1CI6B

Transcription factor atf4-c/ebp beta bzip heterodimer
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
47
structure length
47
Chain Sequence
SRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords TRANSCRIPTION FACTOR ATF-4
publication title Crystal structure of the CCAAT box/enhancer-binding protein beta activating transcription factor-4 basic leucine zipper heterodimer in the absence of DNA
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 1999-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ci6B00
3KQGA 1DH3A 3L36A 3M06A 2XU6A 3P32A 2P67A 5CMZA 3M0DA 1S9KD 2QM8A 5AW8B 3L35A 4I6MC 1OXZA 1HJBA 1GK6A 1H88A 4AYCA 4C46A 4XE5B 3SWFA 1J2JB 5AVRB 3NXSA 1GU5A 2WPRA 3TK1A 3A5TA 3A3YB 4GKGA 2Q7CA 3TNUA 3HE4B 2ZFCA 3M0AA 3VMYA 1YYCA 3LIEA 3KDPB 2R3CA 1IO4A 2Q5UA 1T2KC 1SP4A 1G2CB 1FOSF 3O8ZA 2R32A 2R5DA 3L37A 2IPPA 3M91A 1FAVA 1HWTC 1S9KE 2WT7A 3HTKA 1KQLA 5AVUB 4C7NA 4EOTA 1JUNA 2C9LY 5AW0B 3A2AA 2WWWA 2YNYA 1H89A 2W6AA 2R5BA 3LIDA 5AVSB 2P2UA 1GTWA 4RESB 5AVQB 1GD2E 3UIAA 4AQRD 5AW2B 2VRSA 5APTA 5AW5B 2JJLA 3OAKA 5AW4B 4I2LC 4KHXA 3HE5A 1HUCA 1A02F 3T97A 3P7KA 2Z5HA 1GU4A 1GK4A 1FOSE 4JYBA 3I5CA 2Q3IA 5APXA 5APVA 2BASA 3TYYA 4LC1A 1NAFA 2WPQA 4JYCA 3IR9A 2XZRA 3TNUB 4DZOA 5AW3B 1CI6A 3M9HA 4M3LA 5AVZB 2WPSA 3VYIA 1HBWA 3VTPC 3NMDA 3NTNA 5AVWB 1CSBA 2N9BA 3VN0A 1NWQA 2WTYA 5AW1B 3P8MC 3MD0A 1X8YA 5APQA 2KP8A 4GT1A 3A7OA 5APUA 2XV5A 4C7NB 2W27A 2QM7A 3V4WA 2Z5IA 3VMZA 2E43A 5AW6B 1T2KD 1OWAA 5APSA 1A02J 3HE4A 2C9NY 1MV8A 5AW9B 3M9BA 3VMXA 1MFZA 5APWA 2P7JA 5AW7B 2ZXEB 5AVXB 2YO2A 3B8EB 1H8AA 2YO3A 3HE5B 4B86A 1MUUA 1GZLA 1JNMA 2E42A 4HYTB 3NFQA 1CZQA 3MGNA 5APYA 4AUWA 2H7HA 5AVYB 5AVVB 3V5BA 1SLQA 5AVTB 3V4QA 2WT7B 1CI6B
chains in the Genus database with same CATH superfamily
2GUSA 1DH3A 3L71D 2P67A 2Y9ZA 1WMKA 3KXDA 2UWJE 4IL6H 3W68A 2QG4A 1H88A 4H44D 3LW5J 4R4MA 1GU5A 3V6IA 1FBMA 1IFPA 1M1KQ 3L75G 2ZFCA 3KDPB 3H1KG 1PP9E 1WT6A 1S2EA 1HWTC 1IFMA 3CCMP 1H89A 1KB9E 3H1LD 2OTLP 2OTJP 2NZ2A 5CJ4A 1VDFA 4H13B 1NU1J 2E74B 1P84H 1FZCA 1LTTC 2C0WA 2Q9IA 1OX3A 1DIPA 3CWBE 1K04A 1YJ9P 3RL0C 1NTKG 1RHZB 4N3YB 4WY4A 3P8MC 2K3RA 4CPGA 1EZVG 2G8YA 1X8YA 2V7QJ 2FFDA 2OYIC 2E43A 1BCCD 1FZAA 1T3UA 1TU3F 3CCRP 3FXDA 4WWIA 2WSCJ 1LT1A 1VQ8P 5AVTB 1NTMG 1Z56A 3L36A 1IFJA 3AEAC 5KLVD 2HODB 2C0XA 3BATA 1MZ9A 2IBZI 1ZXGA 4MN4C 1U57A 3AE3C 1YI2P 1KQLA 5KJ7C 2NPSC 4RKUJ 3RK3C 5CCGC 1GD2E 3E1RA 2O1KA 1AVOA 4I1LA 1GL2A 4DOJA 2B88A 1Q7YQ 5H2FH 2JWAA 3FXEA 2H88C 1K05A 3L74G 3H1JG 2N1TC 1AQ5A 5E79E 1CSBA 2OYHC 3B5NB 3U59A 3CWBJ 1RF1B 1KQGB 2W6JH 2OARA 3KZIH 5KKZB 1SQQD 3G6EP 1L0LK 1VF5C 1LTAC 3MUDC 4TT3H 2IYOA 1GDTA 3M9BA 3K5BA 1ZP0C 3ZDMA 1L0LE 1CZQA 1VQMP 1OIPA 2W83C 1N2DC 3U1AA 3Q3DA 3CMEP 1DEBA 2QIWA 4PV1D 1CW5A 1SQPG 2OYOA 4RO0A 1UIXA 3SWFA 3EQ2A 4WBAA 2LKMA 4D6TG 2JDIH 3L72D 1LTJB 4K35A 4WY4D 1EDLA 1E79H 2HPCA 1KILA 1VQLP 1BE3D 4UB6E 1S9KE 3HTKA 4IL6E 5B66H 1DX7A 3L70E 3A2AA 2WWWA 2E5YA 3O6QA 4HKZH 1YJWP 1SQVG 1KMIZ 2O01J 2YKPA 3BRTB 1Q2NA 3RBZA 3VOPA 2Q3IA 3P8CD 4BXLA 1Q81Q 1VPCA 1LWUA 5KLIB 2XZRA 3HRNA 1RY3A 2KZJA 3NMDA 3C8VA 1N7SB 3BASA 1QVFO 2FYZA 1RE3A 1NO4A 1EQ7A 1KORA 4C7NB 3TSIA 1L0NJ 1NGMB 2W8ZA 1J1DC 2WSEH 1S1CX 2R44A 2PRRA 2IZ0A 2WSSH 2ITAA 3A0HH 5KAFH 3L75D 2O01N 5L8RJ 1SFCB 1FU1A 2ZYDA 2WT7B 1KFNA 1URQB 2WQYC 2ZAEB 1JTHA 5AW8B 3MTUE 1RF1A 1NYHA 1X22A 5AVRB 1YJNP 4GKGA 1PIXA 3TNUA 1LJ2A 1FOSF 1GL2C 2IBZE 2P58A 1FDMA 2L91A 4H13D 4W80A 3WMM0 3GF7A 1GTWA 1IFDA 1NKZB 1NU1G 3L70J 1FZGA 3D70A 4GIFA 1ZLLA 4ZNCA 1J1EB 2Z5HA 2B87A 3PJSK 2AEMA 4IOIH 2A06E 1QEXA 4M3LA 2KIKA 5KLVG 4HH2A 1NTMD 3AEEC 3MD0A 2WSFJ 2CK3H 3PLNA 5KTBA 3RK2B 3L73E 1L4AA 4H0LC 3GG2A 1USEA 3HD7B 3G71P 1H8AA 5CBNA 3HE5B 5GTHE 2KK7A 1YQ3C 2PFXA 4TLFA 2H7HA 5AVVB 3S1KA 2N1TB 1Q82Q 2FYNB 1ZV8A 5CMZA 1KILC 2PAJA 3L71E 1M56D 1HJBA 1RE4A 3AEGC 1K8AQ 1VQ7P 1VF5B 1SQBD 3T97B 2IZ1A 1GMJA 3FWNA 3LIEA 1G2CB 3CPWO 1FAVA 2E75D 2WT7A 3AEBC 1G1JA 1URQA 2XKMA 4Z1MH 1OVUA 1YQ4C 2E76C 1ZOYC 3H1LE 4I7ZC 4AQRD 2VRSA 3OAKA 2A45I 1OW7A 3AEDC 1HUCA 3BCCE 2M5AB 1N73C 5APXA 1MKMA 3B5ND 2HFED 1IZNB 3GLMA 3TGUE 3CWBG 2OTKE 3VP9A 4BRYB 2XNDH 4WB4A 3CCUP 3L72G 1BCCE 1T2KD 2FBWC 3L73J 1NH4A 2K1AA 2QJKB 3AE7C 1BE3G 5AVXB 4D6TD 1KYOD 1JEKA 1SQXK 2E42A 2KZIA 5B5EE 2OQQA 5TISH 5KLVK 1USDA 1FZEA 3ABVC 3BRVB 3M06A 1RQVA 1R8EA 1SQXE 2KSJA 2B9BA 1KQSO 3M0DC 1NTZD 3B4SA 4EDFA 1JM0A 3AE4C 4C46A 1SQVD 3A0HE 3HUSB 5KAFE 3RK3E 3CXHI 1K9MQ 1PV3A 2FYUD 3V2PA 2M8RA 4OGQC 1W2EA 1OVRA 3V2QA 2R32A 1EZVI 1L4AD 1X79B 1M1JB 3M9QA 2KNCB 4PJ0H 5CHXA 2BCCE 5APTA 1IK7A 1IJDB 2QA4P 5CCHD 2WITA 1Y47A 3T97A 1AVYA 1L4AC 2BASA 1N7SD 3H1ID 4OH8B 1LT9B 1CI6A 4H44C 2RMZA 1G2CA 1SQQK 1OW8A 1VQ9P 1L0NG 4JF7A 5APUA 5APSA 2LR2A 3PH0A 2WSFH 3JCUH 5AW7B 1SFCD 3CC4P 1P84I 4EIJA 1URQD 2GUVA 1Y9BA 1AFOA 3H32A 2LXBA 5M1BA 3MGNA 1YHQP 3L4FA 3V5BA 1FJKA 1IFIA 2N9YB 3KQGA 2QJYC 4BRYA 1JO5A 1SQXJ 1N7LA 1NU1D 3GHGB 1HH0A 1NHLA 4BWNA 4Y99B 3A5TA 2AXTE 3M0AA 1S5LE 4LLHA 4UB8E 4ASWA 3E1IA 2R3CA 3JSVC 1SP4A 2K9JB 1BGYJ 2QJPC 1ZRTE 3H1HE 1Y8AA 2C9LY 4XA4A 2GM4A 3KPEA 3L70G 4RESB 1JCCA 3CX5D 3PTZA 1IC2A 2JJLA 1NKNA 3E7KA 2PP6A 3HUSA 2IYPA 2ZYGA 1FOSE 2D2CB 1JY2O 1M7LA 2Y9YA 1LP1B 4WVZA 1PP9J 4ZKPA 3VYIA 1KYOH 4KJMA 2ZT9B 1PGJA 3RK2D 1XTCC 2KUBA 1M1JA 2H89C 1BGYD 1DD4A 1NVOA 1SQBG 3II6A 2Z5IA 1MFTA 1KYOI 2KLUA 1R5LA 5APWA 1LNQA 1SS1A 2P7JA 1ZR4A 3S9OA 3B8EB 4B86A 1UIIA 3L75E 2M3EA 1LT9A 3CCSP 3H1KE 3CCLP 2P1JA 5BU8B 1T6AA 2HYNA 2QEXP 1G1IA 2QM8A 4IL6X 2HLOA 1KB9D 4N78E 2Y0EA 1BDDA 3HE4B 5TISE 2MKVA 1NTKK 2LXCB 1EC5A 3CXHE 1ZW0A 2KXPB 4YXDC 4ZKUA 4L74A 2R3SA 3CWBD 1NTKE 4U3FE 2KYVA 4EOTA 1HVVA 1EZVE 3N4XA 1DEEG 3H1HJ 2P10A 1LTGC 2J5UA 2Y0CA 3A0BH 2IFMA 3GHGA 5K5GB 1OFCX 3P7KA 2K37A 2YXQB 1FZCC 4PV1C 3LW5H 1NTMK 2ZXXA 2WPSA 2KS1B 1NTZG 2K9JA 2N9BA 1NAYA 2HODA 4WY4C 2Q3EA 1YITP 3V4WA 2FYUG 2FFDC 1RH5B 5AW6B 1KILE 2SPZA 4YXWH 3AE6C 4PD4D 5APYA 4JQ0D 4N6JA 3RBXA 1KFMA 3IN6A 1ZMEC 1KTMA 2IX7C 1N86A 1P84E 3P32A 3AEFC 3H1KJ 3FGAD 2I1KA 3AE2C 1VQNP 2V7QH 3H1IG 2YMKA 3CX5H 3CCVP 1L0LJ 1M8OB 4GODA 3IFMA 3WU2H 3RL0B 1IO4A 2Q5UA 3B5NA 2IPPA 2YIUC 3L74E 1PPJG 2WSCH 3H1JE 2CPSA 4LGDE 2OYIB 3LIDA 1L0ND 1S4XA 4U3FJ 1N8RQ 2NRGA 1GU4A 2JWDA 3Q2YA 2QRXA 4LC1A 1AQTA 4DCKA 1FZBA 3G3ZA 1HBWA 2E74D 1SQPK 3VN0A 1EDJA 5AW1B 1OZHA 2L5GB 2ZVOB 5APQA 2W27A 3H6PA 3C1LA 1SQPE 1LTJA 3CL3D 2OGUA 4H13C 4ASVA 1KYOE 3GF3A 1QLED 1ZN5A 2NPSB 3RK3B 5DJUB 1S3JA 1SQVK 1S9KD 5H2FE 1X9VA 3L70D 1JY3O 1SQVE 3A3YB 5CCHA 4GOEA 3EWKA 3KZIE 1T8ZA 2OYHB 1BGYG 1N7SA 2O1JA 3Q5SA 3CC2P 3D6YA 4GOFA 3FX0A 4C7NA 4A7PA 5AW0B 3L74J 2YNYA 3H1JJ 3BVHA 1JOCA 2Q6QA 2D2CD 3VMAA 1JY3P 1U7MA 1PP9G 5APVA 2ZT9D 3IR9A 1SFCA 2YKOA 3QWOC 3M9HA 1LWUC 5AVZB 4GDOA 4RJTA 5AVWB 1NWQA 4PD4H 2FXPA 2OYIA 3A0BE 4GT1A 1RE3C 3RGUA 1JMMA 1E5WA 2E75C 1HF9A 2WMMA 2HG5D 4PD4I 2YXRB 3VMXA 5B66E 1GW4A 2O01H 1NOHA 2YO3A 4HJGH 4PV1B 1JNMA 2H43A 3NFQA 4AUWA 4IFDK 1NU1K 2O3JA 2IBZD 2MJZA 5KAIH 3B5NC 1BSNA 1RF1C 3Q5RA 5E79H 3MP7B 4R4LA 1IFNA 3CCEP 1FJPA 4JBZA 1QGKB 1HJ0A 1EDIA 1PL5A 3MIWA 3OJAB 1FC2C 1T2KC 3L37A 5KJ7A 5CCGA 3GMAA 2Y0DA 3L71J 5KLVE 2WPVB 1RF0A 3H1HG 4XFJA 5BU5A 2W6BA 3ITKA 1J1DB 3HD7A 3SFEC 1KC8Q 3CX5E 2Z4EA 3IAOA 2IDBA 3L73D 3HE5A 3WU2E 4EI2A 2N1TA 1JB0J 1LTJC 1FE6A 1FS0E 2A45G 3VTPC 2K9YA 2WTYA 1KD1Q 1WRGA 1AJYA 5TJHA 3H1LJ 2XV5A 1BDCA 3MUDA 2JR8A 1LTBC 2AEFA 4UB6H 1OWAA 1VQPP 2C9NY 5AW9B 3TDKA 3BCCJ 2GA1A 3CI9A 1W5CE 1GL2B 2QE7H 3PHLA 1QL2A 3TGUJ 5CCHC 3VP8A 1S5LX 2Q1KA 5KLIC 3KYQA 2J58A 1HTLC 1PPJD 1SQQE 3AE9C 4QMAA 1N7SC 1OVVA 3SSUA 1BCCJ 2FKWB 4DJGA 1PGOA 1RE4C 2M5AA 2WPRA 3RL0D 1L0LG 1PGPA 3BCCD 3IF4A 5EFWB 1DD3A 3O8ZA 3M91A 3TGUD 5AVUB 1SFCC 1JY2N 1URQC 2B89A 2WSEJ 4U3FG 4H0LB 3RL0g 1X0TA 3U1CA 5KLVJ 3L72E 3AECC 1GW3A 4I2LC 1A02F 3CC7P 1NJIQ 2JP3A 2KSEA 1NAFA 2WPQA 3AE5C 4JYCA 1BE3E 4EYYQ 4O9BA 1QX8A 4OWFA 3PP5A 2HPCB 1KILB 3SWKA 1KZUB 1L2PA 2KI7B 2WVRA 2AEJA 3HTKB 2RN0A 2KP8A 4IFMA 2BCCJ 1SQXD 4ZMDA 3O6QB 3JC22 3R2PA 3P8CE 3V2RA 5KJ7D 4YTPC 2I1JA 2NPSD 3RK3D 3SWYA 5CCGD 1SVFA 1J1EC 1HGZA 4PD4E 1LWUB 1YBKA 5GTIH 3HD7D 3CCQP 2E76B 1EXJA 3S4RA 2KNCA 4I7ZB 3I56P 4I6MC 4Y28J 1SQQJ 1N73B 2N1TD 2E75B 2BCCD 1RF0C 3NXSA 3RK2C 4L76A 3HD7C 5DJTB 1JY2P 1K73Q 1PP9D 2KOGA 2YKQA 1YTZT 1L0NK 5KAIE 1VF5D 4C7RA 1H0TB 1IK9A 2BEZF 5GTHH 2FYNC 2W6AA 2HR3A 5AVSB 2P2UA 1JTHB 5AVQB 3OA7A 1L0NE 5AW2B 1YTZI 3V2NA 2J59M 5AW4B 3L72J 2IBZG 3TNUB 1U7JA 1KV4A 3KHUA 1BE3J 4JPZB 5CJ0A 3EFFK 4OVNF 2V4HA 3AE8C 4NPEA 4W7ZA 4OGQB 2ZXEB 2A06G 2JEEA 2B87B 4PJ0E 1LTIC 2KB7P 1NTME 2XDJA 1BSHA 1T3JA 3MZWB 3W67A 3L73G 1ZRTD 3H1HD 2I8DA 1LGHB 1L4AB 4HB1A 1LP1A 2Q7CA 4H44B 1Q90D 2K88A 3VMYA 3C9IA 3L75J 2QJKC 4NPDA 5BVZA 2JKVA 1SQBK 3L71G 2ZVNB 3SFDC 3JCUE 5B5EH 2ZJSE 1SQBE 5AW5B 1N73A 1GK4A 3I5CA 3HUSC 3Q1MA 3MHVA 3TYYA 1M90Q 3WUVA 4DZOA 1PGQA 3CX5I 5CBOA 4NPFX 3NTNA 4K3AA 3WUUA 2QJYB 1H0TA 1NTKJ 3H1LG 3H1KD 2W90A 3CCJP 1M1JC 3VMZA 2H8PD 1VQ4P 3H25A 3BCCG 1GL2D 1Q86Q 1PZQA 3HE4A 1JMBA 3USSA 3FWLA 4N78D 1KQFB 1L0LD 3TGUG 2KLVA 1AA0A 3QH9A 2QJPB 1QVGO 3EFGA 1JY3N 2RH0A 1KN7A 1LT9C 3CXHD 1NTMJ 2XU6A 3M0DA 1RQUA 3Q5PA 1BCCG 1OXZA 1ZR2A 1D7MA 1NTKD 4U3FD 1GK6A 2E74C 1EZVD 4XE5B 1KB9H 1J2JB 2AXCA 4D6TE 2RKLA 1W2BO 2BEQD 3N7NA 5GTIE 1YYCA 1NTZK 2KS1A 1OMIA 1KB9I 2R5DA 4H0LD 3F5HA 2QSIA 1SQXG 2FYUK 3CMAP 1NTZE 2FXMA 3OW2O 4W7YA 2R5BA 2PGDA 3D71A 4IFFA 1VQ5P 2FYUE 4KHXA 1SQBJ 1VQOP 3GHGC 4Y99C 1KILD 5AW3B 2E5TA 2DW3A 3D6ZA 2AXTH 1VL2A 1S5LH 4UB8H 1EXIA 2BCCG 1VQ6P 1M57D 1P84D 3A7OA 4L73A 4KT0J 2JO1A 3PRJA 3H1IE 1MUUA 2CPBA 2E76D 2D2CC 3R4YA 1FDIA 2M3BA 4U7JA 1SLQA 1CI6B 2XNXA 2M0BA 1LTSC 2WZ7A 3L74D 1PPJE 2ZT9C 1SQQG 3F89A 3H1JD 3L35A 2A45H 3G4SP 1SQPJ 1OW6A 2G3AA 4AYCA 1FZCB 3TK1A 4DT0A 4D6TJ 2FXOA 3B71A 1R5SA 3H32B 4WY4B 2FY8A 1FZFA 3CLQA 1JUNA 2FFDB 3TF5A 1NU1E 5KKZC 1S72P 1XTGB 1NTZJ 1QL1A 3UIAA 1FDOA 1HGVA 1JCDA 2POHA 1SQVJ 1PFIA 1SQPD 1VQKP 3G9RA 4JYBA 2FYUJ 3CD6P 2YMYA 2QVAA 2A06D 2NPSA 5C39A 1AV1A 1EDKA 2IFNA 4OGQD 2QM7A 2ZYAA 3CXHH 3WUTA 1A02J 4YPCA 1MV8A 1MFZA 1YIJP 4L75A 2YO2A 2OYHA 3AE1C 1GZLA 3GW6A 2YIUB 4HYTB 3H1IJ 5AVYB 3V4QA 1BGYE 3I55P
chains in the Genus database with same CATH topology
1N86A 2GUSA 1DH3A 3P32A 5CMZA 1KILC 2P67A 2PAJA 2I1KA 4I6MC 1HJBA 1RE4A 1H88A 1N73B 2N1TD 3RK2C 3NXSA 1RF0C 1GU5A 1FBMA 3HD7C 2ZFCA 1JY2P 3IFMA 3LIEA 3KDPB 3RL0B 2KOGA 2YKQA 1IO4A 2Q5UA 1G2CB 3B5NA 1YTZT 1L0NK 2IPPA 4C7RA 1WT6A 1FAVA 1HWTC 2WSCH 2WT7A 1IFMA 1G1JA 1IK9A 1URQA 2CPSA 2XKMA 4LGDE 2OYIB 1H89A 2W6AA 3LIDA 5AVSB 2P2UA 1JTHB 5CJ4A 5AVQB 3OA7A 4AQRD 5AW2B 1VDFA 2VRSA 1YTZI 3V2NA 3OAKA 2J59M 5AW4B 2A45I 1FZCA 1HUCA 1LTTC 1N73C 1GU4A 5APXA 2C0WA 2Q9IA 4LC1A 3B5ND 2HFED 1FZBA 3TNUB 3G3ZA 1HBWA 3RL0C 1SQPK 3VN0A 4N3YB 4WY4A 5AW1B 3P8MC 3VP9A 2L5GB 1X8YA 5APQA 5CJ0A 2FFDA 4WB4A 2W27A 3H6PA 2OYIC 2E43A 1FZAA 1T3UA 1T2KD 1LTJA 4W7ZA 3CL3D 1NH4A 2ZXEB 5AVXB 2JEEA 1SQXK 2E42A 1ZN5A 1LTIC 2KB7P 2XDJA 5KLVK 5AVTB 2NPSB 3RK3B 1Z56A 1FZEA 3BRVB 3L36A 3M06A 1IFJA 1T3JA 1SQVK 2KSJA 1S9KD 2HODB 3M0DC 1X9VA 2C0XA 3BATA 4C46A 1JY3O 1LGHB 3HUSB 1L4AB 1MZ9A 3A3YB 5CCHA 2Q7CA 3V2PA 2M8RA 3VMYA 1W2EA 3C9IA 3V2QA 2OYHB 1T8ZA 1N7SA 5BVZA 2O1JA 2R32A 1SQBK 1L4AD 1KQLA 1X79B 1M1JB 5KJ7C 2NPSC 4C7NA 3M9QA 3RK3C 5CCGC 5AW0B 2YNYA 3BVHA 1JOCA 5CHXA 1GD2E 2O1KA 5APTA 1IJDB 5AW5B 5CCHD 2WITA 1N73A 4I1LA 3T97A 1GL2A 1GK4A 1JY3P 4DOJA 3I5CA 3HUSC 1L4AC 5APVA 2BASA 3TYYA 1N7SD 4DZOA 3IR9A 4OH8B 1SFCA 2YKOA 1LT9B 1CI6A 3M9HA 1LWUC 5AVZB 2N1TC 1AQ5A 1G2CA 1SQQK 3NTNA 5AVWB 1CSBA 1NWQA 2OYHC 3B5NB 3U59A 1RF1B 4JF7A 2OYIA 4GT1A 1M1JC 5APUA 2OARA 1RE3C 3VMZA 1JMMA 2H8PD 1L0LK 1E5WA 1LTAC 1GL2D 5APSA 2HG5D 3HE4A 1GDTA 3M9BA 3VMXA 2WSFH 5AW7B 1GW4A 2O01H 1SFCD 1NOHA 2YO3A 4N78D 1JNMA 4EIJA 1URQD 2GUVA 2KLVA 2H43A 1AFOA 3H32A 3NFQA 1CZQA 3MGNA 4AUWA 3L4FA 3EFGA 1JY3N 3V5BA 4IFDK 1FJKA 1N2DC 1LT9C 1IFIA 3U1AA 1NU1K 3KQGA 2XU6A 2MJZA 3M0DA 3B5NC 1DEBA 1CW5A 1OXZA 1ZR2A 1JO5A 1GK6A 1RF1C 1N7LA 3GHGB 1HH0A 4XE5B 1NHLA 3SWFA 4Y99B 1J2JB 3EQ2A 4WBAA 3A5TA 2LKMA 1IFNA 1FJPA 1LTJB 3N7NA 3M0AA 4LLHA 4WY4D 1YYCA 3E1IA 1NTZK 3MIWA 2R3CA 1KILA 2HPCA 3OJAB 1T2KC 1SP4A 2R5DA 3L37A 5KJ7A 1S9KE 3HTKA 5CCGA 2FYUK 1DX7A 2FXMA 2C9LY 1RF0A 4XA4A 3A2AA 5BU5A 2GM4A 2WWWA 3KPEA 2W6BA 4W7YA 1J1DB 2R5BA 4RESB 3HD7A 1JCCA 4IFFA 1IC2A 2Z4EA 2YKPA 2JJLA 3BRTB 1NKNA 4KHXA 3HE5A 2PP6A 3HUSA 3GHGC 1FOSE 4Y99C 3VOPA 2Q3IA 1KILD 3P8CD 1VPCA 1JY2O 1M7LA 1LWUA 2N1TA 2XZRA 1LTJC 5AW3B 4ZKPA 2A45G 3VYIA 3HRNA 1RY3A 3VTPC 3NMDA 1N7SB 3RK2D 2WTYA 1XTCC 3BASA 1WRGA 1M1JA 2FYZA 1RE3A 1NO4A 1EQ7A 3II6A 3A7OA 4C7NB 2XV5A 3TSIA 2Z5IA 3MUDA 1LTBC 1J1DC 2WSEH 1OWAA 2C9NY 5AW9B 3CI9A 5APWA 2P7JA 1ZR4A 3B8EB 4B86A 1MUUA 2CPBA 1GL2B 1QL2A 5CCHC 1LT9A 2M3BA 3VP8A 1SLQA 1SFCB 1FU1A 2WT7B 1CI6B 1KFNA 3KYQA 2XNXA 2P1JA 1URQB 5BU8B 2J58A 2HYNA 1HTLC 1JTHA 1LTSC 2WZ7A 1G1IA 1N7SC 2QM8A 5AW8B 3MTUE 1RF1A 3L35A 2HLOA 2A45H 2FKWB 4AYCA 1RE4C 1FZCB 5AVRB 4N78E 2WPRA 3RL0D 3TK1A 4GKGA 3TNUA 3HE4B 1NTKK 1FOSF 3O8ZA 1GL2C 3M91A 3H32B 4ZKUA 4WY4B 1FDMA 5AVUB 1SFCC 1FZFA 2KYVA 3CLQA 4W80A 3WMM0 4EOTA 2FFDB 1JUNA 1HVVA 1JY2N 1URQC 3N4XA 3U1CA 1GTWA 1IFDA 1NKZB 1XTGB 1QL1A 3UIAA 1LTGC 1FZGA 1GW3A 1HGVA 2IFMA 3GHGA 1JCDA 4GIFA 4I2LC 2POHA 1ZLLA 1PFIA 1A02F 1J1EB 3P7KA 2Z5HA 1FZCC 4JYBA 3LW5H 1NTMK 2YMYA 1NAFA 2WPQA 4JYCA 2NPSA 4M3LA 2WPSA 4O9BA 3PP5A 2HPCB 1KILB 2N9BA 4HH2A 1KZUB 3MD0A 2HODA 4WY4C 3HTKB 5KTBA 2IFNA 2KP8A 4IFMA 2QM7A 3V4WA 3RK2B 2FFDC 5AW6B 1L4AA 3HD7B 3R2PA 1A02J 3P8CE 1MV8A 1MFZA 3V2RA 5KJ7D 2YO2A 1H8AA 2I1JA 2NPSD 3HE5B 2OYHA 3RK3D 3SWYA 5CCGD 1GZLA 1SVFA 1J1EC 4HYTB 5APYA 1HGZA 4N6JA 2H7HA 1KFMA 5AVYB 5AVVB 1LWUB 2N1TB 3V4QA 2IX7C 3HD7D 1ZV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KQG A;  1DH3 A;  3L36 A;  3M06 A;  2XU6 A;  3P32 A;  2P67 A;  5CMZ A;  3M0D A;  1S9K D;  2QM8 A;  5AW8 B;  3L35 A;  4I6M C;  1OXZ A;  1HJB A;  1GK6 A;  1H88 A;  4AYC A;  4C46 A;  4XE5 B;  3SWF A;  1J2J B;  5AVR B;  3NXS A;  1GU5 A;  2WPR A;  3TK1 A;  3A5T A;  3A3Y B;  4GKG A;  2Q7C A;  3TNU A;  3HE4 B;  2ZFC A;  3M0A A;  3VMY A;  1YYC A;  3LIE A;  3KDP B;  2R3C A;  1IO4 A;  2Q5U A;  1T2K C;  1SP4 A;  1G2C B;  1FOS F;  3O8Z A;  2R32 A;  2R5D A;  3L37 A;  2IPP A;  3M91 A;  1FAV A;  1HWT C;  1S9K E;  2WT7 A;  3HTK A;  1KQL A;  5AVU B;  4C7N A;  4EOT A;  1JUN A;  2C9L Y;  5AW0 B;  3A2A A;  2WWW A;  2YNY A;  1H89 A;  2W6A A;  2R5B A;  3LID A;  5AVS B;  2P2U A;  1GTW A;  4RES B;  5AVQ B;  1GD2 E;  3UIA A;  4AQR D;  5AW2 B;  2VRS A;  5APT A;  5AW5 B;  2JJL A;  3OAK A;  5AW4 B;  4I2L C;  4KHX A;  3HE5 A;  1HUC A;  1A02 F;  3T97 A;  3P7K A;  2Z5H A;  1GU4 A;  1GK4 A;  1FOS E;  4JYB A;  3I5C A;  2Q3I A;  5APX A;  5APV A;  2BAS A;  3TYY A;  4LC1 A;  1NAF A;  2WPQ A;  4JYC A;  3IR9 A;  2XZR A;  3TNU B;  4DZO A;  5AW3 B;  1CI6 A;  3M9H A;  4M3L A;  5AVZ B;  2WPS A;  3VYI A;  1HBW A;  3VTP C;  3NMD A;  3NTN A;  5AVW B;  1CSB A;  2N9B A;  3VN0 A;  1NWQ A;  2WTY A;  5AW1 B;  3P8M C;  3MD0 A;  1X8Y A;  5APQ A;  2KP8 A;  4GT1 A;  3A7O A;  5APU A;  2XV5 A;  4C7N B;  2W27 A;  2QM7 A;  3V4W A;  2Z5I A;  3VMZ A;  2E43 A;  5AW6 B;  1T2K D;  1OWA A;  5APS A;  1A02 J;  3HE4 A;  2C9N Y;  1MV8 A;  5AW9 B;  3M9B A;  3VMX A;  1MFZ A;  5APW A;  2P7J A;  5AW7 B;  2ZXE B;  5AVX B;  2YO2 A;  3B8E B;  1H8A A;  2YO3 A;  3HE5 B;  4B86 A;  1MUU A;  1GZL A;  1JNM A;  2E42 A;  4HYT B;  3NFQ A;  1CZQ A;  3MGN A;  5APY A;  4AUW A;  2H7H A;  5AVY B;  5AVV B;  3V5B A;  1SLQ A;  5AVT B;  3V4Q A;  2WT7 B;  1CI6 B; 
#chains in the Genus database with same CATH topology
 2GUS A;  1DH3 A;  3L71 D;  2P67 A;  2Y9Z A;  1WMK A;  3KXD A;  2UWJ E;  4IL6 H;  3W68 A;  2QG4 A;  1H88 A;  4H44 D;  3LW5 J;  4R4M A;  1GU5 A;  3V6I A;  1FBM A;  1IFP A;  1M1K Q;  3L75 G;  2ZFC A;  3KDP B;  3H1K G;  1PP9 E;  1WT6 A;  1S2E A;  1HWT C;  1IFM A;  3CCM P;  1H89 A;  1KB9 E;  3H1L D;  2OTL P;  2OTJ P;  2NZ2 A;  5CJ4 A;  1VDF A;  4H13 B;  1NU1 J;  2E74 B;  1P84 H;  1FZC A;  1LTT C;  2C0W A;  2Q9I A;  1OX3 A;  1DIP A;  3CWB E;  1K04 A;  1YJ9 P;  3RL0 C;  1NTK G;  1RHZ B;  4N3Y B;  4WY4 A;  3P8M C;  2K3R A;  4CPG A;  1EZV G;  2G8Y A;  1X8Y A;  2V7Q J;  2FFD A;  2OYI C;  2E43 A;  1BCC D;  1FZA A;  1T3U A;  1TU3 F;  3CCR P;  3FXD A;  4WWI A;  2WSC J;  1LT1 A;  1VQ8 P;  5AVT B;  1NTM G;  1Z56 A;  3L36 A;  1IFJ A;  3AEA C;  5KLV D;  2HOD B;  2C0X A;  3BAT A;  1MZ9 A;  2IBZ I;  1ZXG A;  4MN4 C;  1U57 A;  3AE3 C;  1YI2 P;  1KQL A;  5KJ7 C;  2NPS C;  4RKU J;  3RK3 C;  5CCG C;  1GD2 E;  3E1R A;  2O1K A;  1AVO A;  4I1L A;  1GL2 A;  4DOJ A;  2B88 A;  1Q7Y Q;  5H2F H;  2JWA A;  3FXE A;  2H88 C;  1K05 A;  3L74 G;  3H1J G;  2N1T C;  1AQ5 A;  5E79 E;  1CSB A;  2OYH C;  3B5N B;  3U59 A;  3CWB J;  1RF1 B;  1KQG B;  2W6J H;  2OAR A;  3KZI H;  5KKZ B;  1SQQ D;  3G6E P;  1L0L K;  1VF5 C;  1LTA C;  3MUD C;  4TT3 H;  2IYO A;  1GDT A;  3M9B A;  3K5B A;  1ZP0 C;  3ZDM A;  1L0L E;  1CZQ A;  1VQM P;  1OIP A;  2W83 C;  1N2D C;  3U1A A;  3Q3D A;  3CME P;  1DEB A;  2QIW A;  4PV1 D;  1CW5 A;  1SQP G;  2OYO A;  4RO0 A;  1UIX A;  3SWF A;  3EQ2 A;  4WBA A;  2LKM A;  4D6T G;  2JDI H;  3L72 D;  1LTJ B;  4K35 A;  4WY4 D;  1EDL A;  1E79 H;  2HPC A;  1KIL A;  1VQL P;  1BE3 D;  4UB6 E;  1S9K E;  3HTK A;  4IL6 E;  5B66 H;  1DX7 A;  3L70 E;  3A2A A;  2WWW A;  2E5Y A;  3O6Q A;  4HKZ H;  1YJW P;  1SQV G;  1KMI Z;  2O01 J;  2YKP A;  3BRT B;  1Q2N A;  3RBZ A;  3VOP A;  2Q3I A;  3P8C D;  4BXL A;  1Q81 Q;  1VPC A;  1LWU A;  5KLI B;  2XZR A;  3HRN A;  1RY3 A;  2KZJ A;  3NMD A;  3C8V A;  1N7S B;  3BAS A;  1QVF O;  2FYZ A;  1RE3 A;  1NO4 A;  1EQ7 A;  1KOR A;  4C7N B;  3TSI A;  1L0N J;  1NGM B;  2W8Z A;  1J1D C;  2WSE H;  1S1C X;  2R44 A;  2PRR A;  2IZ0 A;  2WSS H;  2ITA A;  3A0H H;  5KAF H;  3L75 D;  2O01 N;  5L8R J;  1SFC B;  1FU1 A;  2ZYD A;  2WT7 B;  1KFN A;  1URQ B;  2WQY C;  2ZAE B;  1JTH A;  5AW8 B;  3MTU E;  1RF1 A;  1NYH A;  1X22 A;  5AVR B;  1YJN P;  4GKG A;  1PIX A;  3TNU A;  1LJ2 A;  1FOS F;  1GL2 C;  2IBZ E;  2P58 A;  1FDM A;  2L91 A;  4H13 D;  4W80 A;  3WMM 0;  3GF7 A;  1GTW A;  1IFD A;  1NKZ B;  1NU1 G;  3L70 J;  1FZG A;  3D70 A;  4GIF A;  1ZLL A;  4ZNC A;  1J1E B;  2Z5H A;  2B87 A;  3PJS K;  2AEM A;  4IOI H;  2A06 E;  1QEX A;  4M3L A;  2KIK A;  5KLV G;  4HH2 A;  1NTM D;  3AEE C;  3MD0 A;  2WSF J;  2CK3 H;  3PLN A;  5KTB A;  3RK2 B;  3L73 E;  1L4A A;  4H0L C;  3GG2 A;  1USE A;  3HD7 B;  3G71 P;  1H8A A;  5CBN A;  3HE5 B;  5GTH E;  2KK7 A;  1YQ3 C;  2PFX A;  4TLF A;  2H7H A;  5AVV B;  3S1K A;  2N1T B;  1Q82 Q;  2FYN B;  1ZV8 A;  5CMZ A;  1KIL C;  2PAJ A;  3L71 E;  1M56 D;  1HJB A;  1RE4 A;  3AEG C;  1K8A Q;  1VQ7 P;  1VF5 B;  1SQB D;  3T97 B;  2IZ1 A;  1GMJ A;  3FWN A;  3LIE A;  1G2C B;  3CPW O;  1FAV A;  2E75 D;  2WT7 A;  3AEB C;  1G1J A;  1URQ A;  2XKM A;  4Z1M H;  1OVU A;  1YQ4 C;  2E76 C;  1ZOY C;  3H1L E;  4I7Z C;  4AQR D;  2VRS A;  3OAK A;  2A45 I;  1OW7 A;  3AED C;  1HUC A;  3BCC E;  2M5A B;  1N73 C;  5APX A;  1MKM A;  3B5N D;  2HFE D;  1IZN B;  3GLM A;  3TGU E;  3CWB G;  2OTK E;  3VP9 A;  4BRY B;  2XND H;  4WB4 A;  3CCU P;  3L72 G;  1BCC E;  1T2K D;  2FBW C;  3L73 J;  1NH4 A;  2K1A A;  2QJK B;  3AE7 C;  1BE3 G;  5AVX B;  4D6T D;  1KYO D;  1JEK A;  1SQX K;  2E42 A;  2KZI A;  5B5E E;  2OQQ A;  5TIS H;  5KLV K;  1USD A;  1FZE A;  3ABV C;  3BRV B;  3M06 A;  1RQV A;  1R8E A;  1SQX E;  2KSJ A;  2B9B A;  1KQS O;  3M0D C;  1NTZ D;  3B4S A;  4EDF A;  1JM0 A;  3AE4 C;  4C46 A;  1SQV D;  3A0H E;  3HUS B;  5KAF E;  3RK3 E;  3CXH I;  1K9M Q;  1PV3 A;  2FYU D;  3V2P A;  2M8R A;  4OGQ C;  1W2E A;  1OVR A;  3V2Q A;  2R32 A;  1EZV I;  1L4A D;  1X79 B;  1M1J B;  3M9Q A;  2KNC B;  4PJ0 H;  5CHX A;  2BCC E;  5APT A;  1IK7 A;  1IJD B;  2QA4 P;  5CCH D;  2WIT A;  1Y47 A;  3T97 A;  1AVY A;  1L4A C;  2BAS A;  1N7S D;  3H1I D;  4OH8 B;  1LT9 B;  1CI6 A;  4H44 C;  2RMZ A;  1G2C A;  1SQQ K;  1OW8 A;  1VQ9 P;  1L0N G;  4JF7 A;  5APU A;  5APS A;  2LR2 A;  3PH0 A;  2WSF H;  3JCU H;  5AW7 B;  1SFC D;  3CC4 P;  1P84 I;  4EIJ A;  1URQ D;  2GUV A;  1Y9B A;  1AFO A;  3H32 A;  2LXB A;  5M1B A;  3MGN A;  1YHQ P;  3L4F A;  3V5B A;  1FJK A;  1IFI A;  2N9Y B;  3KQG A;  2QJY C;  4BRY A;  1JO5 A;  1SQX J;  1N7L A;  1NU1 D;  3GHG B;  1HH0 A;  1NHL A;  4BWN A;  4Y99 B;  3A5T A;  2AXT E;  3M0A A;  1S5L E;  4LLH A;  4UB8 E;  4ASW A;  3E1I A;  2R3C A;  3JSV C;  1SP4 A;  2K9J B;  1BGY J;  2QJP C;  1ZRT E;  3H1H E;  1Y8A A;  2C9L Y;  4XA4 A;  2GM4 A;  3KPE A;  3L70 G;  4RES B;  1JCC A;  3CX5 D;  3PTZ A;  1IC2 A;  2JJL A;  1NKN A;  3E7K A;  2PP6 A;  3HUS A;  2IYP A;  2ZYG A;  1FOS E;  2D2C B;  1JY2 O;  1M7L A;  2Y9Y A;  1LP1 B;  4WVZ A;  1PP9 J;  4ZKP A;  3VYI A;  1KYO H;  4KJM A;  2ZT9 B;  1PGJ A;  3RK2 D;  1XTC C;  2KUB A;  1M1J A;  2H89 C;  1BGY D;  1DD4 A;  1NVO A;  1SQB G;  3II6 A;  2Z5I A;  1MFT A;  1KYO I;  2KLU A;  1R5L A;  5APW A;  1LNQ A;  1SS1 A;  2P7J A;  1ZR4 A;  3S9O A;  3B8E B;  4B86 A;  1UII A;  3L75 E;  2M3E A;  1LT9 A;  3CCS P;  3H1K E;  3CCL P;  2P1J A;  5BU8 B;  1T6A A;  2HYN A;  2QEX P;  1G1I A;  2QM8 A;  4IL6 X;  2HLO A;  1KB9 D;  4N78 E;  2Y0E A;  1BDD A;  3HE4 B;  5TIS E;  2MKV A;  1NTK K;  2LXC B;  1EC5 A;  3CXH E;  1ZW0 A;  2KXP B;  4YXD C;  4ZKU A;  4L74 A;  2R3S A;  3CWB D;  1NTK E;  4U3F E;  2KYV A;  4EOT A;  1HVV A;  1EZV E;  3N4X A;  1DEE G;  3H1H J;  2P10 A;  1LTG C;  2J5U A;  2Y0C A;  3A0B H;  2IFM A;  3GHG A;  5K5G B;  1OFC X;  3P7K A;  2K37 A;  2YXQ B;  1FZC C;  4PV1 C;  3LW5 H;  1NTM K;  2ZXX A;  2WPS A;  2KS1 B;  1NTZ G;  2K9J A;  2N9B A;  1NAY A;  2HOD A;  4WY4 C;  2Q3E A;  1YIT P;  3V4W A;  2FYU G;  2FFD C;  1RH5 B;  5AW6 B;  1KIL E;  2SPZ A;  4YXW H;  3AE6 C;  4PD4 D;  5APY A;  4JQ0 D;  4N6J A;  3RBX A;  1KFM A;  3IN6 A;  1ZME C;  1KTM A;  2IX7 C;  1N86 A;  1P84 E;  3P32 A;  3AEF C;  3H1K J;  3FGA D;  2I1K A;  3AE2 C;  1VQN P;  2V7Q H;  3H1I G;  2YMK A;  3CX5 H;  3CCV P;  1L0L J;  1M8O B;  4GOD A;  3IFM A;  3WU2 H;  3RL0 B;  1IO4 A;  2Q5U A;  3B5N A;  2IPP A;  2YIU C;  3L74 E;  1PPJ G;  2WSC H;  3H1J E;  2CPS A;  4LGD E;  2OYI B;  3LID A;  1L0N D;  1S4X A;  4U3F J;  1N8R Q;  2NRG A;  1GU4 A;  2JWD A;  3Q2Y A;  2QRX A;  4LC1 A;  1AQT A;  4DCK A;  1FZB A;  3G3Z A;  1HBW A;  2E74 D;  1SQP K;  3VN0 A;  1EDJ A;  5AW1 B;  1OZH A;  2L5G B;  2ZVO B;  5APQ A;  2W27 A;  3H6P A;  3C1L A;  1SQP E;  1LTJ A;  3CL3 D;  2OGU A;  4H13 C;  4ASV A;  1KYO E;  3GF3 A;  1QLE D;  1ZN5 A;  2NPS B;  3RK3 B;  5DJU B;  1S3J A;  1SQV K;  1S9K D;  5H2F E;  1X9V A;  3L70 D;  1JY3 O;  1SQV E;  3A3Y B;  5CCH A;  4GOE A;  3EWK A;  3KZI E;  1T8Z A;  2OYH B;  1BGY G;  1N7S A;  2O1J A;  3Q5S A;  3CC2 P;  3D6Y A;  4GOF A;  3FX0 A;  4C7N A;  4A7P A;  5AW0 B;  3L74 J;  2YNY A;  3H1J J;  3BVH A;  1JOC A;  2Q6Q A;  2D2C D;  3VMA A;  1JY3 P;  1U7M A;  1PP9 G;  5APV A;  2ZT9 D;  3IR9 A;  1SFC A;  2YKO A;  3QWO C;  3M9H A;  1LWU C;  5AVZ B;  4GDO A;  4RJT A;  5AVW B;  1NWQ A;  4PD4 H;  2FXP A;  2OYI A;  3A0B E;  4GT1 A;  1RE3 C;  3RGU A;  1JMM A;  1E5W A;  2E75 C;  1HF9 A;  2WMM A;  2HG5 D;  4PD4 I;  2YXR B;  3VMX A;  5B66 E;  1GW4 A;  2O01 H;  1NOH A;  2YO3 A;  4HJG H;  4PV1 B;  1JNM A;  2H43 A;  3NFQ A;  4AUW A;  4IFD K;  1NU1 K;  2O3J A;  2IBZ D;  2MJZ A;  5KAI H;  3B5N C;  1BSN A;  1RF1 C;  3Q5R A;  5E79 H;  3MP7 B;  4R4L A;  1IFN A;  3CCE P;  1FJP A;  4JBZ A;  1QGK B;  1HJ0 A;  1EDI A;  1PL5 A;  3MIW A;  3OJA B;  1FC2 C;  1T2K C;  3L37 A;  5KJ7 A;  5CCG A;  3GMA A;  2Y0D A;  3L71 J;  5KLV E;  2WPV B;  1RF0 A;  3H1H G;  4XFJ A;  5BU5 A;  2W6B A;  3ITK A;  1J1D B;  3HD7 A;  3SFE C;  1KC8 Q;  3CX5 E;  2Z4E A;  3IAO A;  2IDB A;  3L73 D;  3HE5 A;  3WU2 E;  4EI2 A;  2N1T A;  1JB0 J;  1LTJ C;  1FE6 A;  1FS0 E;  2A45 G;  3VTP C;  2K9Y A;  2WTY A;  1KD1 Q;  1WRG A;  1AJY A;  5TJH A;  3H1L J;  2XV5 A;  1BDC A;  3MUD A;  2JR8 A;  1LTB C;  2AEF A;  4UB6 H;  1OWA A;  1VQP P;  2C9N Y;  5AW9 B;  3TDK A;  3BCC J;  2GA1 A;  3CI9 A;  1W5C E;  1GL2 B;  2QE7 H;  3PHL A;  1QL2 A;  3TGU J;  5CCH C;  3VP8 A;  1S5L X;  2Q1K A;  5KLI C;  3KYQ A;  2J58 A;  1HTL C;  1PPJ D;  1SQQ E;  3AE9 C;  4QMA A;  1N7S C;  1OVV A;  3SSU A;  1BCC J;  2FKW B;  4DJG A;  1PGO A;  1RE4 C;  2M5A A;  2WPR A;  3RL0 D;  1L0L G;  1PGP A;  3BCC D;  3IF4 A;  5EFW B;  1DD3 A;  3O8Z A;  3M91 A;  3TGU D;  5AVU B;  1SFC C;  1JY2 N;  1URQ C;  2B89 A;  2WSE J;  4U3F G;  4H0L B;  3RL0 g;  1X0T A;  3U1C A;  5KLV J;  3L72 E;  3AEC C;  1GW3 A;  4I2L C;  1A02 F;  3CC7 P;  1NJI Q;  2JP3 A;  2KSE A;  1NAF A;  2WPQ A;  3AE5 C;  4JYC A;  1BE3 E;  4EYY Q;  4O9B A;  1QX8 A;  4OWF A;  3PP5 A;  2HPC B;  1KIL B;  3SWK A;  1KZU B;  1L2P A;  2KI7 B;  2WVR A;  2AEJ A;  3HTK B;  2RN0 A;  2KP8 A;  4IFM A;  2BCC J;  1SQX D;  4ZMD A;  3O6Q B;  3JC2 2;  3R2P A;  3P8C E;  3V2R A;  5KJ7 D;  4YTP C;  2I1J A;  2NPS D;  3RK3 D;  3SWY A;  5CCG D;  1SVF A;  1J1E C;  1HGZ A;  4PD4 E;  1LWU B;  1YBK A;  5GTI H;  3HD7 D;  3CCQ P;  2E76 B;  1EXJ A;  3S4R A;  2KNC A;  4I7Z B;  3I56 P;  4I6M C;  4Y28 J;  1SQQ J;  1N73 B;  2N1T D;  2E75 B;  2BCC D;  1RF0 C;  3NXS A;  3RK2 C;  4L76 A;  3HD7 C;  5DJT B;  1JY2 P;  1K73 Q;  1PP9 D;  2KOG A;  2YKQ A;  1YTZ T;  1L0N K;  5KAI E;  1VF5 D;  4C7R A;  1H0T B;  1IK9 A;  2BEZ F;  5GTH H;  2FYN C;  2W6A A;  2HR3 A;  5AVS B;  2P2U A;  1JTH B;  5AVQ B;  3OA7 A;  1L0N E;  5AW2 B;  1YTZ I;  3V2N A;  2J59 M;  5AW4 B;  3L72 J;  2IBZ G;  3TNU B;  1U7J A;  1KV4 A;  3KHU A;  1BE3 J;  4JPZ B;  5CJ0 A;  3EFF K;  4OVN F;  2V4H A;  3AE8 C;  4NPE A;  4W7Z A;  4OGQ B;  2ZXE B;  2A06 G;  2JEE A;  2B87 B;  4PJ0 E;  1LTI C;  2KB7 P;  1NTM E;  2XDJ A;  1BSH A;  1T3J A;  3MZW B;  3W67 A;  3L73 G;  1ZRT D;  3H1H D;  2I8D A;  1LGH B;  1L4A B;  4HB1 A;  1LP1 A;  2Q7C A;  4H44 B;  1Q90 D;  2K88 A;  3VMY A;  3C9I A;  3L75 J;  2QJK C;  4NPD A;  5BVZ A;  2JKV A;  1SQB K;  3L71 G;  2ZVN B;  3SFD C;  3JCU E;  5B5E H;  2ZJS E;  1SQB E;  5AW5 B;  1N73 A;  1GK4 A;  3I5C A;  3HUS C;  3Q1M A;  3MHV A;  3TYY A;  1M90 Q;  3WUV A;  4DZO A;  1PGQ A;  3CX5 I;  5CBO A;  4NPF X;  3NTN A;  4K3A A;  3WUU A;  2QJY B;  1H0T A;  1NTK J;  3H1L G;  3H1K D;  2W90 A;  3CCJ P;  1M1J C;  3VMZ A;  2H8P D;  1VQ4 P;  3H25 A;  3BCC G;  1GL2 D;  1Q86 Q;  1PZQ A;  3HE4 A;  1JMB A;  3USS A;  3FWL A;  4N78 D;  1KQF B;  1L0L D;  3TGU G;  2KLV A;  1AA0 A;  3QH9 A;  2QJP B;  1QVG O;  3EFG A;  1JY3 N;  2RH0 A;  1KN7 A;  1LT9 C;  3CXH D;  1NTM J;  2XU6 A;  3M0D A;  1RQU A;  3Q5P A;  1BCC G;  1OXZ A;  1ZR2 A;  1D7M A;  1NTK D;  4U3F D;  1GK6 A;  2E74 C;  1EZV D;  4XE5 B;  1KB9 H;  1J2J B;  2AXC A;  4D6T E;  2RKL A;  1W2B O;  2BEQ D;  3N7N A;  5GTI E;  1YYC A;  1NTZ K;  2KS1 A;  1OMI A;  1KB9 I;  2R5D A;  4H0L D;  3F5H A;  2QSI A;  1SQX G;  2FYU K;  3CMA P;  1NTZ E;  2FXM A;  3OW2 O;  4W7Y A;  2R5B A;  2PGD A;  3D71 A;  4IFF A;  1VQ5 P;  2FYU E;  4KHX A;  1SQB J;  1VQO P;  3GHG C;  4Y99 C;  1KIL D;  5AW3 B;  2E5T A;  2DW3 A;  3D6Z A;  2AXT H;  1VL2 A;  1S5L H;  4UB8 H;  1EXI A;  2BCC G;  1VQ6 P;  1M57 D;  1P84 D;  3A7O A;  4L73 A;  4KT0 J;  2JO1 A;  3PRJ A;  3H1I E;  1MUU A;  2CPB A;  2E76 D;  2D2C C;  3R4Y A;  1FDI A;  2M3B A;  4U7J A;  1SLQ A;  1CI6 B;  2XNX A;  2M0B A;  1LTS C;  2WZ7 A;  3L74 D;  1PPJ E;  2ZT9 C;  1SQQ G;  3F89 A;  3H1J D;  3L35 A;  2A45 H;  3G4S P;  1SQP J;  1OW6 A;  2G3A A;  4AYC A;  1FZC B;  3TK1 A;  4DT0 A;  4D6T J;  2FXO A;  3B71 A;  1R5S A;  3H32 B;  4WY4 B;  2FY8 A;  1FZF A;  3CLQ A;  1JUN A;  2FFD B;  3TF5 A;  1NU1 E;  5KKZ C;  1S72 P;  1XTG B;  1NTZ J;  1QL1 A;  3UIA A;  1FDO A;  1HGV A;  1JCD A;  2POH A;  1SQV J;  1PFI A;  1SQP D;  1VQK P;  3G9R A;  4JYB A;  2FYU J;  3CD6 P;  2YMY A;  2QVA A;  2A06 D;  2NPS A;  5C39 A;  1AV1 A;  1EDK A;  2IFN A;  4OGQ D;  2QM7 A;  2ZYA A;  3CXH H;  3WUT A;  1A02 J;  4YPC A;  1MV8 A;  1MFZ A;  1YIJ P;  4L75 A;  2YO2 A;  2OYH A;  3AE1 C;  1GZL A;  3GW6 A;  2YIU B;  4HYT B;  3H1I J;  5AVY B;  3V4Q A;  1BGY E;  3I55 P; 
#chains in the Genus database with same CATH homology
 1N86 A;  2GUS A;  1DH3 A;  3P32 A;  5CMZ A;  1KIL C;  2P67 A;  2PAJ A;  2I1K A;  4I6M C;  1HJB A;  1RE4 A;  1H88 A;  1N73 B;  2N1T D;  3RK2 C;  3NXS A;  1RF0 C;  1GU5 A;  1FBM A;  3HD7 C;  2ZFC A;  1JY2 P;  3IFM A;  3LIE A;  3KDP B;  3RL0 B;  2KOG A;  2YKQ A;  1IO4 A;  2Q5U A;  1G2C B;  3B5N A;  1YTZ T;  1L0N K;  2IPP A;  4C7R A;  1WT6 A;  1FAV A;  1HWT C;  2WSC H;  2WT7 A;  1IFM A;  1G1J A;  1IK9 A;  1URQ A;  2CPS A;  2XKM A;  4LGD E;  2OYI B;  1H89 A;  2W6A A;  3LID A;  5AVS B;  2P2U A;  1JTH B;  5CJ4 A;  5AVQ B;  3OA7 A;  4AQR D;  5AW2 B;  1VDF A;  2VRS A;  1YTZ I;  3V2N A;  3OAK A;  2J59 M;  5AW4 B;  2A45 I;  1FZC A;  1HUC A;  1LTT C;  1N73 C;  1GU4 A;  5APX A;  2C0W A;  2Q9I A;  4LC1 A;  3B5N D;  2HFE D;  1FZB A;  3TNU B;  3G3Z A;  1HBW A;  3RL0 C;  1SQP K;  3VN0 A;  4N3Y B;  4WY4 A;  5AW1 B;  3P8M C;  3VP9 A;  2L5G B;  1X8Y A;  5APQ A;  5CJ0 A;  2FFD A;  4WB4 A;  2W27 A;  3H6P A;  2OYI C;  2E43 A;  1FZA A;  1T3U A;  1T2K D;  1LTJ A;  4W7Z A;  3CL3 D;  1NH4 A;  2ZXE B;  5AVX B;  2JEE A;  1SQX K;  2E42 A;  1ZN5 A;  1LTI C;  2KB7 P;  2XDJ A;  5KLV K;  5AVT B;  2NPS B;  3RK3 B;  1Z56 A;  1FZE A;  3BRV B;  3L36 A;  3M06 A;  1IFJ A;  1T3J A;  1SQV K;  2KSJ A;  1S9K D;  2HOD B;  3M0D C;  1X9V A;  2C0X A;  3BAT A;  4C46 A;  1JY3 O;  1LGH B;  3HUS B;  1L4A B;  1MZ9 A;  3A3Y B;  5CCH A;  2Q7C A;  3V2P A;  2M8R A;  3VMY A;  1W2E A;  3C9I A;  3V2Q A;  2OYH B;  1T8Z A;  1N7S A;  5BVZ A;  2O1J A;  2R32 A;  1SQB K;  1L4A D;  1KQL A;  1X79 B;  1M1J B;  5KJ7 C;  2NPS C;  4C7N A;  3M9Q A;  3RK3 C;  5CCG C;  5AW0 B;  2YNY A;  3BVH A;  1JOC A;  5CHX A;  1GD2 E;  2O1K A;  5APT A;  1IJD B;  5AW5 B;  5CCH D;  2WIT A;  1N73 A;  4I1L A;  3T97 A;  1GL2 A;  1GK4 A;  1JY3 P;  4DOJ A;  3I5C A;  3HUS C;  1L4A C;  5APV A;  2BAS A;  3TYY A;  1N7S D;  4DZO A;  3IR9 A;  4OH8 B;  1SFC A;  2YKO A;  1LT9 B;  1CI6 A;  3M9H A;  1LWU C;  5AVZ B;  2N1T C;  1AQ5 A;  1G2C A;  1SQQ K;  3NTN A;  5AVW B;  1CSB A;  1NWQ A;  2OYH C;  3B5N B;  3U59 A;  1RF1 B;  4JF7 A;  2OYI A;  4GT1 A;  1M1J C;  5APU A;  2OAR A;  1RE3 C;  3VMZ A;  1JMM A;  2H8P D;  1L0L K;  1E5W A;  1LTA C;  1GL2 D;  5APS A;  2HG5 D;  3HE4 A;  1GDT A;  3M9B A;  3VMX A;  2WSF H;  5AW7 B;  1GW4 A;  2O01 H;  1SFC D;  1NOH A;  2YO3 A;  4N78 D;  1JNM A;  4EIJ A;  1URQ D;  2GUV A;  2KLV A;  2H43 A;  1AFO A;  3H32 A;  3NFQ A;  1CZQ A;  3MGN A;  4AUW A;  3L4F A;  3EFG A;  1JY3 N;  3V5B A;  4IFD K;  1FJK A;  1N2D C;  1LT9 C;  1IFI A;  3U1A A;  1NU1 K;  3KQG A;  2XU6 A;  2MJZ A;  3M0D A;  3B5N C;  1DEB A;  1CW5 A;  1OXZ A;  1ZR2 A;  1JO5 A;  1GK6 A;  1RF1 C;  1N7L A;  3GHG B;  1HH0 A;  4XE5 B;  1NHL A;  3SWF A;  4Y99 B;  1J2J B;  3EQ2 A;  4WBA A;  3A5T A;  2LKM A;  1IFN A;  1FJP A;  1LTJ B;  3N7N A;  3M0A A;  4LLH A;  4WY4 D;  1YYC A;  3E1I A;  1NTZ K;  3MIW A;  2R3C A;  1KIL A;  2HPC A;  3OJA B;  1T2K C;  1SP4 A;  2R5D A;  3L37 A;  5KJ7 A;  1S9K E;  3HTK A;  5CCG A;  2FYU K;  1DX7 A;  2FXM A;  2C9L Y;  1RF0 A;  4XA4 A;  3A2A A;  5BU5 A;  2GM4 A;  2WWW A;  3KPE A;  2W6B A;  4W7Y A;  1J1D B;  2R5B A;  4RES B;  3HD7 A;  1JCC A;  4IFF A;  1IC2 A;  2Z4E A;  2YKP A;  2JJL A;  3BRT B;  1NKN A;  4KHX A;  3HE5 A;  2PP6 A;  3HUS A;  3GHG C;  1FOS E;  4Y99 C;  3VOP A;  2Q3I A;  1KIL D;  3P8C D;  1VPC A;  1JY2 O;  1M7L A;  1LWU A;  2N1T A;  2XZR A;  1LTJ C;  5AW3 B;  4ZKP A;  2A45 G;  3VYI A;  3HRN A;  1RY3 A;  3VTP C;  3NMD A;  1N7S B;  3RK2 D;  2WTY A;  1XTC C;  3BAS A;  1WRG A;  1M1J A;  2FYZ A;  1RE3 A;  1NO4 A;  1EQ7 A;  3II6 A;  3A7O A;  4C7N B;  2XV5 A;  3TSI A;  2Z5I A;  3MUD A;  1LTB C;  1J1D C;  2WSE H;  1OWA A;  2C9N Y;  5AW9 B;  3CI9 A;  5APW A;  2P7J A;  1ZR4 A;  3B8E B;  4B86 A;  1MUU A;  2CPB A;  1GL2 B;  1QL2 A;  5CCH C;  1LT9 A;  2M3B A;  3VP8 A;  1SLQ A;  1SFC B;  1FU1 A;  2WT7 B;  1CI6 B;  1KFN A;  3KYQ A;  2XNX A;  2P1J A;  1URQ B;  5BU8 B;  2J58 A;  2HYN A;  1HTL C;  1JTH A;  1LTS C;  2WZ7 A;  1G1I A;  1N7S C;  2QM8 A;  5AW8 B;  3MTU E;  1RF1 A;  3L35 A;  2HLO A;  2A45 H;  2FKW B;  4AYC A;  1RE4 C;  1FZC B;  5AVR B;  4N78 E;  2WPR A;  3RL0 D;  3TK1 A;  4GKG A;  3TNU A;  3HE4 B;  1NTK K;  1FOS F;  3O8Z A;  1GL2 C;  3M91 A;  3H32 B;  4ZKU A;  4WY4 B;  1FDM A;  5AVU B;  1SFC C;  1FZF A;  2KYV A;  3CLQ A;  4W80 A;  3WMM 0;  4EOT A;  2FFD B;  1JUN A;  1HVV A;  1JY2 N;  1URQ C;  3N4X A;  3U1C A;  1GTW A;  1IFD A;  1NKZ B;  1XTG B;  1QL1 A;  3UIA A;  1LTG C;  1FZG A;  1GW3 A;  1HGV A;  2IFM A;  3GHG A;  1JCD A;  4GIF A;  4I2L C;  2POH A;  1ZLL A;  1PFI A;  1A02 F;  1J1E B;  3P7K A;  2Z5H A;  1FZC C;  4JYB A;  3LW5 H;  1NTM K;  2YMY A;  1NAF A;  2WPQ A;  4JYC A;  2NPS A;  4M3L A;  2WPS A;  4O9B A;  3PP5 A;  2HPC B;  1KIL B;  2N9B A;  4HH2 A;  1KZU B;  3MD0 A;  2HOD A;  4WY4 C;  3HTK B;  5KTB A;  2IFN A;  2KP8 A;  4IFM A;  2QM7 A;  3V4W A;  3RK2 B;  2FFD C;  5AW6 B;  1L4A A;  3HD7 B;  3R2P A;  1A02 J;  3P8C E;  1MV8 A;  1MFZ A;  3V2R A;  5KJ7 D;  2YO2 A;  1H8A A;  2I1J A;  2NPS D;  3HE5 B;  2OYH A;  3RK3 D;  3SWY A;  5CCG D;  1GZL A;  1SVF A;  1J1E C;  4HYT B;  5APY A;  1HGZ A;  4N6J A;  2H7H A;  1KFM A;  5AVY B;  5AVV B;  1LWU B;  2N1T B;  3V4Q A;  2IX7 C;  3HD7 D;  1ZV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...