1NGMB

Crystal structure of a yeast brf1-tbp-dna ternary complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
GSYCPRNLHLLPTTDTYLSKVSDDPDNLEDVDDEELNAHLLNEEASKLKERIWIGLNADFLLEQESKRLKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*CP*TP*AP*TP*AP*AP*AP*AP*AP*AP*AP*TP*GP*TP*TP*TP*TP*TP*
publication title Crystal structure of a transcription factor IIIB core interface ternary complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
total genus 12
structure length 72
sequence length 72
chains with identical sequence F, J, N
ec nomenclature
pdb deposition date 2002-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.650 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ngmB00
1NGMB
chains in the Genus database with same CATH superfamily
1NU1J 5CCGC 1JUNA 1Q90D 2QJPB 2YIUC 1N7SC 2FYUJ 5AW6B 1JY2P 1X0TA 1Q82Q 3V5BA 3HE5B 3GHGC 2KOGA 1PP9G 4PD4H 3CCMP 2W90A 3T97B 1K05A 1L0LJ 4EOTA 4WY4B 4C7RA 3V2RA 4H0LC 2XNXA 4ZNCA 2IBZD 4IFDK 1BSNA 1VPCA 3H1KJ 1H8AA 1NO4A 3CCJP 2I1JA 1GDTA 1L4AC 1EDLA 2KB7P 1D7MA 2H43A 4PJ0E 2QEXP 1LJ2A 3SFEC 1T8ZA 2HPCA 1LTSC 3L71G 2AEFA 3M0DC 3VN0A 1L0ND 1UIXA 1J1EB 3TGUG 2WMMA 2IBZI 4HH2A 2K37A 3G4SP 4L76A 1KILE 2A45H 2KI7B 2N1TC 2NPSA 1LT9B 3AE9C 4H44C 1LTAC 1CZQA 1E79H 2QJYB 3PH0A 2E76D 2PFXA 1JB0J 2Q9IA 5CMZA 3CD6P 5M1BA 3HD7D 1KTMA 1ZMEC 5AVTB 1SQBK 3KPEA 1IFJA 1IJDB 3RL0D 1SQPE 2AXCA 1BCCG 5AVWB 4KT0J 2Q1KA 3O6QA 1PPJE 2ZYDA 2ZT9C 3V2NA 4DOJA 1S1CX 2E76B 3TF5A 1SQPK 2A45G 2BCCD 4D6TE 5AW3B 3HD7B 2ZFCA 1OFCX 4ZKPA 2OARA 1LTJC 4HJGH 2KP8A 1YQ4C 1SQBG 4WVZA 2ITAA 2HG5D 1QX8A 3CI9A 3L75G 2J59M 1L0NJ 1HH0A 4ASVA 3HE5A 4GT1A 3I56P 2W6JH 4GDOA 3T97A 1HJBA 4WY4A 4L73A 1GD2E 3H1JJ 2Y0CA 3M0AA 1ZOYC 3CCSP 4OH8B 2IYOA 4L75A 5GTIE 1KC8Q 1NAYA 2B87B 4U3FG 3ZDMA 2GM4A 1G1IA 1QLED 1VQ6P 2GA1A 1NTZD 1RF1B 2WZ7A 3RK2C 3AE3C 1NJIQ 1IFIA 2QG4A 2QM8A 1LT9A 1VDFA 1URQC 1PGPA 2M0BA 2M3EA 3MD0A 5CBOA 2BCCJ 4RO0A 2KZIA 3H1IE 3CLQA 1VQLP 1T2KD 1VQPP 1QVGO 1UIIA 3K5BA 1JCCA 3B8EB 5KAFE 3U59A 1DIPA 4JPZB 1Y9BA 1OIPA 1HGZA 1NU1E 3L73G 3V4WA 1M1KQ 4W80A 1NTME 3FWLA 2KLVA 1BDCA 1ZR4A 2FYUE 3SWYA 3BCCG 1SQXD 1BGYD 5APWA 2OGUA 3B5NC 2WQYC 1EQ7A 1P84H 3CMEP 5AW7B 4N3YB 4ZMDA 3AE7C 1USDA 1NU1K 3VOPA 1L0LE 4Z1MH 2C0WA 1QL2A 4BRYA 2JR8A 1T3UA 1FU1A 3RK3E 2H88C 2JP3A 1OWAA 2FYUK 3RGUA 3H1KE 4OGQC 4TLFA 1NTZJ 2IZ1A 3KZIH 1L0LK 2QJPC 3AE8C 3WUUA 3M06A 4H13B 2C9NY 2E5YA 4BXLA 1EXJA 1S5LH 1YQ3C 1DD3A 4JBZA 1OMIA 3Q3DA 4WY4C 3CX5D 5B5EE 4D6TD 5APYA 2GUVA 1KFNA 4N78E 1H0TB 2YKOA 2Q5UA 1RF1A 2MJZA 4EI2A 1KQGB 2OYOA 1AJYA 1DX7A 3CX5I 1L0LG 3L74J 2KSEA 3VP9A 1BE3D 1A02F 2E75D 2HODB 2FFDB 1M1JB 1X22A 3S9OA 1SQXJ 1X9VA 1BGYJ 2MKVA 1NTKK 2WITA 3H1KG 1EZVG 3L4FA 1CI6B 4JQ0D 1Z56A 5AVSB 1HGVA 3QH9A 4WWIA 1R5LA 3VMZA 5AW0B 2FXPA 2KS1B 3AEFC 4Y28J 1ZRTE 1HWTC 2IBZE 3M9QA 2YXRB 3PTZA 2B89A 1AVYA 2E75B 3PP5A 3V2PA 2O1KA 3KYQA 1RQVA 2AXTE 1K04A 1IFPA 2JWDA 5KJ7A 1L0NE 2WSEJ 1DEBA 5BVZA 3AEAC 1NTKG 1G2CA 2E76C 2V4HA 2FXMA 2SPZA 2I1KA 3H1ID 3H1JE 3SWFA 3CWBG 1JMBA 2NPSD 3HD7C 2QVAA 1L0NK 1NVOA 3AE2C 4IOIH 3RL0C 1IFMA 2WT7B 1LTGC 1T3JA 1GW4A 2ZXXA 1NTMD 1PL5A 4RESB 2YO3A 1BE3J 1KN7A 2HPCB 3W68A 2FYUD 1SS1A 5AW5B 2ZVOB 1Q81Q 3U1AA 4R4LA 1OW6A 2HLOA 5H2FH 3MUDA 3EWKA 2YKQA 2QJKC 2ZXEB 3GW6A 4Y99B 1H0TA 1XTGB 3WUTA 1JY3N 3TDKA 1AQTA 2R5DA 1FJPA 5TJHA 1YJ9P 3A0BE 2XZRA 4B86A 2WSSH 1KQSO 3VTPC 2BEQD 2V7QH 2BCCE 1X8YA 3HUSC 2Z5IA 2CPBA 1R8EA 1U7MA 1S9KE 4PV1D 2HODA 3A0HH 5KLVJ 1M1JA 3L35A 2JWAA 4LC1A 1M57D 4GODA 1KB9H 1CSBA 2JJLA 1SQQD 4N78D 4TT3H 1JOCA 2KS1A 3LW5H 3F89A 1FZCC 1GU4A 5AVUB 5AVYB 1W2BO 3OW2O 1AVOA 3AE4C 2FBWC 1SFCB 5BU5A 1NTMJ 3A3YB 1NTZE 2WVRA 1FAVA 3Q5SA 1SQVD 2DW3A 3AEBC 5AW9B 1LTTC 3S4RA 3G3ZA 2OTLP 1NTZK 3U1CA 1ZRTD 4JYBA 3VYIA 2ZAEB 1JEKA 5BU8B 2WT7A 2YO2A 3N7NA 2IZ0A 1KILC 1N86A 4PJ0H 3L74E 3SSUA 3H1HG 3JC22 2Q3IA 4C7NB 1SQQJ 1SQXE 1BGYE 3MUDC 2OTJP 3H1JD 5CJ4A 4KHXA 3USSA 2N9YB 5APSA 1MUUA 1SQXK 1LP1B 4I7ZB 1KYOD 2W6BA 3C8VA 2H89C 3H6PA 4DJGA 3CL3D 2FFDC 3L70J 3O8ZA 5E79E 1SQVJ 2IDBA 4ASWA 1HF9A 3IN6A 3CC2P 5KKZB 2O01J 3M9HA 1FDMA 3GLMA 2LXCB 2XV5A 1KYOI 4YXWH 3CX5E 1KD1Q 1FC2C 4BRYB 2OTKE 2OYIC 3BRTB 1SFCA 1S9KD 2KLUA 5GTHE 2E75C 1KQLA 3A5TA 2CPSA 2ZYGA 2GUSA 3D71A 1N7LA 3FXDA 4U7JA 4AQRD 1PP9D 1RE4A 2FYNB 3CXHD 1BE3E 5CHXA 1FOSE 2AEJA 1FS0E 4UB8E 3IAOA 3MGNA 2IX7C 1JY2N 5APTA 1JY3O 1FDOA 2XDJA 1SQPG 3AEGC 4XA4A 3P8MC 4IFMA 2K3RA 1VQMP 1PPJG 4EIJA 3KXDA 3CXHI 3KDPB 3L71D 1KB9I 2O1JA 3TGUD 1OZHA 2D2CD 4D6TG 1JNMA 3CCQP 5KLVE 1NKNA 3Q5PA 4AUWA 4C7NA 1YJNP 1HVVA 1ZW0A 4GKGA 3MTUE 3BRVB 4C46A 5KAIE 4I2LC 2NPSC 3M91A 1BSHA 1FE6A 5KJ7D 1FZFA 2HFED 3GG2A 5CCGD 3H1LJ 2FY8A 1RHZB 1JO5A 2OYHB 1N7SD 2WSCH 3HRNA 4K3AA 1IZNB 2V7QJ 3M9BA 2NRGA 1LP1A 1NYHA 1VQ8P 2AEMA 3CCVP 5KTBA 5B66E 3VMXA 1KV4A 4PD4I 2D2CB 3E7KA 2WWWA 2Y0EA 2YKPA 3L74D 3GF3A 3UIAA 1PP9J 3P32A 4H0LD 5KAFH 1QGKB 4H13D 3RK3C 2UWJE 3PRJA 1OW7A 1H89A 1G2CB 4NPEA 2KSJA 1N7SB 1NTMK 2WTYA 3WU2H 4L74A 1NH4A 4PV1C 2W27A 3GHGB 4N6JA 3Q1MA 5C39A 3TNUB 1VQ9P 3L71J 1ZV8A 4MN4C 2A45I 2XU6A 3C1LA 3TGUJ 4H0LB 1RE3A 2M5AB 2A06E 3H1IG 3KZIE 3Q5RA 4RJTA 1CW5A 3AE1C 1L4AB 3KQGA 1M56D 4JYCA 5AVXB 2OQQA 3PLNA 2KK7A 1R5SA 2FYZA 1JCDA 1U57A 1SQQE 1NU1G 1LT1A 5KLIB 1NTMG 1N8RQ 2FYUG 5B5EH 3FX0A 2N1TB 3A7OA 1WMKA 2ZT9D 1BCCJ 3R4YA 4H44B 1SQQK 3A2AA 3KHUA 4XE5B 5CCHA 1FZEA 1X79B 1J1EC 5TISE 2O01N 4M3LA 1OVVA 3V6IA 1YHQP 3L70E 1YIJP 1RH5B 1SQVE 3NXSA 1LT9C 3H25A 5APVA 2QJYC 1LGHB 2OYHA 4NPFX 3L72E 2M8RA 1K9MQ 1SQBJ 3D70A 1RQUA 2ZT9B 1SQVK 2Z5HA 4I7ZC 3L75J 3PHLA 4W7YA 5AW1B 5KLVD 1VQKP 1Q2NA 2IPPA 3BCCD 1JY2O 5KKZC 1LTJB 2FKWB 1HUCA 5CCGA 1GW3A 1N7SA 1AQ5A 2AXTH 3RL0g 1Q86Q 1PGQA 1JTHB 1FZBA 3CCEP 1PV3A 1J2JB 3QWOC 3GHGA 3RBXA 3TNUA 1W2EA 2K9JB 3JCUH 2Q3EA 3H32B 1IO4A 1URQD 3VMAA 3F5HA 2M5AA 1KYOE 4K35A 3FGAD 2FYNC 1L4AA 1VQ5P 1VQNP 2IBZG 3EFGA 4IL6E 1K73Q 1P84D 3TYYA 3M0DA 3P7KA 4UB6E 3RK2B 2KIKA 5L8RJ 1IK7A 1L0NG 2N1TA 1YI2P 3H1LE 3GMAA 2J58A 1URQB 2K1AA 2YNYA 1Y8AA 5APUA 1YITP 3L73J 2P67A 3A0BH 1SLQA 1RF1C 2A06D 1P84I 1VF5D 1SFCD 2I8DA 3H1JG 3BCCJ 3Q2YA 1GTWA 1FJKA 1JM0A 1QL1A 3BATA 3FWNA 1PP9E 5CBNA 3CXHE 2H8PD 5DJTB 1KB9E 5AVRB 4OGQD 1ZN5A 2B9BA 4HB1A 1VQ4P 4QMAA 4GOEA 1EZVI 2IYPA 3B5NB 4LLHA 1VF5B 2LXBA 4YTPC 2D2CC 3HTKB 1YYCA 3L71E 1H88A 3HE4B 1LTJA 3L70D 3TGUE 4RKUJ 2BCCG 2CK3H 3IR9A 1GU5A 2JDIH 5KJ7C 1NHLA 3IF4A 1PZQA 2JO1A 4OGQB 1FOSF 1JTHA 1T6AA 3CCUP 3CWBD 3CPWO 1KFMA 3L72D 4PD4E 1ZP0C 1T2KC 4XFJA 3P8CD 2KXPB 5AW2B 3V2QA 1IK9A 2K9JA 2QSIA 3H32A 4BWNA 2Q6QA 2QE7H 1NWQA 1K8AQ 1OVUA 1BCCE 2E74D 2C9LY 4H13C 1S2EA 1M90Q 3JSVC 3ABVC 4IFFA 1LWUB 3S1KA 3SWKA 2P1JA 2YMYA 1MFZA 1J1DB 1JMMA 3L36A 5KLIC 1NTZG 2K88A 2RN0A 1S5LX 1URQA 2G8YA 2N9BA 1SQBE 3RBZA 1M7LA 2E74B 3IFMA 4KJMA 3L75E 1GL2D 1PIXA 1M1JC 1NTKJ 2W8ZA 2KUBA 2KNCB 2K9YA 2KYVA 3N4XA 3D6YA 3WMM0 2J5UA 5E79H 3II6A 3CWBJ 3L72J 1N73B 4JF7A 4LGDE 3H1LD 3L74G 2YXQB 2WSEH 3B5NA 1NGMB 4U3FE 1PFIA 3HTKA 2ZVNB 3CX5H 2Y0DA 4W7ZA 1SQXG 1BGYG 2L91A 1GL2B 2FXOA 3HE4A 1IC2A 2QRXA 1GMJA 3W67A 1G1JA 1N2DC 5GTHH 4DZOA 2RKLA 4EYYQ 3RL0B 5CCHD 1NAFA 1KB9D 3PJSK 2B88A 3V4QA 1MFTA 2R32A 4UB8H 3B4SA 2LKMA 1RF0A 3NMDA 1FDIA 2RMZA 3R2PA 1OXZA 3OAKA 5DJUB 2QIWA 2QJKB 5GTIH 1KZUB 1AFOA 3H1HD 3L73E 4WB4A 1LWUA 3BCCE 3HUSB 4DCKA 4ZKUA 1SP4A 2XKMA 3NTNA 4PD4D 3TSIA 3AE5C 3VP8A 3MHVA 4Y99C 4IL6X 2WSFH 2W83C 5KLVK 1BE3G 5KAIH 4R4MA 3AE6C 2O3JA 3MZWB 1BCCD 1DH3A 1DD4A 2IFNA 2KNCA 2POHA 1HBWA 5B66H 1SVFA 1FZCB 1A02J 5K5GB 1NOHA 1IFDA 2P58A 1ZLLA 1N73A 1L4AD 5APXA 3CMAP 3OA7A 2YIUB 1P84E 5CJ0A 5EFWB 1KILD 2L5GB 5KLVG 1PGJA 3CC7P 1LTIC 2HR3A 1SQBD 3LW5J 1AV1A 1S3JA 4OWFA 3D6ZA 3WUVA 1WRGA 1GL2A 3EFFK 1VF5C 2BASA 1SFCC 3E1IA 3WU2E 3L75D 2N1TD 3HD7A 3H1HJ 1YTZT 4YXDC 2WPQA 4H44D 1XTCC 1DEEG 1GK6A 1KQFB 1S72P 1KORA 1OW8A 1RE4C 1MKMA 1EZVE 1SQPD 1NKZB 3LIDA 2VRSA 4I6MC 4NPDA 1KILB 1S5LE 5APQA 2E42A 1PPJD 3MIWA 4CPGA 4U3FD 1GZLA 1LNQA 2WPRA 1JY3P 5AVQB 2R5BA 1RF0C 3AEDC 2PP6A 4GOFA 3BASA 1VQOP 2B87A 3TK1A 3HUSA 1YBKA 3MP7B 1MV8A 1LWUC 1NTKE 3C9IA 2R3CA 1EDKA 1Y47A 1J1DC 2P10A 5TISH 3L37A 2E5TA 1QVFO 2W6AA 2C0XA 1RY3A 4HKZH 3CWBE 2M3BA 4GIFA 2LR2A 2A06G 3I55P 4DT0A 5AW8B 5AVZB 3P8CE 2XNDH 1USEA 2O01H 2H7HA 2BEZF 3AEEC 2R44A 2R3SA 1PGOA 1AA0A 2E74C 1E5WA 3L73D 1IFNA 5AW4B 2G3AA 2QM7A 1SQQG 3I5CA 2P7JA 2PGDA 1FZCA 3E1RA 1EC5A 2KZJA 2OYIB 1MZ9A 2Z4EA 1KMIZ 2WPVB 1EDIA 1SQPJ 3NFQA 2IFMA 1BDDA 1M8OB 1N73C 1W5CE 2PRRA 2JEEA 1S4XA 3G6EP 4U3FJ 1YTZI 3RK2D 1FZGA 3L70G 1SQVG 1QEXA 4OVNF 1GL2C 1L2PA 4D6TJ 2NZ2A 3G9RA 3JCUE 1HTLC 1GK4A 1WT6A 2P2UA 3L72G 3BVHA 1RE3C 2E43A 1KYOH 1KILA 1NU1D 2WPSA 1U7JA 1OX3A 5H2FE 3AECC 4A7PA 3G71P 1EXIA 1FZAA 3VMYA 4IL6H 4O9BA 2Q7CA 3GF7A 3LIEA 1L0LD 4UB6H 1VQ7P 3RK3D 2NPSB 3B71A 3OJAB 3B5ND 1FBMA 1OVRA 2QA4P 5CCHC 1LTBC 3H1KD 1EZVD 3A0HE 2HYNA 2ZJSE 4HYTB 4EDFA 3FXEA 2FFDA 1ZXGA 4AYCA 2WSFJ 3CXHH 2OYHC 5AVVB 1EDJA 4YPCA 3EQ2A 1ZR2A 2RH0A 1CI6A 1YJWP 2WSCJ 3CC4P 3CCLP 3O6QB 4WBAA 3RK3B 2Y9YA 3SFDC 1TU3F 3H1IJ 2YMKA 2ZYAA 2PAJA 4WY4D 3CCRP 2OYIA 2JKVA 3H1HE 1Q7YQ 1NTKD 3H1LG 4PV1B 3ITKA 2Y9ZA 1HJ0A 1VL2A 4I1LA
chains in the Genus database with same CATH topology
3D70A 1RQUA 3AEAC 3AE3C 2ZT9B 4TT3H 1Q90D 2E76C 2YIUC 1GMJA 4PV1C 3Q1MA 1EXJA 2E74D 4I7ZC 1YQ3C 1DD3A 4KT0J 3O6QA 4H13C 1VF5D 1OMIA 3Q3DA 2P10A 3AECC 2ZT9C 1EXIA 3Q2YA 3ABVC 1S1CX 4H0LB 2E76B 3GF7A 3T97B 1K05A 4I7ZB 3AE2C 3AE4C 3C8VA 5KKZC 2FBWC 2D2CD 2H89C 3Q5RA 2BEZF 3AEEC 4H0LC 3AE1C 5KLIC 3LW5J 3Q5PA 3B71A 3D6ZA 1KQGB 2E74C 4OGQD 1AJYA 3RL0g 1S5LX 1FDIA 2IDBA 2OQQA 1HF9A 1PL5A 1VF5C 2G3AA 3IN6A 1YQ4C 1DIPA 3Q5SA 2G8YA 2O01J 1PV3A 2QIWA 1U57A 1Y9BA 3GLMA 2E75D 3AEBC 4YXDC 4H44D 4R4LA 1OW6A 2E74B 1KQFB 3SFEC 3S9OA 1KMIZ 1VF5B 4YTPC 2WPVB 2D2CC 1KORA 1OW8A 2MKVA 3EWKA 2QJKC 1PIXA 2V7QJ 1MKMA 1UIXA 4GDOA 1NYHA 1WMKA 2ZT9D 2WQYC 3R4YA 4H44B 2K9YA 2WSFJ 4RKUJ 3D6YA 3AE7C 1KILE 2FXPA 3FGAD 2D2CB 3AE5C 2FYNC 2BEQD 4Z1MH 2J5UA 3AEFC 4Y28J 2WSCJ 4IL6X 2E75C 1ZRTE 3RK3E 3AE9C 3GF3A 4H44C 3SFDC 1ZOYC 2H88C 2JP3A 1R8EA 2JO1A 4OGQB 4U7JA 3D71A 1TU3F 4H0LD 2E76D 4PV1D 1JB0J 1ZP0C 4XFJA 3AEDC 2YMKA 3H25A 2NZ2A 3G9RA 4H13D 4R4MA 2E75B 5M1BA 3AE6C 4OGQC 1NGMB 2QJYC 3IAOA 2QSIA 2QJPC 3AE8C 1OW7A 1KTMA 5L8RJ 1ZMEC 1IK7A 1RQVA 1DD4A 4PV1B 1FDOA 1K04A 1HJ0A 1VL2A 3GMAA 4H13B 2WSEJ 3AEGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NGM B; 
#chains in the Genus database with same CATH topology
 1NU1 J;  5CCG C;  1JUN A;  1Q90 D;  2QJP B;  2YIU C;  1N7S C;  2FYU J;  5AW6 B;  1JY2 P;  1X0T A;  1Q82 Q;  3V5B A;  3HE5 B;  3GHG C;  2KOG A;  1PP9 G;  4PD4 H;  3CCM P;  2W90 A;  3T97 B;  1K05 A;  1L0L J;  4EOT A;  4WY4 B;  4C7R A;  3V2R A;  4H0L C;  2XNX A;  4ZNC A;  2IBZ D;  4IFD K;  1BSN A;  1VPC A;  3H1K J;  1H8A A;  1NO4 A;  3CCJ P;  2I1J A;  1GDT A;  1L4A C;  1EDL A;  2KB7 P;  1D7M A;  2H43 A;  4PJ0 E;  2QEX P;  1LJ2 A;  3SFE C;  1T8Z A;  2HPC A;  1LTS C;  3L71 G;  2AEF A;  3M0D C;  3VN0 A;  1L0N D;  1UIX A;  1J1E B;  3TGU G;  2WMM A;  2IBZ I;  4HH2 A;  2K37 A;  3G4S P;  4L76 A;  1KIL E;  2A45 H;  2KI7 B;  2N1T C;  2NPS A;  1LT9 B;  3AE9 C;  4H44 C;  1LTA C;  1CZQ A;  1E79 H;  2QJY B;  3PH0 A;  2E76 D;  2PFX A;  1JB0 J;  2Q9I A;  5CMZ A;  3CD6 P;  5M1B A;  3HD7 D;  1KTM A;  1ZME C;  5AVT B;  1SQB K;  3KPE A;  1IFJ A;  1IJD B;  3RL0 D;  1SQP E;  2AXC A;  1BCC G;  5AVW B;  4KT0 J;  2Q1K A;  3O6Q A;  1PPJ E;  2ZYD A;  2ZT9 C;  3V2N A;  4DOJ A;  1S1C X;  2E76 B;  3TF5 A;  1SQP K;  2A45 G;  2BCC D;  4D6T E;  5AW3 B;  3HD7 B;  2ZFC A;  1OFC X;  4ZKP A;  2OAR A;  1LTJ C;  4HJG H;  2KP8 A;  1YQ4 C;  1SQB G;  4WVZ A;  2ITA A;  2HG5 D;  1QX8 A;  3CI9 A;  3L75 G;  2J59 M;  1L0N J;  1HH0 A;  4ASV A;  3HE5 A;  4GT1 A;  3I56 P;  2W6J H;  4GDO A;  3T97 A;  1HJB A;  4WY4 A;  4L73 A;  1GD2 E;  3H1J J;  2Y0C A;  3M0A A;  1ZOY C;  3CCS P;  4OH8 B;  2IYO A;  4L75 A;  5GTI E;  1KC8 Q;  1NAY A;  2B87 B;  4U3F G;  3ZDM A;  2GM4 A;  1G1I A;  1QLE D;  1VQ6 P;  2GA1 A;  1NTZ D;  1RF1 B;  2WZ7 A;  3RK2 C;  3AE3 C;  1NJI Q;  1IFI A;  2QG4 A;  2QM8 A;  1LT9 A;  1VDF A;  1URQ C;  1PGP A;  2M0B A;  2M3E A;  3MD0 A;  5CBO A;  2BCC J;  4RO0 A;  2KZI A;  3H1I E;  3CLQ A;  1VQL P;  1T2K D;  1VQP P;  1QVG O;  1UII A;  3K5B A;  1JCC A;  3B8E B;  5KAF E;  3U59 A;  1DIP A;  4JPZ B;  1Y9B A;  1OIP A;  1HGZ A;  1NU1 E;  3L73 G;  3V4W A;  1M1K Q;  4W80 A;  1NTM E;  3FWL A;  2KLV A;  1BDC A;  1ZR4 A;  2FYU E;  3SWY A;  3BCC G;  1SQX D;  1BGY D;  5APW A;  2OGU A;  3B5N C;  2WQY C;  1EQ7 A;  1P84 H;  3CME P;  5AW7 B;  4N3Y B;  4ZMD A;  3AE7 C;  1USD A;  1NU1 K;  3VOP A;  1L0L E;  4Z1M H;  2C0W A;  1QL2 A;  4BRY A;  2JR8 A;  1T3U A;  1FU1 A;  3RK3 E;  2H88 C;  2JP3 A;  1OWA A;  2FYU K;  3RGU A;  3H1K E;  4OGQ C;  4TLF A;  1NTZ J;  2IZ1 A;  3KZI H;  1L0L K;  2QJP C;  3AE8 C;  3WUU A;  3M06 A;  4H13 B;  2C9N Y;  2E5Y A;  4BXL A;  1EXJ A;  1S5L H;  1YQ3 C;  1DD3 A;  4JBZ A;  1OMI A;  3Q3D A;  4WY4 C;  3CX5 D;  5B5E E;  4D6T D;  5APY A;  2GUV A;  1KFN A;  4N78 E;  1H0T B;  2YKO A;  2Q5U A;  1RF1 A;  2MJZ A;  4EI2 A;  1KQG B;  2OYO A;  1AJY A;  1DX7 A;  3CX5 I;  1L0L G;  3L74 J;  2KSE A;  3VP9 A;  1BE3 D;  1A02 F;  2E75 D;  2HOD B;  2FFD B;  1M1J B;  1X22 A;  3S9O A;  1SQX J;  1X9V A;  1BGY J;  2MKV A;  1NTK K;  2WIT A;  3H1K G;  1EZV G;  3L4F A;  1CI6 B;  4JQ0 D;  1Z56 A;  5AVS B;  1HGV A;  3QH9 A;  4WWI A;  1R5L A;  3VMZ A;  5AW0 B;  2FXP A;  2KS1 B;  3AEF C;  4Y28 J;  1ZRT E;  1HWT C;  2IBZ E;  3M9Q A;  2YXR B;  3PTZ A;  2B89 A;  1AVY A;  2E75 B;  3PP5 A;  3V2P A;  2O1K A;  3KYQ A;  1RQV A;  2AXT E;  1K04 A;  1IFP A;  2JWD A;  5KJ7 A;  1L0N E;  2WSE J;  1DEB A;  5BVZ A;  3AEA C;  1NTK G;  1G2C A;  2E76 C;  2V4H A;  2FXM A;  2SPZ A;  2I1K A;  3H1I D;  3H1J E;  3SWF A;  3CWB G;  1JMB A;  2NPS D;  3HD7 C;  2QVA A;  1L0N K;  1NVO A;  3AE2 C;  4IOI H;  3RL0 C;  1IFM A;  2WT7 B;  1LTG C;  1T3J A;  1GW4 A;  2ZXX A;  1NTM D;  1PL5 A;  4RES B;  2YO3 A;  1BE3 J;  1KN7 A;  2HPC B;  3W68 A;  2FYU D;  1SS1 A;  5AW5 B;  2ZVO B;  1Q81 Q;  3U1A A;  4R4L A;  1OW6 A;  2HLO A;  5H2F H;  3MUD A;  3EWK A;  2YKQ A;  2QJK C;  2ZXE B;  3GW6 A;  4Y99 B;  1H0T A;  1XTG B;  3WUT A;  1JY3 N;  3TDK A;  1AQT A;  2R5D A;  1FJP A;  5TJH A;  1YJ9 P;  3A0B E;  2XZR A;  4B86 A;  2WSS H;  1KQS O;  3VTP C;  2BEQ D;  2V7Q H;  2BCC E;  1X8Y A;  3HUS C;  2Z5I A;  2CPB A;  1R8E A;  1U7M A;  1S9K E;  4PV1 D;  2HOD A;  3A0H H;  5KLV J;  1M1J A;  3L35 A;  2JWA A;  4LC1 A;  1M57 D;  4GOD A;  1KB9 H;  1CSB A;  2JJL A;  1SQQ D;  4N78 D;  4TT3 H;  1JOC A;  2KS1 A;  3LW5 H;  3F89 A;  1FZC C;  1GU4 A;  5AVU B;  5AVY B;  1W2B O;  3OW2 O;  1AVO A;  3AE4 C;  2FBW C;  1SFC B;  5BU5 A;  1NTM J;  3A3Y B;  1NTZ E;  2WVR A;  1FAV A;  3Q5S A;  1SQV D;  2DW3 A;  3AEB C;  5AW9 B;  1LTT C;  3S4R A;  3G3Z A;  2OTL P;  1NTZ K;  3U1C A;  1ZRT D;  4JYB A;  3VYI A;  2ZAE B;  1JEK A;  5BU8 B;  2WT7 A;  2YO2 A;  3N7N A;  2IZ0 A;  1KIL C;  1N86 A;  4PJ0 H;  3L74 E;  3SSU A;  3H1H G;  3JC2 2;  2Q3I A;  4C7N B;  1SQQ J;  1SQX E;  1BGY E;  3MUD C;  2OTJ P;  3H1J D;  5CJ4 A;  4KHX A;  3USS A;  2N9Y B;  5APS A;  1MUU A;  1SQX K;  1LP1 B;  4I7Z B;  1KYO D;  2W6B A;  3C8V A;  2H89 C;  3H6P A;  4DJG A;  3CL3 D;  2FFD C;  3L70 J;  3O8Z A;  5E79 E;  1SQV J;  2IDB A;  4ASW A;  1HF9 A;  3IN6 A;  3CC2 P;  5KKZ B;  2O01 J;  3M9H A;  1FDM A;  3GLM A;  2LXC B;  2XV5 A;  1KYO I;  4YXW H;  3CX5 E;  1KD1 Q;  1FC2 C;  4BRY B;  2OTK E;  2OYI C;  3BRT B;  1SFC A;  1S9K D;  2KLU A;  5GTH E;  2E75 C;  1KQL A;  3A5T A;  2CPS A;  2ZYG A;  2GUS A;  3D71 A;  1N7L A;  3FXD A;  4U7J A;  4AQR D;  1PP9 D;  1RE4 A;  2FYN B;  3CXH D;  1BE3 E;  5CHX A;  1FOS E;  2AEJ A;  1FS0 E;  4UB8 E;  3IAO A;  3MGN A;  2IX7 C;  1JY2 N;  5APT A;  1JY3 O;  1FDO A;  2XDJ A;  1SQP G;  3AEG C;  4XA4 A;  3P8M C;  4IFM A;  2K3R A;  1VQM P;  1PPJ G;  4EIJ A;  3KXD A;  3CXH I;  3KDP B;  3L71 D;  1KB9 I;  2O1J A;  3TGU D;  1OZH A;  2D2C D;  4D6T G;  1JNM A;  3CCQ P;  5KLV E;  1NKN A;  3Q5P A;  4AUW A;  4C7N A;  1YJN P;  1HVV A;  1ZW0 A;  4GKG A;  3MTU E;  3BRV B;  4C46 A;  5KAI E;  4I2L C;  2NPS C;  3M91 A;  1BSH A;  1FE6 A;  5KJ7 D;  1FZF A;  2HFE D;  3GG2 A;  5CCG D;  3H1L J;  2FY8 A;  1RHZ B;  1JO5 A;  2OYH B;  1N7S D;  2WSC H;  3HRN A;  4K3A A;  1IZN B;  2V7Q J;  3M9B A;  2NRG A;  1LP1 A;  1NYH A;  1VQ8 P;  2AEM A;  3CCV P;  5KTB A;  5B66 E;  3VMX A;  1KV4 A;  4PD4 I;  2D2C B;  3E7K A;  2WWW A;  2Y0E A;  2YKP A;  3L74 D;  3GF3 A;  3UIA A;  1PP9 J;  3P32 A;  4H0L D;  5KAF H;  1QGK B;  4H13 D;  3RK3 C;  2UWJ E;  3PRJ A;  1OW7 A;  1H89 A;  1G2C B;  4NPE A;  2KSJ A;  1N7S B;  1NTM K;  2WTY A;  3WU2 H;  4L74 A;  1NH4 A;  4PV1 C;  2W27 A;  3GHG B;  4N6J A;  3Q1M A;  5C39 A;  3TNU B;  1VQ9 P;  3L71 J;  1ZV8 A;  4MN4 C;  2A45 I;  2XU6 A;  3C1L A;  3TGU J;  4H0L B;  1RE3 A;  2M5A B;  2A06 E;  3H1I G;  3KZI E;  3Q5R A;  4RJT A;  1CW5 A;  3AE1 C;  1L4A B;  3KQG A;  1M56 D;  4JYC A;  5AVX B;  2OQQ A;  3PLN A;  2KK7 A;  1R5S A;  2FYZ A;  1JCD A;  1U57 A;  1SQQ E;  1NU1 G;  1LT1 A;  5KLI B;  1NTM G;  1N8R Q;  2FYU G;  5B5E H;  3FX0 A;  2N1T B;  3A7O A;  1WMK A;  2ZT9 D;  1BCC J;  3R4Y A;  4H44 B;  1SQQ K;  3A2A A;  3KHU A;  4XE5 B;  5CCH A;  1FZE A;  1X79 B;  1J1E C;  5TIS E;  2O01 N;  4M3L A;  1OVV A;  3V6I A;  1YHQ P;  3L70 E;  1YIJ P;  1RH5 B;  1SQV E;  3NXS A;  1LT9 C;  3H25 A;  5APV A;  2QJY C;  1LGH B;  2OYH A;  4NPF X;  3L72 E;  2M8R A;  1K9M Q;  1SQB J;  3D70 A;  1RQU A;  2ZT9 B;  1SQV K;  2Z5H A;  4I7Z C;  3L75 J;  3PHL A;  4W7Y A;  5AW1 B;  5KLV D;  1VQK P;  1Q2N A;  2IPP A;  3BCC D;  1JY2 O;  5KKZ C;  1LTJ B;  2FKW B;  1HUC A;  5CCG A;  1GW3 A;  1N7S A;  1AQ5 A;  2AXT H;  3RL0 g;  1Q86 Q;  1PGQ A;  1JTH B;  1FZB A;  3CCE P;  1PV3 A;  1J2J B;  3QWO C;  3GHG A;  3RBX A;  3TNU A;  1W2E A;  2K9J B;  3JCU H;  2Q3E A;  3H32 B;  1IO4 A;  1URQ D;  3VMA A;  3F5H A;  2M5A A;  1KYO E;  4K35 A;  3FGA D;  2FYN C;  1L4A A;  1VQ5 P;  1VQN P;  2IBZ G;  3EFG A;  4IL6 E;  1K73 Q;  1P84 D;  3TYY A;  3M0D A;  3P7K A;  4UB6 E;  3RK2 B;  2KIK A;  5L8R J;  1IK7 A;  1L0N G;  2N1T A;  1YI2 P;  3H1L E;  3GMA A;  2J58 A;  1URQ B;  2K1A A;  2YNY A;  1Y8A A;  5APU A;  1YIT P;  3L73 J;  2P67 A;  3A0B H;  1SLQ A;  1RF1 C;  2A06 D;  1P84 I;  1VF5 D;  1SFC D;  2I8D A;  3H1J G;  3BCC J;  3Q2Y A;  1GTW A;  1FJK A;  1JM0 A;  1QL1 A;  3BAT A;  3FWN A;  1PP9 E;  5CBN A;  3CXH E;  2H8P D;  5DJT B;  1KB9 E;  5AVR B;  4OGQ D;  1ZN5 A;  2B9B A;  4HB1 A;  1VQ4 P;  4QMA A;  4GOE A;  1EZV I;  2IYP A;  3B5N B;  4LLH A;  1VF5 B;  2LXB A;  4YTP C;  2D2C C;  3HTK B;  1YYC A;  3L71 E;  1H88 A;  3HE4 B;  1LTJ A;  3L70 D;  3TGU E;  4RKU J;  2BCC G;  2CK3 H;  3IR9 A;  1GU5 A;  2JDI H;  5KJ7 C;  1NHL A;  3IF4 A;  1PZQ A;  2JO1 A;  4OGQ B;  1FOS F;  1JTH A;  1T6A A;  3CCU P;  3CWB D;  3CPW O;  1KFM A;  3L72 D;  4PD4 E;  1ZP0 C;  1T2K C;  4XFJ A;  3P8C D;  2KXP B;  5AW2 B;  3V2Q A;  1IK9 A;  2K9J A;  2QSI A;  3H32 A;  4BWN A;  2Q6Q A;  2QE7 H;  1NWQ A;  1K8A Q;  1OVU A;  1BCC E;  2E74 D;  2C9L Y;  4H13 C;  1S2E A;  1M90 Q;  3JSV C;  3ABV C;  4IFF A;  1LWU B;  3S1K A;  3SWK A;  2P1J A;  2YMY A;  1MFZ A;  1J1D B;  1JMM A;  3L36 A;  5KLI C;  1NTZ G;  2K88 A;  2RN0 A;  1S5L X;  1URQ A;  2G8Y A;  2N9B A;  1SQB E;  3RBZ A;  1M7L A;  2E74 B;  3IFM A;  4KJM A;  3L75 E;  1GL2 D;  1PIX A;  1M1J C;  1NTK J;  2W8Z A;  2KUB A;  2KNC B;  2K9Y A;  2KYV A;  3N4X A;  3D6Y A;  3WMM 0;  2J5U A;  5E79 H;  3II6 A;  3CWB J;  3L72 J;  1N73 B;  4JF7 A;  4LGD E;  3H1L D;  3L74 G;  2YXQ B;  2WSE H;  3B5N A;  1NGM B;  4U3F E;  1PFI A;  3HTK A;  2ZVN B;  3CX5 H;  2Y0D A;  4W7Z A;  1SQX G;  1BGY G;  2L91 A;  1GL2 B;  2FXO A;  3HE4 A;  1IC2 A;  2QRX A;  1GMJ A;  3W67 A;  1G1J A;  1N2D C;  5GTH H;  4DZO A;  2RKL A;  4EYY Q;  3RL0 B;  5CCH D;  1NAF A;  1KB9 D;  3PJS K;  2B88 A;  3V4Q A;  1MFT A;  2R32 A;  4UB8 H;  3B4S A;  2LKM A;  1RF0 A;  3NMD A;  1FDI A;  2RMZ A;  3R2P A;  1OXZ A;  3OAK A;  5DJU B;  2QIW A;  2QJK B;  5GTI H;  1KZU B;  1AFO A;  3H1H D;  3L73 E;  4WB4 A;  1LWU A;  3BCC E;  3HUS B;  4DCK A;  4ZKU A;  1SP4 A;  2XKM A;  3NTN A;  4PD4 D;  3TSI A;  3AE5 C;  3VP8 A;  3MHV A;  4Y99 C;  4IL6 X;  2WSF H;  2W83 C;  5KLV K;  1BE3 G;  5KAI H;  4R4M A;  3AE6 C;  2O3J A;  3MZW B;  1BCC D;  1DH3 A;  1DD4 A;  2IFN A;  2KNC A;  2POH A;  1HBW A;  5B66 H;  1SVF A;  1FZC B;  1A02 J;  5K5G B;  1NOH A;  1IFD A;  2P58 A;  1ZLL A;  1N73 A;  1L4A D;  5APX A;  3CMA P;  3OA7 A;  2YIU B;  1P84 E;  5CJ0 A;  5EFW B;  1KIL D;  2L5G B;  5KLV G;  1PGJ A;  3CC7 P;  1LTI C;  2HR3 A;  1SQB D;  3LW5 J;  1AV1 A;  1S3J A;  4OWF A;  3D6Z A;  3WUV A;  1WRG A;  1GL2 A;  3EFF K;  1VF5 C;  2BAS A;  1SFC C;  3E1I A;  3WU2 E;  3L75 D;  2N1T D;  3HD7 A;  3H1H J;  1YTZ T;  4YXD C;  2WPQ A;  4H44 D;  1XTC C;  1DEE G;  1GK6 A;  1KQF B;  1S72 P;  1KOR A;  1OW8 A;  1RE4 C;  1MKM A;  1EZV E;  1SQP D;  1NKZ B;  3LID A;  2VRS A;  4I6M C;  4NPD A;  1KIL B;  1S5L E;  5APQ A;  2E42 A;  1PPJ D;  3MIW A;  4CPG A;  4U3F D;  1GZL A;  1LNQ A;  2WPR A;  1JY3 P;  5AVQ B;  2R5B A;  1RF0 C;  3AED C;  2PP6 A;  4GOF A;  3BAS A;  1VQO P;  2B87 A;  3TK1 A;  3HUS A;  1YBK A;  3MP7 B;  1MV8 A;  1LWU C;  1NTK E;  3C9I A;  2R3C A;  1EDK A;  1Y47 A;  1J1D C;  2P10 A;  5TIS H;  3L37 A;  2E5T A;  1QVF O;  2W6A A;  2C0X A;  1RY3 A;  4HKZ H;  3CWB E;  2M3B A;  4GIF A;  2LR2 A;  2A06 G;  3I55 P;  4DT0 A;  5AW8 B;  5AVZ B;  3P8C E;  2XND H;  1USE A;  2O01 H;  2H7H A;  2BEZ F;  3AEE C;  2R44 A;  2R3S A;  1PGO A;  1AA0 A;  2E74 C;  1E5W A;  3L73 D;  1IFN A;  5AW4 B;  2G3A A;  2QM7 A;  1SQQ G;  3I5C A;  2P7J A;  2PGD A;  1FZC A;  3E1R A;  1EC5 A;  2KZJ A;  2OYI B;  1MZ9 A;  2Z4E A;  1KMI Z;  2WPV B;  1EDI A;  1SQP J;  3NFQ A;  2IFM A;  1BDD A;  1M8O B;  1N73 C;  1W5C E;  2PRR A;  2JEE A;  1S4X A;  3G6E P;  4U3F J;  1YTZ I;  3RK2 D;  1FZG A;  3L70 G;  1SQV G;  1QEX A;  4OVN F;  1GL2 C;  1L2P A;  4D6T J;  2NZ2 A;  3G9R A;  3JCU E;  1HTL C;  1GK4 A;  1WT6 A;  2P2U A;  3L72 G;  3BVH A;  1RE3 C;  2E43 A;  1KYO H;  1KIL A;  1NU1 D;  2WPS A;  1U7J A;  1OX3 A;  5H2F E;  3AEC C;  4A7P A;  3G71 P;  1EXI A;  1FZA A;  3VMY A;  4IL6 H;  4O9B A;  2Q7C A;  3GF7 A;  3LIE A;  1L0L D;  4UB6 H;  1VQ7 P;  3RK3 D;  2NPS B;  3B71 A;  3OJA B;  3B5N D;  1FBM A;  1OVR A;  2QA4 P;  5CCH C;  1LTB C;  3H1K D;  1EZV D;  3A0H E;  2HYN A;  2ZJS E;  4HYT B;  4EDF A;  3FXE A;  2FFD A;  1ZXG A;  4AYC A;  2WSF J;  3CXH H;  2OYH C;  5AVV B;  1EDJ A;  4YPC A;  3EQ2 A;  1ZR2 A;  2RH0 A;  1CI6 A;  1YJW P;  2WSC J;  3CC4 P;  3CCL P;  3O6Q B;  4WBA A;  3RK3 B;  2Y9Y A;  3SFD C;  1TU3 F;  3H1I J;  2YMK A;  2ZYA A;  2PAJ A;  4WY4 D;  3CCR P;  2OYI A;  2JKV A;  3H1H E;  1Q7Y Q;  1NTK D;  3H1L G;  4PV1 B;  3ITK A;  2Y9Z A;  1HJ0 A;  1VL2 A;  4I1L A; 
#chains in the Genus database with same CATH homology
 3D70 A;  1RQU A;  3AEA C;  3AE3 C;  2ZT9 B;  4TT3 H;  1Q90 D;  2E76 C;  2YIU C;  1GMJ A;  4PV1 C;  3Q1M A;  1EXJ A;  2E74 D;  4I7Z C;  1YQ3 C;  1DD3 A;  4KT0 J;  3O6Q A;  4H13 C;  1VF5 D;  1OMI A;  3Q3D A;  2P10 A;  3AEC C;  2ZT9 C;  1EXI A;  3Q2Y A;  3ABV C;  1S1C X;  4H0L B;  2E76 B;  3GF7 A;  3T97 B;  1K05 A;  4I7Z B;  3AE2 C;  3AE4 C;  3C8V A;  5KKZ C;  2FBW C;  2D2C D;  2H89 C;  3Q5R A;  2BEZ F;  3AEE C;  4H0L C;  3AE1 C;  5KLI C;  3LW5 J;  3Q5P A;  3B71 A;  3D6Z A;  1KQG B;  2E74 C;  4OGQ D;  1AJY A;  3RL0 g;  1S5L X;  1FDI A;  2IDB A;  2OQQ A;  1HF9 A;  1PL5 A;  1VF5 C;  2G3A A;  3IN6 A;  1YQ4 C;  1DIP A;  3Q5S A;  2G8Y A;  2O01 J;  1PV3 A;  2QIW A;  1U57 A;  1Y9B A;  3GLM A;  2E75 D;  3AEB C;  4YXD C;  4H44 D;  4R4L A;  1OW6 A;  2E74 B;  1KQF B;  3SFE C;  3S9O A;  1KMI Z;  1VF5 B;  4YTP C;  2WPV B;  2D2C C;  1KOR A;  1OW8 A;  2MKV A;  3EWK A;  2QJK C;  1PIX A;  2V7Q J;  1MKM A;  1UIX A;  4GDO A;  1NYH A;  1WMK A;  2ZT9 D;  2WQY C;  3R4Y A;  4H44 B;  2K9Y A;  2WSF J;  4RKU J;  3D6Y A;  3AE7 C;  1KIL E;  2FXP A;  3FGA D;  2D2C B;  3AE5 C;  2FYN C;  2BEQ D;  4Z1M H;  2J5U A;  3AEF C;  4Y28 J;  2WSC J;  4IL6 X;  2E75 C;  1ZRT E;  3RK3 E;  3AE9 C;  3GF3 A;  4H44 C;  3SFD C;  1ZOY C;  2H88 C;  2JP3 A;  1R8E A;  2JO1 A;  4OGQ B;  4U7J A;  3D71 A;  1TU3 F;  4H0L D;  2E76 D;  4PV1 D;  1JB0 J;  1ZP0 C;  4XFJ A;  3AED C;  2YMK A;  3H25 A;  2NZ2 A;  3G9R A;  4H13 D;  4R4M A;  2E75 B;  5M1B A;  3AE6 C;  4OGQ C;  1NGM B;  2QJY C;  3IAO A;  2QSI A;  2QJP C;  3AE8 C;  1OW7 A;  1KTM A;  5L8R J;  1ZME C;  1IK7 A;  1RQV A;  1DD4 A;  4PV1 B;  1FDO A;  1K04 A;  1HJ0 A;  1VL2 A;  3GMA A;  4H13 B;  2WSE J;  3AEG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...