1NGMB

Crystal structure of a yeast brf1-tbp-dna ternary complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
GSYCPRNLHLLPTTDTYLSKVSDDPDNLEDVDDEELNAHLLNEEASKLKERIWIGLNADFLLEQESKRLKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 5'-D(*CP*TP*AP*TP*AP*AP*AP*AP*AP*AP*AP*TP*GP*TP*TP*TP*TP*TP*
publication title Crystal structure of a transcription factor IIIB core interface ternary complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 12
structure length 72
sequence length 72
chains with identical sequence F, J, N
ec nomenclature
pdb deposition date 2002-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.650 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ngmB00
1NGMB
chains in the Genus database with same CATH superfamily
1KD1Q 1HTLC 2NRGA 2O1JA 2Y9YA 3M0DC 1IFIA 4AUWA 3VMAA 1VQ7P 1GDTA 1JY3O 1E5WA 2W83C 1M57D 3A5TA 1LTBC 4GOEA 2KK7A 3P7KA 2HLOA 2FXPA 5APVA 1QL1A 1FZFA 5CCHA 4EI2A 1N7SA 1VQ5P 1EXIA 5TISE 1IFJA 2YO2A 2H7HA 1PPJD 3P8CD 1RY3A 2KXPB 5KLVJ 2YKPA 3CCRP 1BCCE 4I7ZC 3BRTB 1XTCC 2QRXA 4HKZH 5APTA 2M3BA 1FDMA 1PP9D 1KC8Q 3W68A 3L74D 1BGYD 1JY2O 1P84I 1SQBJ 1L4AD 1SQPD 4PJ0H 1GL2A 3NFQA 4TT3H 3I56P 1NAFA 4NPFX 1M90Q 1SQVJ 3L71G 1JCCA 5AVQB 1MFZA 1M1JB 2KUBA 5APWA 1L0LJ 2XNXA 4WVZA 4L73A 1VQLP 1Y9BA 3H32B 3QH9A 1NTZD 1PL5A 1QVGO 4R4LA 4K35A 2MJZA 3NXSA 1G1JA 4C7NB 3AECC 1ZOYC 3HUSB 2OTLP 2AXTE 1FZCB 3IF4A 4HB1A 3B71A 3CPWO 1YITP 3RL0D 3MD0A 2P67A 3MZWB 2BASA 2NPSB 3EFFK 2QEXP 1FE6A 4QMAA 3WU2E 3RK2D 1WRGA 2CPSA 1NWQA 1QVFO 1W2EA 2D2CB 3JCUE 2B88A 2R3SA 4UB6E 4H44D 1NO4A 1SP4A 3H1KG 1AQ5A 2OYHA 1HBWA 4DJGA 1K05A 1IK7A 3D70A 2QJYB 5H2FH 2K9JA 3H25A 2AEJA 1BCCG 1CI6B 1L0ND 1SVFA 2WT7B 3L71D 3TGUD 1OMIA 1P84D 1X8YA 1JCDA 3WUUA 1SQXK 1EDJA 4D6TE 4XFJA 3H1JE 1GW4A 4HH2A 4PV1B 4U7JA 3A0BE 4PD4H 1N86A 2N9YB 1M1JC 3D71A 2Z4EA 4AYCA 3R4YA 4DT0A 3SWYA 1G2CB 2R5BA 2WPVB 2LXCB 2KNCB 3IAOA 3L37A 3F5HA 3SWKA 5AVTB 4BRYA 1MZ9A 3MUDA 3GHGA 4NPEA 3Q5SA 1GZLA 3E7KA 4JYCA 3HUSC 4OGQD 1YTZT 3CXHE 1XTGB 5CHXA 1QEXA 3CWBD 3CCEP 3FXDA 1FZCC 3LW5H 2Q9IA 1LTJB 3EWKA 1HJ0A 3V4WA 1EZVI 1BSNA 3NTNA 2NPSC 4IFDK 1Q7YQ 3BCCD 1PGJA 1QLED 2FFDA 2K9YA 4YPCA 1QL2A 3HE5A 4WY4A 4EYYQ 1BCCD 2HPCB 1LT9A 2Z5HA 2ZVOB 3H1HE 4OH8B 3L75J 3AEEC 1SFCD 3AE5C 1JMBA 2O1KA 3FX0A 3H32A 3KXDA 2IYOA 4ZNCA 1Y47A 3AE1C 5EFWB 2W6BA 2QJYC 3L73E 1AQTA 2Y0EA 3GLMA 2W6JH 2H88C 3O8ZA 2BCCJ 1VF5D 3HUSA 2CPBA 2Y9ZA 2N1TB 1LJ2A 2J5UA 4PJ0E 1EDLA 3OA7A 3PLNA 4IL6H 2I8DA 3BRVB 1BE3E 4YXWH 3MIWA 2NPSA 2ZYDA 2R44A 1E79H 3D6YA 4D6TG 4PV1C 4KJMA 2IZ1A 1IC2A 2WMMA 2E74D 1NTKJ 3CX5H 4MN4C 4JPZB 1SQXE 1MFTA 1ZN5A 3CL3D 5AVRB 2WSSH 3Q5RA 2YXRB 5AVVB 1N7SD 2P58A 3M9HA 1U7MA 4GT1A 4JF7A 3MGNA 4Y28J 4BWNA 1KORA 3L36A 1LTJC 1N7SB 1CI6A 5AW3B 2WT7A 1GK4A 1JOCA 1SQQJ 2W90A 3R2PA 2Q3EA 4N3YB 1ZR2A 5AVYB 2N9BA 1GU4A 1GU5A 1JY3N 5TJHA 1VL2A 3P32A 1KQSO 3IN6A 2IFMA 3FGAD 4A7PA 3C8VA 1GL2B 2GM4A 4C46A 5AW2B 5CCGC 5H2FE 3L73G 1SFCC 5AVUB 1BDDA 3SWFA 4HYTB 4TLFA 4YTPC 3CCMP 4XA4A 4YXDC 3A0HE 1OVRA 1VQPP 2N1TC 4D6TD 3H1JD 4N6JA 3CCVP 1L0LG 3M9BA 5CBNA 2XU6A 3H1LJ 1IFPA 3FXEA 4N78E 2JWAA 5APQA 1BE3G 3CCSP 3I55P 3M06A 2WSFH 4PD4E 3I5CA 2NZ2A 1D7MA 1A02F 2WTYA 3B8EB 3CXHD 1SQXG 3H1IE 2HPCA 2E74C 2KLVA 1DH3A 1RQUA 1LTTC 1QX8A 3KHUA 3HD7B 3IFMA 3VMYA 4W7YA 3CCQP 1IO4A 4DZOA 2HODA 5CCHC 3HE4B 3KDPB 1N7SC 1JY2P 3V5BA 2OTJP 2N1TA 2OYHB 2ZAEB 2Q3IA 2K9JB 3V4QA 3H1HD 2E43A 3TSIA 1N73A 1PGPA 3G3ZA 1K04A 2FYNB 1QGKB 2ZXXA 5KJ7A 3L73D 1RF0C 2QM7A 1NU1E 1R5SA 1GL2C 3D6ZA 1NTMJ 4AQRD 4RESB 4U3FE 3LIDA 2Y0DA 5AVWB 1NYHA 2J59M 2FYUJ 1OFCX 1PGOA 1FDOA 1USEA 5AW7B 1BE3D 4CPGA 2DW3A 3MP7B 2QVAA 3H1KE 4JBZA 2KP8A 1HGZA 4XE5B 4IL6E 3G71P 2E76B 4BRYB 3GHGB 3BVHA 1SQXD 1JNMA 1FS0E 2VRSA 3JSVC 2OARA 3CX5E 3IR9A 1OW6A 1KILA 1X9VA 1YBKA 5CMZA 1RF0A 1M8OB 3H1IG 2FFDB 3W67A 2FY8A 4M3LA 1KB9H 1K8AQ 3HE5B 3AE6C 3L70D 3MTUE 4WY4B 1AVOA 2WWWA 1ZRTE 4ASVA 3TNUA 1LT9B 4IFFA 4JQ0D 5KAIH 1KQFB 3P8MC 2OYHC 1U7JA 3L72E 1T8ZA 1FOSF 1RH5B 2P7JA 2H89C 3CI9A 1PGQA 3AE4C 2FYNC 2NPSD 3PRJA 3S9OA 5KLVK 1H0TA 1NU1G 1AVYA 1N8RQ 1IFDA 4GOFA 1ZP0C 3B5NA 1OW8A 4U3FG 2D2CD 2C0XA 1KYOH 2R32A 1ZR4A 4N78D 3HD7A 3N4XA 1JTHA 1URQA 1YJ9P 2V7QJ 2JJLA 3Q2YA 3N7NA 2KS1A 5B5EH 4PD4D 1PP9J 3HE4A 3GG2A 1SQVK 3L74J 1YHQP 1OW7A 1BGYJ 3PH0A 2E76C 4RO0A 2XV5A 3MUDC 3GHGC 3CC4P 1SQPJ 2R3CA 1L0LK 3H1ID 1FJPA 5DJUB 2ZVNB 2LR2A 2JEEA 1KTMA 1GTWA 3KQGA 2LXBA 3A0HH 2M0BA 1R8EA 1VQOP 4PV1D 5KTBA 2FFDC 1SQQG 1KZUB 1NTZJ 2A45H 2Q6QA 1EDIA 1Q82Q 4WY4C 5K5GB 3TF5A 3GMAA 3AEAC 1LT9C 5KKZB 4R4MA 2ZXEB 3A2AA 1K9MQ 1DEBA 4W7ZA 1H8AA 2MKVA 4W80A 1VPCA 1NU1D 5AVZB 2B87A 3L72G 2IBZE 5CJ4A 1S1CX 4H0LB 5DJTB 3HRNA 2KZIA 1LGHB 4U3FD 2E75B 5GTIH 1RF1A 1H89A 1S9KE 1OVVA 1Q90D 2IFNA 3H1KD 2OTKE 1P84H 3O6QA 5AVSB 1KFMA 3H1LG 2B9BA 3GW6A 2KIKA 1G1IA 5KLVE 4L76A 1OWAA 2QM8A 1NKZB 2KLUA 2D2CC 5CCGD 1L0NJ 2JR8A 2KSJA 3L71J 3TGUJ 2RMZA 3V2PA 1HVVA 3CX5D 1SQBE 2POHA 3LIEA 1IFMA 3OJAB 2N1TD 2K37A 2HODB 2PFXA 1SQVE 3RK3B 1RE4A 2RH0A 1T3JA 1FZAA 1S2EA 2I1JA 3L35A 1ZLLA 1L0LE 1ZRTD 1EXJA 1LTIC 1HF9A 3Q1MA 1KB9E 2IPPA 2L5GB 1N73B 1RE3C 1S5LH 2I1KA 2QJKB 2IYPA 2M5AA 3L72D 3OW2O 3EQ2A 1W5CE 1DD3A 5KAIE 5KKZC 3M91A 1FBMA 3CWBJ 2CK3H 2WVRA 3CXHI 4B86A 3E1IA 2XNDH 5CCHD 3AE3C 5CJ0A 4H0LC 2IBZG 1W2BO 1YQ3C 3BCCJ 2QE7H 1KQLA 2H8PD 1LP1A 3AEGC 2E75C 2FYUG 5AW5B 3VMZA 2Y0CA 5AW1B 3KYQA 1FDIA 1BCCJ 5E79H 1BGYE 1WMKA 2ZFCA 1LWUA 1KYOE 1NU1K 2ZYGA 1MV8A 1SQPE 4H13B 5AW6B 4Y99B 5CBOA 1RE3A 4LGDE 1GL2D 1VQ8P 5KLVG 1Q86Q 1KILB 3CCUP 3SFEC 5APSA 5B5EE 2JWDA 4I6MC 4I2LC 2HFED 2E42A 2P2UA 1RQVA 1FC2C 1SQBG 1UIIA 3TYYA 1ZV8A 2WSCJ 3TNUB 3RK3C 3JC22 3OAKA 1KFNA 1SQVG 2W27A 3ZDMA 1OXZA 3V2QA 2YIUB 1LT1A 1JY2N 1KV4A 2FYZA 3BATA 3FWNA 1N73C 1VQ4P 2QJKC 1LNQA 1SQQK 1AFOA 5L8RJ 1WT6A 1KMIZ 5KJ7C 3B5ND 2R5DA 2IBZD 2KYVA 1YIJP 1H0TB 2YMYA 5BVZA 4ZMDA 1OZHA 3HD7D 3B5NB 2K3RA 2WSEJ 1U57A 4LLHA 1YTZI 3RGUA 1GK6A 2QJPB 1OX3A 3HTKA 1JTHB 1URQB 5GTIE 1DD4A 4BXLA 2KS1B 4C7RA 3A7OA 1JUNA 1M7LA 5KLVD 2JDIH 3VTPC 1EQ7A 1NHLA 3TGUE 1P84E 1BGYG 3L75E 1LTAC 3KPEA 3AE2C 4H13C 1FJKA 1SQBD 1SQPG 5GTHH 4Y99C 1KILC 1EDKA 2BCCE 2WITA 2E5YA 1SQVD 4D6TJ 3H1JJ 1OIPA 3II6A 1L0LD 2WZ7A 1HUCA 1R5LA 3CMAP 3GF7A 1ZMEC 1X0TA 1JEKA 1VQ9P 1KB9D 3CLQA 4DOJA 2E76D 2SPZA 5AVXB 2M3EA 1NTKE 2YIUC 1TU3F 1ZW0A 4PD4I 3VP9A 3CWBE 1CSBA 5KAFH 2B87B 3VMXA 1J1EB 3Q3DA 2JP3A 2A45G 2Q7CA 1YJWP 1S5LE 2HG5D 1SLQA 2W8ZA 1PIXA 3PHLA 1KQGB 1RF1B 1FAVA 2WPSA 3BCCE 1DX7A 2RN0A 3GF3A 3RK3E 1SS1A 3B5NC 1SQQE 3O6QB 4WY4D 3ITKA 2QJPC 2FBWC 1HGVA 3HD7C 1HWTC 3AE8C 1URQC 1Q81Q 1NTMK 1KYOD 3H1HJ 4JYBA 3H6PA 5B66H 2O01H 1VQMP 1GD2E 3PTZA 2K1AA 2KI7B 2FYUK 3L73J 3T97B 1RHZB 1Z56A 2O01N 2OQQA 5E79E 1L0NG 2H43A 3KZIH 1L4AB 3M0DA 3TGUG 2FXOA 2P10A 3L75G 1NJIQ 2O01J 3CC2P 2FKWB 1T2KC 2PRRA 1BE3J 2XKMA 2YKQA 2BCCG 1K73Q 1IFNA 2V7QH 2G8YA 1IK9A 4NPDA 1Y8AA 1IZNB 2M5AB 3H1LE 3CMEP 1J1DB 1JMMA 2RKLA 3L4FA 5M1BA 1FZBA 1SQBK 1SQXJ 1BDCA 2HR3A 1AA0A 3V2NA 1LTGC 1BSHA 1NAYA 1KILE 2QA4P 1T3UA 3RL0B 1NTKG 3G6EP 4DCKA 2AXCA 3CWBG 2YXQB 3CX5I 1J1EC 4L74A 1EZVE 3AEFC 3RBZA 1LP1B 4UB8H 2YMKA 1RF1C 3AE9C 3RL0g 1X79B 1YQ4C 3BCCG 4IL6X 3L70J 3RK2B 3BASA 1S5LX 4H44B 4RJTA 1LWUB 1YYCA 1DEEG 2QSIA 1NVOA 2GUSA 3G4SP 3VOPA 1FZGA 1HH0A 1DIPA 3AEBC 3L75D 4GIFA 1JB0J 4H0LD 1L4AC 2BCCD 3AE7C 2E75D 4L75A 1NTME 1N7LA 5GTHE 1RE4C 2FYUE 1NOHA 2GA1A 2OYIB 1SQPK 1AJYA 1FOSE 1S4XA 2OGUA 2C0WA 4ZKUA 5BU8B 4GKGA 2XZRA 1UIXA 4I1LA 1NTKD 1FZEA 2K88A 2A06E 1J1DC 3Q5PA 1ZXGA 3WUTA 1PZQA 3H1IJ 1LTSC 4OGQB 3WUVA 3PP5A 1NTZK 4WB4A 3EFGA 1VQ6P 2C9NY 2Z5IA 3RL0C 3C1LA 5KAFE 3UIAA 2IDBA 2KOGA 3RK3D 3T97A 3LW5J 2ZT9D 3HTKB 1L4AA 1EZVG 1IJDB 1SQQD 1S3JA 4GODA 1M1JA 2ITAA 3S1KA 3U1AA 3TDKA 2ZT9B 2W6AA 1MUUA 1USDA 3RK2C 2P1JA 2ZJSE 2ZYAA 3CCJP 4IFMA 4H44C 1S72P 1LWUC 1GW3A 2HYNA 2M8RA 5KJ7D 4C7NA 1SFCB 3B4SA 3CCLP 3C9IA 2WPRA 1NU1J 2J58A 2PAJA 4HJGH 4IOIH 1FZCA 1EC5A 3CC7P 5B66E 2BEQD 3A3YB 1AV1A 4U3FJ 2IBZI 1VF5B 4KT0J 5TISH 3CD6P 1L2PA 1VQKP 3KZIE 2JO1A 3MHVA 3H1JG 3S4RA 1NTMG 3NMDA 3AEDC 3PJSK 5APXA 3H1KJ 1L0NK 1N2DC 2WQYC 3F89A 3USSA 4WBAA 4KHXA 1PPJE 3K5BA 3H1LD 3P8CE 2OYIC 2E74B 1NH4A 1MKMA 2O3JA 1M56D 4H13D 2L91A 1PP9E 3L74E 1KILD 5KLIB 5AW8B 1JO5A 4K3AA 2OYOA 5AW4B 2A06G 2QIWA 1EZVD 1T6AA 4OGQC 2WSCH 3VYIA 4EDFA 3TK1A 1GMJA 3L70E 1X22A 4ZKPA 3SFDC 1A02J 4ASWA 1NTKK 2IZ0A 4Z1MH 2XDJA 3G9RA 4UB8E 1M1KQ 1NTZE 2AXTH 5AW0B 2PGDA 3SSUA 2KSEA 2ZT9C 2Q5UA 1KB9I 3L72J 3VP8A 1G2CA 2FXMA 2GUVA 3V6IA 3H1HG 2AEMA 2WPQA 2OYIA 2Q1KA 4GDOA 1HJBA 2KNCA 3VN0A 3RBXA 5BU5A 2JKVA 1Q2NA 1VQNP 2WSEH 1CZQA 3WU2H 1NGMB 1KN7A 1PV3A 3U59A 3JCUH 1NTMD 4UB6H 1LTJA 2QG4A 1VF5C 2B89A 2KB7P 2V4HA 3M9QA 2FYUD 3M0AA 1NKNA 1J2JB 4EIJA 5APUA 1URQD 1JY3P 2PP6A 2YKOA 4I7ZB 4OVNF 2YNYA 3E1RA 1S9KD 2C9LY 5AW9B 4OWFA 4LC1A 2KZJA 1KYOI 2A06D 1YI2P 1PPJG 1PFIA 2LKMA 4WWIA 1JM0A 4RKUJ 2WSFJ 1YJNP 1L0NE 3ABVC 2E5TA 3L71E 1PP9G 5CCGA 1T2KD 3L74G 5KLIC 3V2RA 3U1CA 3A0BH 1SFCA 2AEFA 3FWLA 2UWJE 5APYA 2BEZF 2YO3A 3L70G 1CW5A 2G3AA 5C39A 3QWOC 2IX7C 1H88A 3CXHH 1NTZG 1OVUA 4EOTA 2A45I 1VDFA 3WMM0 4O9BA 1FU1A
chains in the Genus database with same CATH topology
1WMKA 4U7JA 3AE6C 3AECC 2J5UA 2WQYC 1UIXA 1ZRTE 3D71A 1ZOYC 3GF3A 3R4YA 3RK3E 1DD4A 1VF5C 4H13B 1R8EA 3Q5PA 1KQFB 4PV1D 3AEFC 1K04A 2E74B 2WPVB 3B71A 3SFEC 1MKMA 2YMKA 1KTMA 4OGQB 4YTPC 3IAOA 2QJPC 2FBWC 4H13D 4I7ZB 4YXDC 2FXPA 3D6YA 3AE9C 4PV1C 3D6ZA 3RL0g 1YQ4C 4IL6X 2H89C 3AE8C 3Q5SA 2E74D 1EXIA 1RQVA 3AE2C 3GMAA 4OGQD 3AEAC 1S5LX 4H13C 1NYHA 2IDBA 1EXJA 4H44B 4R4MA 3LW5J 2QIWA 2ZT9D 3AE4C 2FYNC 1HF9A 1FDOA 3Q1MA 4RKUJ 2QSIA 3EWKA 2WSCJ 4OGQC 2WSFJ 3T97B 3S9OA 1HJ0A 2OQQA 2D2CB 4I7ZC 3Q5RA 4H44D 3ABVC 2MKVA 1GMJA 2ZT9B 2NZ2A 3SFDC 1DIPA 1S1CX 5KLIC 1ZP0C 4H0LB 2P10A 3AEBC 1OW8A 1DD3A 5KKZC 4Y28J 4H44C 2D2CD 2K9YA 1JB0J 2O01J 2E76B 1KORA 2E75B 4Z1MH 1K05A 1IK7A 3G9RA 3GF7A 3D70A 1ZMEC 2E74C 4H0LD 4TT3H 2BEZF 1RQUA 3H25A 2V7QJ 2QJKC 2E76D 3Q2YA 3AE7C 2E75D 2ZT9C 5L8RJ 1KMIZ 1Q90D 2G8YA 3AE3C 2G3AA 4H0LC 1OMIA 2YIUC 1TU3F 1OW7A 1OW6A 1YQ3C 2BEQD 3AEEC 3AE5C 3O6QA 2E76C 4GDOA 3AEGC 2E75C 3AE1C 1VF5B 3Q3DA 2JP3A 4KT0J 5M1BA 1VL2A 2QJYC 1Y9BA 2JO1A 2WSEJ 1U57A 1PL5A 1AJYA 3AEDC 2D2CC 3GLMA 3IN6A 2H88C 1PIXA 4R4LA 1FDIA 1NGMB 3FGAD 4XFJA 1KQGB 1VF5D 3C8VA 4PV1B 1PV3A 1KILE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NGM B; 
#chains in the Genus database with same CATH topology
 1KD1 Q;  1HTL C;  2NRG A;  2O1J A;  2Y9Y A;  3M0D C;  1IFI A;  4AUW A;  3VMA A;  1VQ7 P;  1GDT A;  1JY3 O;  1E5W A;  2W83 C;  1M57 D;  3A5T A;  1LTB C;  4GOE A;  2KK7 A;  3P7K A;  2HLO A;  2FXP A;  5APV A;  1QL1 A;  1FZF A;  5CCH A;  4EI2 A;  1N7S A;  1VQ5 P;  1EXI A;  5TIS E;  1IFJ A;  2YO2 A;  2H7H A;  1PPJ D;  3P8C D;  1RY3 A;  2KXP B;  5KLV J;  2YKP A;  3CCR P;  1BCC E;  4I7Z C;  3BRT B;  1XTC C;  2QRX A;  4HKZ H;  5APT A;  2M3B A;  1FDM A;  1PP9 D;  1KC8 Q;  3W68 A;  3L74 D;  1BGY D;  1JY2 O;  1P84 I;  1SQB J;  1L4A D;  1SQP D;  4PJ0 H;  1GL2 A;  3NFQ A;  4TT3 H;  3I56 P;  1NAF A;  4NPF X;  1M90 Q;  1SQV J;  3L71 G;  1JCC A;  5AVQ B;  1MFZ A;  1M1J B;  2KUB A;  5APW A;  1L0L J;  2XNX A;  4WVZ A;  4L73 A;  1VQL P;  1Y9B A;  3H32 B;  3QH9 A;  1NTZ D;  1PL5 A;  1QVG O;  4R4L A;  4K35 A;  2MJZ A;  3NXS A;  1G1J A;  4C7N B;  3AEC C;  1ZOY C;  3HUS B;  2OTL P;  2AXT E;  1FZC B;  3IF4 A;  4HB1 A;  3B71 A;  3CPW O;  1YIT P;  3RL0 D;  3MD0 A;  2P67 A;  3MZW B;  2BAS A;  2NPS B;  3EFF K;  2QEX P;  1FE6 A;  4QMA A;  3WU2 E;  3RK2 D;  1WRG A;  2CPS A;  1NWQ A;  1QVF O;  1W2E A;  2D2C B;  3JCU E;  2B88 A;  2R3S A;  4UB6 E;  4H44 D;  1NO4 A;  1SP4 A;  3H1K G;  1AQ5 A;  2OYH A;  1HBW A;  4DJG A;  1K05 A;  1IK7 A;  3D70 A;  2QJY B;  5H2F H;  2K9J A;  3H25 A;  2AEJ A;  1BCC G;  1CI6 B;  1L0N D;  1SVF A;  2WT7 B;  3L71 D;  3TGU D;  1OMI A;  1P84 D;  1X8Y A;  1JCD A;  3WUU A;  1SQX K;  1EDJ A;  4D6T E;  4XFJ A;  3H1J E;  1GW4 A;  4HH2 A;  4PV1 B;  4U7J A;  3A0B E;  4PD4 H;  1N86 A;  2N9Y B;  1M1J C;  3D71 A;  2Z4E A;  4AYC A;  3R4Y A;  4DT0 A;  3SWY A;  1G2C B;  2R5B A;  2WPV B;  2LXC B;  2KNC B;  3IAO A;  3L37 A;  3F5H A;  3SWK A;  5AVT B;  4BRY A;  1MZ9 A;  3MUD A;  3GHG A;  4NPE A;  3Q5S A;  1GZL A;  3E7K A;  4JYC A;  3HUS C;  4OGQ D;  1YTZ T;  3CXH E;  1XTG B;  5CHX A;  1QEX A;  3CWB D;  3CCE P;  3FXD A;  1FZC C;  3LW5 H;  2Q9I A;  1LTJ B;  3EWK A;  1HJ0 A;  3V4W A;  1EZV I;  1BSN A;  3NTN A;  2NPS C;  4IFD K;  1Q7Y Q;  3BCC D;  1PGJ A;  1QLE D;  2FFD A;  2K9Y A;  4YPC A;  1QL2 A;  3HE5 A;  4WY4 A;  4EYY Q;  1BCC D;  2HPC B;  1LT9 A;  2Z5H A;  2ZVO B;  3H1H E;  4OH8 B;  3L75 J;  3AEE C;  1SFC D;  3AE5 C;  1JMB A;  2O1K A;  3FX0 A;  3H32 A;  3KXD A;  2IYO A;  4ZNC A;  1Y47 A;  3AE1 C;  5EFW B;  2W6B A;  2QJY C;  3L73 E;  1AQT A;  2Y0E A;  3GLM A;  2W6J H;  2H88 C;  3O8Z A;  2BCC J;  1VF5 D;  3HUS A;  2CPB A;  2Y9Z A;  2N1T B;  1LJ2 A;  2J5U A;  4PJ0 E;  1EDL A;  3OA7 A;  3PLN A;  4IL6 H;  2I8D A;  3BRV B;  1BE3 E;  4YXW H;  3MIW A;  2NPS A;  2ZYD A;  2R44 A;  1E79 H;  3D6Y A;  4D6T G;  4PV1 C;  4KJM A;  2IZ1 A;  1IC2 A;  2WMM A;  2E74 D;  1NTK J;  3CX5 H;  4MN4 C;  4JPZ B;  1SQX E;  1MFT A;  1ZN5 A;  3CL3 D;  5AVR B;  2WSS H;  3Q5R A;  2YXR B;  5AVV B;  1N7S D;  2P58 A;  3M9H A;  1U7M A;  4GT1 A;  4JF7 A;  3MGN A;  4Y28 J;  4BWN A;  1KOR A;  3L36 A;  1LTJ C;  1N7S B;  1CI6 A;  5AW3 B;  2WT7 A;  1GK4 A;  1JOC A;  1SQQ J;  2W90 A;  3R2P A;  2Q3E A;  4N3Y B;  1ZR2 A;  5AVY B;  2N9B A;  1GU4 A;  1GU5 A;  1JY3 N;  5TJH A;  1VL2 A;  3P32 A;  1KQS O;  3IN6 A;  2IFM A;  3FGA D;  4A7P A;  3C8V A;  1GL2 B;  2GM4 A;  4C46 A;  5AW2 B;  5CCG C;  5H2F E;  3L73 G;  1SFC C;  5AVU B;  1BDD A;  3SWF A;  4HYT B;  4TLF A;  4YTP C;  3CCM P;  4XA4 A;  4YXD C;  3A0H E;  1OVR A;  1VQP P;  2N1T C;  4D6T D;  3H1J D;  4N6J A;  3CCV P;  1L0L G;  3M9B A;  5CBN A;  2XU6 A;  3H1L J;  1IFP A;  3FXE A;  4N78 E;  2JWA A;  5APQ A;  1BE3 G;  3CCS P;  3I55 P;  3M06 A;  2WSF H;  4PD4 E;  3I5C A;  2NZ2 A;  1D7M A;  1A02 F;  2WTY A;  3B8E B;  3CXH D;  1SQX G;  3H1I E;  2HPC A;  2E74 C;  2KLV A;  1DH3 A;  1RQU A;  1LTT C;  1QX8 A;  3KHU A;  3HD7 B;  3IFM A;  3VMY A;  4W7Y A;  3CCQ P;  1IO4 A;  4DZO A;  2HOD A;  5CCH C;  3HE4 B;  3KDP B;  1N7S C;  1JY2 P;  3V5B A;  2OTJ P;  2N1T A;  2OYH B;  2ZAE B;  2Q3I A;  2K9J B;  3V4Q A;  3H1H D;  2E43 A;  3TSI A;  1N73 A;  1PGP A;  3G3Z A;  1K04 A;  2FYN B;  1QGK B;  2ZXX A;  5KJ7 A;  3L73 D;  1RF0 C;  2QM7 A;  1NU1 E;  1R5S A;  1GL2 C;  3D6Z A;  1NTM J;  4AQR D;  4RES B;  4U3F E;  3LID A;  2Y0D A;  5AVW B;  1NYH A;  2J59 M;  2FYU J;  1OFC X;  1PGO A;  1FDO A;  1USE A;  5AW7 B;  1BE3 D;  4CPG A;  2DW3 A;  3MP7 B;  2QVA A;  3H1K E;  4JBZ A;  2KP8 A;  1HGZ A;  4XE5 B;  4IL6 E;  3G71 P;  2E76 B;  4BRY B;  3GHG B;  3BVH A;  1SQX D;  1JNM A;  1FS0 E;  2VRS A;  3JSV C;  2OAR A;  3CX5 E;  3IR9 A;  1OW6 A;  1KIL A;  1X9V A;  1YBK A;  5CMZ A;  1RF0 A;  1M8O B;  3H1I G;  2FFD B;  3W67 A;  2FY8 A;  4M3L A;  1KB9 H;  1K8A Q;  3HE5 B;  3AE6 C;  3L70 D;  3MTU E;  4WY4 B;  1AVO A;  2WWW A;  1ZRT E;  4ASV A;  3TNU A;  1LT9 B;  4IFF A;  4JQ0 D;  5KAI H;  1KQF B;  3P8M C;  2OYH C;  1U7J A;  3L72 E;  1T8Z A;  1FOS F;  1RH5 B;  2P7J A;  2H89 C;  3CI9 A;  1PGQ A;  3AE4 C;  2FYN C;  2NPS D;  3PRJ A;  3S9O A;  5KLV K;  1H0T A;  1NU1 G;  1AVY A;  1N8R Q;  1IFD A;  4GOF A;  1ZP0 C;  3B5N A;  1OW8 A;  4U3F G;  2D2C D;  2C0X A;  1KYO H;  2R32 A;  1ZR4 A;  4N78 D;  3HD7 A;  3N4X A;  1JTH A;  1URQ A;  1YJ9 P;  2V7Q J;  2JJL A;  3Q2Y A;  3N7N A;  2KS1 A;  5B5E H;  4PD4 D;  1PP9 J;  3HE4 A;  3GG2 A;  1SQV K;  3L74 J;  1YHQ P;  1OW7 A;  1BGY J;  3PH0 A;  2E76 C;  4RO0 A;  2XV5 A;  3MUD C;  3GHG C;  3CC4 P;  1SQP J;  2R3C A;  1L0L K;  3H1I D;  1FJP A;  5DJU B;  2ZVN B;  2LR2 A;  2JEE A;  1KTM A;  1GTW A;  3KQG A;  2LXB A;  3A0H H;  2M0B A;  1R8E A;  1VQO P;  4PV1 D;  5KTB A;  2FFD C;  1SQQ G;  1KZU B;  1NTZ J;  2A45 H;  2Q6Q A;  1EDI A;  1Q82 Q;  4WY4 C;  5K5G B;  3TF5 A;  3GMA A;  3AEA C;  1LT9 C;  5KKZ B;  4R4M A;  2ZXE B;  3A2A A;  1K9M Q;  1DEB A;  4W7Z A;  1H8A A;  2MKV A;  4W80 A;  1VPC A;  1NU1 D;  5AVZ B;  2B87 A;  3L72 G;  2IBZ E;  5CJ4 A;  1S1C X;  4H0L B;  5DJT B;  3HRN A;  2KZI A;  1LGH B;  4U3F D;  2E75 B;  5GTI H;  1RF1 A;  1H89 A;  1S9K E;  1OVV A;  1Q90 D;  2IFN A;  3H1K D;  2OTK E;  1P84 H;  3O6Q A;  5AVS B;  1KFM A;  3H1L G;  2B9B A;  3GW6 A;  2KIK A;  1G1I A;  5KLV E;  4L76 A;  1OWA A;  2QM8 A;  1NKZ B;  2KLU A;  2D2C C;  5CCG D;  1L0N J;  2JR8 A;  2KSJ A;  3L71 J;  3TGU J;  2RMZ A;  3V2P A;  1HVV A;  3CX5 D;  1SQB E;  2POH A;  3LIE A;  1IFM A;  3OJA B;  2N1T D;  2K37 A;  2HOD B;  2PFX A;  1SQV E;  3RK3 B;  1RE4 A;  2RH0 A;  1T3J A;  1FZA A;  1S2E A;  2I1J A;  3L35 A;  1ZLL A;  1L0L E;  1ZRT D;  1EXJ A;  1LTI C;  1HF9 A;  3Q1M A;  1KB9 E;  2IPP A;  2L5G B;  1N73 B;  1RE3 C;  1S5L H;  2I1K A;  2QJK B;  2IYP A;  2M5A A;  3L72 D;  3OW2 O;  3EQ2 A;  1W5C E;  1DD3 A;  5KAI E;  5KKZ C;  3M91 A;  1FBM A;  3CWB J;  2CK3 H;  2WVR A;  3CXH I;  4B86 A;  3E1I A;  2XND H;  5CCH D;  3AE3 C;  5CJ0 A;  4H0L C;  2IBZ G;  1W2B O;  1YQ3 C;  3BCC J;  2QE7 H;  1KQL A;  2H8P D;  1LP1 A;  3AEG C;  2E75 C;  2FYU G;  5AW5 B;  3VMZ A;  2Y0C A;  5AW1 B;  3KYQ A;  1FDI A;  1BCC J;  5E79 H;  1BGY E;  1WMK A;  2ZFC A;  1LWU A;  1KYO E;  1NU1 K;  2ZYG A;  1MV8 A;  1SQP E;  4H13 B;  5AW6 B;  4Y99 B;  5CBO A;  1RE3 A;  4LGD E;  1GL2 D;  1VQ8 P;  5KLV G;  1Q86 Q;  1KIL B;  3CCU P;  3SFE C;  5APS A;  5B5E E;  2JWD A;  4I6M C;  4I2L C;  2HFE D;  2E42 A;  2P2U A;  1RQV A;  1FC2 C;  1SQB G;  1UII A;  3TYY A;  1ZV8 A;  2WSC J;  3TNU B;  3RK3 C;  3JC2 2;  3OAK A;  1KFN A;  1SQV G;  2W27 A;  3ZDM A;  1OXZ A;  3V2Q A;  2YIU B;  1LT1 A;  1JY2 N;  1KV4 A;  2FYZ A;  3BAT A;  3FWN A;  1N73 C;  1VQ4 P;  2QJK C;  1LNQ A;  1SQQ K;  1AFO A;  5L8R J;  1WT6 A;  1KMI Z;  5KJ7 C;  3B5N D;  2R5D A;  2IBZ D;  2KYV A;  1YIJ P;  1H0T B;  2YMY A;  5BVZ A;  4ZMD A;  1OZH A;  3HD7 D;  3B5N B;  2K3R A;  2WSE J;  1U57 A;  4LLH A;  1YTZ I;  3RGU A;  1GK6 A;  2QJP B;  1OX3 A;  3HTK A;  1JTH B;  1URQ B;  5GTI E;  1DD4 A;  4BXL A;  2KS1 B;  4C7R A;  3A7O A;  1JUN A;  1M7L A;  5KLV D;  2JDI H;  3VTP C;  1EQ7 A;  1NHL A;  3TGU E;  1P84 E;  1BGY G;  3L75 E;  1LTA C;  3KPE A;  3AE2 C;  4H13 C;  1FJK A;  1SQB D;  1SQP G;  5GTH H;  4Y99 C;  1KIL C;  1EDK A;  2BCC E;  2WIT A;  2E5Y A;  1SQV D;  4D6T J;  3H1J J;  1OIP A;  3II6 A;  1L0L D;  2WZ7 A;  1HUC A;  1R5L A;  3CMA P;  3GF7 A;  1ZME C;  1X0T A;  1JEK A;  1VQ9 P;  1KB9 D;  3CLQ A;  4DOJ A;  2E76 D;  2SPZ A;  5AVX B;  2M3E A;  1NTK E;  2YIU C;  1TU3 F;  1ZW0 A;  4PD4 I;  3VP9 A;  3CWB E;  1CSB A;  5KAF H;  2B87 B;  3VMX A;  1J1E B;  3Q3D A;  2JP3 A;  2A45 G;  2Q7C A;  1YJW P;  1S5L E;  2HG5 D;  1SLQ A;  2W8Z A;  1PIX A;  3PHL A;  1KQG B;  1RF1 B;  1FAV A;  2WPS A;  3BCC E;  1DX7 A;  2RN0 A;  3GF3 A;  3RK3 E;  1SS1 A;  3B5N C;  1SQQ E;  3O6Q B;  4WY4 D;  3ITK A;  2QJP C;  2FBW C;  1HGV A;  3HD7 C;  1HWT C;  3AE8 C;  1URQ C;  1Q81 Q;  1NTM K;  1KYO D;  3H1H J;  4JYB A;  3H6P A;  5B66 H;  2O01 H;  1VQM P;  1GD2 E;  3PTZ A;  2K1A A;  2KI7 B;  2FYU K;  3L73 J;  3T97 B;  1RHZ B;  1Z56 A;  2O01 N;  2OQQ A;  5E79 E;  1L0N G;  2H43 A;  3KZI H;  1L4A B;  3M0D A;  3TGU G;  2FXO A;  2P10 A;  3L75 G;  1NJI Q;  2O01 J;  3CC2 P;  2FKW B;  1T2K C;  2PRR A;  1BE3 J;  2XKM A;  2YKQ A;  2BCC G;  1K73 Q;  1IFN A;  2V7Q H;  2G8Y A;  1IK9 A;  4NPD A;  1Y8A A;  1IZN B;  2M5A B;  3H1L E;  3CME P;  1J1D B;  1JMM A;  2RKL A;  3L4F A;  5M1B A;  1FZB A;  1SQB K;  1SQX J;  1BDC A;  2HR3 A;  1AA0 A;  3V2N A;  1LTG C;  1BSH A;  1NAY A;  1KIL E;  2QA4 P;  1T3U A;  3RL0 B;  1NTK G;  3G6E P;  4DCK A;  2AXC A;  3CWB G;  2YXQ B;  3CX5 I;  1J1E C;  4L74 A;  1EZV E;  3AEF C;  3RBZ A;  1LP1 B;  4UB8 H;  2YMK A;  1RF1 C;  3AE9 C;  3RL0 g;  1X79 B;  1YQ4 C;  3BCC G;  4IL6 X;  3L70 J;  3RK2 B;  3BAS A;  1S5L X;  4H44 B;  4RJT A;  1LWU B;  1YYC A;  1DEE G;  2QSI A;  1NVO A;  2GUS A;  3G4S P;  3VOP A;  1FZG A;  1HH0 A;  1DIP A;  3AEB C;  3L75 D;  4GIF A;  1JB0 J;  4H0L D;  1L4A C;  2BCC D;  3AE7 C;  2E75 D;  4L75 A;  1NTM E;  1N7L A;  5GTH E;  1RE4 C;  2FYU E;  1NOH A;  2GA1 A;  2OYI B;  1SQP K;  1AJY A;  1FOS E;  1S4X A;  2OGU A;  2C0W A;  4ZKU A;  5BU8 B;  4GKG A;  2XZR A;  1UIX A;  4I1L A;  1NTK D;  1FZE A;  2K88 A;  2A06 E;  1J1D C;  3Q5P A;  1ZXG A;  3WUT A;  1PZQ A;  3H1I J;  1LTS C;  4OGQ B;  3WUV A;  3PP5 A;  1NTZ K;  4WB4 A;  3EFG A;  1VQ6 P;  2C9N Y;  2Z5I A;  3RL0 C;  3C1L A;  5KAF E;  3UIA A;  2IDB A;  2KOG A;  3RK3 D;  3T97 A;  3LW5 J;  2ZT9 D;  3HTK B;  1L4A A;  1EZV G;  1IJD B;  1SQQ D;  1S3J A;  4GOD A;  1M1J A;  2ITA A;  3S1K A;  3U1A A;  3TDK A;  2ZT9 B;  2W6A A;  1MUU A;  1USD A;  3RK2 C;  2P1J A;  2ZJS E;  2ZYA A;  3CCJ P;  4IFM A;  4H44 C;  1S72 P;  1LWU C;  1GW3 A;  2HYN A;  2M8R A;  5KJ7 D;  4C7N A;  1SFC B;  3B4S A;  3CCL P;  3C9I A;  2WPR A;  1NU1 J;  2J58 A;  2PAJ A;  4HJG H;  4IOI H;  1FZC A;  1EC5 A;  3CC7 P;  5B66 E;  2BEQ D;  3A3Y B;  1AV1 A;  4U3F J;  2IBZ I;  1VF5 B;  4KT0 J;  5TIS H;  3CD6 P;  1L2P A;  1VQK P;  3KZI E;  2JO1 A;  3MHV A;  3H1J G;  3S4R A;  1NTM G;  3NMD A;  3AED C;  3PJS K;  5APX A;  3H1K J;  1L0N K;  1N2D C;  2WQY C;  3F89 A;  3USS A;  4WBA A;  4KHX A;  1PPJ E;  3K5B A;  3H1L D;  3P8C E;  2OYI C;  2E74 B;  1NH4 A;  1MKM A;  2O3J A;  1M56 D;  4H13 D;  2L91 A;  1PP9 E;  3L74 E;  1KIL D;  5KLI B;  5AW8 B;  1JO5 A;  4K3A A;  2OYO A;  5AW4 B;  2A06 G;  2QIW A;  1EZV D;  1T6A A;  4OGQ C;  2WSC H;  3VYI A;  4EDF A;  3TK1 A;  1GMJ A;  3L70 E;  1X22 A;  4ZKP A;  3SFD C;  1A02 J;  4ASW A;  1NTK K;  2IZ0 A;  4Z1M H;  2XDJ A;  3G9R A;  4UB8 E;  1M1K Q;  1NTZ E;  2AXT H;  5AW0 B;  2PGD A;  3SSU A;  2KSE A;  2ZT9 C;  2Q5U A;  1KB9 I;  3L72 J;  3VP8 A;  1G2C A;  2FXM A;  2GUV A;  3V6I A;  3H1H G;  2AEM A;  2WPQ A;  2OYI A;  2Q1K A;  4GDO A;  1HJB A;  2KNC A;  3VN0 A;  3RBX A;  5BU5 A;  2JKV A;  1Q2N A;  1VQN P;  2WSE H;  1CZQ A;  3WU2 H;  1NGM B;  1KN7 A;  1PV3 A;  3U59 A;  3JCU H;  1NTM D;  4UB6 H;  1LTJ A;  2QG4 A;  1VF5 C;  2B89 A;  2KB7 P;  2V4H A;  3M9Q A;  2FYU D;  3M0A A;  1NKN A;  1J2J B;  4EIJ A;  5APU A;  1URQ D;  1JY3 P;  2PP6 A;  2YKO A;  4I7Z B;  4OVN F;  2YNY A;  3E1R A;  1S9K D;  2C9L Y;  5AW9 B;  4OWF A;  4LC1 A;  2KZJ A;  1KYO I;  2A06 D;  1YI2 P;  1PPJ G;  1PFI A;  2LKM A;  4WWI A;  1JM0 A;  4RKU J;  2WSF J;  1YJN P;  1L0N E;  3ABV C;  2E5T A;  3L71 E;  1PP9 G;  5CCG A;  1T2K D;  3L74 G;  5KLI C;  3V2R A;  3U1C A;  3A0B H;  1SFC A;  2AEF A;  3FWL A;  2UWJ E;  5APY A;  2BEZ F;  2YO3 A;  3L70 G;  1CW5 A;  2G3A A;  5C39 A;  3QWO C;  2IX7 C;  1H88 A;  3CXH H;  1NTZ G;  1OVU A;  4EOT A;  2A45 I;  1VDF A;  3WMM 0;  4O9B A;  1FU1 A; 
#chains in the Genus database with same CATH homology
 1WMK A;  4U7J A;  3AE6 C;  3AEC C;  2J5U A;  2WQY C;  1UIX A;  1ZRT E;  3D71 A;  1ZOY C;  3GF3 A;  3R4Y A;  3RK3 E;  1DD4 A;  1VF5 C;  4H13 B;  1R8E A;  3Q5P A;  1KQF B;  4PV1 D;  3AEF C;  1K04 A;  2E74 B;  2WPV B;  3B71 A;  3SFE C;  1MKM A;  2YMK A;  1KTM A;  4OGQ B;  4YTP C;  3IAO A;  2QJP C;  2FBW C;  4H13 D;  4I7Z B;  4YXD C;  2FXP A;  3D6Y A;  3AE9 C;  4PV1 C;  3D6Z A;  3RL0 g;  1YQ4 C;  4IL6 X;  2H89 C;  3AE8 C;  3Q5S A;  2E74 D;  1EXI A;  1RQV A;  3AE2 C;  3GMA A;  4OGQ D;  3AEA C;  1S5L X;  4H13 C;  1NYH A;  2IDB A;  1EXJ A;  4H44 B;  4R4M A;  3LW5 J;  2QIW A;  2ZT9 D;  3AE4 C;  2FYN C;  1HF9 A;  1FDO A;  3Q1M A;  4RKU J;  2QSI A;  3EWK A;  2WSC J;  4OGQ C;  2WSF J;  3T97 B;  3S9O A;  1HJ0 A;  2OQQ A;  2D2C B;  4I7Z C;  3Q5R A;  4H44 D;  3ABV C;  2MKV A;  1GMJ A;  2ZT9 B;  2NZ2 A;  3SFD C;  1DIP A;  1S1C X;  5KLI C;  1ZP0 C;  4H0L B;  2P10 A;  3AEB C;  1OW8 A;  1DD3 A;  5KKZ C;  4Y28 J;  4H44 C;  2D2C D;  2K9Y A;  1JB0 J;  2O01 J;  2E76 B;  1KOR A;  2E75 B;  4Z1M H;  1K05 A;  1IK7 A;  3G9R A;  3GF7 A;  3D70 A;  1ZME C;  2E74 C;  4H0L D;  4TT3 H;  2BEZ F;  1RQU A;  3H25 A;  2V7Q J;  2QJK C;  2E76 D;  3Q2Y A;  3AE7 C;  2E75 D;  2ZT9 C;  5L8R J;  1KMI Z;  1Q90 D;  2G8Y A;  3AE3 C;  2G3A A;  4H0L C;  1OMI A;  2YIU C;  1TU3 F;  1OW7 A;  1OW6 A;  1YQ3 C;  2BEQ D;  3AEE C;  3AE5 C;  3O6Q A;  2E76 C;  4GDO A;  3AEG C;  2E75 C;  3AE1 C;  1VF5 B;  3Q3D A;  2JP3 A;  4KT0 J;  5M1B A;  1VL2 A;  2QJY C;  1Y9B A;  2JO1 A;  2WSE J;  1U57 A;  1PL5 A;  1AJY A;  3AED C;  2D2C C;  3GLM A;  3IN6 A;  2H88 C;  1PIX A;  4R4L A;  1FDI A;  1NGM B;  3FGA D;  4XFJ A;  1KQG B;  1VF5 D;  3C8V A;  4PV1 B;  1PV3 A;  1KIL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...