2LKMA

Structural basis for molecular interactions involving mrg domains: implications in chromatin biology
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
42
structure length
42
Chain Sequence
DYVQPQLRRPFELLIAAAMERNPTQFQLPNELTCTTALPGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords PHD finger protein 12
publication title Structural basis for molecular interactions involving MRG domains: implications in chromatin biology.
pubmed doi rcsb
source organism Homo sapiens
total genus 5
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2011-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16737 PHF12_MRG_bd PHD finger protein 12 MRG binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2lkmA01
1NTZK 1L0LK 3LW5H 2OARA 2LKMA 1SQXK 3M9QA 4IFDK 3G3ZA 1NU1K 1NTMK 1SQPK 1SQBK 5KLVK 2O01H 2WSEH 1SQVK 1SQQK 3CLQA 1L0NK 2J59M 2WSFH 1NTKK 2FYUK 2WSCH
chains in the Genus database with same CATH superfamily
2E5TA 3CX5H 1Q2NA 2WTYA 2PFXA 2WSCJ 5GTHE 1SQVG 2ZXXA 1KILC 3AE8C 1JB0J 1E5WA 2GM4A 4ASVA 2V7QJ 1QGKB 2QM8A 1R5LA 5CJ0A 4QMAA 3B5NB 3SWFA 4AQRD 1KFNA 4C7NB 1URQB 4WY4D 2JR8A 2D2CB 3A7OA 4GOEA 1CI6B 3SWYA 3NXSA 1PPJE 2J58A 4H0LC 3TGUG 3W67A 1S9KE 1LTJA 1OFCX 3QWOC 1M1JC 1U7MA 3AEAC 2BCCG 3VMYA 2W6BA 1PP9E 2ZT9C 1LT9C 2GUVA 2YO3A 2KSJA 5CBNA 1SQPK 3Q5PA 1KB9H 3RL0D 2N1TB 3H32A 2AEJA 2K9JA 5BU8B 2XZRA 1BSHA 2FBWC 1OW8A 3CXHH 4CPGA 4JYBA 3AE3C 4RKUJ 2IZ0A 2B87B 2ZVNB 2QJKB 1NTZD 2AEFA 1ZMEC 1NTZE 1SFCA 1JMBA 1NTKJ 1LWUB 1S5LE 2H8PD 1J1EB 1IZNB 1VQ9P 4O9BA 3AE6C 1PZQA 1IO4A 1MV8A 5L8RJ 1D7MA 2Y0DA 4DOJA 1VF5C 1M57D 3B5ND 1RF0C 5KJ7A 1FC2C 4TT3H 2C9NY 2Y0EA 2P10A 1GL2D 1OVUA 3OA7A 1U57A 2QJPC 1SQPG 1G1IA 1N73B 1FDIA 1J1DB 3MD0A 3CMEP 2K88A 1N7SA 1AFOA 3NTNA 3H1JD 2FFDC 4L74A 3H1JE 5B66H 5AW0B 2N1TD 1SQQJ 3O6QB 2E74B 1FDOA 1IFMA 1J2JB 3CC4P 1KD1Q 5AVYB 1NGMB 1BCCD 3G6EP 2OYIC 3L74J 1BCCE 2KS1A 4Y28J 2KIKA 2OARA 2DW3A 2WQYC 3KZIE 2NPSB 2H7HA 2FKWB 1T3UA 1FZCB 4EI2A 4IL6E 1ZRTE 1NO4A 3HD7C 5AW3B 5KLVD 3MUDC 3A0HH 1KILB 1HUCA 3CCVP 2JWDA 2M5AB 3KPEA 1BSNA 3VP9A 3HE5A 3FX0A 1FZFA 1FU1A 3GW6A 2Z4EA 3WUTA 1PPJG 1KV4A 3WMM0 1RF1A 1SQBD 1X8YA 1NAYA 3SFDC 4U3FJ 2IX7C 3W68A 2E76D 2HLOA 2WSFJ 2Y9YA 3A0BH 1PP9G 3UIAA 5CHXA 1CW5A 3A2AA 1PFIA 3Q5RA 1Y47A 3BCCD 2QVAA 1IJDB 2QEXP 3RK3D 1JTHB 1M1JB 1KQSO 4DT0A 2ZT9B 3ZDMA 3PHLA 1GDTA 1LP1B 1LT9B 2ZXEB 1HVVA 1JO5A 2G8YA 3RBXA 2KYVA 2FXPA 3SSUA 4BRYB 2E74D 1KC8Q 5TISH 2PRRA 1NTZG 2RN0A 1NTMD 1KQGB 3FWLA 1NKNA 1P84D 1NTME 5KAFE 1P84E 1NYHA 3MP7B 1L0ND 5E79E 1L0NE 2NPSD 1X0TA 1YTZI 4L76A 3P7KA 1EZVE 5APWA 3HRNA 5EFWB 5M1BA 1XTCC 1KILE 1W2BO 3CXHI 4YXDC 1VF5B 5APYA 1HF9A 3L4FA 1ZR2A 3AE9C 2QJPB 2N9YB 4BWNA 1IC2A 3CWBJ 2FYUD 3H1JG 3OJAB 1YJWP 3LW5J 1KYOE 3CCQP 3S9OA 2L5GB 3CCJP 3GHGA 2FFDB 2JEEA 1FDMA 1DIPA 1K73Q 1BCCG 1M90Q 3B5NC 1ZOYC 1HGZA 1GL2C 3P8CD 1YJNP 2AEMA 2IDBA 3VOPA 4GIFA 2E43A 1BGYE 3H1HD 2E75D 5KLVG 2O1JA 3TGUE 3HD7B 3AE5C 3CL3D 3CLQA 3Q2YA 3FXDA 5AVSB 3PTZA 2KK7A 2WSSH 1JNMA 5AW7B 3C8VA 2YMKA 3A5TA 4LLHA 1BE3J 2CK3H 1QVFO 3CC7P 2XNXA 2A45H 1EDJA 1MFZA 4JF7A 4OH8B 1IFIA 4AUWA 2QJKC 3BCCG 1JCDA 1NU1E 1LTTC 4UB6E 2IBZD 3L72E 1LWUC 2Q1KA 1J1EC 3TK1A 2J5UA 3TYYA 2AXTE 3H1LJ 4C7RA 2I8DA 5KTBA 1N7SB 3I5CA 2QE7H 3KHUA 2KUBA 3H25A 3V2RA 3CX5D 1EXIA 4WVZA 1NTMG 4DJGA 1VQLP 2RMZA 4PD4I 1JY3N 1L0NG 1USEA 3L37A 1HWTC 3H1IJ 2E76C 5AVQB 4C46A 3A3YB 1BDCA 1EZVG 2LR2A 2CPSA 2PAJA 2Q5UA 3SFEC 4YTPC 1SFCD 2JKVA 1RE4A 3RK3C 1GTWA 2HODA 5CJ4A 1SQVJ 2KLUA 4JYCA 2HG5D 4AYCA 2O01N 4HKZH 2E74C 2WSCH 2M3BA 2IPPA 2XNDH 2WPVB 1EQ7A 2WWWA 1SVFA 3PRJA 2LKMA 1JY2O 3HE5B 5KJ7D 1NTKD 3H1KJ 4LC1A 3V6IA 1DEBA 1KB9E 2O1KA 2ZJSE 2R44A 2FYUG 2HPCA 3TGUJ 4OVNF 4I7ZB 2O01J 1Q7YQ 2ZYGA 2Z5HA 1FZCC 1KTMA 2BCCJ 1RE3A 2IYOA 3CXHD 1UIIA 4JQ0D 2ZFCA 3RK2D 1N7SD 1NU1K 3L71D 3N7NA 3L71E 2POHA 2CPBA 1LNQA 3CC2P 3IN6A 3KXDA 2QG4A 1FE6A 3M91A 2HYNA 4PJ0H 2H89C 2LXBA 1VPCA 3KDPB 2I1JA 5B5EH 1GL2B 2M0BA 2Q7CA 1BGYG 5KLIB 3PH0A 3L75D 4L75A 3L75E 5APVA 2WITA 1IFJA 3ITKA 2OYHC 3FWNA 3T97B 1SQQD 3HUSC 1GW3A 1G2CA 1GW4A 1PV3A 3AEGC 4IFDK 2KB7P 1MFTA 1JM0A 3L74D 3TNUA 1LT1A 1VQ7P 4JPZB 1A02F 3GG2A 2KSEA 3M0DA 1AA0A 1NU1G 4Z1MH 1SQPJ 3L72G 1HBWA 2IBZG 5B66E 3TF5A 3MIWA 3E1RA 2E75C 2ZYDA 3RBZA 3SWKA 5KAIH 4EDFA 2R5DA 3D6ZA 2E42A 1HH0A 4R4LA 2R5BA 5GTHH 2BEZF 1RQVA 5APXA 3GHGB 2A45I 2W8ZA 1CSBA 4U3FD 1ZN5A 2WMMA 3IAOA 3M9BA 1VQOP 1FJPA 2E76B 2KZIA 3MGNA 4YPCA 1EDLA 3L73D 3L73E 3RK3B 4XFJA 1LTJC 2M3EA 2YKPA 1LTGC 2YXQB 5DJTB 1PGPA 3EWKA 3A0BE 1S72P 2FY8A 3D71A 3WU2H 4ASWA 1N86A 3GLMA 4GKGA 1FOSE 4N6JA 2WPQA 1LTIC 4DZOA 1OIPA 5AVVB 1VL2A 3M9QA 2KLVA 1PP9J 4EIJA 2V4HA 4WY4A 1IFNA 4NPDA 4OGQC 2W27A 1SFCC 1L0LD 5TISE 2O3JA 3L71G 1L0LE 3VN0A 4K3AA 5GTIH 2WSFH 3HTKA 1NTZK 1T6AA 5KLVE 1H8AA 4H13C 2YKOA 4TLFA 3HE4A 3G9RA 3PJSK 1S5LX 1JY3P 1WT6A 5AVUB 1K05A 2FXMA 1LTSC 1NTZJ 3L75G 1ZXGA 1KQLA 1L4AA 3EFFK 3CWBD 5KJ7C 2KZJA 1FS0E 1SQBE 2QSIA 4B86A 1DX7A 3AEEC 4PD4H 1KZUB 1M8OB 1TU3F 3VTPC 2OYHB 1Q86Q 2KNCA 3BCCE 5AW9B 3RK2C 3RK3E 4EYYQ 3HUSB 4L73A 1N7SC 1OVVA 2HODB 2KI7B 3AECC 3Q3DA 4I1LA 2N9BA 4UB8E 1XTGB 2IZ1A 4H44D 1QEXA 1H0TA 1NH4A 2SPZA 3JCUH 3I56P 1YBKA 2ITAA 3KZIH 1URQA 1VQ5P 3H1JJ 2WT7B 2E75B 1CI6A 2W83C 1SQXD 4NPEA 3KQGA 1MZ9A 1KQFB 1SQXE 2XU6A 1BE3D 1A02J 4WB4A 1L0LK 3LW5H 1OW7A 1BCCJ 1NOHA 5KLVK 4Y99C 2WPRA 2N1TA 1JEKA 2LXCB 2XV5A 1RF1C 3L73G 3H1LD 3ABVC 1JY2P 4I7ZC 4N78D 2UWJE 1GMJA 1IK7A 2YXRB 2ZYAA 1RQUA 1SQBK 3GMAA 2FYUE 1HJ0A 3B71A 2B87A 1YIJP 1LTJB 5AW5B 1G2CB 2WSEJ 1VDFA 2P7JA 3II6A 4R4MA 1YQ4C 2QRXA 3TNUB 3H32B 4D6TD 2K9JB 4D6TE 4ZMDA 4DCKA 3P8CE 5KLIC 2QA4P 1L0LG 1YJ9P 1SQVD 4W80A 5CCGA 4OGQB 3L70D 1SFCB 3H1HE 1GK6A 1NTMK 1KFMA 3G4SP 2GA1A 1QVGO 5CCHA 1L0NK 1W2EA 5AVZB 1NHLA 4RO0A 3S1KA 1LJ2A 4H13B 3AE2C 3H1KD 2OTLP 3V2QA 3P32A 1KMIZ 1NTMJ 3CWBG 1SQXK 1SQBG 1L0NJ 1VQ4P 1PGQA 5AW6B 3D6YA 3O6QA 2W90A 5K5GB 3CCSP 2Y9ZA 2OTKE 2L91A 3BVHA 2IBZE 5CBOA 4K35A 4MN4C 2P67A 1SS1A 3RK2B 1AQTA 2NPSA 1H88A 1GU5A 4U7JA 1PGOA 2IFMA 5APTA 3AE4C 2RH0A 2QM7A 3GHGC 2FYUK 1QX8A 4WBAA 1YI2P 2NRGA 1PGJA 3M0AA 3CX5E 1KILA 3M06A 2A06D 2M5AA 3CCRP 4GDOA 2VRSA 1N2DC 3TDKA 2FYUJ 2KS1B 5AW4B 4PJ0E 1YTZT 1AV1A 3CCLP 3F89A 1SQXG 4OGQD 3AEDC 3GF3A 3MZWB 2GUSA 1USDA 2KP8A 4JBZA 1IFDA 1G1JA 2O01H 1X9VA 1GK4A 1T3JA 3HTKB 4H13D 4BXLA 4RJTA 2I1KA 1SQPD 2IFNA 1JTHA 1M1JA 1X22A 3HE4B 4H44C 4PV1D 1S1CX 1LT9A 2YMYA 4Y99B 1M1KQ 1FZEA 1BGYJ 1SP4A 4BRYA 1NTKE 1YYCA 1RF1B 5C39A 4UB6H 1VQNP 3V5BA 3E7KA 3CXHE 2KNCB 1NJIQ 3BRVB 1BDDA 4RESB 3CCUP 5AW8B 2ZVOB 4YXWH 1FAVA 1Q90D 4D6TG 1NKZB 2FYZA 4KHXA 5H2FH 1QLED 3O8ZA 4XE5B 2XKMA 1FBMA 1NU1J 1H0TB 3L72J 3V4QA 4W7YA 1SLQA 2Y0CA 3VMAA 5BVZA 1DD4A 3H1HG 3L70G 1WMKA 3CMAP 1RF0A 3QH9A 1FZAA 3V2PA 3JC22 1AVYA 1S4XA 3U1CA 1JY2N 4I2LC 1Y9BA 1RE4C 1SQQE 3H1KG 3PLNA 1PPJD 4N3YB 2C0XA 4NPFX 1ZLLA 1S9KD 3L74E 1H89A 2FYNC 2YNYA 1P84I 2K3RA 1PP9D 2JP3A 2FFDA 1FOSF 1IFPA 1M56D 5AW2B 1JOCA 3TSIA 4ZNCA 3CPWO 2C9LY 1L4AD 1EZVI 2H43A 1EDIA 3S4RA 1ZV8A 4IFFA 1M7LA 2OYIA 3WU2E 1NTKK 2B9BA 1ZP0C 1DD3A 3AE1C 1RE3C 1X79B 3V2NA 3B8EB 4WWIA 2A06G 4U3FE 3HD7A 1T8ZA 3CI9A 1YQ3C 4HJGH 2AXCA 2R32A 5GTIE 3MUDA 3L35A 4W7ZA 1YITP 4A7PA 2QJYC 3A0HE 1CZQA 1KYOI 2C0WA 1FZBA 2OYOA 5APQA 3L71J 1K04A 3WUVA 1AQ5A 1URQD 3VMXA 2D2CD 3LIDA 1GD2E 4PD4D 4PD4E 1AJYA 1T2KD 1N8RQ 1NVOA 1E79H 1W5CE 2BASA 1SQQK 1NAFA 1DH3A 1NTKG 4H44B 2Q6QA 3L75J 1EC5A 5AVRB 5KKZC 2R3CA 3M0DC 2QIWA 1MKMA 1RHZB 1S5LH 3JCUE 1IK9A 3I55P 1RY3A 2JJLA 3IFMA 4OWFA 1OXZA 4PV1C 2E5YA 4I6MC 1ZRTD 1UIXA 1KN7A 4HYTB 1EXJA 2PP6A 2P1JA 2IBZI 3CWBE 1N7LA 2KXPB 3L36A 1SQQG 1R5SA 5CCGD 1VQMP 1QL1A 2FXOA 3L74G 3MHVA 3Q5SA 3P8MC 3CX5I 3KYQA 5CCHD 1QL2A 4HH2A 2K1AA 4H0LB 1Y8AA 2PGDA 3MTUE 2FYNB 2JWAA 1GZLA 4EOTA 3K5BA 5AVWB 5DJUB 2W6JH 2HR3A 3L73J 1OWAA 2MKVA 3B5NA 5CMZA 2YO2A 2Q9IA 4C7NA 1GL2A 2HPCB 1OW6A 4WY4C 3JSVC 1VQ8P 4IL6H 2XDJA 2OTJP 3OAKA 1L2PA 1OZHA 4GOFA 2H88C 4GT1A 4U3FG 1RH5B 3NMDA 4LGDE 1BE3E 3T97A 2JDIH 4IL6X 1EZVD 1Q81Q 1KB9I 2MJZA 2WSEH 3IF4A 2WVRA 4IOIH 4XA4A 1KILD 1L4AC 1L0LJ 2QJYB 3RL0C 1AVOA 2B89A 1S3JA 3USSA 2YIUC 3H1LE 1ZW0A 3FXEA 1OX3A 4N78E 5KLVJ 3RGUA 1PIXA 1GU4A 2WPSA 3VYIA 4KT0J 5AVXB 3RL0g 1KORA 2NZ2A 1HGVA 1Z56A 1OVRA 4ZKPA 1VQ6P 2RKLA 2YKQA 4UB8H 1LWUA 3R2PA 4H0LD 3CD6P 1SQBJ 3H1ID 1JCCA 1KYOD 3H1IE 1LTAC 5BU5A 2ZT9D 4IFMA 5KKZB 4M3LA 5KAFH 1P84H 3BCCJ 3IR9A 5E79H 1SQVE 2K37A 5AVTB 2OGUA 3G3ZA 1URQC 3VP8A 2KOGA 3L70E 2D2CC 2OYIB 1LGHB 1Q82Q 1K9MQ 1N73A 2OQQA 3GF7A 3M9HA 5APSA 1T2KC 2P2UA 1BGYD 3H6PA 2Q3EA 3H1KE 4PV1B 3OW2O 1S2EA 3TGUD 1JY3O 3C9IA 1FZGA 3AEFC 2J59M 2BCCD 2Q3IA 2BCCE 2N1TC 3G71P 1SQXJ 1VF5D 1PL5A 3U59A 2WZ7A 1U7JA 3FGAD 1VQPP 1KYOH 1JUNA 2HFED 3VMZA 1NU1D 3L72D 1FZCA 3BRTB 2R3SA 1WRGA 1K8AQ 1DEEG 2K9YA 4KJMA 3AE7C 1VQKP 3LIEA 1EDKA 3E1IA 2A06E 2JO1A 1R8EA 3N4XA 2Z5IA 2M8RA 3WUUA 5H2FE 3EFGA 5CCGC 3F5HA 2B88A 2W6AA 4WY4B 1BE3G 2IYPA 5B5EE 1SQVK 3D70A 5CCHC 2OYHA 1HJBA 1N73C 4D6TJ 3C1LA 3CCMP 1HTLC 1J1DC 5AW1B 1SQPE 3HUSA 3NFQA 4ZKUA 1LP1A 2P58A 3HD7D 2G3AA 3H1LG 2ZAEB 1OMIA 4HB1A 1ZR4A 3H1HJ 1MUUA 1YHQP 3L70J 1L4AB 1JMMA 3RL0B 3BASA 5APUA 2A45G 2YIUB 2BEQD 1LTBC 3EQ2A 3CCEP 3R4YA 4GODA 3U1AA 3V4WA 2V7QH 1FJKA 2AXTH 5TJHA 1NWQA 1KB9D 3Q1MA 3H1IG 2WT7A 2NPSC 3AEBC 3BATA 3B4SA 3PP5A 5KAIE
chains in the Genus database with same CATH topology
1JNMA 5AW7B 1GD2E 2WTYA 3A5TA 1URQA 4LLHA 1KILC 2XNXA 2WT7B 2A45H 1T2KD 1MFZA 4JF7A 4OH8B 1CI6A 1IFIA 1E5WA 2GM4A 2BASA 1SQQK 4AUWA 1NAFA 1DH3A 3KQGA 1MZ9A 2QM8A 5CJ0A 1JCDA 2XU6A 3B5NB 3SWFA 1A02J 1LTTC 4AQRD 1KFNA 5AVRB 4C7NB 1URQB 4WB4A 4WY4D 1LWUC 2R3CA 3M0DC 1L0LK 3LW5H 1J1EC 3TK1A 3TYYA 1NOHA 3A7OA 1CI6B 3SWYA 3NXSA 4C7RA 5KLVK 5KTBA 1N7SB 3I5CA 4Y99C 2WPRA 2J58A 2N1TA 1S9KE 1LTJA 1IK9A 2XV5A 1RF1C 1M1JC 3VMYA 1RY3A 2JJLA 2W6BA 3V2RA 3IFMA 1JY2P 4N78D 1LT9C 2GUVA 1JY3N 2YO3A 2KSJA 1SQPK 1SQBK 1OXZA 3L37A 3RL0D 2N1TB 4I6MC 1HWTC 1LTJB 3H32A 5AVQB 4C46A 3A3YB 5AW5B 2CPSA 4HYTB 2PP6A 5BU8B 1G2CB 2XZRA 2PAJA 1VDFA 2P1JA 2Q5UA 2P7JA 1SFCD 1RE4A 3II6A 4JYBA 3RK3C 1GTWA 2HODA 5CJ4A 1N7LA 3TNUB 3L36A 3H32B 4JYCA 1SFCA 5CCGD 2HG5D 3P8CE 4AYCA 1LWUB 2H8PD 1J1EB 1QL1A 2WSCH 2M3BA 2IPPA 4O9BA 4W80A 1EQ7A 3P8MC 2WWWA 5CCGA 3KYQA 1MV8A 1IO4A 5CCHD 1SVFA 1QL2A 2LKMA 1JY2O 4HH2A 3HE5B 1SFCB 5KJ7D 1GK6A 1NTMK 1KFMA 4LC1A 3MTUE 1DEBA 4DOJA 5CCHA 2O1KA 1L0NK 1GZLA 1W2EA 2HPCA 5AVZB 1NHLA 3B5ND 1RF0C 4EOTA 5KJ7A 2C9NY 5AVWB 2Z5HA 1FZCC 1GL2D 3OA7A 1RE3A 3V2QA 1OWAA 3P32A 1SQXK 2ZFCA 3B5NA 5CMZA 1G1IA 3RK2D 2YO2A 2Q9IA 4C7NA 1N7SD 1NU1K 1N73B 3N7NA 1GL2A 2HPCB 5AW6B 4WY4C 2POHA 2CPBA 2XDJA 1J1DB 3MD0A 3OAKA 3M91A 2HYNA 1N7SA 4GT1A 1AFOA 3NMDA 4LGDE 3NTNA 1VPCA 2FFDC 3BVHA 3KDPB 2I1JA 1GL2B 3T97A 5AW0B 2N1TD 2P67A 2Q7CA 3RK2B 2MJZA 2WSEH 5APVA 2NPSA 1IFMA 1J2JB 1H88A 1GU5A 5AVYB 2WITA 1IFJA 2IFMA 4XA4A 5APTA 2OYHC 2QM7A 3GHGC 1KILD 2OYIC 2FYUK 1L4AC 4WBAA 3RL0C 3HUSC 1GW3A 1G2CA 2OARA 3M0AA 1GW4A 4IFDK 1KILA 2KB7P 4N78E 3M06A 2NPSB 1GU4A 2WPSA 2VRSA 2H7HA 2FKWB 1N2DC 1T3UA 3VYIA 1FZCB 3TNUA 5AVXB 1HGVA 1Z56A 1A02F 1NO4A 3HD7C 5AW4B 1YTZT 4ZKPA 5AW3B 2YKQA 1LWUA 3M0DA 1KILB 1HUCA 3R2PA 2GUSA 2KP8A 1HBWA 3KPEA 1JCCA 3VP9A 1IFDA 1G1JA 2O01H 1LTAC 3HE5A 1X9VA 1GK4A 5BU5A 1T3JA 3MIWA 3HTKB 1FZFA 1FU1A 2Z4EA 4IFMA 4M3LA 2I1KA 2IFNA 1JTHA 1M1JA 3WMM0 1RF1A 1X8YA 3HE4B 3IR9A 2R5DA 2E42A 1HH0A 2IX7C 2R5BA 1LT9A 2HLOA 2YMYA 4Y99B 5AVTB 3G3ZA 3VP8A 1URQC 3UIAA 5APXA 5CHXA 1FZEA 1CW5A 3A2AA 2KOGA 1PFIA 1SP4A 1YYCA 3GHGB 2A45I 2OYIB 1IJDB 1LGHB 1CSBA 1ZN5A 3RK3D 1RF1B 1JTHB 1M1JB 1N73A 3M9HA 5APSA 3V5BA 3M9BA 1GDTA 1T2KC 1LT9B 2P2UA 2ZXEB 1HVVA 3H6PA 1JO5A 1FJPA 2KYVA 1JY3O 3BRVB 4RESB 3C9IA 5AW8B 3MGNA 1FZGA 2J59M 1FAVA 2Q3IA 1NKZB 2FYZA 2N1TC 4KHXA 3RK3B 1NKNA 1LTJC 3O8ZA 4XE5B 2XKMA 1FBMA 2YKPA 3U59A 1LTGC 2WZ7A 2NPSD 1YTZI 3V4QA 4W7YA 1SLQA 3P7KA 5BVZA 1JUNA 2HFED 5APWA 1RF0A 3HRNA 3VMZA 1N86A 1XTCC 1FZAA 1FZCA 3V2PA 4GKGA 1FOSE 4N6JA 2WPQA 3BRTB 1LTIC 3U1CA 4DZOA 1WRGA 5AVVB 1JY2N 4I2LC 1RE4C 3M9QA 2KLVA 3LIEA 4EIJA 4WY4A 1IFNA 3E1IA 4N3YB 5APYA 2C0XA 2W27A 1ZLLA 1SFCC 1S9KD 3L4FA 1H89A 1ZR2A 3N4XA 2Z5IA 3VN0A 2WSFH 2YNYA 3HTKA 2M8RA 1NTZK 2FFDA 1FOSF 3EFGA 1H8AA 5CCGC 5AW2B 2YKOA 2W6AA 3HE4A 1IC2A 4WY4B 1JOCA 3TSIA 2C9LY 1JY3P 1L4AD 3OJAB 2H43A 1WT6A 1SQVK 5AVUB 2FXMA 5CCHC 2L5GB 2OYHA 1LTSC 1HJBA 1N73C 1ZV8A 4IFFA 3GHGA 1M7LA 2OYIA 2FFDB 1KQLA 1L4AA 2JEEA 5KJ7C 1NTKK 1FDMA 1HTLC 1J1DC 5AW1B 3HUSA 3NFQA 4B86A 1DX7A 1RE3C 4ZKUA 1X79B 1KZUB 3B5NC 3V2NA 3HD7D 3VTPC 3B8EB 1HGZA 2OYHB 1GL2C 3P8CD 1ZR4A 1MUUA 1L4AB 1JMMA 5AW9B 3RL0B 3BASA 3RK2C 3VOPA 3HD7A 1T8ZA 5APUA 3CI9A 3HUSB 2A45G 4GIFA 1N7SC 2R32A 2HODB 2E43A 3MUDA 3L35A 1LTBC 4W7ZA 3EQ2A 4I1LA 2N9BA 3U1AA 3V4WA 1FJKA 2O1JA 1XTGB 1NWQA 1CZQA 3HD7B 2C0WA 1NH4A 1FZBA 3CL3D 5APQA 3CLQA 2WT7A 2NPSC 1AQ5A 3BATA 5AVSB 1URQD 3VMXA 3PP5A 3LIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTZ K;  1L0L K;  3LW5 H;  2OAR A;  2LKM A;  1SQX K;  3M9Q A;  4IFD K;  3G3Z A;  1NU1 K;  1NTM K;  1SQP K;  1SQB K;  5KLV K;  2O01 H;  2WSE H;  1SQV K;  1SQQ K;  3CLQ A;  1L0N K;  2J59 M;  2WSF H;  1NTK K;  2FYU K;  2WSC H; 
#chains in the Genus database with same CATH topology
 2E5T A;  3CX5 H;  1Q2N A;  2WTY A;  2PFX A;  2WSC J;  5GTH E;  1SQV G;  2ZXX A;  1KIL C;  3AE8 C;  1JB0 J;  1E5W A;  2GM4 A;  4ASV A;  2V7Q J;  1QGK B;  2QM8 A;  1R5L A;  5CJ0 A;  4QMA A;  3B5N B;  3SWF A;  4AQR D;  1KFN A;  4C7N B;  1URQ B;  4WY4 D;  2JR8 A;  2D2C B;  3A7O A;  4GOE A;  1CI6 B;  3SWY A;  3NXS A;  1PPJ E;  2J58 A;  4H0L C;  3TGU G;  3W67 A;  1S9K E;  1LTJ A;  1OFC X;  3QWO C;  1M1J C;  1U7M A;  3AEA C;  2BCC G;  3VMY A;  2W6B A;  1PP9 E;  2ZT9 C;  1LT9 C;  2GUV A;  2YO3 A;  2KSJ A;  5CBN A;  1SQP K;  3Q5P A;  1KB9 H;  3RL0 D;  2N1T B;  3H32 A;  2AEJ A;  2K9J A;  5BU8 B;  2XZR A;  1BSH A;  2FBW C;  1OW8 A;  3CXH H;  4CPG A;  4JYB A;  3AE3 C;  4RKU J;  2IZ0 A;  2B87 B;  2ZVN B;  2QJK B;  1NTZ D;  2AEF A;  1ZME C;  1NTZ E;  1SFC A;  1JMB A;  1NTK J;  1LWU B;  1S5L E;  2H8P D;  1J1E B;  1IZN B;  1VQ9 P;  4O9B A;  3AE6 C;  1PZQ A;  1IO4 A;  1MV8 A;  5L8R J;  1D7M A;  2Y0D A;  4DOJ A;  1VF5 C;  1M57 D;  3B5N D;  1RF0 C;  5KJ7 A;  1FC2 C;  4TT3 H;  2C9N Y;  2Y0E A;  2P10 A;  1GL2 D;  1OVU A;  3OA7 A;  1U57 A;  2QJP C;  1SQP G;  1G1I A;  1N73 B;  1FDI A;  1J1D B;  3MD0 A;  3CME P;  2K88 A;  1N7S A;  1AFO A;  3NTN A;  3H1J D;  2FFD C;  4L74 A;  3H1J E;  5B66 H;  5AW0 B;  2N1T D;  1SQQ J;  3O6Q B;  2E74 B;  1FDO A;  1IFM A;  1J2J B;  3CC4 P;  1KD1 Q;  5AVY B;  1NGM B;  1BCC D;  3G6E P;  2OYI C;  3L74 J;  1BCC E;  2KS1 A;  4Y28 J;  2KIK A;  2OAR A;  2DW3 A;  2WQY C;  3KZI E;  2NPS B;  2H7H A;  2FKW B;  1T3U A;  1FZC B;  4EI2 A;  4IL6 E;  1ZRT E;  1NO4 A;  3HD7 C;  5AW3 B;  5KLV D;  3MUD C;  3A0H H;  1KIL B;  1HUC A;  3CCV P;  2JWD A;  2M5A B;  3KPE A;  1BSN A;  3VP9 A;  3HE5 A;  3FX0 A;  1FZF A;  1FU1 A;  3GW6 A;  2Z4E A;  3WUT A;  1PPJ G;  1KV4 A;  3WMM 0;  1RF1 A;  1SQB D;  1X8Y A;  1NAY A;  3SFD C;  4U3F J;  2IX7 C;  3W68 A;  2E76 D;  2HLO A;  2WSF J;  2Y9Y A;  3A0B H;  1PP9 G;  3UIA A;  5CHX A;  1CW5 A;  3A2A A;  1PFI A;  3Q5R A;  1Y47 A;  3BCC D;  2QVA A;  1IJD B;  2QEX P;  3RK3 D;  1JTH B;  1M1J B;  1KQS O;  4DT0 A;  2ZT9 B;  3ZDM A;  3PHL A;  1GDT A;  1LP1 B;  1LT9 B;  2ZXE B;  1HVV A;  1JO5 A;  2G8Y A;  3RBX A;  2KYV A;  2FXP A;  3SSU A;  4BRY B;  2E74 D;  1KC8 Q;  5TIS H;  2PRR A;  1NTZ G;  2RN0 A;  1NTM D;  1KQG B;  3FWL A;  1NKN A;  1P84 D;  1NTM E;  5KAF E;  1P84 E;  1NYH A;  3MP7 B;  1L0N D;  5E79 E;  1L0N E;  2NPS D;  1X0T A;  1YTZ I;  4L76 A;  3P7K A;  1EZV E;  5APW A;  3HRN A;  5EFW B;  5M1B A;  1XTC C;  1KIL E;  1W2B O;  3CXH I;  4YXD C;  1VF5 B;  5APY A;  1HF9 A;  3L4F A;  1ZR2 A;  3AE9 C;  2QJP B;  2N9Y B;  4BWN A;  1IC2 A;  3CWB J;  2FYU D;  3H1J G;  3OJA B;  1YJW P;  3LW5 J;  1KYO E;  3CCQ P;  3S9O A;  2L5G B;  3CCJ P;  3GHG A;  2FFD B;  2JEE A;  1FDM A;  1DIP A;  1K73 Q;  1BCC G;  1M90 Q;  3B5N C;  1ZOY C;  1HGZ A;  1GL2 C;  3P8C D;  1YJN P;  2AEM A;  2IDB A;  3VOP A;  4GIF A;  2E43 A;  1BGY E;  3H1H D;  2E75 D;  5KLV G;  2O1J A;  3TGU E;  3HD7 B;  3AE5 C;  3CL3 D;  3CLQ A;  3Q2Y A;  3FXD A;  5AVS B;  3PTZ A;  2KK7 A;  2WSS H;  1JNM A;  5AW7 B;  3C8V A;  2YMK A;  3A5T A;  4LLH A;  1BE3 J;  2CK3 H;  1QVF O;  3CC7 P;  2XNX A;  2A45 H;  1EDJ A;  1MFZ A;  4JF7 A;  4OH8 B;  1IFI A;  4AUW A;  2QJK C;  3BCC G;  1JCD A;  1NU1 E;  1LTT C;  4UB6 E;  2IBZ D;  3L72 E;  1LWU C;  2Q1K A;  1J1E C;  3TK1 A;  2J5U A;  3TYY A;  2AXT E;  3H1L J;  4C7R A;  2I8D A;  5KTB A;  1N7S B;  3I5C A;  2QE7 H;  3KHU A;  2KUB A;  3H25 A;  3V2R A;  3CX5 D;  1EXI A;  4WVZ A;  1NTM G;  4DJG A;  1VQL P;  2RMZ A;  4PD4 I;  1JY3 N;  1L0N G;  1USE A;  3L37 A;  1HWT C;  3H1I J;  2E76 C;  5AVQ B;  4C46 A;  3A3Y B;  1BDC A;  1EZV G;  2LR2 A;  2CPS A;  2PAJ A;  2Q5U A;  3SFE C;  4YTP C;  1SFC D;  2JKV A;  1RE4 A;  3RK3 C;  1GTW A;  2HOD A;  5CJ4 A;  1SQV J;  2KLU A;  4JYC A;  2HG5 D;  4AYC A;  2O01 N;  4HKZ H;  2E74 C;  2WSC H;  2M3B A;  2IPP A;  2XND H;  2WPV B;  1EQ7 A;  2WWW A;  1SVF A;  3PRJ A;  2LKM A;  1JY2 O;  3HE5 B;  5KJ7 D;  1NTK D;  3H1K J;  4LC1 A;  3V6I A;  1DEB A;  1KB9 E;  2O1K A;  2ZJS E;  2R44 A;  2FYU G;  2HPC A;  3TGU J;  4OVN F;  4I7Z B;  2O01 J;  1Q7Y Q;  2ZYG A;  2Z5H A;  1FZC C;  1KTM A;  2BCC J;  1RE3 A;  2IYO A;  3CXH D;  1UII A;  4JQ0 D;  2ZFC A;  3RK2 D;  1N7S D;  1NU1 K;  3L71 D;  3N7N A;  3L71 E;  2POH A;  2CPB A;  1LNQ A;  3CC2 P;  3IN6 A;  3KXD A;  2QG4 A;  1FE6 A;  3M91 A;  2HYN A;  4PJ0 H;  2H89 C;  2LXB A;  1VPC A;  3KDP B;  2I1J A;  5B5E H;  1GL2 B;  2M0B A;  2Q7C A;  1BGY G;  5KLI B;  3PH0 A;  3L75 D;  4L75 A;  3L75 E;  5APV A;  2WIT A;  1IFJ A;  3ITK A;  2OYH C;  3FWN A;  3T97 B;  1SQQ D;  3HUS C;  1GW3 A;  1G2C A;  1GW4 A;  1PV3 A;  3AEG C;  4IFD K;  2KB7 P;  1MFT A;  1JM0 A;  3L74 D;  3TNU A;  1LT1 A;  1VQ7 P;  4JPZ B;  1A02 F;  3GG2 A;  2KSE A;  3M0D A;  1AA0 A;  1NU1 G;  4Z1M H;  1SQP J;  3L72 G;  1HBW A;  2IBZ G;  5B66 E;  3TF5 A;  3MIW A;  3E1R A;  2E75 C;  2ZYD A;  3RBZ A;  3SWK A;  5KAI H;  4EDF A;  2R5D A;  3D6Z A;  2E42 A;  1HH0 A;  4R4L A;  2R5B A;  5GTH H;  2BEZ F;  1RQV A;  5APX A;  3GHG B;  2A45 I;  2W8Z A;  1CSB A;  4U3F D;  1ZN5 A;  2WMM A;  3IAO A;  3M9B A;  1VQO P;  1FJP A;  2E76 B;  2KZI A;  3MGN A;  4YPC A;  1EDL A;  3L73 D;  3L73 E;  3RK3 B;  4XFJ A;  1LTJ C;  2M3E A;  2YKP A;  1LTG C;  2YXQ B;  5DJT B;  1PGP A;  3EWK A;  3A0B E;  1S72 P;  2FY8 A;  3D71 A;  3WU2 H;  4ASW A;  1N86 A;  3GLM A;  4GKG A;  1FOS E;  4N6J A;  2WPQ A;  1LTI C;  4DZO A;  1OIP A;  5AVV B;  1VL2 A;  3M9Q A;  2KLV A;  1PP9 J;  4EIJ A;  2V4H A;  4WY4 A;  1IFN A;  4NPD A;  4OGQ C;  2W27 A;  1SFC C;  1L0L D;  5TIS E;  2O3J A;  3L71 G;  1L0L E;  3VN0 A;  4K3A A;  5GTI H;  2WSF H;  3HTK A;  1NTZ K;  1T6A A;  5KLV E;  1H8A A;  4H13 C;  2YKO A;  4TLF A;  3HE4 A;  3G9R A;  3PJS K;  1S5L X;  1JY3 P;  1WT6 A;  5AVU B;  1K05 A;  2FXM A;  1LTS C;  1NTZ J;  3L75 G;  1ZXG A;  1KQL A;  1L4A A;  3EFF K;  3CWB D;  5KJ7 C;  2KZJ A;  1FS0 E;  1SQB E;  2QSI A;  4B86 A;  1DX7 A;  3AEE C;  4PD4 H;  1KZU B;  1M8O B;  1TU3 F;  3VTP C;  2OYH B;  1Q86 Q;  2KNC A;  3BCC E;  5AW9 B;  3RK2 C;  3RK3 E;  4EYY Q;  3HUS B;  4L73 A;  1N7S C;  1OVV A;  2HOD B;  2KI7 B;  3AEC C;  3Q3D A;  4I1L A;  2N9B A;  4UB8 E;  1XTG B;  2IZ1 A;  4H44 D;  1QEX A;  1H0T A;  1NH4 A;  2SPZ A;  3JCU H;  3I56 P;  1YBK A;  2ITA A;  3KZI H;  1URQ A;  1VQ5 P;  3H1J J;  2WT7 B;  2E75 B;  1CI6 A;  2W83 C;  1SQX D;  4NPE A;  3KQG A;  1MZ9 A;  1KQF B;  1SQX E;  2XU6 A;  1BE3 D;  1A02 J;  4WB4 A;  1L0L K;  3LW5 H;  1OW7 A;  1BCC J;  1NOH A;  5KLV K;  4Y99 C;  2WPR A;  2N1T A;  1JEK A;  2LXC B;  2XV5 A;  1RF1 C;  3L73 G;  3H1L D;  3ABV C;  1JY2 P;  4I7Z C;  4N78 D;  2UWJ E;  1GMJ A;  1IK7 A;  2YXR B;  2ZYA A;  1RQU A;  1SQB K;  3GMA A;  2FYU E;  1HJ0 A;  3B71 A;  2B87 A;  1YIJ P;  1LTJ B;  5AW5 B;  1G2C B;  2WSE J;  1VDF A;  2P7J A;  3II6 A;  4R4M A;  1YQ4 C;  2QRX A;  3TNU B;  3H32 B;  4D6T D;  2K9J B;  4D6T E;  4ZMD A;  4DCK A;  3P8C E;  5KLI C;  2QA4 P;  1L0L G;  1YJ9 P;  1SQV D;  4W80 A;  5CCG A;  4OGQ B;  3L70 D;  1SFC B;  3H1H E;  1GK6 A;  1NTM K;  1KFM A;  3G4S P;  2GA1 A;  1QVG O;  5CCH A;  1L0N K;  1W2E A;  5AVZ B;  1NHL A;  4RO0 A;  3S1K A;  1LJ2 A;  4H13 B;  3AE2 C;  3H1K D;  2OTL P;  3V2Q A;  3P32 A;  1KMI Z;  1NTM J;  3CWB G;  1SQX K;  1SQB G;  1L0N J;  1VQ4 P;  1PGQ A;  5AW6 B;  3D6Y A;  3O6Q A;  2W90 A;  5K5G B;  3CCS P;  2Y9Z A;  2OTK E;  2L91 A;  3BVH A;  2IBZ E;  5CBO A;  4K35 A;  4MN4 C;  2P67 A;  1SS1 A;  3RK2 B;  1AQT A;  2NPS A;  1H88 A;  1GU5 A;  4U7J A;  1PGO A;  2IFM A;  5APT A;  3AE4 C;  2RH0 A;  2QM7 A;  3GHG C;  2FYU K;  1QX8 A;  4WBA A;  1YI2 P;  2NRG A;  1PGJ A;  3M0A A;  3CX5 E;  1KIL A;  3M06 A;  2A06 D;  2M5A A;  3CCR P;  4GDO A;  2VRS A;  1N2D C;  3TDK A;  2FYU J;  2KS1 B;  5AW4 B;  4PJ0 E;  1YTZ T;  1AV1 A;  3CCL P;  3F89 A;  1SQX G;  4OGQ D;  3AED C;  3GF3 A;  3MZW B;  2GUS A;  1USD A;  2KP8 A;  4JBZ A;  1IFD A;  1G1J A;  2O01 H;  1X9V A;  1GK4 A;  1T3J A;  3HTK B;  4H13 D;  4BXL A;  4RJT A;  2I1K A;  1SQP D;  2IFN A;  1JTH A;  1M1J A;  1X22 A;  3HE4 B;  4H44 C;  4PV1 D;  1S1C X;  1LT9 A;  2YMY A;  4Y99 B;  1M1K Q;  1FZE A;  1BGY J;  1SP4 A;  4BRY A;  1NTK E;  1YYC A;  1RF1 B;  5C39 A;  4UB6 H;  1VQN P;  3V5B A;  3E7K A;  3CXH E;  2KNC B;  1NJI Q;  3BRV B;  1BDD A;  4RES B;  3CCU P;  5AW8 B;  2ZVO B;  4YXW H;  1FAV A;  1Q90 D;  4D6T G;  1NKZ B;  2FYZ A;  4KHX A;  5H2F H;  1QLE D;  3O8Z A;  4XE5 B;  2XKM A;  1FBM A;  1NU1 J;  1H0T B;  3L72 J;  3V4Q A;  4W7Y A;  1SLQ A;  2Y0C A;  3VMA A;  5BVZ A;  1DD4 A;  3H1H G;  3L70 G;  1WMK A;  3CMA P;  1RF0 A;  3QH9 A;  1FZA A;  3V2P A;  3JC2 2;  1AVY A;  1S4X A;  3U1C A;  1JY2 N;  4I2L C;  1Y9B A;  1RE4 C;  1SQQ E;  3H1K G;  3PLN A;  1PPJ D;  4N3Y B;  2C0X A;  4NPF X;  1ZLL A;  1S9K D;  3L74 E;  1H89 A;  2FYN C;  2YNY A;  1P84 I;  2K3R A;  1PP9 D;  2JP3 A;  2FFD A;  1FOS F;  1IFP A;  1M56 D;  5AW2 B;  1JOC A;  3TSI A;  4ZNC A;  3CPW O;  2C9L Y;  1L4A D;  1EZV I;  2H43 A;  1EDI A;  3S4R A;  1ZV8 A;  4IFF A;  1M7L A;  2OYI A;  3WU2 E;  1NTK K;  2B9B A;  1ZP0 C;  1DD3 A;  3AE1 C;  1RE3 C;  1X79 B;  3V2N A;  3B8E B;  4WWI A;  2A06 G;  4U3F E;  3HD7 A;  1T8Z A;  3CI9 A;  1YQ3 C;  4HJG H;  2AXC A;  2R32 A;  5GTI E;  3MUD A;  3L35 A;  4W7Z A;  1YIT P;  4A7P A;  2QJY C;  3A0H E;  1CZQ A;  1KYO I;  2C0W A;  1FZB A;  2OYO A;  5APQ A;  3L71 J;  1K04 A;  3WUV A;  1AQ5 A;  1URQ D;  3VMX A;  2D2C D;  3LID A;  1GD2 E;  4PD4 D;  4PD4 E;  1AJY A;  1T2K D;  1N8R Q;  1NVO A;  1E79 H;  1W5C E;  2BAS A;  1SQQ K;  1NAF A;  1DH3 A;  1NTK G;  4H44 B;  2Q6Q A;  3L75 J;  1EC5 A;  5AVR B;  5KKZ C;  2R3C A;  3M0D C;  2QIW A;  1MKM A;  1RHZ B;  1S5L H;  3JCU E;  1IK9 A;  3I55 P;  1RY3 A;  2JJL A;  3IFM A;  4OWF A;  1OXZ A;  4PV1 C;  2E5Y A;  4I6M C;  1ZRT D;  1UIX A;  1KN7 A;  4HYT B;  1EXJ A;  2PP6 A;  2P1J A;  2IBZ I;  3CWB E;  1N7L A;  2KXP B;  3L36 A;  1SQQ G;  1R5S A;  5CCG D;  1VQM P;  1QL1 A;  2FXO A;  3L74 G;  3MHV A;  3Q5S A;  3P8M C;  3CX5 I;  3KYQ A;  5CCH D;  1QL2 A;  4HH2 A;  2K1A A;  4H0L B;  1Y8A A;  2PGD A;  3MTU E;  2FYN B;  2JWA A;  1GZL A;  4EOT A;  3K5B A;  5AVW B;  5DJU B;  2W6J H;  2HR3 A;  3L73 J;  1OWA A;  2MKV A;  3B5N A;  5CMZ A;  2YO2 A;  2Q9I A;  4C7N A;  1GL2 A;  2HPC B;  1OW6 A;  4WY4 C;  3JSV C;  1VQ8 P;  4IL6 H;  2XDJ A;  2OTJ P;  3OAK A;  1L2P A;  1OZH A;  4GOF A;  2H88 C;  4GT1 A;  4U3F G;  1RH5 B;  3NMD A;  4LGD E;  1BE3 E;  3T97 A;  2JDI H;  4IL6 X;  1EZV D;  1Q81 Q;  1KB9 I;  2MJZ A;  2WSE H;  3IF4 A;  2WVR A;  4IOI H;  4XA4 A;  1KIL D;  1L4A C;  1L0L J;  2QJY B;  3RL0 C;  1AVO A;  2B89 A;  1S3J A;  3USS A;  2YIU C;  3H1L E;  1ZW0 A;  3FXE A;  1OX3 A;  4N78 E;  5KLV J;  3RGU A;  1PIX A;  1GU4 A;  2WPS A;  3VYI A;  4KT0 J;  5AVX B;  3RL0 g;  1KOR A;  2NZ2 A;  1HGV A;  1Z56 A;  1OVR A;  4ZKP A;  1VQ6 P;  2RKL A;  2YKQ A;  4UB8 H;  1LWU A;  3R2P A;  4H0L D;  3CD6 P;  1SQB J;  3H1I D;  1JCC A;  1KYO D;  3H1I E;  1LTA C;  5BU5 A;  2ZT9 D;  4IFM A;  5KKZ B;  4M3L A;  5KAF H;  1P84 H;  3BCC J;  3IR9 A;  5E79 H;  1SQV E;  2K37 A;  5AVT B;  2OGU A;  3G3Z A;  1URQ C;  3VP8 A;  2KOG A;  3L70 E;  2D2C C;  2OYI B;  1LGH B;  1Q82 Q;  1K9M Q;  1N73 A;  2OQQ A;  3GF7 A;  3M9H A;  5APS A;  1T2K C;  2P2U A;  1BGY D;  3H6P A;  2Q3E A;  3H1K E;  4PV1 B;  3OW2 O;  1S2E A;  3TGU D;  1JY3 O;  3C9I A;  1FZG A;  3AEF C;  2J59 M;  2BCC D;  2Q3I A;  2BCC E;  2N1T C;  3G71 P;  1SQX J;  1VF5 D;  1PL5 A;  3U59 A;  2WZ7 A;  1U7J A;  3FGA D;  1VQP P;  1KYO H;  1JUN A;  2HFE D;  3VMZ A;  1NU1 D;  3L72 D;  1FZC A;  3BRT B;  2R3S A;  1WRG A;  1K8A Q;  1DEE G;  2K9Y A;  4KJM A;  3AE7 C;  1VQK P;  3LIE A;  1EDK A;  3E1I A;  2A06 E;  2JO1 A;  1R8E A;  3N4X A;  2Z5I A;  2M8R A;  3WUU A;  5H2F E;  3EFG A;  5CCG C;  3F5H A;  2B88 A;  2W6A A;  4WY4 B;  1BE3 G;  2IYP A;  5B5E E;  1SQV K;  3D70 A;  5CCH C;  2OYH A;  1HJB A;  1N73 C;  4D6T J;  3C1L A;  3CCM P;  1HTL C;  1J1D C;  5AW1 B;  1SQP E;  3HUS A;  3NFQ A;  4ZKU A;  1LP1 A;  2P58 A;  3HD7 D;  2G3A A;  3H1L G;  2ZAE B;  1OMI A;  4HB1 A;  1ZR4 A;  3H1H J;  1MUU A;  1YHQ P;  3L70 J;  1L4A B;  1JMM A;  3RL0 B;  3BAS A;  5APU A;  2A45 G;  2YIU B;  2BEQ D;  1LTB C;  3EQ2 A;  3CCE P;  3R4Y A;  4GOD A;  3U1A A;  3V4W A;  2V7Q H;  1FJK A;  2AXT H;  5TJH A;  1NWQ A;  1KB9 D;  3Q1M A;  3H1I G;  2WT7 A;  2NPS C;  3AEB C;  3BAT A;  3B4S A;  3PP5 A;  5KAI E; 
#chains in the Genus database with same CATH homology
 1JNM A;  5AW7 B;  1GD2 E;  2WTY A;  3A5T A;  1URQ A;  4LLH A;  1KIL C;  2XNX A;  2WT7 B;  2A45 H;  1T2K D;  1MFZ A;  4JF7 A;  4OH8 B;  1CI6 A;  1IFI A;  1E5W A;  2GM4 A;  2BAS A;  1SQQ K;  4AUW A;  1NAF A;  1DH3 A;  3KQG A;  1MZ9 A;  2QM8 A;  5CJ0 A;  1JCD A;  2XU6 A;  3B5N B;  3SWF A;  1A02 J;  1LTT C;  4AQR D;  1KFN A;  5AVR B;  4C7N B;  1URQ B;  4WB4 A;  4WY4 D;  1LWU C;  2R3C A;  3M0D C;  1L0L K;  3LW5 H;  1J1E C;  3TK1 A;  3TYY A;  1NOH A;  3A7O A;  1CI6 B;  3SWY A;  3NXS A;  4C7R A;  5KLV K;  5KTB A;  1N7S B;  3I5C A;  4Y99 C;  2WPR A;  2J58 A;  2N1T A;  1S9K E;  1LTJ A;  1IK9 A;  2XV5 A;  1RF1 C;  1M1J C;  3VMY A;  1RY3 A;  2JJL A;  2W6B A;  3V2R A;  3IFM A;  1JY2 P;  4N78 D;  1LT9 C;  2GUV A;  1JY3 N;  2YO3 A;  2KSJ A;  1SQP K;  1SQB K;  1OXZ A;  3L37 A;  3RL0 D;  2N1T B;  4I6M C;  1HWT C;  1LTJ B;  3H32 A;  5AVQ B;  4C46 A;  3A3Y B;  5AW5 B;  2CPS A;  4HYT B;  2PP6 A;  5BU8 B;  1G2C B;  2XZR A;  2PAJ A;  1VDF A;  2P1J A;  2Q5U A;  2P7J A;  1SFC D;  1RE4 A;  3II6 A;  4JYB A;  3RK3 C;  1GTW A;  2HOD A;  5CJ4 A;  1N7L A;  3TNU B;  3L36 A;  3H32 B;  4JYC A;  1SFC A;  5CCG D;  2HG5 D;  3P8C E;  4AYC A;  1LWU B;  2H8P D;  1J1E B;  1QL1 A;  2WSC H;  2M3B A;  2IPP A;  4O9B A;  4W80 A;  1EQ7 A;  3P8M C;  2WWW A;  5CCG A;  3KYQ A;  1MV8 A;  1IO4 A;  5CCH D;  1SVF A;  1QL2 A;  2LKM A;  1JY2 O;  4HH2 A;  3HE5 B;  1SFC B;  5KJ7 D;  1GK6 A;  1NTM K;  1KFM A;  4LC1 A;  3MTU E;  1DEB A;  4DOJ A;  5CCH A;  2O1K A;  1L0N K;  1GZL A;  1W2E A;  2HPC A;  5AVZ B;  1NHL A;  3B5N D;  1RF0 C;  4EOT A;  5KJ7 A;  2C9N Y;  5AVW B;  2Z5H A;  1FZC C;  1GL2 D;  3OA7 A;  1RE3 A;  3V2Q A;  1OWA A;  3P32 A;  1SQX K;  2ZFC A;  3B5N A;  5CMZ A;  1G1I A;  3RK2 D;  2YO2 A;  2Q9I A;  4C7N A;  1N7S D;  1NU1 K;  1N73 B;  3N7N A;  1GL2 A;  2HPC B;  5AW6 B;  4WY4 C;  2POH A;  2CPB A;  2XDJ A;  1J1D B;  3MD0 A;  3OAK A;  3M91 A;  2HYN A;  1N7S A;  4GT1 A;  1AFO A;  3NMD A;  4LGD E;  3NTN A;  1VPC A;  2FFD C;  3BVH A;  3KDP B;  2I1J A;  1GL2 B;  3T97 A;  5AW0 B;  2N1T D;  2P67 A;  2Q7C A;  3RK2 B;  2MJZ A;  2WSE H;  5APV A;  2NPS A;  1IFM A;  1J2J B;  1H88 A;  1GU5 A;  5AVY B;  2WIT A;  1IFJ A;  2IFM A;  4XA4 A;  5APT A;  2OYH C;  2QM7 A;  3GHG C;  1KIL D;  2OYI C;  2FYU K;  1L4A C;  4WBA A;  3RL0 C;  3HUS C;  1GW3 A;  1G2C A;  2OAR A;  3M0A A;  1GW4 A;  4IFD K;  1KIL A;  2KB7 P;  4N78 E;  3M06 A;  2NPS B;  1GU4 A;  2WPS A;  2VRS A;  2H7H A;  2FKW B;  1N2D C;  1T3U A;  3VYI A;  1FZC B;  3TNU A;  5AVX B;  1HGV A;  1Z56 A;  1A02 F;  1NO4 A;  3HD7 C;  5AW4 B;  1YTZ T;  4ZKP A;  5AW3 B;  2YKQ A;  1LWU A;  3M0D A;  1KIL B;  1HUC A;  3R2P A;  2GUS A;  2KP8 A;  1HBW A;  3KPE A;  1JCC A;  3VP9 A;  1IFD A;  1G1J A;  2O01 H;  1LTA C;  3HE5 A;  1X9V A;  1GK4 A;  5BU5 A;  1T3J A;  3MIW A;  3HTK B;  1FZF A;  1FU1 A;  2Z4E A;  4IFM A;  4M3L A;  2I1K A;  2IFN A;  1JTH A;  1M1J A;  3WMM 0;  1RF1 A;  1X8Y A;  3HE4 B;  3IR9 A;  2R5D A;  2E42 A;  1HH0 A;  2IX7 C;  2R5B A;  1LT9 A;  2HLO A;  2YMY A;  4Y99 B;  5AVT B;  3G3Z A;  3VP8 A;  1URQ C;  3UIA A;  5APX A;  5CHX A;  1FZE A;  1CW5 A;  3A2A A;  2KOG A;  1PFI A;  1SP4 A;  1YYC A;  3GHG B;  2A45 I;  2OYI B;  1IJD B;  1LGH B;  1CSB A;  1ZN5 A;  3RK3 D;  1RF1 B;  1JTH B;  1M1J B;  1N73 A;  3M9H A;  5APS A;  3V5B A;  3M9B A;  1GDT A;  1T2K C;  1LT9 B;  2P2U A;  2ZXE B;  1HVV A;  3H6P A;  1JO5 A;  1FJP A;  2KYV A;  1JY3 O;  3BRV B;  4RES B;  3C9I A;  5AW8 B;  3MGN A;  1FZG A;  2J59 M;  1FAV A;  2Q3I A;  1NKZ B;  2FYZ A;  2N1T C;  4KHX A;  3RK3 B;  1NKN A;  1LTJ C;  3O8Z A;  4XE5 B;  2XKM A;  1FBM A;  2YKP A;  3U59 A;  1LTG C;  2WZ7 A;  2NPS D;  1YTZ I;  3V4Q A;  4W7Y A;  1SLQ A;  3P7K A;  5BVZ A;  1JUN A;  2HFE D;  5APW A;  1RF0 A;  3HRN A;  3VMZ A;  1N86 A;  1XTC C;  1FZA A;  1FZC A;  3V2P A;  4GKG A;  1FOS E;  4N6J A;  2WPQ A;  3BRT B;  1LTI C;  3U1C A;  4DZO A;  1WRG A;  5AVV B;  1JY2 N;  4I2L C;  1RE4 C;  3M9Q A;  2KLV A;  3LIE A;  4EIJ A;  4WY4 A;  1IFN A;  3E1I A;  4N3Y B;  5APY A;  2C0X A;  2W27 A;  1ZLL A;  1SFC C;  1S9K D;  3L4F A;  1H89 A;  1ZR2 A;  3N4X A;  2Z5I A;  3VN0 A;  2WSF H;  2YNY A;  3HTK A;  2M8R A;  1NTZ K;  2FFD A;  1FOS F;  3EFG A;  1H8A A;  5CCG C;  5AW2 B;  2YKO A;  2W6A A;  3HE4 A;  1IC2 A;  4WY4 B;  1JOC A;  3TSI A;  2C9L Y;  1JY3 P;  1L4A D;  3OJA B;  2H43 A;  1WT6 A;  1SQV K;  5AVU B;  2FXM A;  5CCH C;  2L5G B;  2OYH A;  1LTS C;  1HJB A;  1N73 C;  1ZV8 A;  4IFF A;  3GHG A;  1M7L A;  2OYI A;  2FFD B;  1KQL A;  1L4A A;  2JEE A;  5KJ7 C;  1NTK K;  1FDM A;  1HTL C;  1J1D C;  5AW1 B;  3HUS A;  3NFQ A;  4B86 A;  1DX7 A;  1RE3 C;  4ZKU A;  1X79 B;  1KZU B;  3B5N C;  3V2N A;  3HD7 D;  3VTP C;  3B8E B;  1HGZ A;  2OYH B;  1GL2 C;  3P8C D;  1ZR4 A;  1MUU A;  1L4A B;  1JMM A;  5AW9 B;  3RL0 B;  3BAS A;  3RK2 C;  3VOP A;  3HD7 A;  1T8Z A;  5APU A;  3CI9 A;  3HUS B;  2A45 G;  4GIF A;  1N7S C;  2R32 A;  2HOD B;  2E43 A;  3MUD A;  3L35 A;  1LTB C;  4W7Z A;  3EQ2 A;  4I1L A;  2N9B A;  3U1A A;  3V4W A;  1FJK A;  2O1J A;  1XTG B;  1NWQ A;  1CZQ A;  3HD7 B;  2C0W A;  1NH4 A;  1FZB A;  3CL3 D;  5APQ A;  3CLQ A;  2WT7 A;  2NPS C;  1AQ5 A;  3BAT A;  5AVS B;  1URQ D;  3VMX A;  3PP5 A;  3LID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...