1NGMB

Crystal structure of a yeast brf1-tbp-dna ternary complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
GSYCPRNLHLLPTTDTYLSKVSDDPDNLEDVDDEELNAHLLNEEASKLKERIWIGLNADFLLEQESKRLKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a transcription factor IIIB core interface ternary complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
molecule keywords 5'-D(*CP*TP*AP*TP*AP*AP*AP*AP*AP*AP*AP*TP*GP*TP*TP*TP*TP*TP*
total genus 12
structure length 72
sequence length 72
chains with identical sequence F, J, N
ec nomenclature
pdb deposition date 2002-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.650 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ngmB00
1NGMB
chains in the Genus database with same CATH superfamily
1R5LA 2OQQA 2E76B 1Q2NA 2WSSH 1OW7A 3H1JJ 1LTTC 1VQ6P 1EZVI 5KLVG 2OYIB 1N73C 3Q5SA 1X0TA 1PIXA 3C1LA 3H32B 3HE4B 4GIFA 1FZGA 1LP1B 1FE6A 1L4AB 2JR8A 1J2JB 1KYOI 4D6TJ 3I56P 1VQOP 1N7SB 1T8ZA 4L74A 2M5AA 4C46A 5APVA 1YJWP 1R8EA 1PPJG 2WT7B 1JOCA 4BRYB 5AVSB 2A45I 3L75J 2BCCG 4ZNCA 1VQ4P 4JQ0D 1OX3A 4PV1D 3TGUJ 2ZXXA 2B89A 3JCUH 2FYNB 4DCKA 1RQUA 2QJKC 5CCGA 1N7SA 1QL2A 4KHXA 4K3AA 4ZKPA 1NU1J 2E76D 2FKWB 3MUDC 1OMIA 4MN4C 4PJ0E 2MJZA 4R4LA 1SFCA 2C0WA 1A02F 3L73G 3SWKA 2BCCE 4PJ0H 4W7ZA 1RF0A 1MUUA 1QGKB 1ZP0C 3USSA 1FBMA 3CC2P 5AW8B 1EC5A 5CCGD 2FXMA 5BU8B 1JO5A 1SQBE 2WZ7A 3L71E 1J1EC 1FAVA 3L72D 2AEMA 3TGUD 4M3LA 3RK2D 1T2KD 2QE7H 2IFMA 3K5BA 3PJSK 3E1IA 1L0LJ 3CXHH 1QX8A 3MD0A 4UB8E 4WWIA 3VP8A 3AE8C 1HTLC 5AW6B 3VMAA 1PP9D 3H1LJ 2FYNC 3A7OA 3W68A 1YJ9P 5CCHA 3EFFK 3PH0A 1JUNA 4HB1A 2G8YA 1SQVE 1JB0J 2A06D 1NTKK 4BXLA 1KTMA 5CHXA 2ITAA 1KORA 2O1JA 3CXHD 4JPZB 1OVRA 2WSEH 1ZOYC 3ZDMA 1HGVA 2R44A 1NYHA 2E5TA 2XNDH 3CCQP 3AE3C 2GM4A 3CC7P 4U7JA 1ZMEC 1LTJB 2E76C 1JM0A 2W83C 1AFOA 3NFQA 1G2CB 4U3FD 2K3RA 3L72J 1N73A 5AW5B 4OWFA 3O6QA 1P84I 2JP3A 2R3CA 4WB4A 3M9BA 3BVHA 1M1JB 1PPJD 4HJGH 2W27A 2ZYAA 3BCCJ 4XFJA 5AVUB 4H44B 2Q6QA 1NHLA 1LTGC 4H44C 3V6IA 1J1EB 1FDIA 3O6QB 1QEXA 1PP9J 1Q90D 3H1LD 3AECC 1JNMA 1QLED 1URQD 1MFZA 4AQRD 2J59M 4PD4E 1YTZT 4W80A 3MGNA 4YXDC 3MHVA 1VQMP 2AXTH 1N86A 2WSFH 3WU2E 3CX5H 2YIUC 3FXEA 1KILD 1SFCB 3VTPC 4WY4D 4RJTA 1VQNP 4PV1B 1EDIA 1LWUB 1U7JA 2XKMA 3HUSC 3CWBD 3A3YB 3JSVC 4H0LC 2QJKB 5TISE 3TNUA 1LT9B 1NTKJ 2JWDA 1OZHA 1KILC 3M9QA 1H0TA 4EIJA 1BGYJ 2M0BA 3NMDA 3L70E 3A0BH 2BEQD 1KFNA 2AEJA 3V5BA 2WTYA 1Y8AA 2H7HA 2GA1A 4WY4B 1NTMD 1SQQG 2R5DA 5AW0B 5B66E 3CD6P 1DX7A 2GUVA 3H1KD 3ITKA 5B66H 3L73E 1JEKA 1ZV8A 3GHGC 2HR3A 1QVGO 4U3FG 1CW5A 1OXZA 1LJ2A 3GHGA 2A45H 1AVOA 2B88A 3CWBE 5CCHC 1X8YA 1ZRTD 1NO4A 1SQPD 3KZIE 2WPVB 2JDIH 1FC2C 2P1JA 1LTBC 3V2PA 2Q1KA 4OH8B 1S72P 3T97A 4ASWA 3G71P 1BE3E 1FS0E 3OW2O 2K9JA 1DIPA 2GUSA 2FYZA 1N8RQ 1YQ3C 1M57D 4WY4C 2YO3A 1PPJE 1W5CE 1L0ND 2FXOA 1HJBA 1LTIC 1KB9H 2QA4P 3IR9A 2AEFA 4Z1MH 3KZIH 3TSIA 2K88A 1LGHB 2NPSD 1BCCE 1L0NG 1KD1Q 1RE3C 4H0LB 4IFMA 1IJDB 2J5UA 2BASA 1IK9A 3M9HA 4HH2A 1IC2A 1IFIA 2M8RA 1P84E 2IFNA 3A0HE 4W7YA 1RE4C 1BE3D 3A0HH 3FWNA 3H1IJ 3RK3D 3V2NA 2NPSA 1VF5C 3GG2A 3L70J 1HUCA 1IFMA 3H1IE 4PD4I 2NPSB 2ZVOB 1ZRTE 2M5AB 2CK3H 4DJGA 2Q9IA 3P32A 1MZ9A 4IFFA 1EQ7A 3HRNA 4O9BA 3WMM0 4BRYA 3L73D 3MZWB 2HPCA 1NAFA 4AUWA 1P84H 1CI6A 2N1TB 2ZT9B 3HE5B 3P8CE 3H1JG 5H2FE 3CMAP 5TISH 4WVZA 5KLVK 1VQ8P 2V7QJ 5H2FH 5DJTB 1EXIA 3Q3DA 2QM7A 1SQPK 2XZRA 4DZOA 4UB6E 3G6EP 2ZVNB 1FOSE 2YKQA 5APTA 3D71A 3U1AA 3WU2H 1LT1A 2IBZE 1IFDA 1T3JA 3RK3E 3CX5I 1HVVA 2PFXA 4JF7A 3TGUG 4B86A 5BU5A 1USDA 4LGDE 1LTAC 2IBZG 1JY2P 4C7NA 3BASA 3TNUB 3U1CA 1CZQA 2K9JB 4EYYQ 2Y0CA 4GOFA 1SQXD 2A45G 1NTMK 2A06G 3CWBJ 3AEGC 1NU1G 1FZEA 3AEEC 1VF5D 4KJMA 3L36A 1Q82Q 1NTZG 2WPSA 5E79H 3CX5D 4NPEA 3WUUA 4C7RA 3JC22 3OJAB 5APWA 2I1JA 1PGJA 3SSUA 1Q81Q 3OAKA 1U57A 2K1AA 1E79H 4U3FE 1BGYE 3A0BE 2FYUG 3AEDC 1DD3A 1D7MA 1LTSC 1SQVK 2NRGA 3A2AA 1NTKE 5BVZA 1RF0C 1PV3A 1X79B 1AQTA 1L0LE 1PL5A 2QG4A 1EDKA 3S1KA 4I7ZC 5KAIH 3KHUA 1DD4A 4U3FJ 3RL0B 5KJ7A 1ZR4A 3PLNA 1H8AA 1SQBJ 2WQYC 4H13B 4C7NB 1PGQA 1SQVD 2H8PD 3R2PA 5CCHD 1LWUA 4JBZA 1T3UA 2BCCJ 3RL0g 1CSBA 1KB9I 1E5WA 1PP9E 1LWUC 1RHZB 3KPEA 4I1LA 3CLQA 2B87A 2ZYGA 1Q7YQ 2JWAA 2Q3EA 2ZAEB 3B5NB 4IL6X 3BCCE 4K35A 4N3YB 3H25A 1BSHA 3L4FA 5APSA 2H88C 1GZLA 2Q5UA 5APQA 3MTUE 2HLOA 5GTIE 1KFMA 3TGUE 3L72E 3HUSA 1L0LD 2IDBA 2WITA 1NTKD 1SQXK 1LNQA 2N1TA 2NZ2A 3KXDA 3VYIA 1UIXA 1LTJA 3KDPB 3VOPA 1JTHA 1AV1A 2FY8A 1M1JC 4OGQD 5C39A 2R3SA 1SVFA 1VDFA 2E74C 3Q5PA 1IZNB 2AXCA 2IYOA 2JO1A 3CX5E 1M56D 1M8OB 1FZAA 1VF5B 2QJYC 2YXQB 4OGQC 3CCUP 3TYYA 1KZUB 2E74D 5KLVD 4Y99C 3AE4C 2FFDA 3FX0A 2OTKE 2KS1B 3HTKA 1RF1A 1FDOA 2P10A 3L74D 1SQPG 5CCGC 5EFWB 4XE5B 2E43A 3C9IA 3WUTA 1GK4A 4I6MC 2RH0A 1J1DB 3G3ZA 2ZJSE 3BATA 1YHQP 2KIKA 2KP8A 3HE4A 1SQQJ 1SQQK 1WT6A 2Y0DA 2KOGA 2Z5HA 2D2CD 5GTHH 1HF9A 1X22A 3TDKA 5GTHE 1GTWA 1VQ7P 1FZCC 2K9YA 2L91A 2HODA 5KAFH 1BCCJ 5KJ7C 3H1JD 5CJ4A 1QVFO 3P8MC 3S9OA 3M0DC 1SQBG 2KSJA 5KKZC 3P8CD 3L74E 1EZVE 2RMZA 3FGAD 1RQVA 4BWNA 2LKMA 1ZR2A 2KS1A 2JJLA 3AE2C 3HTKB 4TT3H 1KQGB 2LXBA 2W6BA 2ZYDA 3E1RA 3L75E 4OVNF 1KYOE 3L75G 3M91A 3CCLP 2D2CB 2IYPA 1KN7A 2Z5IA 1SQQD 2WMMA 5AW9B 1EZVG 1BE3J 2CPSA 2IBZD 2IPPA 2J58A 1S2EA 2W6AA 2WSCJ 2IX7C 2YMKA 2O3JA 3BRVB 3GHGB 2OGUA 3CCRP 1M90Q 2FFDC 1KMIZ 2KSEA 5L8RJ 1KB9E 1JTHB 2QSIA 5CMZA 3QWOC 3RK3C 3H1KG 2QIWA 2YXRB 1S9KE 2XV5A 3EFGA 1N7SC 2N9YB 2M3EA 1L4AC 2R32A 1PFIA 5B5EE 1URQC 5CJ0A 3SWYA 3V4QA 1VQPP 1HGZA 3SWFA 5B5EH 3AEAC 1VPCA 2OYIC 1LT9C 2C0XA 1NKZB 2OARA 2FYUJ 3CCEP 1L2PA 1KV4A 4NPFX 1JCCA 1RF1B 3D6YA 2DW3A 2L5GB 2ZFCA 3M0DA 2JEEA 1SFCC 2PGDA 1GL2B 4YPCA 1S3JA 2YIUB 5AW2B 5KTBA 1K73Q 1FDMA 1IFPA 2O01J 1FZCA 1NAYA 4JYCA 3CCSP 3CMEP 4GODA 2Y9YA 1SQXG 3HD7A 3V2RA 1K9MQ 2OYHB 2IZ1A 4PD4H 5KKZB 4HKZH 2KZIA 2HODB 1NWQA 1YTZI 4EDFA 1BCCD 3VN0A 4IFDK 5KLIC 1USEA 4YTPC 3PP5A 1KQFB 4JYBA 4AYCA 2Q3IA 3H1HD 2HYNA 3HD7D 1J1DC 1RE3A 1NGMB 4CPGA 1G2CA 1YIJP 3B5NC 4L73A 1H88A 1FOSF 1KILA 1VQ5P 5APUA 1OW6A 1RH5B 1RE4A 5CBOA 1URQB 3TF5A 3D6ZA 1NTZD 3FWLA 3B8EB 2KNCA 1PP9G 1JMBA 4EI2A 1M1KQ 1IO4A 3RK2C 1YITP 1OWAA 1FZBA 4H44D 3CPWO 3AE5C 1ZN5A 1OIPA 1FU1A 1NTMG 2QJPC 3B71A 2IBZI 2WPQA 1HH0A 3RL0C 3V4WA 1DEBA 3W67A 4DOJA 1RY3A 2Y9ZA 3P7KA 3L73J 1SFCD 1WRGA 2W6JH 2N1TD 4DT0A 3H1ID 1M7LA 2P7JA 2OYHC 1FJPA 1G1JA 2E75C 2R5BA 5AVXB 2I8DA 1GW4A 1XTGB 1OW8A 3AE6C 3E7KA 1BGYG 3L71G 4I2LC 4KT0J 4WY4A 2Q7CA 1P84D 1Y47A 2V7QH 2WSCH 2SPZA 3H1LE 4QMAA 4RO0A 4ZKUA 1H0TB 1S5LH 2FYUK 2OTLP 1L0LG 3L70D 2QVAA 2HPCB 2HFED 3EWKA 2Y0EA 3AEFC 3H1HE 4L76A 5KLVJ 1W2BO 3HD7C 1DH3A 2M3BA 1S4XA 1ZW0A 1BCCG 1CI6B 1L0NE 1NH4A 1MFTA 1ZLLA 3HE5A 3R4YA 2POHA 1VL2A 2WSEJ 5KJ7D 1KILE 2I1KA 3VMZA 3IAOA 4H13C 1PGPA 3AE1C 2XNXA 3HD7B 1NU1D 3IFMA 1KYOH 5AW4B 1HBWA 4LC1A 4PD4D 1NU1E 3JCUE 1NVOA 4I7ZB 3SFDC 1S5LX 2A06E 1W2EA 1AA0A 2FXPA 2FFDB 2E42A 4H13D 4PV1C 3GW6A 3RL0D 2WT7A 2RN0A 2QJYB 3N7NA 3KYQA 2PRRA 4OGQB 5AVVB 2YNYA 1NTZJ 1H89A 4D6TD 1LP1A 3L74G 2O01N 4GKGA 3GF3A 3AE9C 4IL6H 2G3AA 3AE7C 3H1KJ 4D6TE 1L0NJ 2W8ZA 2CPBA 3NXSA 1R5SA 3N4XA 5CBNA 1OFCX 1JMMA 2P67A 2PP6A 2WSFJ 3H1HJ 3L71D 1EXJA 1N7SD 1YYCA 1GD2E 1SQVG 1SQVJ 2QJPB 3CL3D 3CXHE 4UB8H 1VQ9P 5AVWB 1T6AA 1DEEG 1N2DC 3T97B 2YKPA 4H0LD 2YMYA 4ZMDA 3RK2B 3C8VA 1LTJC 1N7LA 2P2UA 3H1LG 3A5TA 1ZXGA 2KXPB 3L70G 1SQPE 3LW5H 2B87B 1NTKG 2O1KA 3MUDA 3I55P 1SQXJ 4IL6E 3LW5J 1GK6A 1JCDA 1SP4A 1UIIA 1L0NK 2FBWC 2RKLA 4IOIH 1KYOD 1MKMA 3II6A 3GLMA 2AXTE 3L71J 3LIDA 1NJIQ 1A02J 2KI7B 1AVYA 1KC8Q 3D70A 1OVVA 3H1KE 1GU5A 4L75A 1BDCA 1EZVD 1IK7A 1NTME 2WVRA 1IFNA 5AW1B 2P58A 2ZT9C 1NTZE 3RBZA 2K37A 1NU1K 3L72G 3CCMP 3CCVP 5APYA 2E74B 3U59A 3TK1A 5AW3B 3OA7A 1SLQA 2KZJA 1GW3A 3CI9A 5E79E 3BCCG 2QRXA 5APXA 5K5GB 3G4SP 2ZT9D 4D6TG 1LT9A 4YXWH 2IZ0A 2NPSC 3I5CA 4UB6H 1MV8A 2VRSA 4XA4A 2JKVA 1GL2C 1AJYA 2QM8A 3GMAA 1GU4A 1KQSO 1YI2P 2KLUA 2FYUD 1U7MA 1L0LK 2H89C 3M06A 4A7PA 1RF1C 1Y9BA 5KLVE 1GL2D 1L4AA 2WPRA 4WBAA 3AEBC 1BDDA 3IF4A 3RBXA 1XTCC 3H1JE 3SFEC 3QH9A 1TU3F 2V4HA 2OYIA 1T2KC 2KNCB 1FZFA 2W90A 3PTZA 1JY3P 2ZXEB 4GT1A 1URQA 3F5HA 2KK7A 4N6JA 3RK3B 2OYOA 3UIAA 1WMKA 3H1HG 2E75D 2LR2A 3L37A 1KILB 2WWWA 4TLFA 5AVRB 5AW7B 2B9BA 3EQ2A 5AVTB 1S5LE 1KQLA 3IN6A 4HYTB 1NOHA 3V2QA 2QEXP 3HUSB 1SQBD 5AVQB 4NPDA 2C9LY 1PGOA 1K8AQ 1IFJA 1N73B 2C9NY 2D2CC 1GDTA 3KQGA 1NTZK 3L35A 1KB9D 1SQBK 1SS1A 3PRJA 2E5YA 5AVZB 5DJUB 5M1BA 3B5NA 2LXCB 3VP9A 3BCCD 3NTNA 2KUBA 2E75B 3WUVA 1BSNA 1JY3N 3CXHI 1YJNP 1Q86Q 1EDJA 2PAJA 5AVYB 2Z4EA 1JY3O 4N78D 2HG5D 4R4MA 1FZCB 3BRTB 4ASVA 3CCJP 4RKUJ 1BE3G 1YQ4C 2YKOA 1PZQA 2KB7P 2H43A 3B5ND 4Y28J 2OTJP 5KAIE 3B4SA 3ABVC 1Z56A 3LIEA 3S4RA 1X9VA 3G9RA 1OVUA 1S9KD 2KLVA 2YO2A 1K05A 3GF7A 3L74J 4LLHA 1GMJA 2XDJA 3RGUA 2BCCD 1BGYD 1JY2O 4Y99B 1G1IA 2BEZF 3CC4P 4N78E 3MP7B 3VMYA 1HJ0A 1NTMJ 1SQQE 5KLIB 3H1IG 1K04A 2N1TC 3F89A 3CWBG 2OYHA 3Q2YA 2KYVA 3M0AA 3PHLA 4EOTA 1AQ5A 3L75D 1FJKA 5KAFE 5GTIH 1S1CX 3Q1MA 2N9BA 3O8ZA 5TJHA 3VMXA 1VQKP 1EDLA 1YBKA 2UWJE 1NKNA 2FYUE 1SQXE 1VQLP 1HWTC 1QL1A 3H6PA 1SQPJ 1JY2N 2O01H 4GOEA 1GL2A 1L4AD 4RESB 1M1JA 3FXDA 3H32A 2XU6A 2MKVA 3Q5RA 4GDOA 3MIWA
chains in the Genus database with same CATH topology
2OQQA 3AE9C 2E76B 3GF3A 2G3AA 1OW7A 3AE7C 4Z1MH 2D2CD 1HF9A 2K9YA 3Q5SA 4H0LB 1PIXA 2WSFJ 2J5UA 1EXJA 1ZMEC 5KKZC 3S9OA 3FGAD 1RQVA 1R8EA 3T97B 4TT3H 3AE2C 1KQGB 4H0LD 1VF5C 3C8VA 4PV1D 2D2CB 1RQUA 1ZRTE 2QJKC 3LW5J 2E76D 1OMIA 2WSCJ 2YMKA 2FBWC 4R4LA 1MKMA 3GLMA 3D70A 1KMIZ 1ZP0C 5L8RJ 2QSIA 2QIWA 1IK7A 2ZT9B 2ZT9C 2V7QJ 2E74B 1EXIA 3AEAC 3Q3DA 2ZT9D 3AE8C 3D6YA 3D71A 2FYNC 3RK3E 1AJYA 2G8YA 2O01J 3GMAA 1JB0J 2H89C 3AEGC 1KTMA 1Y9BA 1KORA 3AEEC 3AEBC 1VF5D 1ZOYC 3SFEC 1NYHA 1TU3F 3AE3C 4U7JA 5KLIC 2E76C 4YTPC 1KQFB 1U57A 1WMKA 2E75D 3O6QA 1NGMB 2JP3A 3AEDC 1DD3A 4XFJA 3IN6A 4H44B 1OW6A 1PL5A 1PV3A 4H44C 3D6ZA 1FDIA 4I7ZC 1Q90D 1DD4A 3AECC 2D2CC 4YXDC 5M1BA 2WQYC 4H13B 4H44D 3AE5C 2E75B 2YIUC 2QJPC 3B71A 3RL0g 4PV1B 4R4MA 4H0LC 3H25A 4IL6X 4RKUJ 2E75C 1YQ4C 2H88C 4Y28J 3AE6C 1OW8A 4KT0J 3ABVC 2BEQD 3G9RA 2IDBA 1K05A 2NZ2A 3GF7A 1GMJA 1UIXA 4OGQD 3EWKA 3AEFC 2BEZF 2E74C 3Q5PA 2JO1A 3R4YA 1HJ0A 1K04A 1VL2A 2QJYC 1VF5B 1KILE 2WPVB 2WSEJ 4OGQC 3Q2YA 3IAOA 4H13C 3AE1C 2E74D 1S1CX 3Q1MA 3AE4C 3SFDC 1FDOA 2P10A 4I7ZB 1S5LX 1DIPA 2FXPA 1YQ3C 4H13D 4PV1C 4OGQB 2MKVA 3Q5RA 4GDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NGM B; 
#chains in the Genus database with same CATH topology
 1R5L A;  2OQQ A;  2E76 B;  1Q2N A;  2WSS H;  1OW7 A;  3H1J J;  1LTT C;  1VQ6 P;  1EZV I;  5KLV G;  2OYI B;  1N73 C;  3Q5S A;  1X0T A;  1PIX A;  3C1L A;  3H32 B;  3HE4 B;  4GIF A;  1FZG A;  1LP1 B;  1FE6 A;  1L4A B;  2JR8 A;  1J2J B;  1KYO I;  4D6T J;  3I56 P;  1VQO P;  1N7S B;  1T8Z A;  4L74 A;  2M5A A;  4C46 A;  5APV A;  1YJW P;  1R8E A;  1PPJ G;  2WT7 B;  1JOC A;  4BRY B;  5AVS B;  2A45 I;  3L75 J;  2BCC G;  4ZNC A;  1VQ4 P;  4JQ0 D;  1OX3 A;  4PV1 D;  3TGU J;  2ZXX A;  2B89 A;  3JCU H;  2FYN B;  4DCK A;  1RQU A;  2QJK C;  5CCG A;  1N7S A;  1QL2 A;  4KHX A;  4K3A A;  4ZKP A;  1NU1 J;  2E76 D;  2FKW B;  3MUD C;  1OMI A;  4MN4 C;  4PJ0 E;  2MJZ A;  4R4L A;  1SFC A;  2C0W A;  1A02 F;  3L73 G;  3SWK A;  2BCC E;  4PJ0 H;  4W7Z A;  1RF0 A;  1MUU A;  1QGK B;  1ZP0 C;  3USS A;  1FBM A;  3CC2 P;  5AW8 B;  1EC5 A;  5CCG D;  2FXM A;  5BU8 B;  1JO5 A;  1SQB E;  2WZ7 A;  3L71 E;  1J1E C;  1FAV A;  3L72 D;  2AEM A;  3TGU D;  4M3L A;  3RK2 D;  1T2K D;  2QE7 H;  2IFM A;  3K5B A;  3PJS K;  3E1I A;  1L0L J;  3CXH H;  1QX8 A;  3MD0 A;  4UB8 E;  4WWI A;  3VP8 A;  3AE8 C;  1HTL C;  5AW6 B;  3VMA A;  1PP9 D;  3H1L J;  2FYN C;  3A7O A;  3W68 A;  1YJ9 P;  5CCH A;  3EFF K;  3PH0 A;  1JUN A;  4HB1 A;  2G8Y A;  1SQV E;  1JB0 J;  2A06 D;  1NTK K;  4BXL A;  1KTM A;  5CHX A;  2ITA A;  1KOR A;  2O1J A;  3CXH D;  4JPZ B;  1OVR A;  2WSE H;  1ZOY C;  3ZDM A;  1HGV A;  2R44 A;  1NYH A;  2E5T A;  2XND H;  3CCQ P;  3AE3 C;  2GM4 A;  3CC7 P;  4U7J A;  1ZME C;  1LTJ B;  2E76 C;  1JM0 A;  2W83 C;  1AFO A;  3NFQ A;  1G2C B;  4U3F D;  2K3R A;  3L72 J;  1N73 A;  5AW5 B;  4OWF A;  3O6Q A;  1P84 I;  2JP3 A;  2R3C A;  4WB4 A;  3M9B A;  3BVH A;  1M1J B;  1PPJ D;  4HJG H;  2W27 A;  2ZYA A;  3BCC J;  4XFJ A;  5AVU B;  4H44 B;  2Q6Q A;  1NHL A;  1LTG C;  4H44 C;  3V6I A;  1J1E B;  1FDI A;  3O6Q B;  1QEX A;  1PP9 J;  1Q90 D;  3H1L D;  3AEC C;  1JNM A;  1QLE D;  1URQ D;  1MFZ A;  4AQR D;  2J59 M;  4PD4 E;  1YTZ T;  4W80 A;  3MGN A;  4YXD C;  3MHV A;  1VQM P;  2AXT H;  1N86 A;  2WSF H;  3WU2 E;  3CX5 H;  2YIU C;  3FXE A;  1KIL D;  1SFC B;  3VTP C;  4WY4 D;  4RJT A;  1VQN P;  4PV1 B;  1EDI A;  1LWU B;  1U7J A;  2XKM A;  3HUS C;  3CWB D;  3A3Y B;  3JSV C;  4H0L C;  2QJK B;  5TIS E;  3TNU A;  1LT9 B;  1NTK J;  2JWD A;  1OZH A;  1KIL C;  3M9Q A;  1H0T A;  4EIJ A;  1BGY J;  2M0B A;  3NMD A;  3L70 E;  3A0B H;  2BEQ D;  1KFN A;  2AEJ A;  3V5B A;  2WTY A;  1Y8A A;  2H7H A;  2GA1 A;  4WY4 B;  1NTM D;  1SQQ G;  2R5D A;  5AW0 B;  5B66 E;  3CD6 P;  1DX7 A;  2GUV A;  3H1K D;  3ITK A;  5B66 H;  3L73 E;  1JEK A;  1ZV8 A;  3GHG C;  2HR3 A;  1QVG O;  4U3F G;  1CW5 A;  1OXZ A;  1LJ2 A;  3GHG A;  2A45 H;  1AVO A;  2B88 A;  3CWB E;  5CCH C;  1X8Y A;  1ZRT D;  1NO4 A;  1SQP D;  3KZI E;  2WPV B;  2JDI H;  1FC2 C;  2P1J A;  1LTB C;  3V2P A;  2Q1K A;  4OH8 B;  1S72 P;  3T97 A;  4ASW A;  3G71 P;  1BE3 E;  1FS0 E;  3OW2 O;  2K9J A;  1DIP A;  2GUS A;  2FYZ A;  1N8R Q;  1YQ3 C;  1M57 D;  4WY4 C;  2YO3 A;  1PPJ E;  1W5C E;  1L0N D;  2FXO A;  1HJB A;  1LTI C;  1KB9 H;  2QA4 P;  3IR9 A;  2AEF A;  4Z1M H;  3KZI H;  3TSI A;  2K88 A;  1LGH B;  2NPS D;  1BCC E;  1L0N G;  1KD1 Q;  1RE3 C;  4H0L B;  4IFM A;  1IJD B;  2J5U A;  2BAS A;  1IK9 A;  3M9H A;  4HH2 A;  1IC2 A;  1IFI A;  2M8R A;  1P84 E;  2IFN A;  3A0H E;  4W7Y A;  1RE4 C;  1BE3 D;  3A0H H;  3FWN A;  3H1I J;  3RK3 D;  3V2N A;  2NPS A;  1VF5 C;  3GG2 A;  3L70 J;  1HUC A;  1IFM A;  3H1I E;  4PD4 I;  2NPS B;  2ZVO B;  1ZRT E;  2M5A B;  2CK3 H;  4DJG A;  2Q9I A;  3P32 A;  1MZ9 A;  4IFF A;  1EQ7 A;  3HRN A;  4O9B A;  3WMM 0;  4BRY A;  3L73 D;  3MZW B;  2HPC A;  1NAF A;  4AUW A;  1P84 H;  1CI6 A;  2N1T B;  2ZT9 B;  3HE5 B;  3P8C E;  3H1J G;  5H2F E;  3CMA P;  5TIS H;  4WVZ A;  5KLV K;  1VQ8 P;  2V7Q J;  5H2F H;  5DJT B;  1EXI A;  3Q3D A;  2QM7 A;  1SQP K;  2XZR A;  4DZO A;  4UB6 E;  3G6E P;  2ZVN B;  1FOS E;  2YKQ A;  5APT A;  3D71 A;  3U1A A;  3WU2 H;  1LT1 A;  2IBZ E;  1IFD A;  1T3J A;  3RK3 E;  3CX5 I;  1HVV A;  2PFX A;  4JF7 A;  3TGU G;  4B86 A;  5BU5 A;  1USD A;  4LGD E;  1LTA C;  2IBZ G;  1JY2 P;  4C7N A;  3BAS A;  3TNU B;  3U1C A;  1CZQ A;  2K9J B;  4EYY Q;  2Y0C A;  4GOF A;  1SQX D;  2A45 G;  1NTM K;  2A06 G;  3CWB J;  3AEG C;  1NU1 G;  1FZE A;  3AEE C;  1VF5 D;  4KJM A;  3L36 A;  1Q82 Q;  1NTZ G;  2WPS A;  5E79 H;  3CX5 D;  4NPE A;  3WUU A;  4C7R A;  3JC2 2;  3OJA B;  5APW A;  2I1J A;  1PGJ A;  3SSU A;  1Q81 Q;  3OAK A;  1U57 A;  2K1A A;  1E79 H;  4U3F E;  1BGY E;  3A0B E;  2FYU G;  3AED C;  1DD3 A;  1D7M A;  1LTS C;  1SQV K;  2NRG A;  3A2A A;  1NTK E;  5BVZ A;  1RF0 C;  1PV3 A;  1X79 B;  1AQT A;  1L0L E;  1PL5 A;  2QG4 A;  1EDK A;  3S1K A;  4I7Z C;  5KAI H;  3KHU A;  1DD4 A;  4U3F J;  3RL0 B;  5KJ7 A;  1ZR4 A;  3PLN A;  1H8A A;  1SQB J;  2WQY C;  4H13 B;  4C7N B;  1PGQ A;  1SQV D;  2H8P D;  3R2P A;  5CCH D;  1LWU A;  4JBZ A;  1T3U A;  2BCC J;  3RL0 g;  1CSB A;  1KB9 I;  1E5W A;  1PP9 E;  1LWU C;  1RHZ B;  3KPE A;  4I1L A;  3CLQ A;  2B87 A;  2ZYG A;  1Q7Y Q;  2JWA A;  2Q3E A;  2ZAE B;  3B5N B;  4IL6 X;  3BCC E;  4K35 A;  4N3Y B;  3H25 A;  1BSH A;  3L4F A;  5APS A;  2H88 C;  1GZL A;  2Q5U A;  5APQ A;  3MTU E;  2HLO A;  5GTI E;  1KFM A;  3TGU E;  3L72 E;  3HUS A;  1L0L D;  2IDB A;  2WIT A;  1NTK D;  1SQX K;  1LNQ A;  2N1T A;  2NZ2 A;  3KXD A;  3VYI A;  1UIX A;  1LTJ A;  3KDP B;  3VOP A;  1JTH A;  1AV1 A;  2FY8 A;  1M1J C;  4OGQ D;  5C39 A;  2R3S A;  1SVF A;  1VDF A;  2E74 C;  3Q5P A;  1IZN B;  2AXC A;  2IYO A;  2JO1 A;  3CX5 E;  1M56 D;  1M8O B;  1FZA A;  1VF5 B;  2QJY C;  2YXQ B;  4OGQ C;  3CCU P;  3TYY A;  1KZU B;  2E74 D;  5KLV D;  4Y99 C;  3AE4 C;  2FFD A;  3FX0 A;  2OTK E;  2KS1 B;  3HTK A;  1RF1 A;  1FDO A;  2P10 A;  3L74 D;  1SQP G;  5CCG C;  5EFW B;  4XE5 B;  2E43 A;  3C9I A;  3WUT A;  1GK4 A;  4I6M C;  2RH0 A;  1J1D B;  3G3Z A;  2ZJS E;  3BAT A;  1YHQ P;  2KIK A;  2KP8 A;  3HE4 A;  1SQQ J;  1SQQ K;  1WT6 A;  2Y0D A;  2KOG A;  2Z5H A;  2D2C D;  5GTH H;  1HF9 A;  1X22 A;  3TDK A;  5GTH E;  1GTW A;  1VQ7 P;  1FZC C;  2K9Y A;  2L91 A;  2HOD A;  5KAF H;  1BCC J;  5KJ7 C;  3H1J D;  5CJ4 A;  1QVF O;  3P8M C;  3S9O A;  3M0D C;  1SQB G;  2KSJ A;  5KKZ C;  3P8C D;  3L74 E;  1EZV E;  2RMZ A;  3FGA D;  1RQV A;  4BWN A;  2LKM A;  1ZR2 A;  2KS1 A;  2JJL A;  3AE2 C;  3HTK B;  4TT3 H;  1KQG B;  2LXB A;  2W6B A;  2ZYD A;  3E1R A;  3L75 E;  4OVN F;  1KYO E;  3L75 G;  3M91 A;  3CCL P;  2D2C B;  2IYP A;  1KN7 A;  2Z5I A;  1SQQ D;  2WMM A;  5AW9 B;  1EZV G;  1BE3 J;  2CPS A;  2IBZ D;  2IPP A;  2J58 A;  1S2E A;  2W6A A;  2WSC J;  2IX7 C;  2YMK A;  2O3J A;  3BRV B;  3GHG B;  2OGU A;  3CCR P;  1M90 Q;  2FFD C;  1KMI Z;  2KSE A;  5L8R J;  1KB9 E;  1JTH B;  2QSI A;  5CMZ A;  3QWO C;  3RK3 C;  3H1K G;  2QIW A;  2YXR B;  1S9K E;  2XV5 A;  3EFG A;  1N7S C;  2N9Y B;  2M3E A;  1L4A C;  2R32 A;  1PFI A;  5B5E E;  1URQ C;  5CJ0 A;  3SWY A;  3V4Q A;  1VQP P;  1HGZ A;  3SWF A;  5B5E H;  3AEA C;  1VPC A;  2OYI C;  1LT9 C;  2C0X A;  1NKZ B;  2OAR A;  2FYU J;  3CCE P;  1L2P A;  1KV4 A;  4NPF X;  1JCC A;  1RF1 B;  3D6Y A;  2DW3 A;  2L5G B;  2ZFC A;  3M0D A;  2JEE A;  1SFC C;  2PGD A;  1GL2 B;  4YPC A;  1S3J A;  2YIU B;  5AW2 B;  5KTB A;  1K73 Q;  1FDM A;  1IFP A;  2O01 J;  1FZC A;  1NAY A;  4JYC A;  3CCS P;  3CME P;  4GOD A;  2Y9Y A;  1SQX G;  3HD7 A;  3V2R A;  1K9M Q;  2OYH B;  2IZ1 A;  4PD4 H;  5KKZ B;  4HKZ H;  2KZI A;  2HOD B;  1NWQ A;  1YTZ I;  4EDF A;  1BCC D;  3VN0 A;  4IFD K;  5KLI C;  1USE A;  4YTP C;  3PP5 A;  1KQF B;  4JYB A;  4AYC A;  2Q3I A;  3H1H D;  2HYN A;  3HD7 D;  1J1D C;  1RE3 A;  1NGM B;  4CPG A;  1G2C A;  1YIJ P;  3B5N C;  4L73 A;  1H88 A;  1FOS F;  1KIL A;  1VQ5 P;  5APU A;  1OW6 A;  1RH5 B;  1RE4 A;  5CBO A;  1URQ B;  3TF5 A;  3D6Z A;  1NTZ D;  3FWL A;  3B8E B;  2KNC A;  1PP9 G;  1JMB A;  4EI2 A;  1M1K Q;  1IO4 A;  3RK2 C;  1YIT P;  1OWA A;  1FZB A;  4H44 D;  3CPW O;  3AE5 C;  1ZN5 A;  1OIP A;  1FU1 A;  1NTM G;  2QJP C;  3B71 A;  2IBZ I;  2WPQ A;  1HH0 A;  3RL0 C;  3V4W A;  1DEB A;  3W67 A;  4DOJ A;  1RY3 A;  2Y9Z A;  3P7K A;  3L73 J;  1SFC D;  1WRG A;  2W6J H;  2N1T D;  4DT0 A;  3H1I D;  1M7L A;  2P7J A;  2OYH C;  1FJP A;  1G1J A;  2E75 C;  2R5B A;  5AVX B;  2I8D A;  1GW4 A;  1XTG B;  1OW8 A;  3AE6 C;  3E7K A;  1BGY G;  3L71 G;  4I2L C;  4KT0 J;  4WY4 A;  2Q7C A;  1P84 D;  1Y47 A;  2V7Q H;  2WSC H;  2SPZ A;  3H1L E;  4QMA A;  4RO0 A;  4ZKU A;  1H0T B;  1S5L H;  2FYU K;  2OTL P;  1L0L G;  3L70 D;  2QVA A;  2HPC B;  2HFE D;  3EWK A;  2Y0E A;  3AEF C;  3H1H E;  4L76 A;  5KLV J;  1W2B O;  3HD7 C;  1DH3 A;  2M3B A;  1S4X A;  1ZW0 A;  1BCC G;  1CI6 B;  1L0N E;  1NH4 A;  1MFT A;  1ZLL A;  3HE5 A;  3R4Y A;  2POH A;  1VL2 A;  2WSE J;  5KJ7 D;  1KIL E;  2I1K A;  3VMZ A;  3IAO A;  4H13 C;  1PGP A;  3AE1 C;  2XNX A;  3HD7 B;  1NU1 D;  3IFM A;  1KYO H;  5AW4 B;  1HBW A;  4LC1 A;  4PD4 D;  1NU1 E;  3JCU E;  1NVO A;  4I7Z B;  3SFD C;  1S5L X;  2A06 E;  1W2E A;  1AA0 A;  2FXP A;  2FFD B;  2E42 A;  4H13 D;  4PV1 C;  3GW6 A;  3RL0 D;  2WT7 A;  2RN0 A;  2QJY B;  3N7N A;  3KYQ A;  2PRR A;  4OGQ B;  5AVV B;  2YNY A;  1NTZ J;  1H89 A;  4D6T D;  1LP1 A;  3L74 G;  2O01 N;  4GKG A;  3GF3 A;  3AE9 C;  4IL6 H;  2G3A A;  3AE7 C;  3H1K J;  4D6T E;  1L0N J;  2W8Z A;  2CPB A;  3NXS A;  1R5S A;  3N4X A;  5CBN A;  1OFC X;  1JMM A;  2P67 A;  2PP6 A;  2WSF J;  3H1H J;  3L71 D;  1EXJ A;  1N7S D;  1YYC A;  1GD2 E;  1SQV G;  1SQV J;  2QJP B;  3CL3 D;  3CXH E;  4UB8 H;  1VQ9 P;  5AVW B;  1T6A A;  1DEE G;  1N2D C;  3T97 B;  2YKP A;  4H0L D;  2YMY A;  4ZMD A;  3RK2 B;  3C8V A;  1LTJ C;  1N7L A;  2P2U A;  3H1L G;  3A5T A;  1ZXG A;  2KXP B;  3L70 G;  1SQP E;  3LW5 H;  2B87 B;  1NTK G;  2O1K A;  3MUD A;  3I55 P;  1SQX J;  4IL6 E;  3LW5 J;  1GK6 A;  1JCD A;  1SP4 A;  1UII A;  1L0N K;  2FBW C;  2RKL A;  4IOI H;  1KYO D;  1MKM A;  3II6 A;  3GLM A;  2AXT E;  3L71 J;  3LID A;  1NJI Q;  1A02 J;  2KI7 B;  1AVY A;  1KC8 Q;  3D70 A;  1OVV A;  3H1K E;  1GU5 A;  4L75 A;  1BDC A;  1EZV D;  1IK7 A;  1NTM E;  2WVR A;  1IFN A;  5AW1 B;  2P58 A;  2ZT9 C;  1NTZ E;  3RBZ A;  2K37 A;  1NU1 K;  3L72 G;  3CCM P;  3CCV P;  5APY A;  2E74 B;  3U59 A;  3TK1 A;  5AW3 B;  3OA7 A;  1SLQ A;  2KZJ A;  1GW3 A;  3CI9 A;  5E79 E;  3BCC G;  2QRX A;  5APX A;  5K5G B;  3G4S P;  2ZT9 D;  4D6T G;  1LT9 A;  4YXW H;  2IZ0 A;  2NPS C;  3I5C A;  4UB6 H;  1MV8 A;  2VRS A;  4XA4 A;  2JKV A;  1GL2 C;  1AJY A;  2QM8 A;  3GMA A;  1GU4 A;  1KQS O;  1YI2 P;  2KLU A;  2FYU D;  1U7M A;  1L0L K;  2H89 C;  3M06 A;  4A7P A;  1RF1 C;  1Y9B A;  5KLV E;  1GL2 D;  1L4A A;  2WPR A;  4WBA A;  3AEB C;  1BDD A;  3IF4 A;  3RBX A;  1XTC C;  3H1J E;  3SFE C;  3QH9 A;  1TU3 F;  2V4H A;  2OYI A;  1T2K C;  2KNC B;  1FZF A;  2W90 A;  3PTZ A;  1JY3 P;  2ZXE B;  4GT1 A;  1URQ A;  3F5H A;  2KK7 A;  4N6J A;  3RK3 B;  2OYO A;  3UIA A;  1WMK A;  3H1H G;  2E75 D;  2LR2 A;  3L37 A;  1KIL B;  2WWW A;  4TLF A;  5AVR B;  5AW7 B;  2B9B A;  3EQ2 A;  5AVT B;  1S5L E;  1KQL A;  3IN6 A;  4HYT B;  1NOH A;  3V2Q A;  2QEX P;  3HUS B;  1SQB D;  5AVQ B;  4NPD A;  2C9L Y;  1PGO A;  1K8A Q;  1IFJ A;  1N73 B;  2C9N Y;  2D2C C;  1GDT A;  3KQG A;  1NTZ K;  3L35 A;  1KB9 D;  1SQB K;  1SS1 A;  3PRJ A;  2E5Y A;  5AVZ B;  5DJU B;  5M1B A;  3B5N A;  2LXC B;  3VP9 A;  3BCC D;  3NTN A;  2KUB A;  2E75 B;  3WUV A;  1BSN A;  1JY3 N;  3CXH I;  1YJN P;  1Q86 Q;  1EDJ A;  2PAJ A;  5AVY B;  2Z4E A;  1JY3 O;  4N78 D;  2HG5 D;  4R4M A;  1FZC B;  3BRT B;  4ASV A;  3CCJ P;  4RKU J;  1BE3 G;  1YQ4 C;  2YKO A;  1PZQ A;  2KB7 P;  2H43 A;  3B5N D;  4Y28 J;  2OTJ P;  5KAI E;  3B4S A;  3ABV C;  1Z56 A;  3LIE A;  3S4R A;  1X9V A;  3G9R A;  1OVU A;  1S9K D;  2KLV A;  2YO2 A;  1K05 A;  3GF7 A;  3L74 J;  4LLH A;  1GMJ A;  2XDJ A;  3RGU A;  2BCC D;  1BGY D;  1JY2 O;  4Y99 B;  1G1I A;  2BEZ F;  3CC4 P;  4N78 E;  3MP7 B;  3VMY A;  1HJ0 A;  1NTM J;  1SQQ E;  5KLI B;  3H1I G;  1K04 A;  2N1T C;  3F89 A;  3CWB G;  2OYH A;  3Q2Y A;  2KYV A;  3M0A A;  3PHL A;  4EOT A;  1AQ5 A;  3L75 D;  1FJK A;  5KAF E;  5GTI H;  1S1C X;  3Q1M A;  2N9B A;  3O8Z A;  5TJH A;  3VMX A;  1VQK P;  1EDL A;  1YBK A;  2UWJ E;  1NKN A;  2FYU E;  1SQX E;  1VQL P;  1HWT C;  1QL1 A;  3H6P A;  1SQP J;  1JY2 N;  2O01 H;  4GOE A;  1GL2 A;  1L4A D;  4RES B;  1M1J A;  3FXD A;  3H32 A;  2XU6 A;  2MKV A;  3Q5R A;  4GDO A;  3MIW A; 
#chains in the Genus database with same CATH homology
 2OQQ A;  3AE9 C;  2E76 B;  3GF3 A;  2G3A A;  1OW7 A;  3AE7 C;  4Z1M H;  2D2C D;  1HF9 A;  2K9Y A;  3Q5S A;  4H0L B;  1PIX A;  2WSF J;  2J5U A;  1EXJ A;  1ZME C;  5KKZ C;  3S9O A;  3FGA D;  1RQV A;  1R8E A;  3T97 B;  4TT3 H;  3AE2 C;  1KQG B;  4H0L D;  1VF5 C;  3C8V A;  4PV1 D;  2D2C B;  1RQU A;  1ZRT E;  2QJK C;  3LW5 J;  2E76 D;  1OMI A;  2WSC J;  2YMK A;  2FBW C;  4R4L A;  1MKM A;  3GLM A;  3D70 A;  1KMI Z;  1ZP0 C;  5L8R J;  2QSI A;  2QIW A;  1IK7 A;  2ZT9 B;  2ZT9 C;  2V7Q J;  2E74 B;  1EXI A;  3AEA C;  3Q3D A;  2ZT9 D;  3AE8 C;  3D6Y A;  3D71 A;  2FYN C;  3RK3 E;  1AJY A;  2G8Y A;  2O01 J;  3GMA A;  1JB0 J;  2H89 C;  3AEG C;  1KTM A;  1Y9B A;  1KOR A;  3AEE C;  3AEB C;  1VF5 D;  1ZOY C;  3SFE C;  1NYH A;  1TU3 F;  3AE3 C;  4U7J A;  5KLI C;  2E76 C;  4YTP C;  1KQF B;  1U57 A;  1WMK A;  2E75 D;  3O6Q A;  1NGM B;  2JP3 A;  3AED C;  1DD3 A;  4XFJ A;  3IN6 A;  4H44 B;  1OW6 A;  1PL5 A;  1PV3 A;  4H44 C;  3D6Z A;  1FDI A;  4I7Z C;  1Q90 D;  1DD4 A;  3AEC C;  2D2C C;  4YXD C;  5M1B A;  2WQY C;  4H13 B;  4H44 D;  3AE5 C;  2E75 B;  2YIU C;  2QJP C;  3B71 A;  3RL0 g;  4PV1 B;  4R4M A;  4H0L C;  3H25 A;  4IL6 X;  4RKU J;  2E75 C;  1YQ4 C;  2H88 C;  4Y28 J;  3AE6 C;  1OW8 A;  4KT0 J;  3ABV C;  2BEQ D;  3G9R A;  2IDB A;  1K05 A;  2NZ2 A;  3GF7 A;  1GMJ A;  1UIX A;  4OGQ D;  3EWK A;  3AEF C;  2BEZ F;  2E74 C;  3Q5P A;  2JO1 A;  3R4Y A;  1HJ0 A;  1K04 A;  1VL2 A;  2QJY C;  1VF5 B;  1KIL E;  2WPV B;  2WSE J;  4OGQ C;  3Q2Y A;  3IAO A;  4H13 C;  3AE1 C;  2E74 D;  1S1C X;  3Q1M A;  3AE4 C;  3SFD C;  1FDO A;  2P10 A;  4I7Z B;  1S5L X;  1DIP A;  2FXP A;  1YQ3 C;  4H13 D;  4PV1 C;  4OGQ B;  2MKV A;  3Q5R A;  4GDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...