1NGMB

Crystal structure of a yeast brf1-tbp-dna ternary complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
GSYCPRNLHLLPTTDTYLSKVSDDPDNLEDVDDEELNAHLLNEEASKLKERIWIGLNADFLLEQESKRLKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*CP*TP*AP*TP*AP*AP*AP*AP*AP*AP*AP*TP*GP*TP*TP*TP*TP*TP*
publication title Crystal structure of a transcription factor IIIB core interface ternary complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
total genus 12
structure length 72
sequence length 72
chains with identical sequence F, J, N
ec nomenclature
pdb deposition date 2002-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.650 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ngmB00
1NGMB
chains in the Genus database with same CATH superfamily
5KLVK 1RY3A 3HE5B 5DJTB 3PH0A 1G2CA 1OZHA 1NTZG 2KXPB 1NU1J 1T2KC 4RKUJ 1SS1A 1KV4A 3IFMA 5AVVB 3C8VA 2D2CD 1SLQA 1IFDA 2D2CB 1WRGA 2ZVOB 3VMAA 4IL6H 4TLFA 2KSJA 1URQC 2B88A 2PAJA 2KUBA 3ITKA 2E76B 2IBZE 2KSEA 1KB9I 3WUTA 3A3YB 2E74D 1CW5A 2E74B 3U1AA 1NTZD 2QSIA 1ZMEC 1BCCE 1S3JA 2C9NY 2IBZG 2O01N 4H13C 2K37A 3L73J 3RL0g 3JCUH 1LTBC 1ZRTE 2Q7CA 1NKNA 1VL2A 5AVXB 1BCCG 1RF1B 1QL2A 1L0NJ 3T97B 2YIUC 1SQBJ 4GT1A 1MUUA 1OW8A 2A45G 4DZOA 4PJ0E 1L4AD 1L4AB 1X79B 2E75C 3S9OA 5KLVJ 3C9IA 3G3ZA 1FOSF 2QM7A 4NPFX 2IX7C 1CI6A 2M8RA 3H1KG 2CK3H 2KZIA 4JBZA 2IBZD 2M5AA 5KAIH 3CCUP 3SWKA 3GHGC 3GMAA 4WY4D 2K9JB 3A2AA 1ZR2A 2QVAA 2JP3A 1H0TB 2HPCA 3P8CE 4WY4B 2W8ZA 1DD4A 3P7KA 1BSNA 1URQA 2I1KA 1BCCD 2IYPA 3AE3C 5AW4B 3VP9A 1HH0A 1OX3A 2JDIH 4H44C 4H0LD 2BCCJ 5AVYB 2KB7P 3A0BE 1EDKA 2XV5A 5E79H 2O01J 1E5WA 2ITAA 2QJYB 2ZT9B 3LIEA 3Q1MA 1JMMA 3B5NC 3USSA 1ZRTD 3TGUJ 1VQ5P 1DD3A 3H1KD 4XE5B 1VQ9P 2N1TB 1D7MA 2WPSA 4UB6E 4W7ZA 1Y9BA 3HUSB 1NGMB 3H32B 1OW7A 1ZV8A 1NYHA 5B5EE 1S2EA 3G4SP 1LWUC 5KJ7C 2ZXXA 3RBZA 3O8ZA 3AEFC 1J2JB 5AVTB 1FJPA 5APXA 1EC5A 1HUCA 3TNUB 1Q2NA 3H1HG 1Q90D 2HODB 2Y0CA 3P8CD 5APYA 4B86A 3Q5SA 2W6AA 2O1KA 2G3AA 2HYNA 1K04A 4EI2A 1AA0A 3GHGA 1QEXA 1U7JA 3FXDA 2UWJE 4U7JA 2I1JA 1VQ7P 2Y9YA 4AYCA 1R8EA 2L5GB 3GG2A 1KYOE 1YJWP 1S5LX 1KILB 3F89A 1ZR4A 2ZYGA 3MD0A 3H1HD 2WVRA 1M1JB 4TT3H 4DCKA 3B5NA 3CPWO 2IYOA 2PRRA 4LGDE 4CPGA 1YI2P 2SPZA 3V2QA 4NPEA 2A45H 1AJYA 3O6QA 2KOGA 2ZYDA 3NXSA 3N7NA 2B9BA 2PGDA 4I7ZC 3L72J 1PGQA 4WB4A 1LWUA 1NO4A 1FZCB 3SWFA 1Y8AA 2WT7A 1NJIQ 1LTJC 3RK2D 4PJ0H 1LNQA 1L2PA 3H1IJ 3RK2B 4EYYQ 4HJGH 3VYIA 2WPRA 1YTZI 4ZKUA 3TK1A 1Q81Q 1KYOD 1OXZA 2E42A 3GF3A 1EDIA 4PV1C 2KP8A 5TISH 2O3JA 3CCLP 3L71J 4M3LA 4AUWA 2ZVNB 4GOEA 5AW2B 1VQLP 3CCVP 2QEXP 1Q7YQ 4OGQB 1LP1A 1UIIA 2WPQA 2J59M 4RESB 4R4MA 2KLUA 1SQVE 5APUA 3A0BH 2YMYA 3KPEA 2WSFJ 2Q6QA 5KLIC 5H2FE 1A02F 1WMKA 2HFED 1FDOA 1VQNP 5APWA 1X22A 2JO1A 4UB6H 1SQVG 1A02J 4R4LA 3SSUA 2N9YB 1QL1A 4N78E 1NH4A 1BSHA 5B5EH 1MFZA 3D70A 2WSSH 3V2NA 3BRVB 3P8MC 4YTPC 1IO4A 1L0LK 1PP9J 3EFGA 1LTJA 5CJ4A 3V2PA 5L8RJ 2AEJA 3L74J 1NAYA 3I5CA 3Q3DA 1M7LA 3UIAA 5BU5A 1OVVA 1SQVD 3CWBE 1KFMA 3MP7B 1MZ9A 2R32A 2IFMA 1HWTC 2YKQA 4DOJA 2V4HA 4IFDK 4Y28J 1GL2B 1P84I 3QH9A 1NTKJ 3CWBG 4ASWA 3CD6P 3AE6C 1KB9E 4IL6X 1HGVA 3CCMP 1PGOA 2NPSC 5EFWB 5DJUB 4W7YA 1BE3E 3V6IA 1OW6A 2MJZA 1KTMA 2KNCB 2E43A 4HH2A 4QMAA 2P10A 2KK7A 2LXCB 1YQ4C 2OYHB 2WSEJ 2P58A 2IZ0A 1SQBK 1T8ZA 1VQKP 5K5GB 3CWBD 1BE3G 2RN0A 5AW0B 1VF5D 1GK4A 2FXOA 1HTLC 1KQFB 2V7QJ 1FE6A 1VF5B 3EWKA 1AFOA 3Q2YA 3M9HA 3AEAC 1RE4C 3JSVC 2QJPC 3CI9A 1IFMA 4YXWH 2K9YA 5AVRB 2Y0DA 3D6YA 3KHUA 1KB9D 2Y9ZA 1G2CB 1GDTA 1RQVA 4HB1A 3FGAD 4RJTA 3BCCE 2B87A 4BXLA 1BE3D 1IJDB 2M3BA 2ZXEB 1GK6A 4C46A 4OWFA 4JPZB 1SQQE 5KKZC 1KFNA 2QJYC 3KZIH 3NMDA 1S4XA 2FYNB 3Q5PA 5H2FH 2J58A 1USEA 2NPSA 1K73Q 1W5CE 3BCCG 1VQMP 2C0XA 3MGNA 1JY3N 2N1TC 3L70E 1X9VA 3CMAP 4JF7A 4WVZA 2XKMA 4I2LC 3L37A 2FYUJ 2P67A 1J1EC 1SQQG 3B8EB 2R3SA 2FFDC 3T97A 3H1KE 3PJSK 3SFEC 1U57A 2ZFCA 5TJHA 3D71A 1LT9C 3G71P 4W80A 1JO5A 1L0LE 3L70G 2CPSA 2BASA 1YYCA 2WTYA 1XTCC 3OJAB 3RL0D 2QJKB 2H8PD 5AW5B 3RL0B 1RE4A 3BCCD 1NU1E 1JUNA 2NZ2A 4L75A 3CX5I 5TISE 1KN7A 3G9RA 3M06A 3U1CA 1SQQD 1T2KD 1L0LG 2JWAA 2YXRB 3FX0A 3H1LJ 3CXHI 3CMEP 1JMBA 5B66E 4GIFA 1CI6B 4U3FJ 1KILC 5CMZA 1NU1G 4H0LB 2QIWA 1SFCC 3L70D 4N6JA 4BWNA 1SQXK 2GM4A 4ZKPA 3V5BA 1URQD 1J1DC 2HPCB 1KB9H 1IFIA 2FY8A 2AEMA 4GODA 1JCCA 2KYVA 2ZYAA 2N1TA 1USDA 2IPPA 3BATA 3A5TA 1GW4A 5APTA 1NTMK 2XU6A 3H1HE 1JTHA 2WSCJ 3H6PA 3RGUA 2Y0EA 1L0LD 3PHLA 2WPVB 3L73E 4XA4A 3CC2P 3PLNA 2FFDA 1ZP0C 1LTTC 4PD4I 3W67A 1BGYJ 3L75J 1NU1D 1LT9A 2HR3A 2H43A 4H13D 1L0NE 4H13B 3CC4P 4JYBA 4HYTB 4OH8B 2BEQD 1FAVA 2KI7B 3L73G 3MHVA 1X8YA 5CCHC 5KLVE 1N8RQ 3M9QA 2YIUB 2QE7H 3V4WA 4ASVA 1DX7A 1H89A 1M57D 1L0NG 3KXDA 5APSA 5AVUB 2E75D 2K1AA 3RK3C 3OAKA 1R5LA 2E75B 3PP5A 3CX5H 1IFJA 2R5DA 1DEBA 2FBWC 1PIXA 4Y99B 1KILA 5KLVG 4DT0A 1SFCA 3GHGB 2BCCE 1OVRA 3PRJA 1GU5A 2LR2A 1IZNB 1UIXA 1SQXJ 1YHQP 3L73D 3H1JJ 4H44D 1PPJE 1LGHB 3TGUE 1LT1A 2POHA 4C7RA 4D6TJ 2GUSA 1L0ND 2VRSA 3B5ND 2BCCG 1G1IA 1NTMJ 3B5NB 5AW6B 1K9MQ 4EIJA 5KLVD 1PPJG 3W68A 5KJ7A 1U7MA 1EQ7A 4N3YB 1FC2C 3TGUG 1NTZK 3LW5H 3O6QB 1PGJA 1N7SC 2XZRA 3E7KA 2JJLA 1FBMA 2W27A 3I56P 2OARA 1JY3O 3EFFK 2V7QH 3IF4A 5CCGC 3VMZA 3C1LA 5CCHA 5KJ7D 1LWUB 1SQPJ 1NOHA 2WZ7A 2WT7B 2BCCD 3AE7C 1GZLA 2WQYC 1N73C 2OYIC 1ZXGA 5CCHD 5BVZA 3SWYA 1JY3P 3V4QA 1PPJD 3JC22 3A0HE 5B66H 4O9BA 3TGUD 2XNDH 4C7NA 1NTKK 4BRYA 1H8AA 3MTUE 1LTGC 2CPBA 1VPCA 1FZEA 1P84E 3AEDC 1LP1B 3KZIE 3HD7C 1YITP 1NAFA 1W2BO 5CHXA 3Q5RA 4KHXA 2K3RA 3BVHA 5CBOA 1DH3A 3AE5C 2W6BA 2YMKA 3L72E 4KT0J 2IDBA 1JCDA 1LJ2A 5AW9B 1N7SA 1EZVI 4IFMA 2WMMA 2XNXA 3E1IA 3MZWB 5CJ0A 1NTZJ 5AW7B 4I7ZB 2N9BA 5CCGA 3AE2C 3H1IE 1GU4A 1HGZA 1IFPA 1E79H 3VP8A 2JEEA 1M56D 2GA1A 3L72G 1HBWA 1LTJB 2KS1A 1BDDA 2PP6A 1N73A 2OYIA 2D2CC 1JEKA 1ZLLA 3L71E 2YXQB 1P84D 2H7HA 1T3UA 3H1IG 2Q5UA 4PV1D 2E76C 1IK7A 4PV1B 2QRXA 2AXCA 2M0BA 3RBXA 2E74C 1RF0C 3HE4A 3HD7A 2O01H 3L71G 1JY2N 5KAFE 3L72D 4MN4C 5AVZB 4ZMDA 3S1KA 3II6A 2FYUK 2DW3A 2KNCA 3WU2E 1KC8Q 2E5TA 5KLIB 1BCCJ 3KQGA 5AW1B 2J5UA 1LTIC 3H1ID 3HTKA 1EDLA 1GTWA 1VDFA 4GDOA 2FKWB 3AE9C 1RF1C 3BRTB 3S4RA 1GW3A 1PP9E 2W6JH 4LC1A 3HE5A 3L71D 4UB8E 1M90Q 1L4AC 4DJGA 2Q9IA 3H1KJ 2IFNA 3MUDC 1KQLA 1FDIA 3TYYA 1Y47A 3VMXA 2C9LY 3R2PA 4Z1MH 1Q86Q 4AQRD 1PP9G 2R5BA 4WY4C 1AVYA 3CX5E 3LIDA 2KLVA 3L35A 3A0HH 1IK9A 3ABVC 3L74G 2Z5HA 1MKMA 3U59A 4H0LC 3CXHE 1ZN5A 1RF0A 3AE8C 1QLED 1NTKE 1VQ4P 1P84H 3MIWA 5AW3B 2ZT9C 1KORA 2E76D 1AVOA 2Q1KA 2B87B 1HJBA 2YO2A 4ZNCA 3L4FA 1EXIA 1N2DC 4WBAA 1LTAC 1PP9D 3HUSC 1RE3C 1PGPA 3SFDC 2ZJSE 2NPSD 1G1JA 1NTKG 1RH5B 1SVFA 2NPSB 2QM8A 3L74D 1R5SA 5CBNA 1RF1A 1XTGB 3H1HJ 1GD2E 2AEFA 1HF9A 2B89A 3AEGC 3FXEA 1IFNA 4PD4E 2P1JA 2JWDA 1L4AA 2WWWA 1N86A 1MFTA 1IC2A 3CL3D 3MUDA 3G6EP 3CX5D 2I8DA 2L91A 4EDFA 2H89C 3H25A 2WITA 3B71A 3P32A 2W90A 1FJKA 1KQSO 1X0TA 3CXHD 2GUVA 2K9JA 1JNMA 1H0TA 1K05A 4WY4A 1NTKD 1FZBA 3OW2O 1JOCA 1S5LE 2P2UA 4Y99C 2W83C 4K35A 2QJPB 1OWAA 2IZ1A 2M5AB 1HJ0A 5GTIE 1PFIA 1M1JC 4JQ0D 4L74A 2IBZI 1OFCX 1SQVK 2WSFH 1URQB 3KYQA 1DEEG 2RMZA 5KAFH 1PZQA 1Z56A 1YQ3C 3VN0A 3HUSA 1RE3A 4PD4D 2ZT9D 3H32A 3WU2H 3CCRP 5KKZB 1QX8A 2YKPA 2A45I 2FYUE 2LKMA 1FZAA 3CCQP 1QVGO 3EQ2A 1KILE 1FZCC 2N1TD 3KDPB 2R3CA 2RKLA 1FZGA 2BEZF 4L73A 2H88C 1MV8A 1PL5A 5APVA 1JY2O 3TNUA 1SQBE 4EOTA 1JTHB 2HODA 4LLHA 3RK2C 4UB8H 1J1EB 1VQPP 1SQPK 4HKZH 3TSIA 4OVNF 2FFDB 4JYCA 2FYUG 1VQ8P 1ZW0A 1VQ6P 1LT9B 3D6ZA 1GMJA 2Q3IA 2AXTH 1JY2P 1NWQA 1SQBG 1DIPA 3IAOA 1S72P 3AECC 2HG5D 4OGQC 1FOSE 1CSBA 2YO3A 1KMIZ 1TU3F 3L36A 3H1LE 2JKVA 4K3AA 3NTNA 2HLOA 3CXHH 4U3FE 3CCSP 1M1JA 2A06E 2P7JA 5AW8B 3M9BA 5APQA 3OA7A 2C0WA 3CC7P 3M0DC 2FYUD 2OTKE 5KTBA 1SQVJ 1KILD 2MKVA 4H44B 3WUVA 1SFCD 3B4SA 3H1LG 2R44A 3WUUA 1SFCB 2XDJA 3RK3E 1SQBD 4U3FG 3FWNA 1J1DB 3NFQA 1KZUB 2A06G 3V2RA 5GTHE 3ZDMA 1N7LA 5C39A 1OMIA 4L76A 1FZCA 1SP4A 3M0AA 2YKOA 2WSEH 2LXBA 2OGUA 2Z5IA 3HRNA 3K5BA 1CZQA 1YTZT 1Q82Q 1BGYE 3L75E 4GOFA 2OTLP 4PD4H 3IR9A 3CLQA 3E1RA 3VOPA 1EZVE 1KQGB 4GKGA 3H1LD 3R4YA 3FWLA 2QG4A 4U3FD 2A06D 1BGYG 3L75G 2M3EA 2NRGA 1PV3A 1RQUA 1KD1Q 3CCJP 3CCEP 1S5LH 1JB0J 1FZFA 1EZVG 1GL2C 1M8OB 2Q3EA 3CWBJ 3IN6A 1S9KE 1S1CX 1AV1A 4XFJA 5GTIH 3RK3D 1KYOI 1W2EA 5AVSB 4OGQD 3RK3B 4IL6E 3N4XA 3M0DA 4A7PA 1YBKA 1QGKB 3GW6A 3PTZA 1SQXE 3H1JE 2OQQA 3QWOC 2QA4P 4IFFA 1SQQK 1YJNP 2PFXA 3GLMA 4C7NB 4BRYB 1BGYD 3L75D 1WT6A 4D6TE 2RH0A 2FXMA 5BU8B 1AQTA 1NTME 2OYHC 1EZVD 2ZAEB 1BE3J 3AEEC 1K8AQ 1QVFO 1SQXG 3H1JG 2KZJA 3VTPC 1OIPA 4D6TG 3JCUE 1VF5C 3BASA 1NTMG 4I1LA 5AVQB 3TF5A 1S9KD 1N7SD 2OTJP 1SQPE 1YJ9P 1N7SB 1VQOP 4YXDC 3GF7A 1BDCA 5CCGD 3A7OA 2G8YA 1NU1K 3VMYA 2K88A 5AVWB 5M1BA 4KJMA 1SQXD 1GL2A 3H1JD 1FDMA 5KAIE 1SQPG 2KS1B 3AE4C 4RO0A 1EXJA 4D6TD 1N73B 1AQ5A 1RHZB 1JM0A 2OYIB 2OYOA 2E5YA 1FS0E 2Z4EA 1GL2D 2FYNC 1NTMD 1KYOH 3BCCJ 1H88A 1NVOA 1HVVA 3WMM0 2JR8A 3I55P 3AE1C 1FU1A 1T6AA 3M91A 1SQQJ 3TDKA 3HD7D 4N78D 5E79E 2WSCH 3AEBC 3HE4B 3HD7B 5GTHH 2OYHA 4NPDA 1ZOYC 2FXPA 1NHLA 4I6MC 3F5HA 3L70J 1OVUA 2YNYA 2O1JA 1SQPD 2FYZA 2KIKA 1NKZB 1NTZE 4IOIH 1T3JA 1YIJP 1L0NK 3HTKB 1LTSC 2QJKC 3L74E 3RL0C 3LW5J 1M1KQ 1EDJA 4YPCA 1L0LJ 4WWIA 2AXTE
chains in the Genus database with same CATH topology
3D70A 3AEFC 1HJ0A 3AE8C 1JB0J 2P10A 3IN6A 5M1BA 1YQ4C 4YTPC 2WSCJ 2WSEJ 3Q5RA 2ZT9C 1KORA 1S1CX 1Q90D 2WPVB 4XFJA 4RKUJ 2E75C 3S9OA 2E76D 4OGQD 1ZP0C 3AE4C 3SFEC 1EXJA 1U57A 3AE5C 3C8VA 3D71A 2D2CD 3Q5SA 1EXIA 2G3AA 5L8RJ 1VF5D 2MKVA 2D2CB 1K04A 4H44B 2YMKA 1YQ3C 2V7QJ 1KQFB 2J5UA 4H13D 1VF5B 2OQQA 2FYNC 3GMAA 3EWKA 3Q3DA 4KT0J 3GF3A 2IDBA 2ZT9D 4H13B 3SFDC 2JP3A 3RK3E 3Q2YA 3GLMA 1DD4A 4PV1C 4GDOA 3AE9C 3AE1C 3AEAC 4U7JA 2BEQD 3AE3C 2E76B 2QJPC 1R8EA 1HF9A 1KILE 4OGQB 3AEGC 4H44C 4H0LD 2E74D 1OMIA 4I7ZB 2NZ2A 3AE2C 2K9YA 2BEZF 2H88C 3AEBC 2E74B 1S5LX 1PL5A 3G9RA 3AEEC 4Y28J 3D6YA 4R4MA 1ZOYC 2FXPA 2QSIA 1ZMEC 2O01J 1RQVA 2E75D 2ZT9B 3Q1MA 3FGAD 3AE7C 4TT3H 2WQYC 2E75B 1FDIA 1DD3A 2H89C 3H25A 2WSFJ 2FBWC 2D2CC 5KLIC 3B71A 4Z1MH 1PIXA 1KQGB 1VF5C 1WMKA 3AE6C 4H0LB 1FDOA 2QIWA 4H13C 3D6ZA 4IL6X 3R4YA 1GMJA 1Y9BA 5KKZC 3RL0g 1AJYA 2QJYC 1NGMB 1K05A 3O6QA 3Q5PA 2JO1A 2QJKC 1OW7A 1ZRTE 4PV1D 2E76C 1IK7A 3IAOA 3LW5J 1UIXA 3AECC 4PV1B 1NYHA 1DIPA 1VL2A 4YXDC 3ABVC 4OGQC 4R4LA 3GF7A 1MKMA 4I7ZC 1KMIZ 1TU3F 1OW6A 3T97B 2YIUC 1PV3A 1RQUA 1KTMA 4H44D 4H0LC 2E74C 3AEDC 2G8YA 1OW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NGM B; 
#chains in the Genus database with same CATH topology
 5KLV K;  1RY3 A;  3HE5 B;  5DJT B;  3PH0 A;  1G2C A;  1OZH A;  1NTZ G;  2KXP B;  1NU1 J;  1T2K C;  4RKU J;  1SS1 A;  1KV4 A;  3IFM A;  5AVV B;  3C8V A;  2D2C D;  1SLQ A;  1IFD A;  2D2C B;  1WRG A;  2ZVO B;  3VMA A;  4IL6 H;  4TLF A;  2KSJ A;  1URQ C;  2B88 A;  2PAJ A;  2KUB A;  3ITK A;  2E76 B;  2IBZ E;  2KSE A;  1KB9 I;  3WUT A;  3A3Y B;  2E74 D;  1CW5 A;  2E74 B;  3U1A A;  1NTZ D;  2QSI A;  1ZME C;  1BCC E;  1S3J A;  2C9N Y;  2IBZ G;  2O01 N;  4H13 C;  2K37 A;  3L73 J;  3RL0 g;  3JCU H;  1LTB C;  1ZRT E;  2Q7C A;  1NKN A;  1VL2 A;  5AVX B;  1BCC G;  1RF1 B;  1QL2 A;  1L0N J;  3T97 B;  2YIU C;  1SQB J;  4GT1 A;  1MUU A;  1OW8 A;  2A45 G;  4DZO A;  4PJ0 E;  1L4A D;  1L4A B;  1X79 B;  2E75 C;  3S9O A;  5KLV J;  3C9I A;  3G3Z A;  1FOS F;  2QM7 A;  4NPF X;  2IX7 C;  1CI6 A;  2M8R A;  3H1K G;  2CK3 H;  2KZI A;  4JBZ A;  2IBZ D;  2M5A A;  5KAI H;  3CCU P;  3SWK A;  3GHG C;  3GMA A;  4WY4 D;  2K9J B;  3A2A A;  1ZR2 A;  2QVA A;  2JP3 A;  1H0T B;  2HPC A;  3P8C E;  4WY4 B;  2W8Z A;  1DD4 A;  3P7K A;  1BSN A;  1URQ A;  2I1K A;  1BCC D;  2IYP A;  3AE3 C;  5AW4 B;  3VP9 A;  1HH0 A;  1OX3 A;  2JDI H;  4H44 C;  4H0L D;  2BCC J;  5AVY B;  2KB7 P;  3A0B E;  1EDK A;  2XV5 A;  5E79 H;  2O01 J;  1E5W A;  2ITA A;  2QJY B;  2ZT9 B;  3LIE A;  3Q1M A;  1JMM A;  3B5N C;  3USS A;  1ZRT D;  3TGU J;  1VQ5 P;  1DD3 A;  3H1K D;  4XE5 B;  1VQ9 P;  2N1T B;  1D7M A;  2WPS A;  4UB6 E;  4W7Z A;  1Y9B A;  3HUS B;  1NGM B;  3H32 B;  1OW7 A;  1ZV8 A;  1NYH A;  5B5E E;  1S2E A;  3G4S P;  1LWU C;  5KJ7 C;  2ZXX A;  3RBZ A;  3O8Z A;  3AEF C;  1J2J B;  5AVT B;  1FJP A;  5APX A;  1EC5 A;  1HUC A;  3TNU B;  1Q2N A;  3H1H G;  1Q90 D;  2HOD B;  2Y0C A;  3P8C D;  5APY A;  4B86 A;  3Q5S A;  2W6A A;  2O1K A;  2G3A A;  2HYN A;  1K04 A;  4EI2 A;  1AA0 A;  3GHG A;  1QEX A;  1U7J A;  3FXD A;  2UWJ E;  4U7J A;  2I1J A;  1VQ7 P;  2Y9Y A;  4AYC A;  1R8E A;  2L5G B;  3GG2 A;  1KYO E;  1YJW P;  1S5L X;  1KIL B;  3F89 A;  1ZR4 A;  2ZYG A;  3MD0 A;  3H1H D;  2WVR A;  1M1J B;  4TT3 H;  4DCK A;  3B5N A;  3CPW O;  2IYO A;  2PRR A;  4LGD E;  4CPG A;  1YI2 P;  2SPZ A;  3V2Q A;  4NPE A;  2A45 H;  1AJY A;  3O6Q A;  2KOG A;  2ZYD A;  3NXS A;  3N7N A;  2B9B A;  2PGD A;  4I7Z C;  3L72 J;  1PGQ A;  4WB4 A;  1LWU A;  1NO4 A;  1FZC B;  3SWF A;  1Y8A A;  2WT7 A;  1NJI Q;  1LTJ C;  3RK2 D;  4PJ0 H;  1LNQ A;  1L2P A;  3H1I J;  3RK2 B;  4EYY Q;  4HJG H;  3VYI A;  2WPR A;  1YTZ I;  4ZKU A;  3TK1 A;  1Q81 Q;  1KYO D;  1OXZ A;  2E42 A;  3GF3 A;  1EDI A;  4PV1 C;  2KP8 A;  5TIS H;  2O3J A;  3CCL P;  3L71 J;  4M3L A;  4AUW A;  2ZVN B;  4GOE A;  5AW2 B;  1VQL P;  3CCV P;  2QEX P;  1Q7Y Q;  4OGQ B;  1LP1 A;  1UII A;  2WPQ A;  2J59 M;  4RES B;  4R4M A;  2KLU A;  1SQV E;  5APU A;  3A0B H;  2YMY A;  3KPE A;  2WSF J;  2Q6Q A;  5KLI C;  5H2F E;  1A02 F;  1WMK A;  2HFE D;  1FDO A;  1VQN P;  5APW A;  1X22 A;  2JO1 A;  4UB6 H;  1SQV G;  1A02 J;  4R4L A;  3SSU A;  2N9Y B;  1QL1 A;  4N78 E;  1NH4 A;  1BSH A;  5B5E H;  1MFZ A;  3D70 A;  2WSS H;  3V2N A;  3BRV B;  3P8M C;  4YTP C;  1IO4 A;  1L0L K;  1PP9 J;  3EFG A;  1LTJ A;  5CJ4 A;  3V2P A;  5L8R J;  2AEJ A;  3L74 J;  1NAY A;  3I5C A;  3Q3D A;  1M7L A;  3UIA A;  5BU5 A;  1OVV A;  1SQV D;  3CWB E;  1KFM A;  3MP7 B;  1MZ9 A;  2R32 A;  2IFM A;  1HWT C;  2YKQ A;  4DOJ A;  2V4H A;  4IFD K;  4Y28 J;  1GL2 B;  1P84 I;  3QH9 A;  1NTK J;  3CWB G;  4ASW A;  3CD6 P;  3AE6 C;  1KB9 E;  4IL6 X;  1HGV A;  3CCM P;  1PGO A;  2NPS C;  5EFW B;  5DJU B;  4W7Y A;  1BE3 E;  3V6I A;  1OW6 A;  2MJZ A;  1KTM A;  2KNC B;  2E43 A;  4HH2 A;  4QMA A;  2P10 A;  2KK7 A;  2LXC B;  1YQ4 C;  2OYH B;  2WSE J;  2P58 A;  2IZ0 A;  1SQB K;  1T8Z A;  1VQK P;  5K5G B;  3CWB D;  1BE3 G;  2RN0 A;  5AW0 B;  1VF5 D;  1GK4 A;  2FXO A;  1HTL C;  1KQF B;  2V7Q J;  1FE6 A;  1VF5 B;  3EWK A;  1AFO A;  3Q2Y A;  3M9H A;  3AEA C;  1RE4 C;  3JSV C;  2QJP C;  3CI9 A;  1IFM A;  4YXW H;  2K9Y A;  5AVR B;  2Y0D A;  3D6Y A;  3KHU A;  1KB9 D;  2Y9Z A;  1G2C B;  1GDT A;  1RQV A;  4HB1 A;  3FGA D;  4RJT A;  3BCC E;  2B87 A;  4BXL A;  1BE3 D;  1IJD B;  2M3B A;  2ZXE B;  1GK6 A;  4C46 A;  4OWF A;  4JPZ B;  1SQQ E;  5KKZ C;  1KFN A;  2QJY C;  3KZI H;  3NMD A;  1S4X A;  2FYN B;  3Q5P A;  5H2F H;  2J58 A;  1USE A;  2NPS A;  1K73 Q;  1W5C E;  3BCC G;  1VQM P;  2C0X A;  3MGN A;  1JY3 N;  2N1T C;  3L70 E;  1X9V A;  3CMA P;  4JF7 A;  4WVZ A;  2XKM A;  4I2L C;  3L37 A;  2FYU J;  2P67 A;  1J1E C;  1SQQ G;  3B8E B;  2R3S A;  2FFD C;  3T97 A;  3H1K E;  3PJS K;  3SFE C;  1U57 A;  2ZFC A;  5TJH A;  3D71 A;  1LT9 C;  3G71 P;  4W80 A;  1JO5 A;  1L0L E;  3L70 G;  2CPS A;  2BAS A;  1YYC A;  2WTY A;  1XTC C;  3OJA B;  3RL0 D;  2QJK B;  2H8P D;  5AW5 B;  3RL0 B;  1RE4 A;  3BCC D;  1NU1 E;  1JUN A;  2NZ2 A;  4L75 A;  3CX5 I;  5TIS E;  1KN7 A;  3G9R A;  3M06 A;  3U1C A;  1SQQ D;  1T2K D;  1L0L G;  2JWA A;  2YXR B;  3FX0 A;  3H1L J;  3CXH I;  3CME P;  1JMB A;  5B66 E;  4GIF A;  1CI6 B;  4U3F J;  1KIL C;  5CMZ A;  1NU1 G;  4H0L B;  2QIW A;  1SFC C;  3L70 D;  4N6J A;  4BWN A;  1SQX K;  2GM4 A;  4ZKP A;  3V5B A;  1URQ D;  1J1D C;  2HPC B;  1KB9 H;  1IFI A;  2FY8 A;  2AEM A;  4GOD A;  1JCC A;  2KYV A;  2ZYA A;  2N1T A;  1USD A;  2IPP A;  3BAT A;  3A5T A;  1GW4 A;  5APT A;  1NTM K;  2XU6 A;  3H1H E;  1JTH A;  2WSC J;  3H6P A;  3RGU A;  2Y0E A;  1L0L D;  3PHL A;  2WPV B;  3L73 E;  4XA4 A;  3CC2 P;  3PLN A;  2FFD A;  1ZP0 C;  1LTT C;  4PD4 I;  3W67 A;  1BGY J;  3L75 J;  1NU1 D;  1LT9 A;  2HR3 A;  2H43 A;  4H13 D;  1L0N E;  4H13 B;  3CC4 P;  4JYB A;  4HYT B;  4OH8 B;  2BEQ D;  1FAV A;  2KI7 B;  3L73 G;  3MHV A;  1X8Y A;  5CCH C;  5KLV E;  1N8R Q;  3M9Q A;  2YIU B;  2QE7 H;  3V4W A;  4ASV A;  1DX7 A;  1H89 A;  1M57 D;  1L0N G;  3KXD A;  5APS A;  5AVU B;  2E75 D;  2K1A A;  3RK3 C;  3OAK A;  1R5L A;  2E75 B;  3PP5 A;  3CX5 H;  1IFJ A;  2R5D A;  1DEB A;  2FBW C;  1PIX A;  4Y99 B;  1KIL A;  5KLV G;  4DT0 A;  1SFC A;  3GHG B;  2BCC E;  1OVR A;  3PRJ A;  1GU5 A;  2LR2 A;  1IZN B;  1UIX A;  1SQX J;  1YHQ P;  3L73 D;  3H1J J;  4H44 D;  1PPJ E;  1LGH B;  3TGU E;  1LT1 A;  2POH A;  4C7R A;  4D6T J;  2GUS A;  1L0N D;  2VRS A;  3B5N D;  2BCC G;  1G1I A;  1NTM J;  3B5N B;  5AW6 B;  1K9M Q;  4EIJ A;  5KLV D;  1PPJ G;  3W68 A;  5KJ7 A;  1U7M A;  1EQ7 A;  4N3Y B;  1FC2 C;  3TGU G;  1NTZ K;  3LW5 H;  3O6Q B;  1PGJ A;  1N7S C;  2XZR A;  3E7K A;  2JJL A;  1FBM A;  2W27 A;  3I56 P;  2OAR A;  1JY3 O;  3EFF K;  2V7Q H;  3IF4 A;  5CCG C;  3VMZ A;  3C1L A;  5CCH A;  5KJ7 D;  1LWU B;  1SQP J;  1NOH A;  2WZ7 A;  2WT7 B;  2BCC D;  3AE7 C;  1GZL A;  2WQY C;  1N73 C;  2OYI C;  1ZXG A;  5CCH D;  5BVZ A;  3SWY A;  1JY3 P;  3V4Q A;  1PPJ D;  3JC2 2;  3A0H E;  5B66 H;  4O9B A;  3TGU D;  2XND H;  4C7N A;  1NTK K;  4BRY A;  1H8A A;  3MTU E;  1LTG C;  2CPB A;  1VPC A;  1FZE A;  1P84 E;  3AED C;  1LP1 B;  3KZI E;  3HD7 C;  1YIT P;  1NAF A;  1W2B O;  5CHX A;  3Q5R A;  4KHX A;  2K3R A;  3BVH A;  5CBO A;  1DH3 A;  3AE5 C;  2W6B A;  2YMK A;  3L72 E;  4KT0 J;  2IDB A;  1JCD A;  1LJ2 A;  5AW9 B;  1N7S A;  1EZV I;  4IFM A;  2WMM A;  2XNX A;  3E1I A;  3MZW B;  5CJ0 A;  1NTZ J;  5AW7 B;  4I7Z B;  2N9B A;  5CCG A;  3AE2 C;  3H1I E;  1GU4 A;  1HGZ A;  1IFP A;  1E79 H;  3VP8 A;  2JEE A;  1M56 D;  2GA1 A;  3L72 G;  1HBW A;  1LTJ B;  2KS1 A;  1BDD A;  2PP6 A;  1N73 A;  2OYI A;  2D2C C;  1JEK A;  1ZLL A;  3L71 E;  2YXQ B;  1P84 D;  2H7H A;  1T3U A;  3H1I G;  2Q5U A;  4PV1 D;  2E76 C;  1IK7 A;  4PV1 B;  2QRX A;  2AXC A;  2M0B A;  3RBX A;  2E74 C;  1RF0 C;  3HE4 A;  3HD7 A;  2O01 H;  3L71 G;  1JY2 N;  5KAF E;  3L72 D;  4MN4 C;  5AVZ B;  4ZMD A;  3S1K A;  3II6 A;  2FYU K;  2DW3 A;  2KNC A;  3WU2 E;  1KC8 Q;  2E5T A;  5KLI B;  1BCC J;  3KQG A;  5AW1 B;  2J5U A;  1LTI C;  3H1I D;  3HTK A;  1EDL A;  1GTW A;  1VDF A;  4GDO A;  2FKW B;  3AE9 C;  1RF1 C;  3BRT B;  3S4R A;  1GW3 A;  1PP9 E;  2W6J H;  4LC1 A;  3HE5 A;  3L71 D;  4UB8 E;  1M90 Q;  1L4A C;  4DJG A;  2Q9I A;  3H1K J;  2IFN A;  3MUD C;  1KQL A;  1FDI A;  3TYY A;  1Y47 A;  3VMX A;  2C9L Y;  3R2P A;  4Z1M H;  1Q86 Q;  4AQR D;  1PP9 G;  2R5B A;  4WY4 C;  1AVY A;  3CX5 E;  3LID A;  2KLV A;  3L35 A;  3A0H H;  1IK9 A;  3ABV C;  3L74 G;  2Z5H A;  1MKM A;  3U59 A;  4H0L C;  3CXH E;  1ZN5 A;  1RF0 A;  3AE8 C;  1QLE D;  1NTK E;  1VQ4 P;  1P84 H;  3MIW A;  5AW3 B;  2ZT9 C;  1KOR A;  2E76 D;  1AVO A;  2Q1K A;  2B87 B;  1HJB A;  2YO2 A;  4ZNC A;  3L4F A;  1EXI A;  1N2D C;  4WBA A;  1LTA C;  1PP9 D;  3HUS C;  1RE3 C;  1PGP A;  3SFD C;  2ZJS E;  2NPS D;  1G1J A;  1NTK G;  1RH5 B;  1SVF A;  2NPS B;  2QM8 A;  3L74 D;  1R5S A;  5CBN A;  1RF1 A;  1XTG B;  3H1H J;  1GD2 E;  2AEF A;  1HF9 A;  2B89 A;  3AEG C;  3FXE A;  1IFN A;  4PD4 E;  2P1J A;  2JWD A;  1L4A A;  2WWW A;  1N86 A;  1MFT A;  1IC2 A;  3CL3 D;  3MUD A;  3G6E P;  3CX5 D;  2I8D A;  2L91 A;  4EDF A;  2H89 C;  3H25 A;  2WIT A;  3B71 A;  3P32 A;  2W90 A;  1FJK A;  1KQS O;  1X0T A;  3CXH D;  2GUV A;  2K9J A;  1JNM A;  1H0T A;  1K05 A;  4WY4 A;  1NTK D;  1FZB A;  3OW2 O;  1JOC A;  1S5L E;  2P2U A;  4Y99 C;  2W83 C;  4K35 A;  2QJP B;  1OWA A;  2IZ1 A;  2M5A B;  1HJ0 A;  5GTI E;  1PFI A;  1M1J C;  4JQ0 D;  4L74 A;  2IBZ I;  1OFC X;  1SQV K;  2WSF H;  1URQ B;  3KYQ A;  1DEE G;  2RMZ A;  5KAF H;  1PZQ A;  1Z56 A;  1YQ3 C;  3VN0 A;  3HUS A;  1RE3 A;  4PD4 D;  2ZT9 D;  3H32 A;  3WU2 H;  3CCR P;  5KKZ B;  1QX8 A;  2YKP A;  2A45 I;  2FYU E;  2LKM A;  1FZA A;  3CCQ P;  1QVG O;  3EQ2 A;  1KIL E;  1FZC C;  2N1T D;  3KDP B;  2R3C A;  2RKL A;  1FZG A;  2BEZ F;  4L73 A;  2H88 C;  1MV8 A;  1PL5 A;  5APV A;  1JY2 O;  3TNU A;  1SQB E;  4EOT A;  1JTH B;  2HOD A;  4LLH A;  3RK2 C;  4UB8 H;  1J1E B;  1VQP P;  1SQP K;  4HKZ H;  3TSI A;  4OVN F;  2FFD B;  4JYC A;  2FYU G;  1VQ8 P;  1ZW0 A;  1VQ6 P;  1LT9 B;  3D6Z A;  1GMJ A;  2Q3I A;  2AXT H;  1JY2 P;  1NWQ A;  1SQB G;  1DIP A;  3IAO A;  1S72 P;  3AEC C;  2HG5 D;  4OGQ C;  1FOS E;  1CSB A;  2YO3 A;  1KMI Z;  1TU3 F;  3L36 A;  3H1L E;  2JKV A;  4K3A A;  3NTN A;  2HLO A;  3CXH H;  4U3F E;  3CCS P;  1M1J A;  2A06 E;  2P7J A;  5AW8 B;  3M9B A;  5APQ A;  3OA7 A;  2C0W A;  3CC7 P;  3M0D C;  2FYU D;  2OTK E;  5KTB A;  1SQV J;  1KIL D;  2MKV A;  4H44 B;  3WUV A;  1SFC D;  3B4S A;  3H1L G;  2R44 A;  3WUU A;  1SFC B;  2XDJ A;  3RK3 E;  1SQB D;  4U3F G;  3FWN A;  1J1D B;  3NFQ A;  1KZU B;  2A06 G;  3V2R A;  5GTH E;  3ZDM A;  1N7L A;  5C39 A;  1OMI A;  4L76 A;  1FZC A;  1SP4 A;  3M0A A;  2YKO A;  2WSE H;  2LXB A;  2OGU A;  2Z5I A;  3HRN A;  3K5B A;  1CZQ A;  1YTZ T;  1Q82 Q;  1BGY E;  3L75 E;  4GOF A;  2OTL P;  4PD4 H;  3IR9 A;  3CLQ A;  3E1R A;  3VOP A;  1EZV E;  1KQG B;  4GKG A;  3H1L D;  3R4Y A;  3FWL A;  2QG4 A;  4U3F D;  2A06 D;  1BGY G;  3L75 G;  2M3E A;  2NRG A;  1PV3 A;  1RQU A;  1KD1 Q;  3CCJ P;  3CCE P;  1S5L H;  1JB0 J;  1FZF A;  1EZV G;  1GL2 C;  1M8O B;  2Q3E A;  3CWB J;  3IN6 A;  1S9K E;  1S1C X;  1AV1 A;  4XFJ A;  5GTI H;  3RK3 D;  1KYO I;  1W2E A;  5AVS B;  4OGQ D;  3RK3 B;  4IL6 E;  3N4X A;  3M0D A;  4A7P A;  1YBK A;  1QGK B;  3GW6 A;  3PTZ A;  1SQX E;  3H1J E;  2OQQ A;  3QWO C;  2QA4 P;  4IFF A;  1SQQ K;  1YJN P;  2PFX A;  3GLM A;  4C7N B;  4BRY B;  1BGY D;  3L75 D;  1WT6 A;  4D6T E;  2RH0 A;  2FXM A;  5BU8 B;  1AQT A;  1NTM E;  2OYH C;  1EZV D;  2ZAE B;  1BE3 J;  3AEE C;  1K8A Q;  1QVF O;  1SQX G;  3H1J G;  2KZJ A;  3VTP C;  1OIP A;  4D6T G;  3JCU E;  1VF5 C;  3BAS A;  1NTM G;  4I1L A;  5AVQ B;  3TF5 A;  1S9K D;  1N7S D;  2OTJ P;  1SQP E;  1YJ9 P;  1N7S B;  1VQO P;  4YXD C;  3GF7 A;  1BDC A;  5CCG D;  3A7O A;  2G8Y A;  1NU1 K;  3VMY A;  2K88 A;  5AVW B;  5M1B A;  4KJM A;  1SQX D;  1GL2 A;  3H1J D;  1FDM A;  5KAI E;  1SQP G;  2KS1 B;  3AE4 C;  4RO0 A;  1EXJ A;  4D6T D;  1N73 B;  1AQ5 A;  1RHZ B;  1JM0 A;  2OYI B;  2OYO A;  2E5Y A;  1FS0 E;  2Z4E A;  1GL2 D;  2FYN C;  1NTM D;  1KYO H;  3BCC J;  1H88 A;  1NVO A;  1HVV A;  3WMM 0;  2JR8 A;  3I55 P;  3AE1 C;  1FU1 A;  1T6A A;  3M91 A;  1SQQ J;  3TDK A;  3HD7 D;  4N78 D;  5E79 E;  2WSC H;  3AEB C;  3HE4 B;  3HD7 B;  5GTH H;  2OYH A;  4NPD A;  1ZOY C;  2FXP A;  1NHL A;  4I6M C;  3F5H A;  3L70 J;  1OVU A;  2YNY A;  2O1J A;  1SQP D;  2FYZ A;  2KIK A;  1NKZ B;  1NTZ E;  4IOI H;  1T3J A;  1YIJ P;  1L0N K;  3HTK B;  1LTS C;  2QJK C;  3L74 E;  3RL0 C;  3LW5 J;  1M1K Q;  1EDJ A;  4YPC A;  1L0L J;  4WWI A;  2AXT E; 
#chains in the Genus database with same CATH homology
 3D70 A;  3AEF C;  1HJ0 A;  3AE8 C;  1JB0 J;  2P10 A;  3IN6 A;  5M1B A;  1YQ4 C;  4YTP C;  2WSC J;  2WSE J;  3Q5R A;  2ZT9 C;  1KOR A;  1S1C X;  1Q90 D;  2WPV B;  4XFJ A;  4RKU J;  2E75 C;  3S9O A;  2E76 D;  4OGQ D;  1ZP0 C;  3AE4 C;  3SFE C;  1EXJ A;  1U57 A;  3AE5 C;  3C8V A;  3D71 A;  2D2C D;  3Q5S A;  1EXI A;  2G3A A;  5L8R J;  1VF5 D;  2MKV A;  2D2C B;  1K04 A;  4H44 B;  2YMK A;  1YQ3 C;  2V7Q J;  1KQF B;  2J5U A;  4H13 D;  1VF5 B;  2OQQ A;  2FYN C;  3GMA A;  3EWK A;  3Q3D A;  4KT0 J;  3GF3 A;  2IDB A;  2ZT9 D;  4H13 B;  3SFD C;  2JP3 A;  3RK3 E;  3Q2Y A;  3GLM A;  1DD4 A;  4PV1 C;  4GDO A;  3AE9 C;  3AE1 C;  3AEA C;  4U7J A;  2BEQ D;  3AE3 C;  2E76 B;  2QJP C;  1R8E A;  1HF9 A;  1KIL E;  4OGQ B;  3AEG C;  4H44 C;  4H0L D;  2E74 D;  1OMI A;  4I7Z B;  2NZ2 A;  3AE2 C;  2K9Y A;  2BEZ F;  2H88 C;  3AEB C;  2E74 B;  1S5L X;  1PL5 A;  3G9R A;  3AEE C;  4Y28 J;  3D6Y A;  4R4M A;  1ZOY C;  2FXP A;  2QSI A;  1ZME C;  2O01 J;  1RQV A;  2E75 D;  2ZT9 B;  3Q1M A;  3FGA D;  3AE7 C;  4TT3 H;  2WQY C;  2E75 B;  1FDI A;  1DD3 A;  2H89 C;  3H25 A;  2WSF J;  2FBW C;  2D2C C;  5KLI C;  3B71 A;  4Z1M H;  1PIX A;  1KQG B;  1VF5 C;  1WMK A;  3AE6 C;  4H0L B;  1FDO A;  2QIW A;  4H13 C;  3D6Z A;  4IL6 X;  3R4Y A;  1GMJ A;  1Y9B A;  5KKZ C;  3RL0 g;  1AJY A;  2QJY C;  1NGM B;  1K05 A;  3O6Q A;  3Q5P A;  2JO1 A;  2QJK C;  1OW7 A;  1ZRT E;  4PV1 D;  2E76 C;  1IK7 A;  3IAO A;  3LW5 J;  1UIX A;  3AEC C;  4PV1 B;  1NYH A;  1DIP A;  1VL2 A;  4YXD C;  3ABV C;  4OGQ C;  4R4L A;  3GF7 A;  1MKM A;  4I7Z C;  1KMI Z;  1TU3 F;  1OW6 A;  3T97 B;  2YIU C;  1PV3 A;  1RQU A;  1KTM A;  4H44 D;  4H0L C;  2E74 C;  3AED C;  2G8Y A;  1OW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...