CX5 E;  3AE8 C;  2O1J A;  5KAI H;  2CPS A;  1MKM A;  1X22 A;  5BVZ A;  2FFD C;  1L0L G;  4UB8 E;  1SQP G;  3A2A A;  3RL0 g;  4D6T D;  1A02 F;  1USE A;  2W83 C;  3V4Q A;  2KK7 A;  1FAV A;  2NPS D;  5APQ A;  2I1J A;  4M3L A;  1RF0 C;  2RN0 A;  2ZYD A;  2E74 D;  3B5N C;  3KYQ A;  3LW5 J;  4YTP C;  3RBX A;  3TK1 A;  1VQ6 P;  4H44 D;  4OGQ C;  2HPC B;  1FDM A;  4I6M C;  4C7R A;  2QE7 H;  2J5U A;  3C1L A;  2YKQ A;  1SQQ G;  1VL2 A;  1HBW A;  5AW3 B;  2V4H A;  1S5L X;  1L0L J;  4CPG A;  1OVV A;  1R8E A;  1SQX K;  1FU1 A;  4U3F D;  3VYI A;  3JCU H;  2HOD A;  4I7Z B;  3CXH I;  4OGQ B;  1J1E B;  2L91 A;  2FXM A;  3AE2 C;  3L72 G;  1VQ5 P;  1Q82 Q;  1NU1 J;  3UIA A;  1LJ2 A;  4XE5 B;  5AW1 B;  2WPS A;  1KIL B;  2M3E A;  1NTK D;  3L71 G;  1HJB A;  1W5C E;  3HRN A;  1KYO H;  1SQQ J;  3L71 E;  2JKV A;  3A0B E;  3BAT A;  3AE1 C;  1SQB E;  5APS A;  1GL2 C;  2IZ0 A;  1LTS C;  1PIX A;  2JWA A;  2N1T C;  3PTZ A;  1OMI A;  5AVY B;  5CCH A;  5KTB A;  1JY2 O;  3BCC D;  2E75 C;  2IFM A;  2Y0D A;  2E75 D;  4GOD A;  2JO1 A;  3H1I J;  1IFM A;  3FX0 A;  3L72 E;  2IYP A;  3RL0 C;  1QL2 A;  2SPZ A;  1HGV A;  1FZB A;  2ZT9 D;  3A5T A;  1IJD B;  4GT1 A;  4W80 A;  3EWK A;  1SQQ E;  1OWA A;  4JF7 A;  1FS0 E;  3B5N B;  2O01 J;  2E5T A;  2M5A A;  2G8Y A;  2R44 A;  3G4S P;  2Q6Q A;  3H1J G;  1K04 A;  1L0L E;  3IF4 A;  3GHG A;  1LTB C;  5KLI C;  3BRV B;  2GUV A;  3H1J E;  4OWF A;  1VQ4 P;  1NVO A;  1K9M Q;  2AEF A;  4B86 A;  4DZO A;  3AEC C;  1SFC A;  2R3S A;  1U7M A;  2FY8 A;  1Q86 Q;  4TLF A;  1KYO E;  2PFX A;  3E1R A;  5BU5 A;  2D2C B;  2M3B A;  3CCQ P;  5AVR B;  1VQM P;  3H32 A;  2OYI A;  1FBM A;  3AE4 C;  3HUS B;  2DW3 A;  4WY4 B;  4Z1M H;  3OAK A;  1ZME C;  2B88 A;  2NPS C;  3F5H A;  1HF9 A;  1S9K E;  1L0N E;  3G9R A;  1H89 A;  3KZI H;  2OAR A;  1BSN A;  4U3F J;  3RL0 D;  3T97 A;  5KJ7 A;  1RF1 B;  3AEB C;  2W6B A;  1WRG A;  3GHG B;  1IK9 A;  3L36 A;  3VP8 A;  1SS1 A;  1ZLL A;  1FZG A;  2YNY A;  1M1J B;  1LNQ A;  1BGY D;  1S4X A;  2QVA A;  1ZN5 A;  2N1T D;  2VRS A;  2A06 G;  2UWJ E;  3BCC E;  3KZI E;  4IL6 X;  4A7P A;  3GF3 A;  3N4X A;  1SQV J;  1A02 J;  1RE4 C;  1ZV8 A;  2WPR A;  1FJK A;  2K3R A;  4YPC A;  1NTK E;  3G71 P;  3CWB G;  1L0N D;  1KQG B;  2WQY C;  1RQV A;  4XFJ A;  1LWU A;  5DJT B;  1VQP P;  1N8R Q;  1NTK K;  1YJ9 P;  1NTM D;  5EFW B;  4KJM A;  5GTI H;  1NYH A;  4L75 A;  3V2Q A;  2C9L Y;  1GW3 A;  1RHZ B;  2RH0 A;  2W6J H;  4L73 A;  4O9B A;  3RK3 C;  3D71 A;  1M1J A;  1SLQ A;  5AVZ B;  2R3C A;  1K05 A;  2YO3 A;  2H43 A;  4UB6 H;  4H44 C;  4OGQ D;  3S4R A;  4KT0 J;  1W2B O;  1W2E A;  1SQP E;  2M5A B;  3L75 E;  3CXH E;  1PP9 E;  2E76 C;  2OYO A;  1KZU B;  5KLV E;  1VQN P;  1PPJ D;  2AEJ A;  2WSF J;  1RH5 B;  1CSB A;  1P84 D;  3HD7 D;  3L70 D;  2OYH B;  1SFC B;  3NTN A;  2BCC E;  2IBZ G;  2KB7 P;  3WUV A;  2Z4E A;  3LW5 H;  3L72 D;  1AFO A;  5H2F H;  1CW5 A;  4PD4 H;  1GMJ A;  1BCC G;  1JY2 N;  3MIW A;  3HTK B;  1JUN A;  3C9I A;  1Y9B A;  2K37 A;  1OXZ A;  4HH2 A; 
#chains in the Genus database with same CATH homology
 1M8O B;  1S4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...