1NGMB

Crystal structure of a yeast brf1-tbp-dna ternary complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
GSYCPRNLHLLPTTDTYLSKVSDDPDNLEDVDDEELNAHLLNEEASKLKERIWIGLNADFLLEQESKRLKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a transcription factor IIIB core interface ternary complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
molecule keywords 5'-D(*CP*TP*AP*TP*AP*AP*AP*AP*AP*AP*AP*TP*GP*TP*TP*TP*TP*TP*
total genus 12
structure length 72
sequence length 72
chains with identical sequence F, J, N
ec nomenclature
pdb deposition date 2002-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.650 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ngmB00
1NGMB
chains in the Genus database with same CATH superfamily
1J1EC 2B88A 1NHLA 2FYUG 3FXEA 2IBZD 4IL6E 4JYBA 1S3JA 3E1IA 4NPEA 3V2RA 2WTYA 1YITP 5AVRB 2C0XA 5KLVJ 1HJBA 3B8EB 2M0BA 2Q6QA 3AEFC 1OZHA 4LGDE 2C9LY 3V4WA 3AEAC 4IL6H 3VMYA 3P7KA 2R3CA 5CJ4A 1QLED 1M1JA 1PFIA 1AA0A 1L4AD 3I55P 1VQPP 1BDCA 3AECC 3VP8A 4EIJA 1AQTA 1CSBA 2FYUD 4L75A 1L0LD 3CLQA 4N78D 3NFQA 4PJ0E 5DJUB 1JB0J 5CCHA 5KJ7A 1VQKP 1HGZA 3CC4P 1SQPG 4WBAA 3TDKA 1NAYA 1FZGA 2R5DA 3WUUA 4DJGA 2A06D 3M0DC 2N1TD 2QJYB 1FZCB 1NTZG 1JY2N 1JTHB 1BE3J 3AEDC 1EQ7A 2M3EA 2L5GB 3K5BA 1NKNA 1IK7A 1HJ0A 1L0LG 5AVZB 3U59A 1IO4A 1HVVA 3CCLP 2QJKC 2UWJE 3TGUJ 1JY2P 1A02F 2ZFCA 2QG4A 1GL2A 1LWUB 2PFXA 2WT7B 1L0NG 1SQQD 3MZWB 1LT1A 2OYIC 2GA1A 1ZP0C 2QE7H 3L72D 1DEEG 2KNCA 2XDJA 2WPQA 3R4YA 4H44C 2JWDA 3G3ZA 2R3SA 1N7SB 3LW5J 2PRRA 1H89A 3KDPB 1IC2A 5KJ7C 1FZBA 5L8RJ 2KLVA 2WSEH 4W7ZA 2BEQD 1RF1A 2YO2A 1KILB 3H1KJ 1N7SD 1RQUA 3BVHA 2K88A 3USSA 3HUSA 1X9VA 1VQ8P 3SWYA 5AW3B 3HD7B 4OGQD 2L91A 3Q2YA 2BCCE 4XA4A 1JUNA 2P58A 2FYNC 2W6AA 2P67A 3ITKA 5TISH 3H1KD 1FJPA 1RQVA 1L0NK 1J1EB 1SQPJ 5KAIH 1EDIA 1GL2C 3B5ND 4IOIH 4R4MA 3JSVC 3M9HA 1G2CA 1SQQK 4K35A 2Y9ZA 2OYHB 1DIPA 1QVGO 3AE6C 1NTZJ 2IYPA 3AE4C 1USEA 1KFMA 2IFNA 1S9KD 3L75J 5C39A 1KTMA 2BCCG 3TSIA 3GW6A 4PV1C 4HYTB 4U3FJ 3D6YA 1Q2NA 1XTGB 1RF1C 3L35A 3CX5D 4JBZA 1W2BO 2G8YA 1BGYE 1ZRTE 5AW7B 1NAFA 3FWNA 2B87B 1VF5C 2HYNA 2KYVA 2K37A 2XV5A 3OAKA 5GTHH 2Q7CA 2A45G 2RKLA 5AVWB 3HD7D 1YI2P 2O01N 2Z5IA 3AE8C 1PPJG 2PGDA 1NU1J 3L74D 1EZVE 1KORA 3L70E 1KFNA 4H13C 2HG5D 4OVNF 2O3JA 2E5YA 4YPCA 4I7ZC 2WITA 3CCUP 3RL0B 1ZR4A 1GZLA 3L73J 3H1KG 4EYYQ 2QIWA 3B5NA 4GT1A 3H1LG 1SQPD 3JCUH 3W68A 1GW4A 1KD1Q 2E75B 1S4XA 1LT9B 3OW2O 2YKPA 1NTZD 2SPZA 3AEEC 2RMZA 1R5LA 1SQQE 2DW3A 2P2UA 2N1TA 1FZAA 1KMIZ 4U3FD 3CI9A 4C46A 1N7SC 4L74A 1URQC 1DEBA 2OTKE 3PH0A 1BCCD 3V2QA 4NPFX 2YIUC 4B86A 3RK3D 3H32A 1PP9D 1SS1A 1J1DB 1NTME 4DZOA 3G6EP 3RBZA 3Q1MA 3HE5B 1BGYD 2KS1B 2H88C 3G9RA 2V4HA 4C7NB 1WRGA 3H1HE 3L75D 4RO0A 1SQVJ 1T3UA 1GL2D 3B5NC 3IN6A 1DX7A 5AW2B 3CCSP 2IDBA 3M0AA 3V5BA 1OW7A 3CXHE 3EFGA 1LT9C 3H1LE 3O6QB 1AQ5A 3BATA 1ZXGA 3L74E 3H1IJ 3VP9A 2WT7A 1SQBE 1RHZB 4H0LC 2A06G 1BE3E 4N6JA 2Y0CA 4PV1D 5BVZA 4KJMA 2B87A 2XZRA 2WSFJ 2R32A 3KYQA 1MKMA 4ZMDA 1M8OB 1N7SA 1GU4A 4W7YA 2V7QJ 3B71A 1FJKA 1H0TA 4IFMA 1QX8A 1ZW0A 4JQ0D 3KQGA 1EDLA 3QWOC 3H1JE 3WU2E 2BASA 1OXZA 4HH2A 1RF1B 4I1LA 3O8ZA 2C9NY 3EQ2A 3HD7C 3CD6P 1UIIA 3FX0A 2OARA 1FDOA 3HUSB 3M9QA 3RBXA 3CCQP 1GU5A 1FZFA 2ZT9D 1P84H 1YHQP 3A0BE 1PP9E 1U7JA 2JWAA 2W6BA 5CCGA 1AFOA 4D6TE 1ZV8A 3B5NB 2IBZG 1EZVG 3TK1A 3RL0C 3BASA 2HPCB 2P7JA 1LT9A 1LTJB 3T97A 3D6ZA 1KB9H 3A0HH 2KXPB 4HJGH 2XNXA 2JP3A 3HE4B 4H0LB 3SSUA 5KKZC 2Y9YA 5B66E 1BE3G 1USDA 2JDIH 5AW6B 3VMAA 2QRXA 2HLOA 2IPPA 2Q9IA 1VPCA 1KN7A 3MGNA 1UIXA 1CZQA 4AYCA 1EZVI 3S9OA 1YJWP 1HF9A 5APQA 3TGUG 4C7NA 1DD4A 5CCHD 2NRGA 1T3JA 3FWLA 3VN0A 3HE5A 2GM4A 1SFCA 1KYOE 2FYUK 1L0NJ 2IZ0A 5CCGC 4UB6E 2KI7B 1PP9J 1AJYA 4JPZB 1MFZA 5AVVB 2KZIA 1VQOP 3FGAD 2AEMA 1GMJA 2WZ7A 3Q5PA 1CI6B 1SP4A 3EFFK 3L74G 2GUSA 3O6QA 2QVAA 2W6JH 1D7MA 2IX7C 2AEJA 1RE4C 1QL2A 5KLVD 5CBNA 2YKOA 3CX5H 2M5AB 1SQVK 2OTLP 1YQ3C 3BRVB 5APVA 2WSCJ 1GDTA 1PGJA 1FBMA 3TNUB 1SLQA 1R5SA 2O01H 3OJAB 2WSSH 1IFPA 3OA7A 4ASWA 3CCMP 5BU8B 3L73G 1P84E 2KIKA 1K05A 4GKGA 1NU1E 1EXJA 1YQ4C 3EWKA 1K04A 3H1KE 1FAVA 1YTZT 2FYNB 1HBWA 2E76C 3H1JG 5EFWB 5B5EH 3WMM0 4EDFA 2ZT9C 3G4SP 2YXQB 3G71P 4RJTA 3CCRP 3H32B 2OYHC 1VQ9P 2E76B 3D71A 1NOHA 2FYZA 2BCCJ 1YIJP 3N7NA 1KILD 1LTJA 1SQXK 2WWWA 4I2LC 4I7ZB 5APYA 1KQLA 3T97B 4ZKUA 2AXCA 5KJ7D 2Q3EA 1RE4A 1NTKE 1FOSE 2OYOA 5TJHA 1K8AQ 3CWBE 4LC1A 4PD4E 1VDFA 3CXHH 1FU1A 1SFCD 1E79H 2E75C 2NPSD 1FE6A 1SQPE 2J5UA 3HTKA 5APTA 1PGQA 3F5HA 1NTMD 1VF5B 2IZ1A 3MHVA 4H13D 5CJ0A 1KYOH 1QL1A 1NTZE 3D70A 1L0LJ 2FXOA 3PTZA 1EZVD 2PAJA 5AVYB 1X79B 1Y9BA 5CCHC 3BRTB 1T2KD 4GODA 3L71E 4XFJA 3H1LJ 3PJSK 1JM0A 1JTHA 2LXCB 2YIUB 2BEZF 1S5LE 4D6TG 3JC22 4L76A 4PD4H 2XU6A 3L73E 1L0ND 1LTJC 1SQQG 4K3AA 2Q3IA 5GTIE 3A2AA 3L70J 1VQ7P 3CWBD 3RK2B 1JY3O 1E5WA 2A45H 2ZVNB 2WSCH 3H1IE 1NKZB 3IFMA 5E79H 1N8RQ 2WQYC 1FDMA 1QEXA 2KS1A 1IK9A 2ZAEB 1N2DC 3NMDA 3H1JJ 4I6MC 4RKUJ 3ZDMA 3TNUA 1VF5D 2E74B 2ZYGA 4H13B 1SQXE 1IFMA 1K73Q 2RN0A 1IFJA 3I56P 1N86A 1AVOA 2OYIB 1MV8A 4IFDK 5M1BA 2E74C 4RESB 1HTLC 1NTKK 4D6TD 3II6A 3GHGC 1M7LA 3HRNA 1OX3A 1NVOA 4WB4A 4GDOA 4DT0A 2POHA 2W83C 1JCCA 2AXTH 3AEGC 1H0TB 1DH3A 1VQ4P 1BGYG 3H1HJ 3HUSC 4BWNA 2O1JA 2ITAA 1Q7YQ 3RL0g 3L75G 2JEEA 1U7MA 4WY4C 1X8YA 1YTZI 4U3FG 1Y8AA 3CXHI 1NTMJ 1GK4A 2OGUA 3L36A 3L71G 1PPJE 1S2EA 4OH8B 1KQGB 3Q5SA 1IZNB 1SQXJ 2NPSC 1PIXA 2JO1A 4KT0J 2Z5HA 1ZR2A 1S1CX 1AV1A 3W67A 1LTGC 2PP6A 3GHGA 1M57D 3H1ID 4H44D 4LLHA 3HE4A 3AEBC 1IFDA 3B4SA 4BXLA 1VQNP 2KZJA 3WUVA 1LGHB 1MZ9A 3L74J 2H43A 1L0NE 2FYUJ 3AE2C 2D2CC 4PD4I 3RK2D 2O01J 1BCCE 2W8ZA 2QA4P 3CWBJ 5B66H 5B5EE 1GK6A 1NO4A 2QJYC 4GOFA 5GTIH 1EXIA 2M3BA 3KXDA 4TLFA 4OGQC 4Y99C 2K3RA 2I1JA 5KLIC 1BDDA 1BSNA 1J1DC 1L2PA 1LTTC 1XTCC 1JY3N 2CK3H 2E5TA 3H1JD 3KZIH 2Q1KA 5AW0B 2IBZI 1S9KE 1KYOI 1L0LE 1PZQA 5AVSB 2R5BA 4ZKPA 3A7OA 2VRSA 3L70D 3V4QA 5AW5B 2P10A 3BCCG 3CCJP 4N3YB 1NH4A 1BCCG 1P84D 1S5LX 2NPSA 1CI6A 1JMMA 2IYOA 3N4XA 1Y47A 5E79E 3C1LA 3VTPC 2OYIA 2KK7A 2MKVA 3AE9C 2Q5UA 3AE3C 3TGUD 1FZCA 3V2NA 1GD2E 1LTIC 4JYCA 2E74D 1JEKA 3H6PA 5APSA 1FS0E 1NU1D 1KILE 2LR2A 2KNCB 4BRYB 1KB9D 1X0TA 2JR8A 1S5LH 3H1HD 1NTMG 4GOEA 1MFTA 2KLUA 4CPGA 2CPSA 2QJPC 3Q3DA 3PLNA 4M3LA 1JNMA 1SQBJ 3C8VA 3CMEP 2K9JB 4U7JA 3A5TA 1CW5A 3LIDA 4EOTA 1U57A 3GG2A 5AVXB 2ZXEB 2E43A 3TGUE 3P32A 1RY3A 1BE3D 3P8MC 3RK3B 1Q86Q 1T6AA 3LW5H 3IR9A 2I1KA 1SVFA 4AUWA 2C0WA 1YYCA 2P1JA 2WPRA 1NYHA 4WVZA 1W2EA 4PJ0H 1LP1A 1IFNA 2IFMA 1FZEA 1X22A 2B89A 2QJKB 1OVRA 2QM7A 4ZNCA 1K9MQ 1KQSO 1OVUA 1L4AA 3KPEA 1JY3P 4L73A 2FKWB 2R44A 1JMBA 2Y0EA 3L71D 1RF0C 1N73B 1Q82Q 4D6TJ 1L0LK 4Y28J 1LTAC 1NTMK 1VQMP 2KP8A 2G3AA 2QM8A 2N9BA 2Y0DA 3KZIE 3L72G 2J59M 3L70G 4TT3H 5CMZA 2BCCD 2RH0A 3SFDC 1FDIA 3L4FA 2FY8A 4DOJA 2FFDC 1ZN5A 1M90Q 2K1AA 3FXDA 4NPDA 1SQVD 5H2FH 1G1JA 3IF4A 5KLVG 1URQD 2HR3A 1ZMEC 3RK3C 2KOGA 1PV3A 4O9BA 2XNDH 3M91A 1FC2C 3E1RA 3P8CD 3Q5RA 4IFFA 1RE3A 1VQ5P 1WT6A 2YNYA 1GW3A 2HODA 3SFEC 3CX5E 3C9IA 1L4AC 1IFIA 1ZLLA 5KTBA 1OMIA 3LIEA 1SQBG 1SQXD 3RGUA 1RF0A 2MJZA 3PP5A 1JOCA 4DCKA 1NTKJ 1YBKA 1M1JB 1JO5A 2HFED 3CC7P 4IL6X 1GTWA 4H0LD 2FFDA 1FOSF 2N1TC 1EDJA 1PP9G 4YXDC 4UB6H 1BSHA 1J2JB 2J58A 2K9JA 1ZOYC 4MN4C 3ABVC 1W5CE 3L71J 4C7RA 1WMKA 3I5CA 4YXWH 1KILC 1URQA 1KB9I 5TISE 3VOPA 3CPWO 5KLVE 2M8RA 1HUCA 1JY2O 1SQBD 1SQXG 3L37A 3NTNA 5AW9B 3AE1C 1OWAA 3A0BH 1RE3C 1KC8Q 3CC2P 3V6IA 5KAFE 1LP1B 1VQLP 2H8PD 1OW6A 1HGVA 3SWKA 1SFCC 1SQBK 2E75D 2YMKA 1FZCC 3GF7A 2GUVA 2CPBA 3GF3A 2FXPA 1N73A 5KAIE 2N9YB 1GL2B 1LWUA 2LXBA 3RL0D 3E7KA 1KZUB 1T8ZA 2WPSA 3CWBG 1EC5A 3GLMA 3KHUA 1IJDB 3RK3E 1S72P 3M9BA 5AW4B 1RH5B 4KHXA 4Z1MH 3AE5C 4UB8H 1NGMB 2KUBA 2ZYAA 1BGYJ 3H1HG 2WVRA 4WY4D 2H89C 2H7HA 5DJTB 1KILA 2YMYA 3NXSA 1LTBC 2E42A 3L72E 1SQVG 3GMAA 3GHGB 4HKZH 2D2CB 2ZJSE 3CX5I 2ZYDA 3WU2H 3HD7A 4EI2A 2WPVB 3BCCE 1NWQA 2W27A 1OIPA 1PPJD 1EDKA 1N7LA 2OQQA 4OGQB 4Y99B 1SQVE 1OVVA 3M06A 3S1KA 5AVTB 4ASVA 5CCGD 1N73C 2QEXP 3U1AA 1A02J 1M56D 1OFCX 2WMMA 1LWUC 4W80A 1HH0A 2B9BA 2I8DA 2YO3A 4QMAA 1G2CB 5KLVK 2OYHA 2D2CD 3RK2C 3WUTA 3MIWA 2KSJA 2FXMA 4YTPC 2HPCA 2YKQA 1KV4A 1L4AB 2FFDB 1OW8A 4WY4B 3HTKB 1NTKD 1KB9E 3A0HE 1PGPA 2K9YA 5AVQB 5KKZB 3TYYA 3H1LD 2FYUE 2NPSB 2YXRB 1NU1G 1Z56A 1LJ2A 2WSEJ 3CL3D 3F89A 2AXTE 4N78E 1SQQJ 1AVYA 1URQB 2QSIA 4A7PA 2JKVA 2ZXXA 3IAOA 1QGKB 2AEFA 2KSEA 3S4RA 1Q81Q 3QH9A 4BRYA 1H8AA 4HB1A 3BCCJ 5KAFH 5H2FE 1BCCJ 5CHXA 2E76D 4GIFA 2KB7P 3SWFA 1G1IA 2IBZE 1ZRTD 4JF7A 1SFCB 3L75E 2V7QH 5APUA 5KLIB 4U3FE 1QVFO 1VQ6P 1HWTC 3L73D 1JCDA 3H25A 1R8EA 2XKMA 2HODB 3CXHD 1LTSC 3BCCD 3UIAA 3R2PA 3U1CA 2W90A 2JJLA 2WSFH 3JCUE 3MUDC 3VMZA 1H88A 1NU1K 4WWIA 4OWFA 1PGOA 5AVUB 3MD0A 1KYOD 4H44B 3CCVP 1VL2A 3PRJA 3PHLA 1KQFB 2N1TB 1TU3F 2NZ2A 2O1KA 4XE5B 3VYIA 3CMAP 3VMXA 2M5AA 3P8CE 4R4LA 1P84I 3A3YB 1YJNP 2Z4EA 1YJ9P 1Q90D 1M1JC 1MUUA 3AE7C 2OTJP 2ZVOB 4PD4D 5GTHE 1NTKG 2QJPB 2FBWC 3MP7B 3CCEP 4PV1B 1T2KC 2ZT9B 3H1IG 1NJIQ 5APWA 4AQRD 1SQPK 5K5GB 3TF5A 2A45I 3M0DA 5BU5A 5CBOA 5AW8B 5AW1B 3MTUE 2A06E 2LKMA 4UB8E 1M1KQ 1PL5A 1DD3A 1LNQA 3L72J 3MUDA 1NTZK 4WY4A 5APXA 3V2PA
chains in the Genus database with same CATH topology
3IN6A 2WQYC 2IDBA 4RKUJ 1OW7A 1VF5D 2E74B 4H13B 3AEFC 4IL6X 3AEAC 4H0LD 4H0LC 5M1BA 4PV1D 2E74C 4YXDC 3AECC 1ZOYC 2WSFJ 3ABVC 1MKMA 1WMKA 2V7QJ 3B71A 1JB0J 4GDOA 3AEGC 3AE1C 1FDOA 1OW6A 3AEDC 2E75D 2YMKA 2ZT9D 3GF7A 3RL0g 3GF3A 1IK7A 1HJ0A 2FXPA 2QJKC 1KQGB 3GLMA 3Q5SA 3RK3E 2JP3A 1PIXA 2JO1A 4KT0J 4H0LB 3AE5C 1S1CX 1ZP0C 4Z1MH 5KKZC 1NGMB 4H44D 3R4YA 2H89C 4H44C 3AEBC 3LW5J 3GMAA 1UIXA 5L8RJ 3S9OA 1HF9A 2D2CB 2BEQD 2D2CC 3AE2C 1DD4A 2O01J 1RQUA 2WPVB 2QJYC 2OQQA 1EXIA 4OGQB 4OGQC 5KLIC 4OGQD 3D6ZA 1AJYA 3Q2YA 3FGAD 1GMJA 3Q5PA 2FYNC 2D2CD 1RQVA 3O6QA 4YTPC 2P10A 4R4MA 1S5LX 1OW8A 1DIPA 2MKVA 2K9YA 3AE9C 3AE4C 3AE6C 3AE3C 1YQ3C 2WSEJ 2E74D 2WSCJ 1KTMA 1KILE 4PV1C 2QSIA 3D6YA 3IAOA 3Q3DA 2QJPC 2G8YA 1K05A 1ZRTE 1EXJA 3C8VA 1YQ4C 1VF5C 3EWKA 4U7JA 1K04A 2E76D 1U57A 2E76C 2ZT9C 3AE8C 2E76B 3D71A 1KORA 1NYHA 4H13C 3T97B 3H25A 1R8EA 4I7ZB 4I7ZC 2QIWA 4H44B 2E75B 1VL2A 2E75C 4Y28J 2J5UA 1KQFB 1TU3F 2NZ2A 2G3AA 1VF5B 4H13D 4R4LA 3AEEC 4TT3H 3SFDC 1Q90D 3AE7C 3D70A 1FDIA 1KMIZ 1Y9BA 2FBWC 4PV1B 1ZMEC 4XFJA 2ZT9B 2YIUC 1PV3A 2BEZF 3Q5RA 3Q1MA 3SFEC 3G9RA 2H88C 1PL5A 1DD3A 1OMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NGM B; 
#chains in the Genus database with same CATH topology
 1J1E C;  2B88 A;  1NHL A;  2FYU G;  3FXE A;  2IBZ D;  4IL6 E;  4JYB A;  1S3J A;  3E1I A;  4NPE A;  3V2R A;  2WTY A;  1YIT P;  5AVR B;  2C0X A;  5KLV J;  1HJB A;  3B8E B;  2M0B A;  2Q6Q A;  3AEF C;  1OZH A;  4LGD E;  2C9L Y;  3V4W A;  3AEA C;  4IL6 H;  3VMY A;  3P7K A;  2R3C A;  5CJ4 A;  1QLE D;  1M1J A;  1PFI A;  1AA0 A;  1L4A D;  3I55 P;  1VQP P;  1BDC A;  3AEC C;  3VP8 A;  4EIJ A;  1AQT A;  1CSB A;  2FYU D;  4L75 A;  1L0L D;  3CLQ A;  4N78 D;  3NFQ A;  4PJ0 E;  5DJU B;  1JB0 J;  5CCH A;  5KJ7 A;  1VQK P;  1HGZ A;  3CC4 P;  1SQP G;  4WBA A;  3TDK A;  1NAY A;  1FZG A;  2R5D A;  3WUU A;  4DJG A;  2A06 D;  3M0D C;  2N1T D;  2QJY B;  1FZC B;  1NTZ G;  1JY2 N;  1JTH B;  1BE3 J;  3AED C;  1EQ7 A;  2M3E A;  2L5G B;  3K5B A;  1NKN A;  1IK7 A;  1HJ0 A;  1L0L G;  5AVZ B;  3U59 A;  1IO4 A;  1HVV A;  3CCL P;  2QJK C;  2UWJ E;  3TGU J;  1JY2 P;  1A02 F;  2ZFC A;  2QG4 A;  1GL2 A;  1LWU B;  2PFX A;  2WT7 B;  1L0N G;  1SQQ D;  3MZW B;  1LT1 A;  2OYI C;  2GA1 A;  1ZP0 C;  2QE7 H;  3L72 D;  1DEE G;  2KNC A;  2XDJ A;  2WPQ A;  3R4Y A;  4H44 C;  2JWD A;  3G3Z A;  2R3S A;  1N7S B;  3LW5 J;  2PRR A;  1H89 A;  3KDP B;  1IC2 A;  5KJ7 C;  1FZB A;  5L8R J;  2KLV A;  2WSE H;  4W7Z A;  2BEQ D;  1RF1 A;  2YO2 A;  1KIL B;  3H1K J;  1N7S D;  1RQU A;  3BVH A;  2K88 A;  3USS A;  3HUS A;  1X9V A;  1VQ8 P;  3SWY A;  5AW3 B;  3HD7 B;  4OGQ D;  2L91 A;  3Q2Y A;  2BCC E;  4XA4 A;  1JUN A;  2P58 A;  2FYN C;  2W6A A;  2P67 A;  3ITK A;  5TIS H;  3H1K D;  1FJP A;  1RQV A;  1L0N K;  1J1E B;  1SQP J;  5KAI H;  1EDI A;  1GL2 C;  3B5N D;  4IOI H;  4R4M A;  3JSV C;  3M9H A;  1G2C A;  1SQQ K;  4K35 A;  2Y9Z A;  2OYH B;  1DIP A;  1QVG O;  3AE6 C;  1NTZ J;  2IYP A;  3AE4 C;  1USE A;  1KFM A;  2IFN A;  1S9K D;  3L75 J;  5C39 A;  1KTM A;  2BCC G;  3TSI A;  3GW6 A;  4PV1 C;  4HYT B;  4U3F J;  3D6Y A;  1Q2N A;  1XTG B;  1RF1 C;  3L35 A;  3CX5 D;  4JBZ A;  1W2B O;  2G8Y A;  1BGY E;  1ZRT E;  5AW7 B;  1NAF A;  3FWN A;  2B87 B;  1VF5 C;  2HYN A;  2KYV A;  2K37 A;  2XV5 A;  3OAK A;  5GTH H;  2Q7C A;  2A45 G;  2RKL A;  5AVW B;  3HD7 D;  1YI2 P;  2O01 N;  2Z5I A;  3AE8 C;  1PPJ G;  2PGD A;  1NU1 J;  3L74 D;  1EZV E;  1KOR A;  3L70 E;  1KFN A;  4H13 C;  2HG5 D;  4OVN F;  2O3J A;  2E5Y A;  4YPC A;  4I7Z C;  2WIT A;  3CCU P;  3RL0 B;  1ZR4 A;  1GZL A;  3L73 J;  3H1K G;  4EYY Q;  2QIW A;  3B5N A;  4GT1 A;  3H1L G;  1SQP D;  3JCU H;  3W68 A;  1GW4 A;  1KD1 Q;  2E75 B;  1S4X A;  1LT9 B;  3OW2 O;  2YKP A;  1NTZ D;  2SPZ A;  3AEE C;  2RMZ A;  1R5L A;  1SQQ E;  2DW3 A;  2P2U A;  2N1T A;  1FZA A;  1KMI Z;  4U3F D;  3CI9 A;  4C46 A;  1N7S C;  4L74 A;  1URQ C;  1DEB A;  2OTK E;  3PH0 A;  1BCC D;  3V2Q A;  4NPF X;  2YIU C;  4B86 A;  3RK3 D;  3H32 A;  1PP9 D;  1SS1 A;  1J1D B;  1NTM E;  4DZO A;  3G6E P;  3RBZ A;  3Q1M A;  3HE5 B;  1BGY D;  2KS1 B;  2H88 C;  3G9R A;  2V4H A;  4C7N B;  1WRG A;  3H1H E;  3L75 D;  4RO0 A;  1SQV J;  1T3U A;  1GL2 D;  3B5N C;  3IN6 A;  1DX7 A;  5AW2 B;  3CCS P;  2IDB A;  3M0A A;  3V5B A;  1OW7 A;  3CXH E;  3EFG A;  1LT9 C;  3H1L E;  3O6Q B;  1AQ5 A;  3BAT A;  1ZXG A;  3L74 E;  3H1I J;  3VP9 A;  2WT7 A;  1SQB E;  1RHZ B;  4H0L C;  2A06 G;  1BE3 E;  4N6J A;  2Y0C A;  4PV1 D;  5BVZ A;  4KJM A;  2B87 A;  2XZR A;  2WSF J;  2R32 A;  3KYQ A;  1MKM A;  4ZMD A;  1M8O B;  1N7S A;  1GU4 A;  4W7Y A;  2V7Q J;  3B71 A;  1FJK A;  1H0T A;  4IFM A;  1QX8 A;  1ZW0 A;  4JQ0 D;  3KQG A;  1EDL A;  3QWO C;  3H1J E;  3WU2 E;  2BAS A;  1OXZ A;  4HH2 A;  1RF1 B;  4I1L A;  3O8Z A;  2C9N Y;  3EQ2 A;  3HD7 C;  3CD6 P;  1UII A;  3FX0 A;  2OAR A;  1FDO A;  3HUS B;  3M9Q A;  3RBX A;  3CCQ P;  1GU5 A;  1FZF A;  2ZT9 D;  1P84 H;  1YHQ P;  3A0B E;  1PP9 E;  1U7J A;  2JWA A;  2W6B A;  5CCG A;  1AFO A;  4D6T E;  1ZV8 A;  3B5N B;  2IBZ G;  1EZV G;  3TK1 A;  3RL0 C;  3BAS A;  2HPC B;  2P7J A;  1LT9 A;  1LTJ B;  3T97 A;  3D6Z A;  1KB9 H;  3A0H H;  2KXP B;  4HJG H;  2XNX A;  2JP3 A;  3HE4 B;  4H0L B;  3SSU A;  5KKZ C;  2Y9Y A;  5B66 E;  1BE3 G;  1USD A;  2JDI H;  5AW6 B;  3VMA A;  2QRX A;  2HLO A;  2IPP A;  2Q9I A;  1VPC A;  1KN7 A;  3MGN A;  1UIX A;  1CZQ A;  4AYC A;  1EZV I;  3S9O A;  1YJW P;  1HF9 A;  5APQ A;  3TGU G;  4C7N A;  1DD4 A;  5CCH D;  2NRG A;  1T3J A;  3FWL A;  3VN0 A;  3HE5 A;  2GM4 A;  1SFC A;  1KYO E;  2FYU K;  1L0N J;  2IZ0 A;  5CCG C;  4UB6 E;  2KI7 B;  1PP9 J;  1AJY A;  4JPZ B;  1MFZ A;  5AVV B;  2KZI A;  1VQO P;  3FGA D;  2AEM A;  1GMJ A;  2WZ7 A;  3Q5P A;  1CI6 B;  1SP4 A;  3EFF K;  3L74 G;  2GUS A;  3O6Q A;  2QVA A;  2W6J H;  1D7M A;  2IX7 C;  2AEJ A;  1RE4 C;  1QL2 A;  5KLV D;  5CBN A;  2YKO A;  3CX5 H;  2M5A B;  1SQV K;  2OTL P;  1YQ3 C;  3BRV B;  5APV A;  2WSC J;  1GDT A;  1PGJ A;  1FBM A;  3TNU B;  1SLQ A;  1R5S A;  2O01 H;  3OJA B;  2WSS H;  1IFP A;  3OA7 A;  4ASW A;  3CCM P;  5BU8 B;  3L73 G;  1P84 E;  2KIK A;  1K05 A;  4GKG A;  1NU1 E;  1EXJ A;  1YQ4 C;  3EWK A;  1K04 A;  3H1K E;  1FAV A;  1YTZ T;  2FYN B;  1HBW A;  2E76 C;  3H1J G;  5EFW B;  5B5E H;  3WMM 0;  4EDF A;  2ZT9 C;  3G4S P;  2YXQ B;  3G71 P;  4RJT A;  3CCR P;  3H32 B;  2OYH C;  1VQ9 P;  2E76 B;  3D71 A;  1NOH A;  2FYZ A;  2BCC J;  1YIJ P;  3N7N A;  1KIL D;  1LTJ A;  1SQX K;  2WWW A;  4I2L C;  4I7Z B;  5APY A;  1KQL A;  3T97 B;  4ZKU A;  2AXC A;  5KJ7 D;  2Q3E A;  1RE4 A;  1NTK E;  1FOS E;  2OYO A;  5TJH A;  1K8A Q;  3CWB E;  4LC1 A;  4PD4 E;  1VDF A;  3CXH H;  1FU1 A;  1SFC D;  1E79 H;  2E75 C;  2NPS D;  1FE6 A;  1SQP E;  2J5U A;  3HTK A;  5APT A;  1PGQ A;  3F5H A;  1NTM D;  1VF5 B;  2IZ1 A;  3MHV A;  4H13 D;  5CJ0 A;  1KYO H;  1QL1 A;  1NTZ E;  3D70 A;  1L0L J;  2FXO A;  3PTZ A;  1EZV D;  2PAJ A;  5AVY B;  1X79 B;  1Y9B A;  5CCH C;  3BRT B;  1T2K D;  4GOD A;  3L71 E;  4XFJ A;  3H1L J;  3PJS K;  1JM0 A;  1JTH A;  2LXC B;  2YIU B;  2BEZ F;  1S5L E;  4D6T G;  3JC2 2;  4L76 A;  4PD4 H;  2XU6 A;  3L73 E;  1L0N D;  1LTJ C;  1SQQ G;  4K3A A;  2Q3I A;  5GTI E;  3A2A A;  3L70 J;  1VQ7 P;  3CWB D;  3RK2 B;  1JY3 O;  1E5W A;  2A45 H;  2ZVN B;  2WSC H;  3H1I E;  1NKZ B;  3IFM A;  5E79 H;  1N8R Q;  2WQY C;  1FDM A;  1QEX A;  2KS1 A;  1IK9 A;  2ZAE B;  1N2D C;  3NMD A;  3H1J J;  4I6M C;  4RKU J;  3ZDM A;  3TNU A;  1VF5 D;  2E74 B;  2ZYG A;  4H13 B;  1SQX E;  1IFM A;  1K73 Q;  2RN0 A;  1IFJ A;  3I56 P;  1N86 A;  1AVO A;  2OYI B;  1MV8 A;  4IFD K;  5M1B A;  2E74 C;  4RES B;  1HTL C;  1NTK K;  4D6T D;  3II6 A;  3GHG C;  1M7L A;  3HRN A;  1OX3 A;  1NVO A;  4WB4 A;  4GDO A;  4DT0 A;  2POH A;  2W83 C;  1JCC A;  2AXT H;  3AEG C;  1H0T B;  1DH3 A;  1VQ4 P;  1BGY G;  3H1H J;  3HUS C;  4BWN A;  2O1J A;  2ITA A;  1Q7Y Q;  3RL0 g;  3L75 G;  2JEE A;  1U7M A;  4WY4 C;  1X8Y A;  1YTZ I;  4U3F G;  1Y8A A;  3CXH I;  1NTM J;  1GK4 A;  2OGU A;  3L36 A;  3L71 G;  1PPJ E;  1S2E A;  4OH8 B;  1KQG B;  3Q5S A;  1IZN B;  1SQX J;  2NPS C;  1PIX A;  2JO1 A;  4KT0 J;  2Z5H A;  1ZR2 A;  1S1C X;  1AV1 A;  3W67 A;  1LTG C;  2PP6 A;  3GHG A;  1M57 D;  3H1I D;  4H44 D;  4LLH A;  3HE4 A;  3AEB C;  1IFD A;  3B4S A;  4BXL A;  1VQN P;  2KZJ A;  3WUV A;  1LGH B;  1MZ9 A;  3L74 J;  2H43 A;  1L0N E;  2FYU J;  3AE2 C;  2D2C C;  4PD4 I;  3RK2 D;  2O01 J;  1BCC E;  2W8Z A;  2QA4 P;  3CWB J;  5B66 H;  5B5E E;  1GK6 A;  1NO4 A;  2QJY C;  4GOF A;  5GTI H;  1EXI A;  2M3B A;  3KXD A;  4TLF A;  4OGQ C;  4Y99 C;  2K3R A;  2I1J A;  5KLI C;  1BDD A;  1BSN A;  1J1D C;  1L2P A;  1LTT C;  1XTC C;  1JY3 N;  2CK3 H;  2E5T A;  3H1J D;  3KZI H;  2Q1K A;  5AW0 B;  2IBZ I;  1S9K E;  1KYO I;  1L0L E;  1PZQ A;  5AVS B;  2R5B A;  4ZKP A;  3A7O A;  2VRS A;  3L70 D;  3V4Q A;  5AW5 B;  2P10 A;  3BCC G;  3CCJ P;  4N3Y B;  1NH4 A;  1BCC G;  1P84 D;  1S5L X;  2NPS A;  1CI6 A;  1JMM A;  2IYO A;  3N4X A;  1Y47 A;  5E79 E;  3C1L A;  3VTP C;  2OYI A;  2KK7 A;  2MKV A;  3AE9 C;  2Q5U A;  3AE3 C;  3TGU D;  1FZC A;  3V2N A;  1GD2 E;  1LTI C;  4JYC A;  2E74 D;  1JEK A;  3H6P A;  5APS A;  1FS0 E;  1NU1 D;  1KIL E;  2LR2 A;  2KNC B;  4BRY B;  1KB9 D;  1X0T A;  2JR8 A;  1S5L H;  3H1H D;  1NTM G;  4GOE A;  1MFT A;  2KLU A;  4CPG A;  2CPS A;  2QJP C;  3Q3D A;  3PLN A;  4M3L A;  1JNM A;  1SQB J;  3C8V A;  3CME P;  2K9J B;  4U7J A;  3A5T A;  1CW5 A;  3LID A;  4EOT A;  1U57 A;  3GG2 A;  5AVX B;  2ZXE B;  2E43 A;  3TGU E;  3P32 A;  1RY3 A;  1BE3 D;  3P8M C;  3RK3 B;  1Q86 Q;  1T6A A;  3LW5 H;  3IR9 A;  2I1K A;  1SVF A;  4AUW A;  2C0W A;  1YYC A;  2P1J A;  2WPR A;  1NYH A;  4WVZ A;  1W2E A;  4PJ0 H;  1LP1 A;  1IFN A;  2IFM A;  1FZE A;  1X22 A;  2B89 A;  2QJK B;  1OVR A;  2QM7 A;  4ZNC A;  1K9M Q;  1KQS O;  1OVU A;  1L4A A;  3KPE A;  1JY3 P;  4L73 A;  2FKW B;  2R44 A;  1JMB A;  2Y0E A;  3L71 D;  1RF0 C;  1N73 B;  1Q82 Q;  4D6T J;  1L0L K;  4Y28 J;  1LTA C;  1NTM K;  1VQM P;  2KP8 A;  2G3A A;  2QM8 A;  2N9B A;  2Y0D A;  3KZI E;  3L72 G;  2J59 M;  3L70 G;  4TT3 H;  5CMZ A;  2BCC D;  2RH0 A;  3SFD C;  1FDI A;  3L4F A;  2FY8 A;  4DOJ A;  2FFD C;  1ZN5 A;  1M90 Q;  2K1A A;  3FXD A;  4NPD A;  1SQV D;  5H2F H;  1G1J A;  3IF4 A;  5KLV G;  1URQ D;  2HR3 A;  1ZME C;  3RK3 C;  2KOG A;  1PV3 A;  4O9B A;  2XND H;  3M91 A;  1FC2 C;  3E1R A;  3P8C D;  3Q5R A;  4IFF A;  1RE3 A;  1VQ5 P;  1WT6 A;  2YNY A;  1GW3 A;  2HOD A;  3SFE C;  3CX5 E;  3C9I A;  1L4A C;  1IFI A;  1ZLL A;  5KTB A;  1OMI A;  3LIE A;  1SQB G;  1SQX D;  3RGU A;  1RF0 A;  2MJZ A;  3PP5 A;  1JOC A;  4DCK A;  1NTK J;  1YBK A;  1M1J B;  1JO5 A;  2HFE D;  3CC7 P;  4IL6 X;  1GTW A;  4H0L D;  2FFD A;  1FOS F;  2N1T C;  1EDJ A;  1PP9 G;  4YXD C;  4UB6 H;  1BSH A;  1J2J B;  2J58 A;  2K9J A;  1ZOY C;  4MN4 C;  3ABV C;  1W5C E;  3L71 J;  4C7R A;  1WMK A;  3I5C A;  4YXW H;  1KIL C;  1URQ A;  1KB9 I;  5TIS E;  3VOP A;  3CPW O;  5KLV E;  2M8R A;  1HUC A;  1JY2 O;  1SQB D;  1SQX G;  3L37 A;  3NTN A;  5AW9 B;  3AE1 C;  1OWA A;  3A0B H;  1RE3 C;  1KC8 Q;  3CC2 P;  3V6I A;  5KAF E;  1LP1 B;  1VQL P;  2H8P D;  1OW6 A;  1HGV A;  3SWK A;  1SFC C;  1SQB K;  2E75 D;  2YMK A;  1FZC C;  3GF7 A;  2GUV A;  2CPB A;  3GF3 A;  2FXP A;  1N73 A;  5KAI E;  2N9Y B;  1GL2 B;  1LWU A;  2LXB A;  3RL0 D;  3E7K A;  1KZU B;  1T8Z A;  2WPS A;  3CWB G;  1EC5 A;  3GLM A;  3KHU A;  1IJD B;  3RK3 E;  1S72 P;  3M9B A;  5AW4 B;  1RH5 B;  4KHX A;  4Z1M H;  3AE5 C;  4UB8 H;  1NGM B;  2KUB A;  2ZYA A;  1BGY J;  3H1H G;  2WVR A;  4WY4 D;  2H89 C;  2H7H A;  5DJT B;  1KIL A;  2YMY A;  3NXS A;  1LTB C;  2E42 A;  3L72 E;  1SQV G;  3GMA A;  3GHG B;  4HKZ H;  2D2C B;  2ZJS E;  3CX5 I;  2ZYD A;  3WU2 H;  3HD7 A;  4EI2 A;  2WPV B;  3BCC E;  1NWQ A;  2W27 A;  1OIP A;  1PPJ D;  1EDK A;  1N7L A;  2OQQ A;  4OGQ B;  4Y99 B;  1SQV E;  1OVV A;  3M06 A;  3S1K A;  5AVT B;  4ASV A;  5CCG D;  1N73 C;  2QEX P;  3U1A A;  1A02 J;  1M56 D;  1OFC X;  2WMM A;  1LWU C;  4W80 A;  1HH0 A;  2B9B A;  2I8D A;  2YO3 A;  4QMA A;  1G2C B;  5KLV K;  2OYH A;  2D2C D;  3RK2 C;  3WUT A;  3MIW A;  2KSJ A;  2FXM A;  4YTP C;  2HPC A;  2YKQ A;  1KV4 A;  1L4A B;  2FFD B;  1OW8 A;  4WY4 B;  3HTK B;  1NTK D;  1KB9 E;  3A0H E;  1PGP A;  2K9Y A;  5AVQ B;  5KKZ B;  3TYY A;  3H1L D;  2FYU E;  2NPS B;  2YXR B;  1NU1 G;  1Z56 A;  1LJ2 A;  2WSE J;  3CL3 D;  3F89 A;  2AXT E;  4N78 E;  1SQQ J;  1AVY A;  1URQ B;  2QSI A;  4A7P A;  2JKV A;  2ZXX A;  3IAO A;  1QGK B;  2AEF A;  2KSE A;  3S4R A;  1Q81 Q;  3QH9 A;  4BRY A;  1H8A A;  4HB1 A;  3BCC J;  5KAF H;  5H2F E;  1BCC J;  5CHX A;  2E76 D;  4GIF A;  2KB7 P;  3SWF A;  1G1I A;  2IBZ E;  1ZRT D;  4JF7 A;  1SFC B;  3L75 E;  2V7Q H;  5APU A;  5KLI B;  4U3F E;  1QVF O;  1VQ6 P;  1HWT C;  3L73 D;  1JCD A;  3H25 A;  1R8E A;  2XKM A;  2HOD B;  3CXH D;  1LTS C;  3BCC D;  3UIA A;  3R2P A;  3U1C A;  2W90 A;  2JJL A;  2WSF H;  3JCU E;  3MUD C;  3VMZ A;  1H88 A;  1NU1 K;  4WWI A;  4OWF A;  1PGO A;  5AVU B;  3MD0 A;  1KYO D;  4H44 B;  3CCV P;  1VL2 A;  3PRJ A;  3PHL A;  1KQF B;  2N1T B;  1TU3 F;  2NZ2 A;  2O1K A;  4XE5 B;  3VYI A;  3CMA P;  3VMX A;  2M5A A;  3P8C E;  4R4L A;  1P84 I;  3A3Y B;  1YJN P;  2Z4E A;  1YJ9 P;  1Q90 D;  1M1J C;  1MUU A;  3AE7 C;  2OTJ P;  2ZVO B;  4PD4 D;  5GTH E;  1NTK G;  2QJP B;  2FBW C;  3MP7 B;  3CCE P;  4PV1 B;  1T2K C;  2ZT9 B;  3H1I G;  1NJI Q;  5APW A;  4AQR D;  1SQP K;  5K5G B;  3TF5 A;  2A45 I;  3M0D A;  5BU5 A;  5CBO A;  5AW8 B;  5AW1 B;  3MTU E;  2A06 E;  2LKM A;  4UB8 E;  1M1K Q;  1PL5 A;  1DD3 A;  1LNQ A;  3L72 J;  3MUD A;  1NTZ K;  4WY4 A;  5APX A;  3V2P A; 
#chains in the Genus database with same CATH homology
 3IN6 A;  2WQY C;  2IDB A;  4RKU J;  1OW7 A;  1VF5 D;  2E74 B;  4H13 B;  3AEF C;  4IL6 X;  3AEA C;  4H0L D;  4H0L C;  5M1B A;  4PV1 D;  2E74 C;  4YXD C;  3AEC C;  1ZOY C;  2WSF J;  3ABV C;  1MKM A;  1WMK A;  2V7Q J;  3B71 A;  1JB0 J;  4GDO A;  3AEG C;  3AE1 C;  1FDO A;  1OW6 A;  3AED C;  2E75 D;  2YMK A;  2ZT9 D;  3GF7 A;  3RL0 g;  3GF3 A;  1IK7 A;  1HJ0 A;  2FXP A;  2QJK C;  1KQG B;  3GLM A;  3Q5S A;  3RK3 E;  2JP3 A;  1PIX A;  2JO1 A;  4KT0 J;  4H0L B;  3AE5 C;  1S1C X;  1ZP0 C;  4Z1M H;  5KKZ C;  1NGM B;  4H44 D;  3R4Y A;  2H89 C;  4H44 C;  3AEB C;  3LW5 J;  3GMA A;  1UIX A;  5L8R J;  3S9O A;  1HF9 A;  2D2C B;  2BEQ D;  2D2C C;  3AE2 C;  1DD4 A;  2O01 J;  1RQU A;  2WPV B;  2QJY C;  2OQQ A;  1EXI A;  4OGQ B;  4OGQ C;  5KLI C;  4OGQ D;  3D6Z A;  1AJY A;  3Q2Y A;  3FGA D;  1GMJ A;  3Q5P A;  2FYN C;  2D2C D;  1RQV A;  3O6Q A;  4YTP C;  2P10 A;  4R4M A;  1S5L X;  1OW8 A;  1DIP A;  2MKV A;  2K9Y A;  3AE9 C;  3AE4 C;  3AE6 C;  3AE3 C;  1YQ3 C;  2WSE J;  2E74 D;  2WSC J;  1KTM A;  1KIL E;  4PV1 C;  2QSI A;  3D6Y A;  3IAO A;  3Q3D A;  2QJP C;  2G8Y A;  1K05 A;  1ZRT E;  1EXJ A;  3C8V A;  1YQ4 C;  1VF5 C;  3EWK A;  4U7J A;  1K04 A;  2E76 D;  1U57 A;  2E76 C;  2ZT9 C;  3AE8 C;  2E76 B;  3D71 A;  1KOR A;  1NYH A;  4H13 C;  3T97 B;  3H25 A;  1R8E A;  4I7Z B;  4I7Z C;  2QIW A;  4H44 B;  2E75 B;  1VL2 A;  2E75 C;  4Y28 J;  2J5U A;  1KQF B;  1TU3 F;  2NZ2 A;  2G3A A;  1VF5 B;  4H13 D;  4R4L A;  3AEE C;  4TT3 H;  3SFD C;  1Q90 D;  3AE7 C;  3D70 A;  1FDI A;  1KMI Z;  1Y9B A;  2FBW C;  4PV1 B;  1ZME C;  4XFJ A;  2ZT9 B;  2YIU C;  1PV3 A;  2BEZ F;  3Q5R A;  3Q1M A;  3SFE C;  3G9R A;  2H88 C;  1PL5 A;  1DD3 A;  1OMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...