1CI6B

Transcription factor atf4-c/ebp beta bzip heterodimer
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
47
structure length
47
Chain Sequence
SRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTION FACTOR ATF-4
publication title Crystal structure of the CCAAT box/enhancer-binding protein beta activating transcription factor-4 basic leucine zipper heterodimer in the absence of DNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 21
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 1999-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ci6B00
5APSA 2IPPA 1G2CB 5APUA 3VTPC 3VMXA 1H89A 2P7JA 5AVWB 3HE5A 5AW9B 5AVYB 2C9LY 1CZQA 1S9KE 3HE4B 3NTNA 1SLQA 3P8MC 2R5BA 4EOTA 5APVA 2R5DA 3IR9A 1MUUA 1DH3A 4LC1A 1S9KD 3HE4A 3A3YB 5AVSB 4I6MC 2Q7CA 5AW8B 2WTYA 3SWFA 5AW6B 3L35A 4AUWA 3LIDA 3M06A 2N9BA 2QM8A 3P32A 5AW5B 1JNMA 3L37A 3T97A 3A2AA 4I2LC 5AW7B 3A7OA 2ZXEB 2P67A 4JYBA 4DZOA 2Q5UA 3V4WA 3TYYA 3KQGA 1NWQA 2E43A 1OWAA 4RESB 5APXA 1CSBA 2WT7B 2QM7A 1CI6B 2Z5HA 5AVZB 4B86A 3VYIA 3TNUB 3VMZA 2ZFCA 3MGNA 1KQLA 5APWA 4AQRD 1T2KD 2WT7A 1IO4A 2R32A 3M9HA 4M3LA 3NFQA 2XV5A 3I5CA 4JYCA 2R3CA 4HYTB 2WPSA 1A02F 1HWTC 3M91A 5APQA 3M0AA 5AVQB 1FOSE 4GT1A 2C9NY 3P7KA 5AVRB 5APYA 1A02J 1OXZA 1FOSF 3V4QA 1MFZA 1NAFA 1H88A 1SP4A 3O8ZA 3VMYA 2JJLA 3OAKA 1FAVA 1HUCA 3A5TA 2W6AA 1GU5A 5APTA 1X8YA 4XE5B 1GD2E 1H8AA 1JUNA 2H7HA 5AVXB 4C46A 2Q3IA 3MD0A 4C7NB 2BASA 3V5BA 2YO2A 1CI6A 3UIAA 1GZLA 1HBWA 2Z5IA 5AW3B 1GK6A 5AW1B 3HE5B 2VRSA 3TNUA 1T2KC 3KDPB 4C7NA 2WPQA 2YO3A 4KHXA 4GKGA 2WPRA 3LIEA 2WWWA 4AYCA 2YNYA 5AVVB 5AW0B 3B8EB 1GK4A 5AW4B 1MV8A 2KP8A 2P2UA 2XZRA 5AW2B 1J2JB 2W27A 1HJBA 3L36A 3VN0A 3M0DA 5AVUB 2E42A 1GU4A 2XU6A 5AVTB 1GTWA 5CMZA 1YYCA 3NMDA 3HTKA 3M9BA 3TK1A 3NXSA
chains in the Genus database with same CATH superfamily
5APSA 2FYNC 1RF0A 1SQXD 5KLVD 1USEA 1SQQE 1RHZB 2HPCB 1LTSC 2R5BA 3KPEA 2K9JA 1VQ9P 1L0NK 3VMAA 1DH3A 1K9MQ 3LW5J 4GODA 1R8EA 1NU1K 2NPSC 3L35A 5AW5B 1HGVA 2O01H 3JCUE 1M1JC 1PPJD 4GIFA 3CXHH 3ABVC 2KLUA 1LTTC 1KYOD 2Y9ZA 2WT7A 1PZQA 3RL0C 1OMIA 1SQQJ 1OXZA 3CWBE 3WU2E 3H1JG 1GMJA 3VP8A 5CBNA 1G1IA 1OVUA 4XE5B 1GD2E 1H8AA 3H1HG 3IAOA 1VQ4P 2H88C 2PP6A 2N1TC 5AW3B 1GK6A 1NAYA 1NH4A 1VL2A 1X9VA 4H44D 2IBZE 1MV8A 2E5YA 3L74J 3CCEP 1AQ5A 1EZVG 1VQLP 1OZHA 2QRXA 4H44B 4WWIA 1LGHB 1S5LH 2FYUG 1SQXE 3HTKA 5KLVE 1JM0A 2K9YA 5L8RJ 4H0LC 4HH2A 3CCVP 2CK3H 1NTZE 3B5NC 2M8RA 3O6QA 3HE4A 3RK2D 1PPJE 2K3RA 2AXTE 1JY2O 3T97A 3AE7C 2Y0CA 2ZXEB 3RK2B 1NWQA 3H1JD 1SFCC 4RESB 1SQXJ 4BWNA 5KLVJ 3FX0A 2Y0EA 5KAFE 3H1IG 3Q5PA 3H1HD 4M3LA 3RK3D 1YQ4C 3VOPA 2A06G 2KZIA 1LTIC 1SQVK 1NTZJ 1SFCA 1FJPA 2A45I 3V4QA 3PH0A 1OFCX 4A7PA 3RK3B 5TISH 3U1CA 1KILC 1L4AA 1NTMJ 1KB9H 2B87A 2Q3IA 1YHQP 2OYOA 2WSEH 4PJ0E 1EZVD 1LTJA 3WU2H 5CCHD 1KILA 4HJGH 2FYUD 4Y99B 3BVHA 5BU8B 2KK7A 3IN6A 1GTWA 1W2BO 2WZ7A 1R5LA 2P7JA 5AVWB 1AJYA 4W80A 4ZKUA 4U3FE 2YIUB 3KZIE 1QVFO 1ZP0C 1VQMP 2D2CD 5AW6B 3H1ID 3L37A 2A06D 3H1JE 2ZVNB 3CX5I 3TGUE 3V4WA 3AEEC 1URQC 2D2CB 2Q3EA 2QM7A 3H1HE 2YKQA 3RK3E 4JYCA 1KYOH 2R3CA 4HYTB 2QSIA 2V4HA 3M91A 4U3FJ 1ZLLA 2MJZA 1JY3N 4HKZH 5KJ7D 1FAVA 3JSVC 1U57A 1EZVE 2IX7C 3H1JJ 2ZVOB 1YJ9P 2WSCJ 3TGUJ 3CCUP 1BDDA 2AEJA 4IFFA 4H13C 2FYUE 1BGYG 1YI2P 4N78D 3H1HJ 3V6IA 2OTLP 3D6YA 1JCCA 1KTMA 5AW0B 4N3YB 3C9IA 1Q7YQ 1IFDA 4PJ0H 1SQVG 1GU4A 1N7SC 4CPGA 1YYCA 1NHLA 2IDBA 2OYHA 1P84D 1ZV8A 1BCCJ 3RK3C 2N9YB 2QEXP 1WT6A 1RH5B 3L73G 5AVYB 2FYUJ 1KFNA 2PAJA 1GL2C 3H1IE 4PD4D 4LC1A 2A06E 3CC4P 2P10A 3SWYA 5DJTB 1L0NE 4WY4B 3SSUA 2ZYDA 3GW6A 2Q5UA 3KZIH 2GA1A 4ASWA 2A45G 1M8OB 1FDOA 2JWDA 3WUVA 1H0TB 3U59A 2Y9YA 1BGYD 2MKVA 3H1IJ 2XNXA 1FE6A 2NZ2A 2LKMA 3G71P 2IFMA 5GTIE 5TJHA 1EXIA 2W6AA 1L0NJ 3B71A 4N78E 1QL2A 1AA0A 1CI6A 2ZT9C 1SQVD 1PGPA 1NGMB 1NU1J 2KS1A 2L5GB 2VRSA 3TNUA 3IFMA 3MUDC 1M90Q 2K9JB 3EFFK 1OVRA 3ITKA 1L2PA 2WWWA 2K88A 5B5EH 1IFJA 3S1KA 5H2FE 1YITP 3U1AA 2FYNB 3L73D 1YBKA 2NPSD 3S9OA 2PFXA 1KMIZ 1P84E 5CMZA 3CCMP 1LTBC 2NPSB 5APUA 3A0HH 2H8PD 3L74G 1SQBK 3VTPC 2JR8A 1X79B 3HE5A 1M1JB 4LLHA 1NTKG 1TU3F 3RL0D 1LT9A 2E74D 1RQUA 2W6JH 3CPWO 5KJ7C 2RH0A 4DCKA 4AUWA 1IZNB 1K05A 2I8DA 3C1LA 2ZXXA 3RL0B 1S72P 2E74B 4O9BA 3CLQA 1EDLA 2M3EA 4UB8H 1OWAA 1DD4A 2HG5D 2OTJP 4QMAA 2KOGA 2N1TD 1UIXA 3Q5SA 3CC7P 1BGYE 3PRJA 1FOSE 1L0LK 1Z56A 2FYZA 1R5SA 2QJYB 4JBZA 1EXJA 1SQVE 3HTKB 3HRNA 1NTZG 3MD0A 3RBXA 1X0TA 4EI2A 2Z4EA 3Q3DA 4WY4C 4H0LD 1T2KC 1VQ5P 3E7KA 4GKGA 5GTIH 1FDMA 3L73E 2ZYAA 2PRRA 2YNYA 3L74D 3B5ND 3O6QB 1NTMG 3B8EB 2WQYC 3A0BH 1JO5A 4BXLA 2XZRA 4H0LB 5AW2B 3OJAB 2W27A 1NTKD 1EDKA 3T97B 3M0DA 2KXPB 3CX5D 4IL6X 5AVTB 3B5NB 2I1KA 3A5TA 1SQVJ 1SFCD 2H43A 3HD7A 1G2CA 1RF1A 3OW2O 2ZAEB 1P84H 1SFCB 3H32B 1NVOA 2RKLA 3P32A 2ITAA 1YJWP 3PLNA 4PD4H 4L75A 1KILD 4DZOA 2NRGA 1NJIQ 2JEEA 1QEXA 3AE3C 1IO4A 1KILB 2WSFH 3NFQA 4K3AA 1NTZD 3D71A 3EQ2A 1HWTC 3L72E 1HH0A 3GHGA 4YPCA 1NTMD 3JC22 1IC2A 5C39A 1EQ7A 3WMM0 1W5CE 4U3FG 3GF7A 2E74C 2Z5IA 1IJDB 3L74E 1ZXGA 2YO3A 2XDJA 1FZFA 3E1IA 1N2DC 3LIEA 1SQPK 1NTKE 5CJ4A 3BASA 3TGUG 2CPSA 3Q1MA 3CX5E 3V2QA 3HUSA 1EC5A 3L72J 3R2PA 2QIWA 2JWAA 3V2NA 4RJTA 2V7QH 3NMDA 3PTZA 2J58A 1GU5A 3CMEP 1URQD 1ZRTD 2QJYC 1H89A 2YKPA 1IFNA 1KQFB 3M9QA 3MHVA 1CZQA 3AEGC 1JTHA 1URQB 2HYNA 4EYYQ 1KORA 4W7YA 3AEDC 5AW8B 1NTKJ 3SWFA 1BCCG 1KILE 3LW5H 3CXHI 2FKWB 3W67A 1U7JA 1LTAC 4IFDK 2WMMA 1U7MA 2BCCG 2E76B 1JY2N 4H13D 1M1KQ 1S4XA 4W7ZA 2CPBA 5GTHH 4U3FD 2XV5A 2JKVA 1KC8Q 4H13B 1NTME 1H88A 2JP3A 1RE3A 1N7SD 3TGUD 2K1AA 1JUNA 5AVXB 1PGQA 4C7NB 1VQ7P 3UIAA 1HBWA 3JCUH 2E5TA 1N7SB 1N86A 4RKUJ 1L4AC 4WVZA 1GL2D 1L0NG 1IFIA 1LTJC 2KP8A 5CCGA 1NU1G 1PFIA 2WSSH 2WVRA 2KNCA 3II6A 4YXDC 1MKMA 1GL2B 1NOHA 1ZRTE 2HODB 1BCCD 3EWKA 5AW9B 5APVA 2BCCD 4IL6E 2AEFA 1PGOA 1PL5A 2IZ0A 2QA4P 1SQPG 3CCLP 4OVNF 4MN4C 1IFPA 3GF3A 1M56D 1CI6B 1WRGA 2ZT9D 1HGZA 3USSA 2KS1B 3TNUB 1BE3J 4AQRD 1AFOA 1FU1A 4GT1A 5APYA 2ZT9B 1VQ6P 1Y9BA 1LWUA 1SQBJ 1BSHA 2P58A 5KTBA 1DEEG 1L0ND 1KB9I 1WMKA 4L76A 4OH8B 1IK9A 2IFNA 2AXTH 1NU1D 4OWFA 1Q82Q 1GZLA 3QWOC 3HE5B 2WPQA 2E76C 4AYCA 4PV1C 2B9BA 4RO0A 3V2PA 4D6TE 5KAFH 2LR2A 3BRVB 1BCCE 1OVVA 2QVAA 4L73A 2IBZI 4OGQC 3AE6C 1SQPD 1L0LJ 2BCCE 1Y8AA 2OYHC 5E79E 3IR9A 3L70J 2QJPC 3AE8C 4DOJA 3LIDA 2OQQA 4D6TJ 4JPZB 4I7ZB 3H1KJ 3GMAA 1Q86Q 5KAIE 3AEFC 1VF5C 2FXMA 2FY8A 4WY4D 3WUTA 5APWA 1T2KD 1KYOI 3KHUA 3PJSK 2BCCJ 2KYVA 3AE1C 1JMMA 2YXQB 5APQA 3EFGA 3FXEA 3L71G 1LJ2A 3BATA 3V2RA 1IK7A 2JJLA 1NU1E 2W8ZA 1Q90D 3S4RA 3KYQA 5EFWB 1AQTA 5B66E 3SFEC 1ZW0A 2WSCH 4UB6E 3AE4C 5AVVB 2FFDA 1ZR2A 2IZ1A 3CXHD 1N7LA 1FZAA 2B88A 2FXOA 1SQPE 3P8CD 4EIJA 5CCHA 3N7NA 2XNDH 3CD6P 1T3JA 2YXRB 4L74A 1OW8A 3L72G 5CJ0A 2M5AA 1JY3P 2K37A 2QG4A 1NO4A 1FC2C 1USDA 1LT9C 2OGUA 3L71D 1SQPJ 3MTUE 4IFMA 2WT7B 1CSBA 1JEKA 1FZCA 1ZMEC 2R32A 1FZEA 2YMKA 4IOIH 3Q2YA 4K35A 2XKMA 3CCJP 4NPDA 3SWKA 4ZMDA 1KZUB 1VQPP 4U7JA 2YO2A 2KZJA 4I7ZC 1DIPA 3I55P 4KHXA 1JTHB 1VQKP 3CXHE 5AW4B 3L72D 1AV1A 1VQNP 3P8CE 5B66H 1J1EC 1S3JA 3RBZA 3MIWA 1MFTA 3M0DC 3AECC 2ZJSE 3HE4B 1BDCA 3MZWB 2R5DA 1N73A 1K8AQ 2I1JA 3A3YB 2O01J 3HD7C 3SFDC 1RF1C 3M06A 1JOCA 3FGAD 3L71E 2Q9IA 1JNMA 1KB9D 4I2LC 2JDIH 5H2FH 4JYBA 1DEBA 1VQOP 3KQGA 4BRYA 4XA4A 3VMZA 1PP9G 3G4SP 5CBOA 1L4AD 1D7MA 3D70A 2SPZA 3M0AA 4DT0A 1JCDA 2OYIA 1H0TA 2O3JA 1SP4A 4GOEA 2KNCB 1L4AB 3OAKA 1BE3G 1KV4A 2B87B 2C0XA 3W68A 3L71J 5APTA 3PHLA 3F89A 1LTJB 3TF5A 3GHGC 4R4LA 1RQVA 3WUUA 4WB4A 1BSNA 1SQBG 3PP5A 3G9RA 2G8YA 1XTCC 2WPRA 5K5GB 1FZBA 2RN0A 2AEMA 4I1LA 1AVYA 2KB7P 1GDTA 2KI7B 3HUSC 1GW4A 2NPSA 4Y28J 3NTNA 1P84I 5TISE 1ZN5A 1M1JA 1NKZB 2KLVA 1LWUB 1PP9D 1KB9E 2Q6QA 1L0LG 4PD4I 1NYHA 3CCSP 5KLIC 3L70G 3H1LG 1YTZT 2E43A 1LP1A 3RGUA 2Z5HA 1BE3D 3Q5RA 5AVZB 4XFJA 3E1RA 3MGNA 3FWNA 4D6TG 1Y47A 3M9HA 5CHXA 2JO1A 2FXPA 1A02F 3H1KG 2E76D 4TT3H 4PV1D 5BU5A 1SQBD 1Q2NA 1PV3A 2A45H 2H89C 2N1TA 2WSEJ 3B4SA 1AVOA 4PV1B 2IYPA 3CWBJ 2H7HA 4OGQD 1RE3C 2KIKA 3MP7B 1QL1A 2BEQD 3CC2P 1SS1A 4OGQB 1GK4A 1JB0J 1M57D 3CCRP 1M7LA 3L75G 5KKZC 2W83C 1E5WA 2E42A 2OYHB 2XU6A 3BRTB 2QJPB 5CCGC 2J59M 3TK1A 1KYOE 1L0LD 1OW6A 3BCCG 1VF5D 3B5NA 2R44A 3QH9A 4YTPC 2UWJE 3L70D 1S1CX 3C8VA 3H1LD 1PP9E 1VF5B 1QVGO 1S9KD 4I6MC 1YJNP 2KSJA 4D6TD 4Z1MH 2QM8A 3AEBC 4KJMA 3H32A 3H1KD 1J1DB 1FDIA 5AW7B 3A7OA 3AE5C 1BE3E 2P67A 1MZ9A 3CX5H 1X22A 3G6EP 1GW3A 4R4MA 3VYIA 1KQSO 3H6PA 1SQBE 2HPCA 2FFDB 2J5UA 1PP9J 1A02J 4ZKPA 2KSEA 1OX3A 1T6AA 1X8YA 1LWUC 1FS0E 4C46A 3L75D 1RY3A 4KT0J 2M5AB 2AXCA 3BCCD 3N4XA 2C0WA 3VN0A 2QJKB 1L0LE 1JY2P 4HB1A 1DX7A 5M1BA 1SQQK 1S2EA 1K04A 1YTZI 3NXSA 2IYOA 3L70E 2W6BA 1LT9B 3H1LE 1OW7A 1S9KE 1FZCB 1KN7A 1XTGB 4TLFA 4H44C 2M0BA 2O01N 1T3UA 1N8RQ 1HJ0A 1ZOYC 3H1KE 2Q7CA 1LT1A 3KXDA 3TSIA 2GUVA 1URQA 2N9BA 2O1KA 1RE4C 3FWLA 4NPEA 2OTKE 2DW3A 2GUSA 1E79H 3G3ZA 4WBAA 2B89A 5APXA 5B5EE 2E75D 1QLED 3CCQP 4B86A 1RE4A 2HFED 1NTKK 3H1LJ 1JY3O 1YIJP 4GDOA 5AVQB 2E75B 3RK2C 1FJKA 1K73Q 3O8ZA 3VMYA 3A0HE 2Q1KA 1S5LX 3L75E 1HUCA 4IL6H 1FBMA 5BVZA 2ZYGA 1HTLC 1IFMA 2YMYA 3BCCE 1J1DC 4C7NA 4NPFX 1J1EB 2G3AA 1N73B 1N7SA 2M3BA 1T8ZA 1QGKB 1SQXK 1DD3A 5KLVK 1J2JB 4UB8E 3HD7D 2FFDC 2FBWC 1YQ3C 3AE2C 1SVFA 1Q81Q 3L75J 4Y99C 1NTZK 1GL2A 3HD7B 4BRYB 1G2CB 1RF1B 4N6JA 2HODA 1KQGB 5CCHC 2BEZF 2C9LY 3BCCJ 2LXCB 2L91A 4EOTA 1NTMK 3ZDMA 4ZNCA 2LXBA 2PGDA 2OYIB 1VDFA 1FZGA 4LGDE 2HR3A 2YIUC 3TYYA 2W90A 2QJKC 1SQQG 3A0BE 2ZFCA 3I5CA 4GOFA 3TDKA 3F5HA 1HF9A 3GHGB 2C9NY 3P7KA 5AVRB 2D2CC 1FZCC 1FOSF 1MFZA 1PGJA 5E79H 4JF7A 3AE9C 1G1JA 1ZR4A 3MUDA 3V5BA 3H25A 3GG2A 3KDPB 5KAIH 2OARA 4PD4E 3HUSB 3GLMA 2WPVB 3CWBG 3OA7A 1HVVA 4ASVA 2P2UA 3AEAC 3CMAP 1HJBA 1VPCA 2E75C 1KD1Q 3M9BA 1UIIA 1LP1B 2IPPA 3VMXA 5KJ7A 1OIPA 1EZVI 5DJUB 3K5BA 1SLQA 3P8MC 2IBZG 5KLIB 1MUUA 5AVSB 1SQQD 3RL0g 2RMZA 4UB6H 2WTYA 3I56P 1N73C 3A2AA 2N1TB 2R3SA 1SQXG 1KFMA 5KLVG 2YKOA 1W2EA 4JQ0D 2WSFJ 2HLOA 1NKNA 1VQ8P 1EDIA 2KUBA 1QX8A 1KQLA 3L4FA 2GM4A 3VP9A 2WPSA 2O1JA 1PPJG 3R4YA 1BGYJ 1NAFA 2FYUK 3CI9A 1CW5A 3CWBD 4WY4A 2P1JA 3D6ZA 5CCGD 2OYIC 1LNQA 3IF4A 2BASA 5KKZB 4EDFA 5AW1B 1PIXA 2POHA 1S5LE 2WITA 4C7RA 1EDJA 4YXWH 3L36A 2IBZD 3L73J 1RF0C 2QE7H 2V7QJ 2Y0DA 5AVUB 3FXDA 3CL3D 1LTGC 5GTHE 1JMBA 4DJGA
chains in the Genus database with same CATH topology
5APSA 3B5NA 5APUA 2H8PD 3VTPC 1SQBK 1RF0A 1X79B 3HE5A 1M1JB 4LLHA 2HPCB 3RL0D 1LT9A 1LTSC 2R5BA 3KPEA 2OYHC 1L0NK 3IR9A 1DH3A 5KJ7C 1S9KD 4I6MC 4DOJA 1NU1K 2NPSC 3L35A 2KSJA 3LIDA 4AUWA 2QM8A 5AW5B 1HGVA 3H32A 3RL0B 2O01H 4O9BA 1M1JC 4GIFA 1J1DB 5AW7B 3A7OA 2P67A 3CLQA 1MZ9A 1LTTC 2FXMA 1OWAA 2HG5D 1GW3A 2KOGA 2N1TD 3VYIA 4WY4D 3H6PA 5APWA 1T2KD 2WT7A 3RL0C 2KYVA 2HPCA 1JMMA 1FOSE 5APQA 2FFDB 3EFGA 1A02J 4ZKPA 1OXZA 1L0LK 1Z56A 3BATA 3V2RA 2FYZA 2JJLA 3VP8A 1G1IA 1X8YA 4XE5B 1GD2E 1H8AA 1LWUC 3KYQA 3HTKB 3HRNA 4C46A 3MD0A 1RY3A 2PP6A 2Z4EA 2N1TC 5AW3B 4WY4C 1GK6A 1T2KC 2WSCH 1NH4A 4GKGA 1FDMA 1X9VA 2YNYA 5AVVB 2FFDA 3B5ND 3B8EB 1MV8A 1JO5A 2XZRA 5AW2B 3N4XA 3OJAB 2C0WA 2W27A 1ZR2A 1AQ5A 1N7LA 3VN0A 3M0DA 1FZAA 1JY2P 3P8CD 5AVTB 3B5NB 4EIJA 5CCHA 1DX7A 1SQQK 1LGHB 3N7NA 2I1KA 3HTKA 1YTZI 3A5TA 3NXSA 2W6BA 1SFCD 1T3JA 1LT9B 4HH2A 1S9KE 5CJ0A 2H43A 1FZCB 1XTGB 3HD7A 1G2CA 1RF1A 3B5NC 1JY3P 2M8RA 1SFCB 1T3UA 3HE4A 3H32B 3RK2D 1NO4A 2Q7CA 3TSIA 2GUVA 1URQA 2N9BA 1LT9C 1JY2O 3P32A 2O1KA 1RE4C 3T97A 2GUSA 2ZXEB 1KILD 3G3ZA 4DZOA 3RK2B 4WBAA 1NWQA 3MTUE 1SFCC 4IFMA 4RESB 5APXA 1CSBA 2WT7B 4B86A 1RE4A 2HFED 2JEEA 1NTKK 1FZCA 1IO4A 1JY3O 1KILB 2R32A 2WSFH 4M3LA 3NFQA 3RK3D 3EQ2A 3VOPA 1HWTC 5AVQB 1LTIC 1FZEA 1SQVK 1SFCA 3RK2C 1FJPA 1FJKA 2A45I 1HH0A 3V4QA 3GHGA 2XKMA 3O8ZA 3VMYA 3RK3B 1HUCA 3U1CA 1FBMA 5BVZA 1KILC 1IC2A 3WMM0 1EQ7A 1KZUB 1L4AA 2Q3IA 1HTLC 2WSEH 2YO2A 1LTJA 2Z5IA 1IFMA 2YMYA 1J1DC 1IJDB 4C7NA 5CCHD 2YO3A 2XDJA 1FZFA 4KHXA 1J1EB 1KILA 3E1IA 4Y99B 1N2DC 3LIEA 3BVHA 1JTHB 1N73B 1SQPK 1N7SA 5AW4B 2M3BA 3BASA 5CJ4A 5BU8B 1T8ZA 1SQXK 2CPSA 5KLVK 3V2QA 3HUSA 3P8CE 1J2JB 3HD7D 3R2PA 2FFDC 3V2NA 1J1EC 1SVFA 4Y99C 1GTWA 1NTZK 3NMDA 2J58A 1GU5A 3MIWA 1URQD 1GL2A 3HD7B 1G2CB 1RF1B 3M0DC 2WZ7A 4N6JA 1H89A 2HODA 2YKPA 2P7JA 5AVWB 5CCHC 1IFNA 3M9QA 2C9LY 1CZQA 3HE4B 4W80A 4ZKUA 1JTHA 4EOTA 2R5DA 1NTMK 1URQB 1N73A 2HYNA 2I1JA 4W7YA 3A3YB 5AW8B 2OYIB 3SWFA 5AW6B 3HD7C 1RF1C 3M06A 1JOCA 3LW5H 2Q9IA 1VDFA 1JNMA 3L37A 1FZGA 2FKWB 4LGDE 4I2LC 1LTAC 4JYBA 4IFDK 1DEBA 3V4WA 3TYYA 3KQGA 1URQC 1JY2N 2QM7A 2YKQA 4XA4A 3VMZA 2ZFCA 4W7ZA 2CPBA 1L4AD 2XV5A 3I5CA 4JYCA 2R3CA 4HYTB 3GHGB 3M91A 3M0AA 1ZLLA 2C9NY 3P7KA 5AVRB 1JCDA 2MJZA 1FZCC 2OYIA 1FOSF 1MFZA 1H88A 1SP4A 1JY3N 5KJ7D 1L4AB 3OAKA 1FAVA 2C0XA 1RE3A 1N7SD 5APTA 4JF7A 1G1JA 2IX7C 1LTJB 1JUNA 1ZR4A 5AVXB 3MUDA 3GHGC 4C7NB 4IFFA 3V5BA 3UIAA 1HBWA 4WB4A 4N78D 3PP5A 3KDPB 1XTCC 1N7SB 1N86A 1L4AC 2WPRA 2OARA 1FZBA 3HUSB 1GL2D 1JCCA 1IFIA 5AW0B 1LTJC 3OA7A 1HVVA 2KP8A 4N3YB 4I1LA 5CCGA 3C9IA 2P2UA 2KB7P 1HJBA 1IFDA 1PFIA 1VPCA 3II6A 1GU4A 1GDTA 1GL2B 1N7SC 1NOHA 1YYCA 1NHLA 2HODB 3HUSC 3M9BA 2OYHA 2IPPA 1ZV8A 3RK3C 1GW4A 3VMXA 5KJ7A 1WT6A 5AW9B 5AVYB 2NPSA 3NTNA 1SLQA 1KFNA 3P8MC 2PAJA 1GL2C 5APVA 1ZN5A 1MUUA 1M1JA 4LC1A 1NKZB 2KLVA 5AVSB 1LWUB 2WTYA 3SWYA 1N73C 3A2AA 2N1TB 4WY4B 1KFMA 2Q5UA 2YKOA 1W2EA 1YTZT 2E43A 1CI6B 1WRGA 2Z5HA 2HLOA 1NKNA 1HGZA 5AVZB 2A45G 3TNUB 3MGNA 1KQLA 4AQRD 3L4FA 3M9HA 1AFOA 2GM4A 5CHXA 1FU1A 2WPSA 3VP9A 1A02F 2O1JA 3U59A 4GT1A 5BU5A 5APYA 2XNXA 1LWUA 2LKMA 1NAFA 2IFMA 2FYUK 2A45H 3CI9A 1CW5A 5KTBA 2N1TA 4WY4A 2P1JA 2W6AA 4OH8B 1IK9A 2H7HA 5CCGD 2OYIC 4N78E 1QL2A 2IFNA 2BASA 1CI6A 1GZLA 1RE3C 2L5GB 5AW1B 3HE5B 2VRSA 3TNUA 3IFMA 2WPQA 1QL1A 2POHA 2WWWA 4AYCA 1IFJA 2WITA 1GK4A 4C7RA 3U1AA 1M7LA 3V2PA 2NPSD 3BRVB 3L36A 1RF0C 1E5WA 5AVUB 2E42A 2OYHB 2XU6A 3BRTB 3CL3D 1LTGC 5CMZA 5CCGC 2J59M 1LTBC 3TK1A 2NPSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5APS A;  2IPP A;  1G2C B;  5APU A;  3VTP C;  3VMX A;  1H89 A;  2P7J A;  5AVW B;  3HE5 A;  5AW9 B;  5AVY B;  2C9L Y;  1CZQ A;  1S9K E;  3HE4 B;  3NTN A;  1SLQ A;  3P8M C;  2R5B A;  4EOT A;  5APV A;  2R5D A;  3IR9 A;  1MUU A;  1DH3 A;  4LC1 A;  1S9K D;  3HE4 A;  3A3Y B;  5AVS B;  4I6M C;  2Q7C A;  5AW8 B;  2WTY A;  3SWF A;  5AW6 B;  3L35 A;  4AUW A;  3LID A;  3M06 A;  2N9B A;  2QM8 A;  3P32 A;  5AW5 B;  1JNM A;  3L37 A;  3T97 A;  3A2A A;  4I2L C;  5AW7 B;  3A7O A;  2ZXE B;  2P67 A;  4JYB A;  4DZO A;  2Q5U A;  3V4W A;  3TYY A;  3KQG A;  1NWQ A;  2E43 A;  1OWA A;  4RES B;  5APX A;  1CSB A;  2WT7 B;  2QM7 A;  1CI6 B;  2Z5H A;  5AVZ B;  4B86 A;  3VYI A;  3TNU B;  3VMZ A;  2ZFC A;  3MGN A;  1KQL A;  5APW A;  4AQR D;  1T2K D;  2WT7 A;  1IO4 A;  2R32 A;  3M9H A;  4M3L A;  3NFQ A;  2XV5 A;  3I5C A;  4JYC A;  2R3C A;  4HYT B;  2WPS A;  1A02 F;  1HWT C;  3M91 A;  5APQ A;  3M0A A;  5AVQ B;  1FOS E;  4GT1 A;  2C9N Y;  3P7K A;  5AVR B;  5APY A;  1A02 J;  1OXZ A;  1FOS F;  3V4Q A;  1MFZ A;  1NAF A;  1H88 A;  1SP4 A;  3O8Z A;  3VMY A;  2JJL A;  3OAK A;  1FAV A;  1HUC A;  3A5T A;  2W6A A;  1GU5 A;  5APT A;  1X8Y A;  4XE5 B;  1GD2 E;  1H8A A;  1JUN A;  2H7H A;  5AVX B;  4C46 A;  2Q3I A;  3MD0 A;  4C7N B;  2BAS A;  3V5B A;  2YO2 A;  1CI6 A;  3UIA A;  1GZL A;  1HBW A;  2Z5I A;  5AW3 B;  1GK6 A;  5AW1 B;  3HE5 B;  2VRS A;  3TNU A;  1T2K C;  3KDP B;  4C7N A;  2WPQ A;  2YO3 A;  4KHX A;  4GKG A;  2WPR A;  3LIE A;  2WWW A;  4AYC A;  2YNY A;  5AVV B;  5AW0 B;  3B8E B;  1GK4 A;  5AW4 B;  1MV8 A;  2KP8 A;  2P2U A;  2XZR A;  5AW2 B;  1J2J B;  2W27 A;  1HJB A;  3L36 A;  3VN0 A;  3M0D A;  5AVU B;  2E42 A;  1GU4 A;  2XU6 A;  5AVT B;  1GTW A;  5CMZ A;  1YYC A;  3NMD A;  3HTK A;  3M9B A;  3TK1 A;  3NXS A; 
#chains in the Genus database with same CATH topology
 5APS A;  2FYN C;  1RF0 A;  1SQX D;  5KLV D;  1USE A;  1SQQ E;  1RHZ B;  2HPC B;  1LTS C;  2R5B A;  3KPE A;  2K9J A;  1VQ9 P;  1L0N K;  3VMA A;  1DH3 A;  1K9M Q;  3LW5 J;  4GOD A;  1R8E A;  1NU1 K;  2NPS C;  3L35 A;  5AW5 B;  1HGV A;  2O01 H;  3JCU E;  1M1J C;  1PPJ D;  4GIF A;  3CXH H;  3ABV C;  2KLU A;  1LTT C;  1KYO D;  2Y9Z A;  2WT7 A;  1PZQ A;  3RL0 C;  1OMI A;  1SQQ J;  1OXZ A;  3CWB E;  3WU2 E;  3H1J G;  1GMJ A;  3VP8 A;  5CBN A;  1G1I A;  1OVU A;  4XE5 B;  1GD2 E;  1H8A A;  3H1H G;  3IAO A;  1VQ4 P;  2H88 C;  2PP6 A;  2N1T C;  5AW3 B;  1GK6 A;  1NAY A;  1NH4 A;  1VL2 A;  1X9V A;  4H44 D;  2IBZ E;  1MV8 A;  2E5Y A;  3L74 J;  3CCE P;  1AQ5 A;  1EZV G;  1VQL P;  1OZH A;  2QRX A;  4H44 B;  4WWI A;  1LGH B;  1S5L H;  2FYU G;  1SQX E;  3HTK A;  5KLV E;  1JM0 A;  2K9Y A;  5L8R J;  4H0L C;  4HH2 A;  3CCV P;  2CK3 H;  1NTZ E;  3B5N C;  2M8R A;  3O6Q A;  3HE4 A;  3RK2 D;  1PPJ E;  2K3R A;  2AXT E;  1JY2 O;  3T97 A;  3AE7 C;  2Y0C A;  2ZXE B;  3RK2 B;  1NWQ A;  3H1J D;  1SFC C;  4RES B;  1SQX J;  4BWN A;  5KLV J;  3FX0 A;  2Y0E A;  5KAF E;  3H1I G;  3Q5P A;  3H1H D;  4M3L A;  3RK3 D;  1YQ4 C;  3VOP A;  2A06 G;  2KZI A;  1LTI C;  1SQV K;  1NTZ J;  1SFC A;  1FJP A;  2A45 I;  3V4Q A;  3PH0 A;  1OFC X;  4A7P A;  3RK3 B;  5TIS H;  3U1C A;  1KIL C;  1L4A A;  1NTM J;  1KB9 H;  2B87 A;  2Q3I A;  1YHQ P;  2OYO A;  2WSE H;  4PJ0 E;  1EZV D;  1LTJ A;  3WU2 H;  5CCH D;  1KIL A;  4HJG H;  2FYU D;  4Y99 B;  3BVH A;  5BU8 B;  2KK7 A;  3IN6 A;  1GTW A;  1W2B O;  2WZ7 A;  1R5L A;  2P7J A;  5AVW B;  1AJY A;  4W80 A;  4ZKU A;  4U3F E;  2YIU B;  3KZI E;  1QVF O;  1ZP0 C;  1VQM P;  2D2C D;  5AW6 B;  3H1I D;  3L37 A;  2A06 D;  3H1J E;  2ZVN B;  3CX5 I;  3TGU E;  3V4W A;  3AEE C;  1URQ C;  2D2C B;  2Q3E A;  2QM7 A;  3H1H E;  2YKQ A;  3RK3 E;  4JYC A;  1KYO H;  2R3C A;  4HYT B;  2QSI A;  2V4H A;  3M91 A;  4U3F J;  1ZLL A;  2MJZ A;  1JY3 N;  4HKZ H;  5KJ7 D;  1FAV A;  3JSV C;  1U57 A;  1EZV E;  2IX7 C;  3H1J J;  2ZVO B;  1YJ9 P;  2WSC J;  3TGU J;  3CCU P;  1BDD A;  2AEJ A;  4IFF A;  4H13 C;  2FYU E;  1BGY G;  1YI2 P;  4N78 D;  3H1H J;  3V6I A;  2OTL P;  3D6Y A;  1JCC A;  1KTM A;  5AW0 B;  4N3Y B;  3C9I A;  1Q7Y Q;  1IFD A;  4PJ0 H;  1SQV G;  1GU4 A;  1N7S C;  4CPG A;  1YYC A;  1NHL A;  2IDB A;  2OYH A;  1P84 D;  1ZV8 A;  1BCC J;  3RK3 C;  2N9Y B;  2QEX P;  1WT6 A;  1RH5 B;  3L73 G;  5AVY B;  2FYU J;  1KFN A;  2PAJ A;  1GL2 C;  3H1I E;  4PD4 D;  4LC1 A;  2A06 E;  3CC4 P;  2P10 A;  3SWY A;  5DJT B;  1L0N E;  4WY4 B;  3SSU A;  2ZYD A;  3GW6 A;  2Q5U A;  3KZI H;  2GA1 A;  4ASW A;  2A45 G;  1M8O B;  1FDO A;  2JWD A;  3WUV A;  1H0T B;  3U59 A;  2Y9Y A;  1BGY D;  2MKV A;  3H1I J;  2XNX A;  1FE6 A;  2NZ2 A;  2LKM A;  3G71 P;  2IFM A;  5GTI E;  5TJH A;  1EXI A;  2W6A A;  1L0N J;  3B71 A;  4N78 E;  1QL2 A;  1AA0 A;  1CI6 A;  2ZT9 C;  1SQV D;  1PGP A;  1NGM B;  1NU1 J;  2KS1 A;  2L5G B;  2VRS A;  3TNU A;  3IFM A;  3MUD C;  1M90 Q;  2K9J B;  3EFF K;  1OVR A;  3ITK A;  1L2P A;  2WWW A;  2K88 A;  5B5E H;  1IFJ A;  3S1K A;  5H2F E;  1YIT P;  3U1A A;  2FYN B;  3L73 D;  1YBK A;  2NPS D;  3S9O A;  2PFX A;  1KMI Z;  1P84 E;  5CMZ A;  3CCM P;  1LTB C;  2NPS B;  5APU A;  3A0H H;  2H8P D;  3L74 G;  1SQB K;  3VTP C;  2JR8 A;  1X79 B;  3HE5 A;  1M1J B;  4LLH A;  1NTK G;  1TU3 F;  3RL0 D;  1LT9 A;  2E74 D;  1RQU A;  2W6J H;  3CPW O;  5KJ7 C;  2RH0 A;  4DCK A;  4AUW A;  1IZN B;  1K05 A;  2I8D A;  3C1L A;  2ZXX A;  3RL0 B;  1S72 P;  2E74 B;  4O9B A;  3CLQ A;  1EDL A;  2M3E A;  4UB8 H;  1OWA A;  1DD4 A;  2HG5 D;  2OTJ P;  4QMA A;  2KOG A;  2N1T D;  1UIX A;  3Q5S A;  3CC7 P;  1BGY E;  3PRJ A;  1FOS E;  1L0L K;  1Z56 A;  2FYZ A;  1R5S A;  2QJY B;  4JBZ A;  1EXJ A;  1SQV E;  3HTK B;  3HRN A;  1NTZ G;  3MD0 A;  3RBX A;  1X0T A;  4EI2 A;  2Z4E A;  3Q3D A;  4WY4 C;  4H0L D;  1T2K C;  1VQ5 P;  3E7K A;  4GKG A;  5GTI H;  1FDM A;  3L73 E;  2ZYA A;  2PRR A;  2YNY A;  3L74 D;  3B5N D;  3O6Q B;  1NTM G;  3B8E B;  2WQY C;  3A0B H;  1JO5 A;  4BXL A;  2XZR A;  4H0L B;  5AW2 B;  3OJA B;  2W27 A;  1NTK D;  1EDK A;  3T97 B;  3M0D A;  2KXP B;  3CX5 D;  4IL6 X;  5AVT B;  3B5N B;  2I1K A;  3A5T A;  1SQV J;  1SFC D;  2H43 A;  3HD7 A;  1G2C A;  1RF1 A;  3OW2 O;  2ZAE B;  1P84 H;  1SFC B;  3H32 B;  1NVO A;  2RKL A;  3P32 A;  2ITA A;  1YJW P;  3PLN A;  4PD4 H;  4L75 A;  1KIL D;  4DZO A;  2NRG A;  1NJI Q;  2JEE A;  1QEX A;  3AE3 C;  1IO4 A;  1KIL B;  2WSF H;  3NFQ A;  4K3A A;  1NTZ D;  3D71 A;  3EQ2 A;  1HWT C;  3L72 E;  1HH0 A;  3GHG A;  4YPC A;  1NTM D;  3JC2 2;  1IC2 A;  5C39 A;  1EQ7 A;  3WMM 0;  1W5C E;  4U3F G;  3GF7 A;  2E74 C;  2Z5I A;  1IJD B;  3L74 E;  1ZXG A;  2YO3 A;  2XDJ A;  1FZF A;  3E1I A;  1N2D C;  3LIE A;  1SQP K;  1NTK E;  5CJ4 A;  3BAS A;  3TGU G;  2CPS A;  3Q1M A;  3CX5 E;  3V2Q A;  3HUS A;  1EC5 A;  3L72 J;  3R2P A;  2QIW A;  2JWA A;  3V2N A;  4RJT A;  2V7Q H;  3NMD A;  3PTZ A;  2J58 A;  1GU5 A;  3CME P;  1URQ D;  1ZRT D;  2QJY C;  1H89 A;  2YKP A;  1IFN A;  1KQF B;  3M9Q A;  3MHV A;  1CZQ A;  3AEG C;  1JTH A;  1URQ B;  2HYN A;  4EYY Q;  1KOR A;  4W7Y A;  3AED C;  5AW8 B;  1NTK J;  3SWF A;  1BCC G;  1KIL E;  3LW5 H;  3CXH I;  2FKW B;  3W67 A;  1U7J A;  1LTA C;  4IFD K;  2WMM A;  1U7M A;  2BCC G;  2E76 B;  1JY2 N;  4H13 D;  1M1K Q;  1S4X A;  4W7Z A;  2CPB A;  5GTH H;  4U3F D;  2XV5 A;  2JKV A;  1KC8 Q;  4H13 B;  1NTM E;  1H88 A;  2JP3 A;  1RE3 A;  1N7S D;  3TGU D;  2K1A A;  1JUN A;  5AVX B;  1PGQ A;  4C7N B;  1VQ7 P;  3UIA A;  1HBW A;  3JCU H;  2E5T A;  1N7S B;  1N86 A;  4RKU J;  1L4A C;  4WVZ A;  1GL2 D;  1L0N G;  1IFI A;  1LTJ C;  2KP8 A;  5CCG A;  1NU1 G;  1PFI A;  2WSS H;  2WVR A;  2KNC A;  3II6 A;  4YXD C;  1MKM A;  1GL2 B;  1NOH A;  1ZRT E;  2HOD B;  1BCC D;  3EWK A;  5AW9 B;  5APV A;  2BCC D;  4IL6 E;  2AEF A;  1PGO A;  1PL5 A;  2IZ0 A;  2QA4 P;  1SQP G;  3CCL P;  4OVN F;  4MN4 C;  1IFP A;  3GF3 A;  1M56 D;  1CI6 B;  1WRG A;  2ZT9 D;  1HGZ A;  3USS A;  2KS1 B;  3TNU B;  1BE3 J;  4AQR D;  1AFO A;  1FU1 A;  4GT1 A;  5APY A;  2ZT9 B;  1VQ6 P;  1Y9B A;  1LWU A;  1SQB J;  1BSH A;  2P58 A;  5KTB A;  1DEE G;  1L0N D;  1KB9 I;  1WMK A;  4L76 A;  4OH8 B;  1IK9 A;  2IFN A;  2AXT H;  1NU1 D;  4OWF A;  1Q82 Q;  1GZL A;  3QWO C;  3HE5 B;  2WPQ A;  2E76 C;  4AYC A;  4PV1 C;  2B9B A;  4RO0 A;  3V2P A;  4D6T E;  5KAF H;  2LR2 A;  3BRV B;  1BCC E;  1OVV A;  2QVA A;  4L73 A;  2IBZ I;  4OGQ C;  3AE6 C;  1SQP D;  1L0L J;  2BCC E;  1Y8A A;  2OYH C;  5E79 E;  3IR9 A;  3L70 J;  2QJP C;  3AE8 C;  4DOJ A;  3LID A;  2OQQ A;  4D6T J;  4JPZ B;  4I7Z B;  3H1K J;  3GMA A;  1Q86 Q;  5KAI E;  3AEF C;  1VF5 C;  2FXM A;  2FY8 A;  4WY4 D;  3WUT A;  5APW A;  1T2K D;  1KYO I;  3KHU A;  3PJS K;  2BCC J;  2KYV A;  3AE1 C;  1JMM A;  2YXQ B;  5APQ A;  3EFG A;  3FXE A;  3L71 G;  1LJ2 A;  3BAT A;  3V2R A;  1IK7 A;  2JJL A;  1NU1 E;  2W8Z A;  1Q90 D;  3S4R A;  3KYQ A;  5EFW B;  1AQT A;  5B66 E;  3SFE C;  1ZW0 A;  2WSC H;  4UB6 E;  3AE4 C;  5AVV B;  2FFD A;  1ZR2 A;  2IZ1 A;  3CXH D;  1N7L A;  1FZA A;  2B88 A;  2FXO A;  1SQP E;  3P8C D;  4EIJ A;  5CCH A;  3N7N A;  2XND H;  3CD6 P;  1T3J A;  2YXR B;  4L74 A;  1OW8 A;  3L72 G;  5CJ0 A;  2M5A A;  1JY3 P;  2K37 A;  2QG4 A;  1NO4 A;  1FC2 C;  1USD A;  1LT9 C;  2OGU A;  3L71 D;  1SQP J;  3MTU E;  4IFM A;  2WT7 B;  1CSB A;  1JEK A;  1FZC A;  1ZME C;  2R32 A;  1FZE A;  2YMK A;  4IOI H;  3Q2Y A;  4K35 A;  2XKM A;  3CCJ P;  4NPD A;  3SWK A;  4ZMD A;  1KZU B;  1VQP P;  4U7J A;  2YO2 A;  2KZJ A;  4I7Z C;  1DIP A;  3I55 P;  4KHX A;  1JTH B;  1VQK P;  3CXH E;  5AW4 B;  3L72 D;  1AV1 A;  1VQN P;  3P8C E;  5B66 H;  1J1E C;  1S3J A;  3RBZ A;  3MIW A;  1MFT A;  3M0D C;  3AEC C;  2ZJS E;  3HE4 B;  1BDC A;  3MZW B;  2R5D A;  1N73 A;  1K8A Q;  2I1J A;  3A3Y B;  2O01 J;  3HD7 C;  3SFD C;  1RF1 C;  3M06 A;  1JOC A;  3FGA D;  3L71 E;  2Q9I A;  1JNM A;  1KB9 D;  4I2L C;  2JDI H;  5H2F H;  4JYB A;  1DEB A;  1VQO P;  3KQG A;  4BRY A;  4XA4 A;  3VMZ A;  1PP9 G;  3G4S P;  5CBO A;  1L4A D;  1D7M A;  3D70 A;  2SPZ A;  3M0A A;  4DT0 A;  1JCD A;  2OYI A;  1H0T A;  2O3J A;  1SP4 A;  4GOE A;  2KNC B;  1L4A B;  3OAK A;  1BE3 G;  1KV4 A;  2B87 B;  2C0X A;  3W68 A;  3L71 J;  5APT A;  3PHL A;  3F89 A;  1LTJ B;  3TF5 A;  3GHG C;  4R4L A;  1RQV A;  3WUU A;  4WB4 A;  1BSN A;  1SQB G;  3PP5 A;  3G9R A;  2G8Y A;  1XTC C;  2WPR A;  5K5G B;  1FZB A;  2RN0 A;  2AEM A;  4I1L A;  1AVY A;  2KB7 P;  1GDT A;  2KI7 B;  3HUS C;  1GW4 A;  2NPS A;  4Y28 J;  3NTN A;  1P84 I;  5TIS E;  1ZN5 A;  1M1J A;  1NKZ B;  2KLV A;  1LWU B;  1PP9 D;  1KB9 E;  2Q6Q A;  1L0L G;  4PD4 I;  1NYH A;  3CCS P;  5KLI C;  3L70 G;  3H1L G;  1YTZ T;  2E43 A;  1LP1 A;  3RGU A;  2Z5H A;  1BE3 D;  3Q5R A;  5AVZ B;  4XFJ A;  3E1R A;  3MGN A;  3FWN A;  4D6T G;  1Y47 A;  3M9H A;  5CHX A;  2JO1 A;  2FXP A;  1A02 F;  3H1K G;  2E76 D;  4TT3 H;  4PV1 D;  5BU5 A;  1SQB D;  1Q2N A;  1PV3 A;  2A45 H;  2H89 C;  2N1T A;  2WSE J;  3B4S A;  1AVO A;  4PV1 B;  2IYP A;  3CWB J;  2H7H A;  4OGQ D;  1RE3 C;  2KIK A;  3MP7 B;  1QL1 A;  2BEQ D;  3CC2 P;  1SS1 A;  4OGQ B;  1GK4 A;  1JB0 J;  1M57 D;  3CCR P;  1M7L A;  3L75 G;  5KKZ C;  2W83 C;  1E5W A;  2E42 A;  2OYH B;  2XU6 A;  3BRT B;  2QJP B;  5CCG C;  2J59 M;  3TK1 A;  1KYO E;  1L0L D;  1OW6 A;  3BCC G;  1VF5 D;  3B5N A;  2R44 A;  3QH9 A;  4YTP C;  2UWJ E;  3L70 D;  1S1C X;  3C8V A;  3H1L D;  1PP9 E;  1VF5 B;  1QVG O;  1S9K D;  4I6M C;  1YJN P;  2KSJ A;  4D6T D;  4Z1M H;  2QM8 A;  3AEB C;  4KJM A;  3H32 A;  3H1K D;  1J1D B;  1FDI A;  5AW7 B;  3A7O A;  3AE5 C;  1BE3 E;  2P67 A;  1MZ9 A;  3CX5 H;  1X22 A;  3G6E P;  1GW3 A;  4R4M A;  3VYI A;  1KQS O;  3H6P A;  1SQB E;  2HPC A;  2FFD B;  2J5U A;  1PP9 J;  1A02 J;  4ZKP A;  2KSE A;  1OX3 A;  1T6A A;  1X8Y A;  1LWU C;  1FS0 E;  4C46 A;  3L75 D;  1RY3 A;  4KT0 J;  2M5A B;  2AXC A;  3BCC D;  3N4X A;  2C0W A;  3VN0 A;  2QJK B;  1L0L E;  1JY2 P;  4HB1 A;  1DX7 A;  5M1B A;  1SQQ K;  1S2E A;  1K04 A;  1YTZ I;  3NXS A;  2IYO A;  3L70 E;  2W6B A;  1LT9 B;  3H1L E;  1OW7 A;  1S9K E;  1FZC B;  1KN7 A;  1XTG B;  4TLF A;  4H44 C;  2M0B A;  2O01 N;  1T3U A;  1N8R Q;  1HJ0 A;  1ZOY C;  3H1K E;  2Q7C A;  1LT1 A;  3KXD A;  3TSI A;  2GUV A;  1URQ A;  2N9B A;  2O1K A;  1RE4 C;  3FWL A;  4NPE A;  2OTK E;  2DW3 A;  2GUS A;  1E79 H;  3G3Z A;  4WBA A;  2B89 A;  5APX A;  5B5E E;  2E75 D;  1QLE D;  3CCQ P;  4B86 A;  1RE4 A;  2HFE D;  1NTK K;  3H1L J;  1JY3 O;  1YIJ P;  4GDO A;  5AVQ B;  2E75 B;  3RK2 C;  1FJK A;  1K73 Q;  3O8Z A;  3VMY A;  3A0H E;  2Q1K A;  1S5L X;  3L75 E;  1HUC A;  4IL6 H;  1FBM A;  5BVZ A;  2ZYG A;  1HTL C;  1IFM A;  2YMY A;  3BCC E;  1J1D C;  4C7N A;  4NPF X;  1J1E B;  2G3A A;  1N73 B;  1N7S A;  2M3B A;  1T8Z A;  1QGK B;  1SQX K;  1DD3 A;  5KLV K;  1J2J B;  4UB8 E;  3HD7 D;  2FFD C;  2FBW C;  1YQ3 C;  3AE2 C;  1SVF A;  1Q81 Q;  3L75 J;  4Y99 C;  1NTZ K;  1GL2 A;  3HD7 B;  4BRY B;  1G2C B;  1RF1 B;  4N6J A;  2HOD A;  1KQG B;  5CCH C;  2BEZ F;  2C9L Y;  3BCC J;  2LXC B;  2L91 A;  4EOT A;  1NTM K;  3ZDM A;  4ZNC A;  2LXB A;  2PGD A;  2OYI B;  1VDF A;  1FZG A;  4LGD E;  2HR3 A;  2YIU C;  3TYY A;  2W90 A;  2QJK C;  1SQQ G;  3A0B E;  2ZFC A;  3I5C A;  4GOF A;  3TDK A;  3F5H A;  1HF9 A;  3GHG B;  2C9N Y;  3P7K A;  5AVR B;  2D2C C;  1FZC C;  1FOS F;  1MFZ A;  1PGJ A;  5E79 H;  4JF7 A;  3AE9 C;  1G1J A;  1ZR4 A;  3MUD A;  3V5B A;  3H25 A;  3GG2 A;  3KDP B;  5KAI H;  2OAR A;  4PD4 E;  3HUS B;  3GLM A;  2WPV B;  3CWB G;  3OA7 A;  1HVV A;  4ASV A;  2P2U A;  3AEA C;  3CMA P;  1HJB A;  1VPC A;  2E75 C;  1KD1 Q;  3M9B A;  1UII A;  1LP1 B;  2IPP A;  3VMX A;  5KJ7 A;  1OIP A;  1EZV I;  5DJU B;  3K5B A;  1SLQ A;  3P8M C;  2IBZ G;  5KLI B;  1MUU A;  5AVS B;  1SQQ D;  3RL0 g;  2RMZ A;  4UB6 H;  2WTY A;  3I56 P;  1N73 C;  3A2A A;  2N1T B;  2R3S A;  1SQX G;  1KFM A;  5KLV G;  2YKO A;  1W2E A;  4JQ0 D;  2WSF J;  2HLO A;  1NKN A;  1VQ8 P;  1EDI A;  2KUB A;  1QX8 A;  1KQL A;  3L4F A;  2GM4 A;  3VP9 A;  2WPS A;  2O1J A;  1PPJ G;  3R4Y A;  1BGY J;  1NAF A;  2FYU K;  3CI9 A;  1CW5 A;  3CWB D;  4WY4 A;  2P1J A;  3D6Z A;  5CCG D;  2OYI C;  1LNQ A;  3IF4 A;  2BAS A;  5KKZ B;  4EDF A;  5AW1 B;  1PIX A;  2POH A;  1S5L E;  2WIT A;  4C7R A;  1EDJ A;  4YXW H;  3L36 A;  2IBZ D;  3L73 J;  1RF0 C;  2QE7 H;  2V7Q J;  2Y0D A;  5AVU B;  3FXD A;  3CL3 D;  1LTG C;  5GTH E;  1JMB A;  4DJG A; 
#chains in the Genus database with same CATH homology
 5APS A;  3B5N A;  5APU A;  2H8P D;  3VTP C;  1SQB K;  1RF0 A;  1X79 B;  3HE5 A;  1M1J B;  4LLH A;  2HPC B;  3RL0 D;  1LT9 A;  1LTS C;  2R5B A;  3KPE A;  2OYH C;  1L0N K;  3IR9 A;  1DH3 A;  5KJ7 C;  1S9K D;  4I6M C;  4DOJ A;  1NU1 K;  2NPS C;  3L35 A;  2KSJ A;  3LID A;  4AUW A;  2QM8 A;  5AW5 B;  1HGV A;  3H32 A;  3RL0 B;  2O01 H;  4O9B A;  1M1J C;  4GIF A;  1J1D B;  5AW7 B;  3A7O A;  2P67 A;  3CLQ A;  1MZ9 A;  1LTT C;  2FXM A;  1OWA A;  2HG5 D;  1GW3 A;  2KOG A;  2N1T D;  3VYI A;  4WY4 D;  3H6P A;  5APW A;  1T2K D;  2WT7 A;  3RL0 C;  2KYV A;  2HPC A;  1JMM A;  1FOS E;  5APQ A;  2FFD B;  3EFG A;  1A02 J;  4ZKP A;  1OXZ A;  1L0L K;  1Z56 A;  3BAT A;  3V2R A;  2FYZ A;  2JJL A;  3VP8 A;  1G1I A;  1X8Y A;  4XE5 B;  1GD2 E;  1H8A A;  1LWU C;  3KYQ A;  3HTK B;  3HRN A;  4C46 A;  3MD0 A;  1RY3 A;  2PP6 A;  2Z4E A;  2N1T C;  5AW3 B;  4WY4 C;  1GK6 A;  1T2K C;  2WSC H;  1NH4 A;  4GKG A;  1FDM A;  1X9V A;  2YNY A;  5AVV B;  2FFD A;  3B5N D;  3B8E B;  1MV8 A;  1JO5 A;  2XZR A;  5AW2 B;  3N4X A;  3OJA B;  2C0W A;  2W27 A;  1ZR2 A;  1AQ5 A;  1N7L A;  3VN0 A;  3M0D A;  1FZA A;  1JY2 P;  3P8C D;  5AVT B;  3B5N B;  4EIJ A;  5CCH A;  1DX7 A;  1SQQ K;  1LGH B;  3N7N A;  2I1K A;  3HTK A;  1YTZ I;  3A5T A;  3NXS A;  2W6B A;  1SFC D;  1T3J A;  1LT9 B;  4HH2 A;  1S9K E;  5CJ0 A;  2H43 A;  1FZC B;  1XTG B;  3HD7 A;  1G2C A;  1RF1 A;  3B5N C;  1JY3 P;  2M8R A;  1SFC B;  1T3U A;  3HE4 A;  3H32 B;  3RK2 D;  1NO4 A;  2Q7C A;  3TSI A;  2GUV A;  1URQ A;  2N9B A;  1LT9 C;  1JY2 O;  3P32 A;  2O1K A;  1RE4 C;  3T97 A;  2GUS A;  2ZXE B;  1KIL D;  3G3Z A;  4DZO A;  3RK2 B;  4WBA A;  1NWQ A;  3MTU E;  1SFC C;  4IFM A;  4RES B;  5APX A;  1CSB A;  2WT7 B;  4B86 A;  1RE4 A;  2HFE D;  2JEE A;  1NTK K;  1FZC A;  1IO4 A;  1JY3 O;  1KIL B;  2R32 A;  2WSF H;  4M3L A;  3NFQ A;  3RK3 D;  3EQ2 A;  3VOP A;  1HWT C;  5AVQ B;  1LTI C;  1FZE A;  1SQV K;  1SFC A;  3RK2 C;  1FJP A;  1FJK A;  2A45 I;  1HH0 A;  3V4Q A;  3GHG A;  2XKM A;  3O8Z A;  3VMY A;  3RK3 B;  1HUC A;  3U1C A;  1FBM A;  5BVZ A;  1KIL C;  1IC2 A;  3WMM 0;  1EQ7 A;  1KZU B;  1L4A A;  2Q3I A;  1HTL C;  2WSE H;  2YO2 A;  1LTJ A;  2Z5I A;  1IFM A;  2YMY A;  1J1D C;  1IJD B;  4C7N A;  5CCH D;  2YO3 A;  2XDJ A;  1FZF A;  4KHX A;  1J1E B;  1KIL A;  3E1I A;  4Y99 B;  1N2D C;  3LIE A;  3BVH A;  1JTH B;  1N73 B;  1SQP K;  1N7S A;  5AW4 B;  2M3B A;  3BAS A;  5CJ4 A;  5BU8 B;  1T8Z A;  1SQX K;  2CPS A;  5KLV K;  3V2Q A;  3HUS A;  3P8C E;  1J2J B;  3HD7 D;  3R2P A;  2FFD C;  3V2N A;  1J1E C;  1SVF A;  4Y99 C;  1GTW A;  1NTZ K;  3NMD A;  2J58 A;  1GU5 A;  3MIW A;  1URQ D;  1GL2 A;  3HD7 B;  1G2C B;  1RF1 B;  3M0D C;  2WZ7 A;  4N6J A;  1H89 A;  2HOD A;  2YKP A;  2P7J A;  5AVW B;  5CCH C;  1IFN A;  3M9Q A;  2C9L Y;  1CZQ A;  3HE4 B;  4W80 A;  4ZKU A;  1JTH A;  4EOT A;  2R5D A;  1NTM K;  1URQ B;  1N73 A;  2HYN A;  2I1J A;  4W7Y A;  3A3Y B;  5AW8 B;  2OYI B;  3SWF A;  5AW6 B;  3HD7 C;  1RF1 C;  3M06 A;  1JOC A;  3LW5 H;  2Q9I A;  1VDF A;  1JNM A;  3L37 A;  1FZG A;  2FKW B;  4LGD E;  4I2L C;  1LTA C;  4JYB A;  4IFD K;  1DEB A;  3V4W A;  3TYY A;  3KQG A;  1URQ C;  1JY2 N;  2QM7 A;  2YKQ A;  4XA4 A;  3VMZ A;  2ZFC A;  4W7Z A;  2CPB A;  1L4A D;  2XV5 A;  3I5C A;  4JYC A;  2R3C A;  4HYT B;  3GHG B;  3M91 A;  3M0A A;  1ZLL A;  2C9N Y;  3P7K A;  5AVR B;  1JCD A;  2MJZ A;  1FZC C;  2OYI A;  1FOS F;  1MFZ A;  1H88 A;  1SP4 A;  1JY3 N;  5KJ7 D;  1L4A B;  3OAK A;  1FAV A;  2C0X A;  1RE3 A;  1N7S D;  5APT A;  4JF7 A;  1G1J A;  2IX7 C;  1LTJ B;  1JUN A;  1ZR4 A;  5AVX B;  3MUD A;  3GHG C;  4C7N B;  4IFF A;  3V5B A;  3UIA A;  1HBW A;  4WB4 A;  4N78 D;  3PP5 A;  3KDP B;  1XTC C;  1N7S B;  1N86 A;  1L4A C;  2WPR A;  2OAR A;  1FZB A;  3HUS B;  1GL2 D;  1JCC A;  1IFI A;  5AW0 B;  1LTJ C;  3OA7 A;  1HVV A;  2KP8 A;  4N3Y B;  4I1L A;  5CCG A;  3C9I A;  2P2U A;  2KB7 P;  1HJB A;  1IFD A;  1PFI A;  1VPC A;  3II6 A;  1GU4 A;  1GDT A;  1GL2 B;  1N7S C;  1NOH A;  1YYC A;  1NHL A;  2HOD B;  3HUS C;  3M9B A;  2OYH A;  2IPP A;  1ZV8 A;  3RK3 C;  1GW4 A;  3VMX A;  5KJ7 A;  1WT6 A;  5AW9 B;  5AVY B;  2NPS A;  3NTN A;  1SLQ A;  1KFN A;  3P8M C;  2PAJ A;  1GL2 C;  5APV A;  1ZN5 A;  1MUU A;  1M1J A;  4LC1 A;  1NKZ B;  2KLV A;  5AVS B;  1LWU B;  2WTY A;  3SWY A;  1N73 C;  3A2A A;  2N1T B;  4WY4 B;  1KFM A;  2Q5U A;  2YKO A;  1W2E A;  1YTZ T;  2E43 A;  1CI6 B;  1WRG A;  2Z5H A;  2HLO A;  1NKN A;  1HGZ A;  5AVZ B;  2A45 G;  3TNU B;  3MGN A;  1KQL A;  4AQR D;  3L4F A;  3M9H A;  1AFO A;  2GM4 A;  5CHX A;  1FU1 A;  2WPS A;  3VP9 A;  1A02 F;  2O1J A;  3U59 A;  4GT1 A;  5BU5 A;  5APY A;  2XNX A;  1LWU A;  2LKM A;  1NAF A;  2IFM A;  2FYU K;  2A45 H;  3CI9 A;  1CW5 A;  5KTB A;  2N1T A;  4WY4 A;  2P1J A;  2W6A A;  4OH8 B;  1IK9 A;  2H7H A;  5CCG D;  2OYI C;  4N78 E;  1QL2 A;  2IFN A;  2BAS A;  1CI6 A;  1GZL A;  1RE3 C;  2L5G B;  5AW1 B;  3HE5 B;  2VRS A;  3TNU A;  3IFM A;  2WPQ A;  1QL1 A;  2POH A;  2WWW A;  4AYC A;  1IFJ A;  2WIT A;  1GK4 A;  4C7R A;  3U1A A;  1M7L A;  3V2P A;  2NPS D;  3BRV B;  3L36 A;  1RF0 C;  1E5W A;  5AVU B;  2E42 A;  2OYH B;  2XU6 A;  3BRT B;  3CL3 D;  1LTG C;  5CMZ A;  5CCG C;  2J59 M;  1LTB C;  3TK1 A;  2NPS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...