2JO1A

Structure of the na,k-atpase regulatory protein fxyd1 in micelles
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
ESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase regulator
molecule keywords Phospholemman
publication title Structure of the Na,K-ATPase regulatory protein FXYD1 in micelles
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02038 ATP1G1_PLM_MAT8 ATP1G1/PLM/MAT8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.780 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2jo1A00
2JP3A 1Y9BA 2JO1A 2MKVA
chains in the Genus database with same CATH superfamily
2KSEA 2V7QH 1NU1E 1KC8Q 1NO4A 3PHLA 3IFMA 1IJDB 1JMBA 5KLIB 1KILE 1S3JA 4ZKPA 2OYIA 1GK4A 4TLFA 3C8VA 1OW6A 4DZOA 1IK9A 1PP9E 1KYOH 1G2CA 3BRVB 3E7KA 2ZFCA 3O6QA 2K9YA 1GDTA 4L74A 2Q3EA 1BCCG 5KJ7A 3H1KD 2PRRA 1J1EB 2W27A 4Y99C 1NTMG 3R4YA 3SFDC 1VQOP 3CC2P 4PV1C 3V2RA 3F5HA 1SQQD 2Z5IA 3B71A 3H1ID 3A5TA 1L0NJ 1FZAA 3L71D 3B4SA 1DD4A 3AE6C 5GTIH 3RBZA 5KAIE 2K1AA 2IDBA 4CPGA 3D6YA 3CC4P 3CWBJ 1JCCA 1KB9H 2O01J 5APQA 1QL2A 2CPSA 3H1HG 4I7ZC 1G2CB 2I8DA 1LTAC 3O6QB 2FXPA 1BGYE 2KZJA 1OXZA 2Q6QA 3WU2H 1PP9D 1HTLC 2FBWC 2XZRA 2K3RA 4NPEA 4WY4C 3CPWO 1KQLA 1AVOA 2OQQA 3II6A 5KLIC 1Q2NA 4KHXA 1IO4A 4I6MC 1FDIA 1YIJP 4LLHA 4YPCA 2A45I 3CCEP 3L73G 3FXEA 2WPRA 1K05A 3RL0g 1LTGC 3T97A 3TSIA 1J1EC 3LIDA 2A06E 1H0TA 1OIPA 2IBZE 2UWJE 4BWNA 2HLOA 1BGYD 2LXCB 1FC2C 1QLED 1CI6A 2Q7CA 3BATA 1SQQJ 3VP8A 4LGDE 4Z1MH 1SQQK 3H1IJ 5AVTB 1IK7A 1NTZE 3A3YB 3U1CA 3S1KA 2XU6A 3RL0D 1T6AA 5AW3B 1NKZB 1DD3A 2QA4P 1GMJA 1VL2A 3FWLA 1NU1J 3JSVC 2E5YA 1NU1K 4C7RA 3VYIA 5KAFH 1KILA 2E74D 2HODA 1AVYA 1M8OB 1R5LA 1M56D 1PP9J 2YMYA 5KJ7C 1YTZT 1VF5D 1RE3A 2QJPC 1GU5A 3P8MC 1SS1A 1PPJD 2BCCD 2IBZI 1NJIQ 1FAVA 4EOTA 2FYUG 2WSCH 1QVGO 2A06D 2FXOA 3L72E 1CI6B 3GG2A 5KKZB 2FFDA 1FU1A 3H1LE 1FJPA 2I1JA 1N8RQ 3CCRP 1XTGB 2YMKA 4GDOA 5AVVB 1JCDA 1RF0A 3L70E 2KLVA 1U57A 1PIXA 3LW5J 1NTZD 1AQ5A 2AEJA 2N9YB 3V4QA 4YXDC 1MFTA 5APYA 3AEFC 2HODB 2WT7A 1M1JA 1SQVG 3R2PA 3UIAA 1BGYJ 2CK3H 1FZGA 3HD7D 4HB1A 4GT1A 4IFDK 1ZN5A 4N3YB 3L35A 2I1KA 3AE3C 2M3BA 5AW0B 4IL6H 1NYHA 1L4AD 2Z5HA 1RQVA 2QJKB 1EDLA 2PP6A 3MHVA 3G71P 4YXWH 3H25A 5CMZA 2BASA 1RE4A 4C7NA 5CCGD 2OYHA 2W6JH 2WT7B 4PJ0E 1M1JB 3AE9C 3W68A 2E75D 4W7YA 3H1JE 3L4FA 1NTME 3NMDA 5BU5A 1KZUB 4EYYQ 3LIEA 3SWFA 1PGQA 3RL0B 1SVFA 1NVOA 2BEZF 5TISH 3RK2D 3NTNA 2E76D 4OGQD 1NTZJ 2M5AB 1NTZK 3HTKA 2V4HA 2RN0A 1P84E 2IYPA 1JY2P 3H1HE 1FE6A 2E74B 3L37A 1DX7A 1UIXA 3PTZA 3IN6A 1BDCA 3A0HE 1S72P 1OVVA 1VQ7P 4N78D 2C0XA 1VF5B 5TJHA 2LXBA 3SFEC 2WVRA 3OA7A 1JEKA 1RE3C 1SQBE 2CPBA 3VN0A 3AEEC 3HD7A 3IF4A 4UB6H 3S4RA 1BCCD 3KZIH 1DH3A 4AYCA 2R3CA 3PJSK 2OTKE 3A0BE 3VTPC 1NH4A 1DIPA 4JPZB 5B5EH 2N9BA 2POHA 1D7MA 4DCKA 3RBXA 3L72J 1RF0C 2QJKC 2WSSH 2XKMA 1RQUA 1J1DB 3M9BA 3HTKB 3L70J 1YHQP 3SWKA 4H44D 1M90Q 1NTKG 3CMEP 1M1JC 2H89C 2B87A 1BSNA 1JY3O 1VQLP 1P84D 1SFCA 4D6TG 3SWYA 3M9QA 3H1HD 1BDDA 3FGAD 1PGPA 3H6PA 3HD7B 4RKUJ 2W6AA 2KUBA 3CX5D 1KORA 2W6BA 4OH8B 1VQ5P 3G3ZA 2Y0CA 3RL0C 2YKOA 1L4AB 3H1KE 1AV1A 3VMZA 2IZ0A 1OW8A 1VQ6P 1U7JA 4U3FG 1N86A 1SLQA 5EFWB 1VQPP 4M3LA 3VOPA 1T2KD 3VMAA 3M0AA 3M91A 2IX7C 1VF5C 1RE4C 2DW3A 2OYHC 1PGOA 3L73D 2B87B 3TGUG 2E75B 3H1IE 3L36A 1SFCB 1BCCJ 3AEBC 2PFXA 3L71E 3CCMP 1N7SA 3H1JJ 5CCHD 3ZDMA 1NTMJ 3KYQA 1NTMK 3AE1C 2AXCA 4AQRD 1WRGA 1VQ9P 3JC22 2ZT9D 1KQFB 1Z56A 3RK2B 2E76B 4IFMA 5CJ0A 4UB8E 1HGVA 3P7KA 1GZLA 3G4SP 1OVRA 5E79E 2KK7A 2E43A 2ZXXA 3FX0A 1YJ9P 4O9BA 4XFJA 4PD4E 3H1HJ 2KSJA 4W7ZA 3VP9A 3HD7C 5KLVG 3CXHE 3G9RA 3GMAA 1KTMA 1SQBJ 2E42A 1N7SB 1SQBK 5M1BA 2ITAA 2HR3A 5AW6B 1L0NK 1A02F 2WMMA 2XV5A 3L75G 2FYUD 2QJYB 5AVYB 1L4AC 1KB9D 1LGHB 3OAKA 3PH0A 1USEA 4W80A 2FXMA 1ZP0C 1E5WA 1AJYA 3BCCG 3U1AA 5APWA 4H44B 5CCGC 1EXIA 1MUUA 1LT9A 2E75C 1SQPG 2L91A 4H0LD 1SFCC 3Q5PA 3EWKA 2AEFA 4HH2A 1LTTC 1MZ9A 1EZVG 5APXA 5L8RJ 3CXHI 1NWQA 4PD4D 5GTHE 1KFNA 1SQVD 1HF9A 1QX8A 2M0BA 1BE3G 3WMM0 3CXHD 1VQKP 3GW6A 3RK2C 2E76C 3CMAP 2ZYAA 3B5ND 1N73A 5DJTB 1JTHA 2J59M 1EDIA 1NKNA 3P8CE 2C9LY 4OWFA 1CW5A 3V6IA 1JMMA 2K37A 4LC1A 3GLMA 2KIKA 1PPJE 2BCCE 3SSUA 1LTSC 3H1KJ 3HRNA 3L74G 3D70A 4C46A 1OMIA 1LT9B 4EI2A 3TYYA 1SQXG 3LW5H 1KN7A 2KYVA 2A45H 2Z4EA 2PGDA 1VQ4P 4H13D 1IFNA 1N7SC 5KAIH 1ZRTD 3JCUE 5APUA 2W8ZA 3L71J 3GHGA 3CI9A 2QEXP 1H89A 1OW7A 1OZHA 2D2CD 2ZT9B 1S9KD 1IZNB 2AXTE 1N73B 1JTHB 4ZNCA 4H44C 3Q5SA 1NTKE 1URQD 2RMZA 3P8CD 2P2UA 4JF7A 3MUDA 3MD0A 5CBOA 1Q90D 2QIWA 1NAFA 1ZMEC 4HYTB 3V2NA 4A7PA 1HWTC 2KS1B 1QGKB 1FOSF 1LP1B 1T8ZA 1EQ7A 3B5NA 3GHGB 1VQ8P 2IYOA 1LJ2A 2QM8A 1EC5A 1NU1G 4WBAA 1ZW0A 4U3FE 2GUVA 1GL2D 1T2KC 2R5BA 3USSA 3MGNA 1FBMA 1LT9C 1X9VA 1FZEA 2GA1A 3AE5C 4H0LB 1S5LX 2GUSA 1L2PA 3V2QA 2WSEJ 2RH0A 1NTKD 2YO2A 3M0DA 4D6TD 3QH9A 1LTIC 1USDA 1SP4A 2ZT9C 3CD6P 2RKLA 2M5AA 4N78E 1QEXA 4RESB 3B5NB 1N73C 1VPCA 3BASA 2ZJSE 2Y0DA 2Q9IA 1R5SA 3CC7P 2A45G 5B66E 5AVZB 1BCCE 1RF1A 5H2FE 3W67A 2P58A 4U3FD 1PV3A 1W5CE 1NHLA 4WWIA 2BCCJ 3PP5A 3KDPB 2YO3A 4TT3H 1H88A 5KKZC 2HFED 2WSFJ 2JR8A 3MIWA 3M9HA 2E5TA 4H13B 3TGUD 1W2EA 1JY2O 2FY8A 2LKMA 2M8RA 3GHGC 3L75E 4NPFX 5CJ4A 5AW1B 1GL2A 1ZR4A 4ASWA 3BCCE 5AVUB 4RO0A 2B89A 2P7JA 2WWWA 3CX5E 1HJBA 4GOFA 2WPSA 2YIUB 2K9JA 3TNUA 1SQPE 1RF1B 1L0LG 3MUDC 1NTKJ 2NRGA 3PRJA 1NTKK 2OYOA 1JOCA 5KTBA 4D6TJ 1FZCA 3TF5A 1NAYA 2IBZG 2LR2A 1U7MA 1BE3E 1GW4A 5KLVD 2ZXEB 3IR9A 1L4AA 3TDKA 3B5NC 1VQMP 1ZV8A 4DT0A 4L76A 2JO1A 4PJ0H 3L73E 2QM7A 3D71A 1Q86Q 1P84I 3L75D 1GL2B 2JEEA 2XDJA 1RY3A 1JO5A 5CCGA 1S5LE 3L74E 1GU4A 4KT0J 2IZ1A 4U3FJ 1GK6A 3CX5I 3RK3E 3O8ZA 2K9JB 4GIFA 3TNUB 5C39A 4HKZH 3BCCD 1SQXE 3KHUA 4H13C 2SPZA 3AE4C 3CLQA 1KYOE 3ABVC 3M0DC 5AW4B 5KJ7D 1K73Q 1SQPD 1FZCB 2HPCA 1P84H 4Y99B 2G8YA 1QL1A 1RHZB 1HVVA 2O1JA 1EZVD 3A0HH 5APSA 3KXDA 2OARA 1JB0J 3L72G 1PZQA 3CX5H 3ITKA 3H1LG 2E74C 1PGJA 2K88A 1BE3D 3TK1A 4JBZA 2WITA 4ZKUA 4MN4C 3L70G 1RF1C 1AQTA 3A7OA 3AE2C 1EXJA 4QMAA 1LT1A 1UIIA 3A0BH 2J58A 2XNDH 1QVFO 2O01H 5GTIE 5AW5B 2FYUE 3L74D 3V5BA 1GW3A 5AVXB 1KB9E 3RK3D 1YQ4C 1FZFA 1KMIZ 1SQXD 2Q5UA 2HPCB 1HBWA 1YQ3C 1ZLLA 3WU2E 1KYOD 4OGQB 1IFDA 1J1DC 2KP8A 1GL2C 3L75J 3I55P 1HH0A 3I56P 1MKMA 4ZMDA 3U59A 3CL3D 5AW7B 3OW2O 3KQGA 3Q1MA 1YTZI 3N7NA 3PLNA 2Y9YA 1SQVE 4OVNF 3BCCJ 4BXLA 1JY2N 1SQPJ 4N6JA 1SQPK 1FZCC 4DOJA 4IL6X 3FWNA 3H1JG 5APVA 2W83C 1KB9I 5AVWB 4L75A 2NPSD 3CCLP 3V4WA 1G1IA 4XE5B 4GOEA 2P10A 2H7HA 1G1JA 1BE3J 4JQ0D 3AE8C 1ZOYC 2H88C 4I1LA 2IPPA 1LWUA 4EDFA 2R32A 2WPVB 2ZVOB 2N1TD 3AE7C 3L73J 2YKQA 2OYIB 1ZRTE 1NU1D 5AW9B 1IFIA 2NZ2A 2ZYDA 4PD4I 1KILD 2FKWB 3L74J 1LNQA 5CCHA 1N7LA 2V7QJ 4WVZA 1S9KE 2KLUA 1K04A 5KAFE 1T3JA 2IFMA 1SQBG 1SQXJ 2IFNA 4UB8H 1M57D 2QJPB 1SQXK 1LTBC 1L0NG 5E79H 3Q2YA 4OGQC 4WB4A 2GM4A 4PD4H 3B8EB 1JY3N 3CWBG 2HYNA 1TU3F 1LWUB 1MV8A 3CXHH 1X0TA 2B9BA 1KV4A 3H32A 1L0LE 3HE5A 2KOGA 3CCUP 1IC2A 1PFIA 3D6ZA 1X79B 2HG5D 2KS1A 1LP1A 2YXRB 1DEBA 3BVHA 3RK3B 2JWAA 2NPSA 1JM0A 2FYUJ 2QJYC 1WT6A 4IOIH 2FYUK 3GF3A 3OJAB 1CZQA 1JNMA 2O3JA 2ZVNB 3IAOA 2WSEH 3WUTA 2FYZA 3AEDC 5AW8B 3NXSA 2N1TA 2ZAEB 1KFMA 2JWDA 2OYIC 2JKVA 2ZYGA 3H1KG 4HJGH 3EFFK 3S9OA 1YJWP 5GTHH 4D6TE 5AVSB 2Y0EA 3H32B 1FDOA 3NFQA 4IL6E 3HE5B 2QRXA 3BRTB 2OTLP 3MP7B 1NGMB 5DJUB 3FXDA 1SQVJ 2Q1KA 1SQQG 3T97B 1SQVK 4JYBA 1L0LD 1H0TB 3E1IA 3H1IG 3RGUA 2VRSA 2NPSB 2FYNB 3L71G 1S1CX 3N4XA 4BRYA 3Q3DA 4XA4A 2H43A 2IBZD 2QE7H 3KPEA 2WSFH 1DEEG 1ZXGA 1LWUC 1IFMA 2N1TB 4EIJA 3EFGA 1HGZA 5APTA 1BSHA 1PP9G 1T3UA 5BVZA 2R3SA 1X8YA 1K8AQ 3TGUE 3JCUH 5BU8B 4GODA 5TISE 4I2LC 1KILB 3QWOC 1KQGB 2QSIA 5CCHC 1YJNP 3M06A 2AXTH 3RK3C 4R4MA 1LTJA 3GF7A 1M1KQ 2KI7B 4BRYB 2YNYA 4PV1D 3HE4A 3CCVP 2YKPA 3HUSA 3AEAC 4UB6E 4JYCA 2FFDB 1E79H 1H8AA 3VMYA 3KZIE 1MFZA 3K5BA 1URQA 1GTWA 1X22A 4GKGA 1S4XA 2M3EA 1KD1Q 3L72D 3MTUE 1VDFA 3I5CA 3H1LD 2P67A 1Q81Q 1Y9BA 1XTCC 2C9NY 2R5DA 1IFJA 5B5EE 2WSCJ 1OX3A 2KNCA 2MKVA 3A2AA 5KLVE 1Y8AA 1BGYG 3L70D 2WTYA 4U7JA 4L73A 2P1JA 2QG4A 1Q7YQ 1L0LJ 1L0LK 3EQ2A 2WPQA 1SFCD 5K5GB 4R4LA 3CCJP 2NPSC 2FYNC 2Q3IA 3MZWB 2D2CB 4DJGA 1YITP 2C0WA 1LTJB 1YYCA 4WY4D 3CCSP 3C9IA 4K3AA 3HE4B 1AFOA 2O1KA 3HUSB 1CSBA 2WQYC 2N1TC 1FZBA 4KJMA 2G3AA 4YTPC 1URQB 2Y9ZA 4H0LC 1HUCA 2KZIA 5CBNA 1Q82Q 2BEQD 2W90A 1KILC 1FOSE 4RJTA 1PL5A 2YXQB 1PPJG 2BCCG 2JDIH 2KNCB 1EZVE 2A06G 3C1LA 1IFPA 4C7NB 2PAJA 2OYHB 3WUVA 1FJKA 1A02J 1L0NE 5B66H 2KXPB 2MJZA 3VMXA 1OFCX 3AEGC 2WZ7A 1K9MQ 1OVUA 3CCQP 2L5GB 1N7SD 3H1JD 1NTZG 1OWAA 2FFDC 1NTMD 5H2FH 3CWBE 5AVRB 3AECC 3P32A 1ZR2A 3H1LJ 3WUUA 5AVQB 2KB7P 4ASVA 1JUNA 1AA0A 2R44A 4IFFA 5CHXA 1W2BO 1N2DC 3TGUJ 3F89A 3E1RA 1EZVI 1Y47A 1R8EA 2D2CC 1VQNP 1FDMA 4NPDA 1YBKA 1LTJC 4WY4A 1FS0E 1S2EA 1GD2E 4PV1B 1JY3P 2B88A 1HJ0A 3HUSC 1SQBD 4Y28J 2AEMA 4AUWA 1L0ND 1YI2P 3G6EP 1URQC 2YIUC 2O01N 3Q5RA 5AW2B 2QVAA 3CWBD 4B86A 2JJLA 4I7ZB 1RH5B 2XNXA 1WMKA 1M7LA 2OTJP 1SQQE 1J2JB 2JP3A 1KYOI 2J5UA 1NOHA 5KLVJ 5KLVK 1KQSO 2H8PD 4K35A 1EDKA 3V2PA 4WY4B 1S5LH 2OGUA 1EDJA
chains in the Genus database with same CATH topology
1TU3F 3AE5C 1VF5C 4H0LB 2FBWC 3Q3DA 2G8YA 1NYHA 1S5LX 2E75B 1JB0J 1KILE 2WSEJ 1ZP0C 1RQVA 4R4LA 2FYNC 4IL6X 1VF5D 1AJYA 1OW7A 2D2CD 1DIPA 3C8VA 2ZT9B 3AEBC 2D2CB 1OW6A 2E74C 2QJPC 4H44B 2OQQA 3H25A 3D6ZA 1EXIA 5KLIC 2E75C 3O6QA 2QJKC 4H0LD 1FDIA 3Q5PA 2P10A 2ZT9C 3EWKA 1R8EA 2K9YA 2D2CC 3AE1C 3AE9C 4H44C 2WQYC 1RQUA 2E75D 3Q5SA 3AE8C 3AE2C 1EXJA 1ZOYC 2H88C 2QJYC 2ZT9D 2G3AA 5L8RJ 1KQFB 1K05A 4PV1B 3GF3A 4YTPC 1KQGB 2WPVB 4H44D 2QSIA 1HJ0A 2E76B 2YMKA 4H0LC 3RL0g 4Y28J 2H89C 4GDOA 1HF9A 3AE7C 3IAOA 3R4YA 2BEQD 3SFDC 4R4MA 1Q90D 1U57A 1PL5A 1PIXA 1ZRTE 2QIWA 3AEDC 2NZ2A 3LW5J 4PV1C 3FGAD 2YIUC 3AE3C 1ZMEC 3GF7A 2E76C 2JO1A 1YQ4C 3B71A 3Q5RA 3D71A 1KMIZ 4RKUJ 4YXDC 2BEZF 1PV3A 1KORA 3AEFC 4PV1D 4XFJA 1YQ3C 2V7QJ 2E76D 3AEAC 4OGQD 3S9OA 4TT3H 1K04A 4I7ZB 1DD4A 4OGQB 3AE6C 4Z1MH 3GLMA 5KKZC 2WSFJ 1FDOA 4KT0J 2IDBA 1WMKA 3G9RA 4H13B 2E74B 3GMAA 1IK7A 3D6YA 1UIXA 3RK3E 3IN6A 3AEGC 1MKMA 2O01J 3D70A 2JP3A 3Q2YA 1NGMB 1KTMA 2J5UA 4I7ZC 4OGQC 1Y9BA 1OMIA 3T97B 5M1BA 1VF5B 2FXPA 4H13C 1DD3A 2WSCJ 3AE4C 3Q1MA 1GMJA 1VL2A 1OW8A 3SFEC 3ABVC 2MKVA 3AECC 3AEEC 4U7JA 1S1CX 4H13D 2E74D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JP3 A;  1Y9B A;  2JO1 A;  2MKV A; 
#chains in the Genus database with same CATH topology
 2KSE A;  2V7Q H;  1NU1 E;  1KC8 Q;  1NO4 A;  3PHL A;  3IFM A;  1IJD B;  1JMB A;  5KLI B;  1KIL E;  1S3J A;  4ZKP A;  2OYI A;  1GK4 A;  4TLF A;  3C8V A;  1OW6 A;  4DZO A;  1IK9 A;  1PP9 E;  1KYO H;  1G2C A;  3BRV B;  3E7K A;  2ZFC A;  3O6Q A;  2K9Y A;  1GDT A;  4L74 A;  2Q3E A;  1BCC G;  5KJ7 A;  3H1K D;  2PRR A;  1J1E B;  2W27 A;  4Y99 C;  1NTM G;  3R4Y A;  3SFD C;  1VQO P;  3CC2 P;  4PV1 C;  3V2R A;  3F5H A;  1SQQ D;  2Z5I A;  3B71 A;  3H1I D;  3A5T A;  1L0N J;  1FZA A;  3L71 D;  3B4S A;  1DD4 A;  3AE6 C;  5GTI H;  3RBZ A;  5KAI E;  2K1A A;  2IDB A;  4CPG A;  3D6Y A;  3CC4 P;  3CWB J;  1JCC A;  1KB9 H;  2O01 J;  5APQ A;  1QL2 A;  2CPS A;  3H1H G;  4I7Z C;  1G2C B;  2I8D A;  1LTA C;  3O6Q B;  2FXP A;  1BGY E;  2KZJ A;  1OXZ A;  2Q6Q A;  3WU2 H;  1PP9 D;  1HTL C;  2FBW C;  2XZR A;  2K3R A;  4NPE A;  4WY4 C;  3CPW O;  1KQL A;  1AVO A;  2OQQ A;  3II6 A;  5KLI C;  1Q2N A;  4KHX A;  1IO4 A;  4I6M C;  1FDI A;  1YIJ P;  4LLH A;  4YPC A;  2A45 I;  3CCE P;  3L73 G;  3FXE A;  2WPR A;  1K05 A;  3RL0 g;  1LTG C;  3T97 A;  3TSI A;  1J1E C;  3LID A;  2A06 E;  1H0T A;  1OIP A;  2IBZ E;  2UWJ E;  4BWN A;  2HLO A;  1BGY D;  2LXC B;  1FC2 C;  1QLE D;  1CI6 A;  2Q7C A;  3BAT A;  1SQQ J;  3VP8 A;  4LGD E;  4Z1M H;  1SQQ K;  3H1I J;  5AVT B;  1IK7 A;  1NTZ E;  3A3Y B;  3U1C A;  3S1K A;  2XU6 A;  3RL0 D;  1T6A A;  5AW3 B;  1NKZ B;  1DD3 A;  2QA4 P;  1GMJ A;  1VL2 A;  3FWL A;  1NU1 J;  3JSV C;  2E5Y A;  1NU1 K;  4C7R A;  3VYI A;  5KAF H;  1KIL A;  2E74 D;  2HOD A;  1AVY A;  1M8O B;  1R5L A;  1M56 D;  1PP9 J;  2YMY A;  5KJ7 C;  1YTZ T;  1VF5 D;  1RE3 A;  2QJP C;  1GU5 A;  3P8M C;  1SS1 A;  1PPJ D;  2BCC D;  2IBZ I;  1NJI Q;  1FAV A;  4EOT A;  2FYU G;  2WSC H;  1QVG O;  2A06 D;  2FXO A;  3L72 E;  1CI6 B;  3GG2 A;  5KKZ B;  2FFD A;  1FU1 A;  3H1L E;  1FJP A;  2I1J A;  1N8R Q;  3CCR P;  1XTG B;  2YMK A;  4GDO A;  5AVV B;  1JCD A;  1RF0 A;  3L70 E;  2KLV A;  1U57 A;  1PIX A;  3LW5 J;  1NTZ D;  1AQ5 A;  2AEJ A;  2N9Y B;  3V4Q A;  4YXD C;  1MFT A;  5APY A;  3AEF C;  2HOD B;  2WT7 A;  1M1J A;  1SQV G;  3R2P A;  3UIA A;  1BGY J;  2CK3 H;  1FZG A;  3HD7 D;  4HB1 A;  4GT1 A;  4IFD K;  1ZN5 A;  4N3Y B;  3L35 A;  2I1K A;  3AE3 C;  2M3B A;  5AW0 B;  4IL6 H;  1NYH A;  1L4A D;  2Z5H A;  1RQV A;  2QJK B;  1EDL A;  2PP6 A;  3MHV A;  3G71 P;  4YXW H;  3H25 A;  5CMZ A;  2BAS A;  1RE4 A;  4C7N A;  5CCG D;  2OYH A;  2W6J H;  2WT7 B;  4PJ0 E;  1M1J B;  3AE9 C;  3W68 A;  2E75 D;  4W7Y A;  3H1J E;  3L4F A;  1NTM E;  3NMD A;  5BU5 A;  1KZU B;  4EYY Q;  3LIE A;  3SWF A;  1PGQ A;  3RL0 B;  1SVF A;  1NVO A;  2BEZ F;  5TIS H;  3RK2 D;  3NTN A;  2E76 D;  4OGQ D;  1NTZ J;  2M5A B;  1NTZ K;  3HTK A;  2V4H A;  2RN0 A;  1P84 E;  2IYP A;  1JY2 P;  3H1H E;  1FE6 A;  2E74 B;  3L37 A;  1DX7 A;  1UIX A;  3PTZ A;  3IN6 A;  1BDC A;  3A0H E;  1S72 P;  1OVV A;  1VQ7 P;  4N78 D;  2C0X A;  1VF5 B;  5TJH A;  2LXB A;  3SFE C;  2WVR A;  3OA7 A;  1JEK A;  1RE3 C;  1SQB E;  2CPB A;  3VN0 A;  3AEE C;  3HD7 A;  3IF4 A;  4UB6 H;  3S4R A;  1BCC D;  3KZI H;  1DH3 A;  4AYC A;  2R3C A;  3PJS K;  2OTK E;  3A0B E;  3VTP C;  1NH4 A;  1DIP A;  4JPZ B;  5B5E H;  2N9B A;  2POH A;  1D7M A;  4DCK A;  3RBX A;  3L72 J;  1RF0 C;  2QJK C;  2WSS H;  2XKM A;  1RQU A;  1J1D B;  3M9B A;  3HTK B;  3L70 J;  1YHQ P;  3SWK A;  4H44 D;  1M90 Q;  1NTK G;  3CME P;  1M1J C;  2H89 C;  2B87 A;  1BSN A;  1JY3 O;  1VQL P;  1P84 D;  1SFC A;  4D6T G;  3SWY A;  3M9Q A;  3H1H D;  1BDD A;  3FGA D;  1PGP A;  3H6P A;  3HD7 B;  4RKU J;  2W6A A;  2KUB A;  3CX5 D;  1KOR A;  2W6B A;  4OH8 B;  1VQ5 P;  3G3Z A;  2Y0C A;  3RL0 C;  2YKO A;  1L4A B;  3H1K E;  1AV1 A;  3VMZ A;  2IZ0 A;  1OW8 A;  1VQ6 P;  1U7J A;  4U3F G;  1N86 A;  1SLQ A;  5EFW B;  1VQP P;  4M3L A;  3VOP A;  1T2K D;  3VMA A;  3M0A A;  3M91 A;  2IX7 C;  1VF5 C;  1RE4 C;  2DW3 A;  2OYH C;  1PGO A;  3L73 D;  2B87 B;  3TGU G;  2E75 B;  3H1I E;  3L36 A;  1SFC B;  1BCC J;  3AEB C;  2PFX A;  3L71 E;  3CCM P;  1N7S A;  3H1J J;  5CCH D;  3ZDM A;  1NTM J;  3KYQ A;  1NTM K;  3AE1 C;  2AXC A;  4AQR D;  1WRG A;  1VQ9 P;  3JC2 2;  2ZT9 D;  1KQF B;  1Z56 A;  3RK2 B;  2E76 B;  4IFM A;  5CJ0 A;  4UB8 E;  1HGV A;  3P7K A;  1GZL A;  3G4S P;  1OVR A;  5E79 E;  2KK7 A;  2E43 A;  2ZXX A;  3FX0 A;  1YJ9 P;  4O9B A;  4XFJ A;  4PD4 E;  3H1H J;  2KSJ A;  4W7Z A;  3VP9 A;  3HD7 C;  5KLV G;  3CXH E;  3G9R A;  3GMA A;  1KTM A;  1SQB J;  2E42 A;  1N7S B;  1SQB K;  5M1B A;  2ITA A;  2HR3 A;  5AW6 B;  1L0N K;  1A02 F;  2WMM A;  2XV5 A;  3L75 G;  2FYU D;  2QJY B;  5AVY B;  1L4A C;  1KB9 D;  1LGH B;  3OAK A;  3PH0 A;  1USE A;  4W80 A;  2FXM A;  1ZP0 C;  1E5W A;  1AJY A;  3BCC G;  3U1A A;  5APW A;  4H44 B;  5CCG C;  1EXI A;  1MUU A;  1LT9 A;  2E75 C;  1SQP G;  2L91 A;  4H0L D;  1SFC C;  3Q5P A;  3EWK A;  2AEF A;  4HH2 A;  1LTT C;  1MZ9 A;  1EZV G;  5APX A;  5L8R J;  3CXH I;  1NWQ A;  4PD4 D;  5GTH E;  1KFN A;  1SQV D;  1HF9 A;  1QX8 A;  2M0B A;  1BE3 G;  3WMM 0;  3CXH D;  1VQK P;  3GW6 A;  3RK2 C;  2E76 C;  3CMA P;  2ZYA A;  3B5N D;  1N73 A;  5DJT B;  1JTH A;  2J59 M;  1EDI A;  1NKN A;  3P8C E;  2C9L Y;  4OWF A;  1CW5 A;  3V6I A;  1JMM A;  2K37 A;  4LC1 A;  3GLM A;  2KIK A;  1PPJ E;  2BCC E;  3SSU A;  1LTS C;  3H1K J;  3HRN A;  3L74 G;  3D70 A;  4C46 A;  1OMI A;  1LT9 B;  4EI2 A;  3TYY A;  1SQX G;  3LW5 H;  1KN7 A;  2KYV A;  2A45 H;  2Z4E A;  2PGD A;  1VQ4 P;  4H13 D;  1IFN A;  1N7S C;  5KAI H;  1ZRT D;  3JCU E;  5APU A;  2W8Z A;  3L71 J;  3GHG A;  3CI9 A;  2QEX P;  1H89 A;  1OW7 A;  1OZH A;  2D2C D;  2ZT9 B;  1S9K D;  1IZN B;  2AXT E;  1N73 B;  1JTH B;  4ZNC A;  4H44 C;  3Q5S A;  1NTK E;  1URQ D;  2RMZ A;  3P8C D;  2P2U A;  4JF7 A;  3MUD A;  3MD0 A;  5CBO A;  1Q90 D;  2QIW A;  1NAF A;  1ZME C;  4HYT B;  3V2N A;  4A7P A;  1HWT C;  2KS1 B;  1QGK B;  1FOS F;  1LP1 B;  1T8Z A;  1EQ7 A;  3B5N A;  3GHG B;  1VQ8 P;  2IYO A;  1LJ2 A;  2QM8 A;  1EC5 A;  1NU1 G;  4WBA A;  1ZW0 A;  4U3F E;  2GUV A;  1GL2 D;  1T2K C;  2R5B A;  3USS A;  3MGN A;  1FBM A;  1LT9 C;  1X9V A;  1FZE A;  2GA1 A;  3AE5 C;  4H0L B;  1S5L X;  2GUS A;  1L2P A;  3V2Q A;  2WSE J;  2RH0 A;  1NTK D;  2YO2 A;  3M0D A;  4D6T D;  3QH9 A;  1LTI C;  1USD A;  1SP4 A;  2ZT9 C;  3CD6 P;  2RKL A;  2M5A A;  4N78 E;  1QEX A;  4RES B;  3B5N B;  1N73 C;  1VPC A;  3BAS A;  2ZJS E;  2Y0D A;  2Q9I A;  1R5S A;  3CC7 P;  2A45 G;  5B66 E;  5AVZ B;  1BCC E;  1RF1 A;  5H2F E;  3W67 A;  2P58 A;  4U3F D;  1PV3 A;  1W5C E;  1NHL A;  4WWI A;  2BCC J;  3PP5 A;  3KDP B;  2YO3 A;  4TT3 H;  1H88 A;  5KKZ C;  2HFE D;  2WSF J;  2JR8 A;  3MIW A;  3M9H A;  2E5T A;  4H13 B;  3TGU D;  1W2E A;  1JY2 O;  2FY8 A;  2LKM A;  2M8R A;  3GHG C;  3L75 E;  4NPF X;  5CJ4 A;  5AW1 B;  1GL2 A;  1ZR4 A;  4ASW A;  3BCC E;  5AVU B;  4RO0 A;  2B89 A;  2P7J A;  2WWW A;  3CX5 E;  1HJB A;  4GOF A;  2WPS A;  2YIU B;  2K9J A;  3TNU A;  1SQP E;  1RF1 B;  1L0L G;  3MUD C;  1NTK J;  2NRG A;  3PRJ A;  1NTK K;  2OYO A;  1JOC A;  5KTB A;  4D6T J;  1FZC A;  3TF5 A;  1NAY A;  2IBZ G;  2LR2 A;  1U7M A;  1BE3 E;  1GW4 A;  5KLV D;  2ZXE B;  3IR9 A;  1L4A A;  3TDK A;  3B5N C;  1VQM P;  1ZV8 A;  4DT0 A;  4L76 A;  2JO1 A;  4PJ0 H;  3L73 E;  2QM7 A;  3D71 A;  1Q86 Q;  1P84 I;  3L75 D;  1GL2 B;  2JEE A;  2XDJ A;  1RY3 A;  1JO5 A;  5CCG A;  1S5L E;  3L74 E;  1GU4 A;  4KT0 J;  2IZ1 A;  4U3F J;  1GK6 A;  3CX5 I;  3RK3 E;  3O8Z A;  2K9J B;  4GIF A;  3TNU B;  5C39 A;  4HKZ H;  3BCC D;  1SQX E;  3KHU A;  4H13 C;  2SPZ A;  3AE4 C;  3CLQ A;  1KYO E;  3ABV C;  3M0D C;  5AW4 B;  5KJ7 D;  1K73 Q;  1SQP D;  1FZC B;  2HPC A;  1P84 H;  4Y99 B;  2G8Y A;  1QL1 A;  1RHZ B;  1HVV A;  2O1J A;  1EZV D;  3A0H H;  5APS A;  3KXD A;  2OAR A;  1JB0 J;  3L72 G;  1PZQ A;  3CX5 H;  3ITK A;  3H1L G;  2E74 C;  1PGJ A;  2K88 A;  1BE3 D;  3TK1 A;  4JBZ A;  2WIT A;  4ZKU A;  4MN4 C;  3L70 G;  1RF1 C;  1AQT A;  3A7O A;  3AE2 C;  1EXJ A;  4QMA A;  1LT1 A;  1UII A;  3A0B H;  2J58 A;  2XND H;  1QVF O;  2O01 H;  5GTI E;  5AW5 B;  2FYU E;  3L74 D;  3V5B A;  1GW3 A;  5AVX B;  1KB9 E;  3RK3 D;  1YQ4 C;  1FZF A;  1KMI Z;  1SQX D;  2Q5U A;  2HPC B;  1HBW A;  1YQ3 C;  1ZLL A;  3WU2 E;  1KYO D;  4OGQ B;  1IFD A;  1J1D C;  2KP8 A;  1GL2 C;  3L75 J;  3I55 P;  1HH0 A;  3I56 P;  1MKM A;  4ZMD A;  3U59 A;  3CL3 D;  5AW7 B;  3OW2 O;  3KQG A;  3Q1M A;  1YTZ I;  3N7N A;  3PLN A;  2Y9Y A;  1SQV E;  4OVN F;  3BCC J;  4BXL A;  1JY2 N;  1SQP J;  4N6J A;  1SQP K;  1FZC C;  4DOJ A;  4IL6 X;  3FWN A;  3H1J G;  5APV A;  2W83 C;  1KB9 I;  5AVW B;  4L75 A;  2NPS D;  3CCL P;  3V4W A;  1G1I A;  4XE5 B;  4GOE A;  2P10 A;  2H7H A;  1G1J A;  1BE3 J;  4JQ0 D;  3AE8 C;  1ZOY C;  2H88 C;  4I1L A;  2IPP A;  1LWU A;  4EDF A;  2R32 A;  2WPV B;  2ZVO B;  2N1T D;  3AE7 C;  3L73 J;  2YKQ A;  2OYI B;  1ZRT E;  1NU1 D;  5AW9 B;  1IFI A;  2NZ2 A;  2ZYD A;  4PD4 I;  1KIL D;  2FKW B;  3L74 J;  1LNQ A;  5CCH A;  1N7L A;  2V7Q J;  4WVZ A;  1S9K E;  2KLU A;  1K04 A;  5KAF E;  1T3J A;  2IFM A;  1SQB G;  1SQX J;  2IFN A;  4UB8 H;  1M57 D;  2QJP B;  1SQX K;  1LTB C;  1L0N G;  5E79 H;  3Q2Y A;  4OGQ C;  4WB4 A;  2GM4 A;  4PD4 H;  3B8E B;  1JY3 N;  3CWB G;  2HYN A;  1TU3 F;  1LWU B;  1MV8 A;  3CXH H;  1X0T A;  2B9B A;  1KV4 A;  3H32 A;  1L0L E;  3HE5 A;  2KOG A;  3CCU P;  1IC2 A;  1PFI A;  3D6Z A;  1X79 B;  2HG5 D;  2KS1 A;  1LP1 A;  2YXR B;  1DEB A;  3BVH A;  3RK3 B;  2JWA A;  2NPS A;  1JM0 A;  2FYU J;  2QJY C;  1WT6 A;  4IOI H;  2FYU K;  3GF3 A;  3OJA B;  1CZQ A;  1JNM A;  2O3J A;  2ZVN B;  3IAO A;  2WSE H;  3WUT A;  2FYZ A;  3AED C;  5AW8 B;  3NXS A;  2N1T A;  2ZAE B;  1KFM A;  2JWD A;  2OYI C;  2JKV A;  2ZYG A;  3H1K G;  4HJG H;  3EFF K;  3S9O A;  1YJW P;  5GTH H;  4D6T E;  5AVS B;  2Y0E A;  3H32 B;  1FDO A;  3NFQ A;  4IL6 E;  3HE5 B;  2QRX A;  3BRT B;  2OTL P;  3MP7 B;  1NGM B;  5DJU B;  3FXD A;  1SQV J;  2Q1K A;  1SQQ G;  3T97 B;  1SQV K;  4JYB A;  1L0L D;  1H0T B;  3E1I A;  3H1I G;  3RGU A;  2VRS A;  2NPS B;  2FYN B;  3L71 G;  1S1C X;  3N4X A;  4BRY A;  3Q3D A;  4XA4 A;  2H43 A;  2IBZ D;  2QE7 H;  3KPE A;  2WSF H;  1DEE G;  1ZXG A;  1LWU C;  1IFM A;  2N1T B;  4EIJ A;  3EFG A;  1HGZ A;  5APT A;  1BSH A;  1PP9 G;  1T3U A;  5BVZ A;  2R3S A;  1X8Y A;  1K8A Q;  3TGU E;  3JCU H;  5BU8 B;  4GOD A;  5TIS E;  4I2L C;  1KIL B;  3QWO C;  1KQG B;  2QSI A;  5CCH C;  1YJN P;  3M06 A;  2AXT H;  3RK3 C;  4R4M A;  1LTJ A;  3GF7 A;  1M1K Q;  2KI7 B;  4BRY B;  2YNY A;  4PV1 D;  3HE4 A;  3CCV P;  2YKP A;  3HUS A;  3AEA C;  4UB6 E;  4JYC A;  2FFD B;  1E79 H;  1H8A A;  3VMY A;  3KZI E;  1MFZ A;  3K5B A;  1URQ A;  1GTW A;  1X22 A;  4GKG A;  1S4X A;  2M3E A;  1KD1 Q;  3L72 D;  3MTU E;  1VDF A;  3I5C A;  3H1L D;  2P67 A;  1Q81 Q;  1Y9B A;  1XTC C;  2C9N Y;  2R5D A;  1IFJ A;  5B5E E;  2WSC J;  1OX3 A;  2KNC A;  2MKV A;  3A2A A;  5KLV E;  1Y8A A;  1BGY G;  3L70 D;  2WTY A;  4U7J A;  4L73 A;  2P1J A;  2QG4 A;  1Q7Y Q;  1L0L J;  1L0L K;  3EQ2 A;  2WPQ A;  1SFC D;  5K5G B;  4R4L A;  3CCJ P;  2NPS C;  2FYN C;  2Q3I A;  3MZW B;  2D2C B;  4DJG A;  1YIT P;  2C0W A;  1LTJ B;  1YYC A;  4WY4 D;  3CCS P;  3C9I A;  4K3A A;  3HE4 B;  1AFO A;  2O1K A;  3HUS B;  1CSB A;  2WQY C;  2N1T C;  1FZB A;  4KJM A;  2G3A A;  4YTP C;  1URQ B;  2Y9Z A;  4H0L C;  1HUC A;  2KZI A;  5CBN A;  1Q82 Q;  2BEQ D;  2W90 A;  1KIL C;  1FOS E;  4RJT A;  1PL5 A;  2YXQ B;  1PPJ G;  2BCC G;  2JDI H;  2KNC B;  1EZV E;  2A06 G;  3C1L A;  1IFP A;  4C7N B;  2PAJ A;  2OYH B;  3WUV A;  1FJK A;  1A02 J;  1L0N E;  5B66 H;  2KXP B;  2MJZ A;  3VMX A;  1OFC X;  3AEG C;  2WZ7 A;  1K9M Q;  1OVU A;  3CCQ P;  2L5G B;  1N7S D;  3H1J D;  1NTZ G;  1OWA A;  2FFD C;  1NTM D;  5H2F H;  3CWB E;  5AVR B;  3AEC C;  3P32 A;  1ZR2 A;  3H1L J;  3WUU A;  5AVQ B;  2KB7 P;  4ASV A;  1JUN A;  1AA0 A;  2R44 A;  4IFF A;  5CHX A;  1W2B O;  1N2D C;  3TGU J;  3F89 A;  3E1R A;  1EZV I;  1Y47 A;  1R8E A;  2D2C C;  1VQN P;  1FDM A;  4NPD A;  1YBK A;  1LTJ C;  4WY4 A;  1FS0 E;  1S2E A;  1GD2 E;  4PV1 B;  1JY3 P;  2B88 A;  1HJ0 A;  3HUS C;  1SQB D;  4Y28 J;  2AEM A;  4AUW A;  1L0N D;  1YI2 P;  3G6E P;  1URQ C;  2YIU C;  2O01 N;  3Q5R A;  5AW2 B;  2QVA A;  3CWB D;  4B86 A;  2JJL A;  4I7Z B;  1RH5 B;  2XNX A;  1WMK A;  1M7L A;  2OTJ P;  1SQQ E;  1J2J B;  2JP3 A;  1KYO I;  2J5U A;  1NOH A;  5KLV J;  5KLV K;  1KQS O;  2H8P D;  4K35 A;  1EDK A;  3V2P A;  4WY4 B;  1S5L H;  2OGU A;  1EDJ A; 
#chains in the Genus database with same CATH homology
 1TU3 F;  3AE5 C;  1VF5 C;  4H0L B;  2FBW C;  3Q3D A;  2G8Y A;  1NYH A;  1S5L X;  2E75 B;  1JB0 J;  1KIL E;  2WSE J;  1ZP0 C;  1RQV A;  4R4L A;  2FYN C;  4IL6 X;  1VF5 D;  1AJY A;  1OW7 A;  2D2C D;  1DIP A;  3C8V A;  2ZT9 B;  3AEB C;  2D2C B;  1OW6 A;  2E74 C;  2QJP C;  4H44 B;  2OQQ A;  3H25 A;  3D6Z A;  1EXI A;  5KLI C;  2E75 C;  3O6Q A;  2QJK C;  4H0L D;  1FDI A;  3Q5P A;  2P10 A;  2ZT9 C;  3EWK A;  1R8E A;  2K9Y A;  2D2C C;  3AE1 C;  3AE9 C;  4H44 C;  2WQY C;  1RQU A;  2E75 D;  3Q5S A;  3AE8 C;  3AE2 C;  1EXJ A;  1ZOY C;  2H88 C;  2QJY C;  2ZT9 D;  2G3A A;  5L8R J;  1KQF B;  1K05 A;  4PV1 B;  3GF3 A;  4YTP C;  1KQG B;  2WPV B;  4H44 D;  2QSI A;  1HJ0 A;  2E76 B;  2YMK A;  4H0L C;  3RL0 g;  4Y28 J;  2H89 C;  4GDO A;  1HF9 A;  3AE7 C;  3IAO A;  3R4Y A;  2BEQ D;  3SFD C;  4R4M A;  1Q90 D;  1U57 A;  1PL5 A;  1PIX A;  1ZRT E;  2QIW A;  3AED C;  2NZ2 A;  3LW5 J;  4PV1 C;  3FGA D;  2YIU C;  3AE3 C;  1ZME C;  3GF7 A;  2E76 C;  2JO1 A;  1YQ4 C;  3B71 A;  3Q5R A;  3D71 A;  1KMI Z;  4RKU J;  4YXD C;  2BEZ F;  1PV3 A;  1KOR A;  3AEF C;  4PV1 D;  4XFJ A;  1YQ3 C;  2V7Q J;  2E76 D;  3AEA C;  4OGQ D;  3S9O A;  4TT3 H;  1K04 A;  4I7Z B;  1DD4 A;  4OGQ B;  3AE6 C;  4Z1M H;  3GLM A;  5KKZ C;  2WSF J;  1FDO A;  4KT0 J;  2IDB A;  1WMK A;  3G9R A;  4H13 B;  2E74 B;  3GMA A;  1IK7 A;  3D6Y A;  1UIX A;  3RK3 E;  3IN6 A;  3AEG C;  1MKM A;  2O01 J;  3D70 A;  2JP3 A;  3Q2Y A;  1NGM B;  1KTM A;  2J5U A;  4I7Z C;  4OGQ C;  1Y9B A;  1OMI A;  3T97 B;  5M1B A;  1VF5 B;  2FXP A;  4H13 C;  1DD3 A;  2WSC J;  3AE4 C;  3Q1M A;  1GMJ A;  1VL2 A;  1OW8 A;  3SFE C;  3ABV C;  2MKV A;  3AEC C;  3AEE C;  4U7J A;  1S1C X;  4H13 D;  2E74 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...