2LKMA

Structural basis for molecular interactions involving mrg domains: implications in chromatin biology
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
42
structure length
42
Chain Sequence
DYVQPQLRRPFELLIAAAMERNPTQFQLPNELTCTTALPGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHD finger protein 12
publication title Structural basis for molecular interactions involving MRG domains: implications in chromatin biology.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2011-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16737 PHF12_MRG_bd PHD finger protein 12 MRG binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2lkmA01
3G3ZA 1SQVK 1NU1K 2LKMA 1L0NK 4IFDK 1NTKK 3CLQA 1SQPK 1SQXK 2WSCH 2FYUK 2WSFH 5KLVK 3M9QA 2OARA 1L0LK 1NTZK 1SQBK 2WSEH 2J59M 1SQQK 1NTMK 3LW5H 2O01H
chains in the Genus database with same CATH superfamily
2JKVA 5GTIE 5APUA 5AW2B 3RK2D 2H89C 1Z56A 2G3AA 1RY3A 3CMAP 1NKNA 2Q3IA 2QJKB 1OFCX 3L36A 1FJPA 2PFXA 3HD7B 2L91A 1VQ8P 1M1JA 2IPPA 2G8YA 1AVYA 2E76B 2D2CC 4U3FG 2N9YB 3AECC 1IFMA 1DEBA 2Y9YA 1S5LE 5AW1B 2I1KA 2E74D 2KP8A 2OQQA 1SQXD 3VYIA 4EIJA 3HD7A 4PD4E 3CCJP 2E43A 1ZN5A 5CCGC 1S1CX 3OAKA 1CW5A 1JM0A 2YMKA 4EYYQ 1K8AQ 2R5DA 2WTYA 1BGYE 3B8EB 3L70D 3H1JE 1J2JB 3AE5C 1KQLA 3CCEP 1L0NE 3EFFK 3C1LA 1N7SB 2JWDA 1S2EA 3CCVP 1RQUA 4WY4C 1HBWA 3IR9A 1QGKB 4I7ZB 3VMXA 2IYPA 1Q82Q 3U1AA 3BASA 1SQVK 2HR3A 5AW8B 2GA1A 1P84D 3M9BA 3QH9A 3PTZA 3L71E 1BGYJ 1N7SA 2E74C 5KKZB 3JCUH 2WSSH 1SQVJ 2WPRA 1H8AA 1USDA 2Y0CA 1L0NJ 3Q3DA 1N73B 3AEGC 1RE3A 1PP9D 1U7MA 1YJNP 1AFOA 3SWYA 1KB9I 3NFQA 3L75J 3NTNA 4N3YB 2W90A 2C0XA 2QIWA 4A7PA 4N78D 3LW5J 5CJ0A 1LT9B 2OARA 4OH8B 2FXMA 5GTHH 1N73A 2WSEH 4IFFA 2BASA 2ZT9D 4W7YA 1JCDA 4EOTA 2IDBA 1S72P 4LGDE 4DCKA 1M7LA 3WUTA 1BGYG 1VL2A 3JSVC 3JCUE 1QL2A 1KQFB 2QE7H 1SQVG 1NWQA 1LT9A 3Q2YA 5KLIC 1K73Q 1L0NG 1NU1K 1JY3O 1ZRTD 1ZR2A 2QM7A 1GTWA 1PGQA 3L74E 2FYZA 2W6JH 1G2CB 3V2NA 5CHXA 5AVRB 2FKWB 1ZP0C 3L75G 5KAIH 1NU1J 1LGHB 1BCCE 3VMAA 5GTHE 2N1TB 1MZ9A 1PPJD 2P10A 3ABVC 1KYOD 1BE3D 4LLHA 2BCCD 2GUVA 2R44A 4H13B 1LTIC 3H1HD 1G2CA 5KJ7A 1A02J 2KLVA 1AA0A 2ZT9C 3MGNA 2LR2A 1NOHA 2WQYC 1JEKA 1PGJA 1IZNB 2QRXA 1LP1B 3MHVA 2YIUC 3AE7C 5APTA 3L74J 2IFNA 2N1TA 4PD4I 3RK3E 3HD7D 2A06E 3RK2B 3U59A 3VP9A 2E76D 5AVZB 1BCCJ 4YXWH 5DJTB 3GHGC 2WSEJ 2C9NY 3SSUA 1LP1A 5KAIE 1R5SA 1RE4C 1QX8A 2KK7A 1QL1A 3EFGA 3P32A 2Z4EA 3H1IJ 1NU1G 2E5YA 4PJ0E 2HLOA 3O6QB 3L72J 5B66H 1S9KD 3A0HH 4XFJA 2V7QH 1M1JC 4D6TE 1DIPA 1HJ0A 3CCUP 1JY3N 2OYHC 4XE5B 2AEFA 1VQNP 1KQSO 1GL2C 2CPBA 3L74G 4GKGA 5B5EH 4RESB 5BU8B 4YXDC 2QJKC 1N7SD 1SQBK 3O6QA 3L37A 1JY3P 2Y0DA 2KB7P 3HD7C 1M90Q 1CI6B 4I6MC 2JEEA 1BCCG 1PIXA 2H8PD 4PV1C 1L0LD 2JJLA 4UB6H 1YJ9P 5KLVK 1W5CE 1NAFA 1NTZE 1OXZA 1SQBJ 3AEFC 2KUBA 3H1IG 2BEQD 3IN6A 4NPEA 4MN4C 3PP5A 2AEMA 5B66E 3L72G 1VQ4P 3F5HA 3A0HE 1CI6A 1J1EC 1LTJC 4AQRD 2W6AA 1PL5A 3TGUJ 4C7NB 2FFDB 3CX5D 1M8OB 1EDKA 1KZUB 4UB8H 3PH0A 5B5EE 4JBZA 1EDIA 4OGQB 1DEEG 3MUDA 1T3JA 4W80A 3FXEA 2POHA 2WPSA 2W83C 4Z1MH 1DH3A 1WT6A 2C0WA 1NTZJ 4ZKUA 1T3UA 1PFIA 4C7NA 2FFDA 4I7ZC 4UB6E 1MFTA 1NTKK 4XA4A 1SQXE 1GU4A 3H1KD 1EDJA 1SQBG 1BDCA 2IYOA 3N7NA 3IFMA 2O3JA 2XV5A 3IAOA 3V4WA 1GZLA 5AW9B 1NTKJ 1SQXK 1URQB 4HJGH 2M8RA 2Q7CA 3I5CA 3TGUG 3BCCD 3H32B 1NTMD 3CL3D 2Q9IA 1N73C 5APXA 5APYA 4UB8E 5KJ7D 3ITKA 1N86A 1MV8A 2WZ7A 3S4RA 4GOFA 3FWNA 3VOPA 5KLVD 1Q86Q 5TISE 1SQXJ 2PRRA 2QSIA 1FE6A 3EQ2A 2RN0A 2P7JA 1KMIZ 1NTZG 2N1TD 3HE4B 1URQA 1KFNA 3H32A 3CC4P 3D71A 1LT9C 3RBXA 1GW3A 2E75B 2Y9ZA 1FZEA 2N9BA 1XTGB 3L70J 3M91A 3D6ZA 3CD6P 4ZMDA 2P2UA 2E5TA 2K3RA 1NH4A 1JCCA 4W7ZA 1YITP 1OW6A 3HE4A 1X22A 4BXLA 2ZXXA 5AW7B 3WU2H 4JYBA 5AW4B 2AXTH 4JQ0D 1LTGC 4ASVA 1JNMA 2ZJSE 1YYCA 1NTKD 1NHLA 1SFCB 1KYOH 1SQXG 1OWAA 2HG5D 1PV3A 3CCRP 3O8ZA 2WSFH 2JWAA 4KT0J 2XNDH 3Q5PA 1D7MA 2N1TC 3MTUE 1DX7A 1PP9J 3LW5H 1J1DB 1RQVA 3A2AA 1MUUA 3KHUA 3G6EP 3L70G 4H13C 1ZLLA 1SFCA 3A3YB 1ZRTE 4EDFA 3AE3C 1T8ZA 3MZWB 5APQA 1Q90D 2ZYGA 3II6A 1X0TA 3SFDC 3WU2E 1L4AB 1SQVE 4YTPC 1YIJP 3RK2C 1QLED 2AXTE 2B87B 2OTJP 1KQGB 1KB9D 1Q2NA 1SQQK 3AEBC 1KYOE 1BE3E 3VMYA 2BCCE 3G3ZA 1FOSE 3L75E 1VQMP 3P8CE 4ZNCA 2H7HA 3K5BA 2NZ2A 1L4AA 1IFIA 3AE1C 2W8ZA 2J58A 1PP9G 2YKQA 3GG2A 4M3LA 1LWUB 3VTPC 3HTKB 2B87A 5E79H 1HUCA 2JDIH 1IJDB 2NRGA 4LC1A 4OGQD 2A45G 2KYVA 5C39A 4I1LA 4BRYB 1T6AA 3AE6C 5CJ4A 3H25A 1BE3J 2BCCJ 1NKZB 1DD3A 2WSFJ 3SFEC 1LWUA 3H1HJ 3HTKA 3CMEP 1E79H 4KJMA 2ZVOB 3PRJA 2Z5HA 4C46A 1Y47A 1GU5A 3V5BA 4H44B 2UWJE 1S9KE 2ZYAA 5AVWB 2KI7B 4OVNF 4BRYA 2KIKA 1NU1E 3MUDC 4ZKPA 1VF5B 1MKMA 5M1BA 2K1AA 3GF3A 1URQD 1K9MQ 2M3EA 2KS1B 3EWKA 5E79E 3RL0B 1WMKA 1CZQA 3TNUB 3E7KA 1U7JA 3PLNA 3T97B 1FDOA 1SQQD 4OGQC 1FZCB 1RF1B 4Y28J 3C9IA 1LNQA 1PPJG 1BE3G 2BCCG 1FAVA 1NYHA 2KS1A 3CCQP 3H1HG 2E75D 2A45I 3F89A 3TNUA 3T97A 3H1JD 1OW7A 1Y9BA 1L0LK 1KILB 4IL6H 1LT1A 2KSJA 1FZCA 3RBZA 1RF1A 3JC22 3H1IE 2WWWA 2QEXP 5AVTB 1RH5B 2WMMA 2B88A 5AVSB 2P1JA 3L72E 3WMM0 5AVYB 3M0DA 2LXCB 2HODB 1L0LJ 2JO1A 2ZAEB 1M56D 2KNCB 3TYYA 2SPZA 1KILA 2XU6A 1YHQP 2PAJA 1JO5A 3L35A 3GW6A 1SFCD 3L71D 1NO4A 5AVVB 1IFDA 1LTBC 3TF5A 4GIFA 3H1KE 1IC2A 2RMZA 3HRNA 1VDFA 1NGMB 4N6JA 2WPVB 4HB1A 4L73A 5AW6B 2HODA 4DZOA 2LKMA 4IFDK 2YMYA 4WY4B 2KNCA 2E75C 3HE5B 2QJPB 4EI2A 2O1KA 4IL6E 1BSHA 1GDTA 1KYOI 3G9RA 1N2DC 1SQBE 3CPWO 2W6BA 2XKMA 2DW3A 1L4AD 2CPSA 3G4SP 3OA7A 1VQLP 3W67A 1L0LG 5KLVE 1XTCC 4WY4A 3TGUE 3S9OA 3HE5A 1QEXA 3H1KJ 4B86A 1NTMK 2OYIB 3FXDA 2KZJA 3HUSB 4KHXA 1JMBA 3G71P 1TU3F 1SFCC 2E76C 1IO4A 2IZ0A 3I56P 3FX0A 2L5GB 2KSEA 3R2PA 2YKOA 1JB0J 5L8RJ 1BSNA 1L2PA 3BCCJ 1G1IA 1NTMJ 2O01H 5TJHA 5AVUB 3D70A 3P7KA 1QVFO 2OYIA 1G1JA 2FBWC 3HUSA 5KLVJ 3TK1A 2Q3EA 2QJYB 2MJZA 1EZVD 2OGUA 4RKUJ 3CWBJ 5BU5A 1NTKE 1L4AC 1Y8AA 1FJKA 1GD2E 3H1KG 4H0LD 1BDDA 4NPFX 1N7SC 3A0BH 3MP7B 1EC5A 3KYQA 4H44D 1P84H 2Q6QA 3CXHD 1RE3C 1W2BO 2A06D 1VF5D 3M0AA 1YTZT 3BCCG 4RJTA 1NTMG 2R32A 1EQ7A 3L73J 2Q1KA 3KPEA 3CCMP 5APSA 5CCHA 2IZ1A 1AV1A 3RL0D 2V4HA 1K04A 5KKZC 1FZFA 3L70E 2IBZD 3H1LD 4L76A 5KLVG 3V2PA 1DD4A 1QVGO 4JPZB 3SWKA 3AE9C 1MFZA 3V2QA 2A45H 2YIUB 1E5WA 1USEA 2AEJA 2WVRA 4D6TD 1UIIA 2YO2A 1KN7A 2GM4A 1AQTA 2O01J 2H43A 1PGOA 4GDOA 1P84E 3CWBD 3BVHA 1KILD 3OJAB 2ITAA 4H44C 2FY8A 1YJWP 1M57D 1NAYA 1SP4A 4K3AA 2I8DA 1VF5C 2LXBA 1OVRA 1PP9E 1SQPD 1SLQA 4Y99B 2FYUD 1NTKG 3KZIH 2O01N 3NMDA 4TT3H 2BEZF 5AVXB 1S4XA 3L73D 3UIAA 1IFJA 2OYHB 1Q7YQ 2WITA 4YPCA 3RL0g 1RE4A 1FZAA 4N78E 1GL2B 1FOSF 5KJ7C 4R4LA 1ZXGA 2IX7C 3VP8A 1KORA 3LIEA 4ASWA 2QM8A 4WY4D 1N7LA 2ZVNB 3AEAC 1VQ7P 2B89A 3M0DC 1HH0A 1X79B 2ZXEB 4PV1B 2IFMA 4C7RA 1KILC 2OYHA 1AJYA 1AQ5A 3CLQA 2XNXA 1GL2A 1VQOP 1R5LA 2ZFCA 3USSA 5KTBA 1IK7A 2MKVA 2AXCA 2VRSA 3KQGA 2WPQA 1SQQE 1T2KD 3KZIE 2P67A 4U3FD 2Y0EA 3I55P 1H88A 2R5BA 1J1EB 1LTJB 2YXRB 5AVQB 1NJIQ 2YNYA 4QMAA 3PHLA 4K35A 3A5TA 1PPJE 2Q5UA 4O9BA 1RF0A 3V4QA 1ZV8A 2HFED 2O1JA 1HTLC 1PZQA 3H1HE 4HKZH 1LTSC 1JY2O 2WSCH 3LIDA 1LTJA 1R8EA 2NPSB 2QJPC 1KV4A 3V6IA 5CBNA 4DT0A 1SQQJ 1A02F 1S5LX 1ZW0A 2QVAA 2WT7B 1L0NK 1YQ3C 3C8VA 2R3SA 1AVOA 3M9QA 3RGUA 3CCLP 5BVZA 5CCHD 4U7JA 3H1JJ 4TLFA 2NPSA 1T2KC 1GK6A 2OYIC 1LTAC 3HUSC 1OW8A 3WUVA 1IFNA 1CSBA 2WT7A 3E1RA 4H0LB 5CBOA 3H6PA 1FU1A 4R4MA 4AUWA 4BWNA 4GODA 1GK4A 2K37A 1FDMA 3PJSK 1FZGA 4DOJA 2FXOA 3Q5SA 3D6YA 3RK3B 2FYNB 2GUSA 2RKLA 2PP6A 3AE8C 3CX5H 2YO3A 1P84I 3VN0A 3BRVB 2FXPA 2JR8A 3L71J 2K9JB 3B5NB 1VPCA 1SQQG 1OMIA 2XDJA 3B71A 1KC8Q 2FFDC 2KZIA 4JYCA 2QJYC 3N4XA 2CK3H 1HGZA 2E42A 1HVVA 1L0LE 3H1JG 4PD4D 3CXHH 3Q1MA 5CCHC 1VQ9P 2P58A 2K9JA 3B5NA 4GT1A 1JY2N 2WSCJ 1BGYD 4JF7A 1YQ4C 3M06A 3CCSP 1SQVD 1OVUA 2D2CB 2J59M 1L0ND 1FBMA 4NPDA 1JY2P 5AW5B 3CX5E 3CC2P 1OX3A 1KFMA 1EZVE 4PJ0H 3CC7P 1YTZI 2QG4A 3L71G 1URQC 3L75D 4HH2A 3P8CD 3OW2O 2J5UA 1EXJA 1KTMA 1GL2D 1X9VA 2QA4P 3BRTB 2PGDA 3CXHE 1H89A 3TSIA 3ZDMA 2OTLP 1YBKA 1HWTC 4PV1D 2OTKE 4CPGA 5CCGA 2M3BA 4WVZA 2RH0A 4AYCA 4GOEA 2B9BA 3BATA 2IBZE 3H1LE 1HF9A 3BCCE 1NTME 2HPCB 1WRGA 3KDPB 4Y99C 2OYOA 5DJUB 1RHZB 1OVVA 2E74B 3GLMA 1NU1D 1JMMA 1ZR4A 2H88C 5APWA 5K5GB 4WB4A 2M0BA 3CWBE 2JP3A 1FS0E 1KILE 1VQ6P 3IF4A 4WBAA 2HPCA 4WWIA 1JUNA 5APVA 3MD0A 3S1KA 3AEDC 1KD1Q 3H1LJ 2NPSD 3M9HA 3U1CA 3P8MC 1FZBA 5AW0B 3L74D 5CMZA 1EZVG 1J1DC 1SQPE 1GW4A 1X8YA 1H0TB 2FYUE 3VMZA 1SVFA 4L74A 4IL6X 4D6TJ 1FC2C 1SS1A 1M1KQ 5H2FH 3L73E 5AW3B 1BCCD 1RF0C 3CI9A 2C9LY 2XZRA 3AEEC 2KLUA 4RO0A 4IOIH 1SQPK 1OIPA 5EFWB 1KB9H 2FYUK 2KOGA 3V2RA 3H1ID 1NTZK 3FGAD 5KLIB 2A06G 1H0TA 2HYNA 2M5AB 3L72D 3SWFA 1S3JA 1SQPJ 1EDLA 3AE4C 2ZYDA 1Q81Q 3RK3D 4I2LC 5TISH 2FYUJ 3AE2C 2IBZG 3H1LG 3KXDA 1OZHA 1VQ5P 1HGVA 2NPSC 3B5ND 4HYTB 3R4YA 1LWUC 2M5AA 4U3FE 1K05A 2V7QJ 1VQKP 5KAFH 2YXQB 4D6TG 5H2FE 3TDKA 2Z5IA 1EXIA 2ZT9B 3CX5I 2W27A 2I1JA 3GMAA 1EZVI 3CWBG 3NXSA 1JTHB 1KB9E 3A7OA 5GTIH 1SQBD 1LTTC 2KXPB 4OWFA 1IK9A 3L4FA 3A0BE 1GMJA 1N8RQ 4H0LC 2K9YA 2D2CD 4L75A 2R3CA 1UIXA 1SQPG 3TGUD 1PGPA 3GHGB 3GF7A 3CXHI 4IFMA 4U3FJ 1ZOYC 2FYUG 3WUUA 3Q5RA 1JOCA 1JTHA 3QWOC 3RK3C 2FYNC 1FDIA 1IFPA 1VQPP 3L73G 1HJBA 4DJGA 1W2EA 1U57A 1S5LH 3B5NC 3MIWA 4H13D 2K88A 3W68A 5KAFE 5CCGD 3B4SA 3FWLA 1LJ2A 1ZMEC 3RL0C 3E1IA 4PD4H 1M1JB 1NTZD 2IBZI 1NVOA 3GHGA 2YKPA 1YI2P 1FZCC 1RF1C
chains in the Genus database with same CATH topology
2NPSA 3TYYA 1T2KC 1KZUB 5APUA 5AW2B 3RK2D 1KILA 1GK6A 2XU6A 1Z56A 2OYIC 1RY3A 2PAJA 1JO5A 3L35A 1LTAC 1NKNA 1SFCD 2Q3IA 3HUSC 3MUDA 1NO4A 1T3JA 1IFNA 4W80A 1CSBA 2WT7A 5AVVB 2POHA 2WPSA 3L36A 1DH3A 1IFDA 1FJPA 1LTBC 3H6PA 1FU1A 3HD7B 4GIFA 1M1JA 4AUWA 1WT6A 2C0WA 1IC2A 1GK4A 1FDMA 3HRNA 1VDFA 4ZKUA 2IPPA 1FZGA 1T3UA 4N6JA 1PFIA 5AW6B 4C7NA 4DOJA 2FFDA 2HODA 4DZOA 2LKMA 4IFDK 2YMYA 4WY4B 1IFMA 1NTKK 4XA4A 3RK3B 3HE5B 1GU4A 2GUSA 1DEBA 2O1KA 2PP6A 2YO3A 1GDTA 3VN0A 3BRVB 1N2DC 3B5NB 1VPCA 5AW1B 2I1KA 2KP8A 3N7NA 2XDJA 3IFMA 3VYIA 2XV5A 3V4WA 4EIJA 3HD7A 2FFDC 4JYCA 2E43A 2W6BA 1ZN5A 2XKMA 1GZLA 5AW9B 5CCGC 1L4AD 3OAKA 1SQXK 1URQB 2Q7CA 2M8RA 2CPSA 1CW5A 3I5CA 3N4XA 3OA7A 3H32B 3CL3D 2Q9IA 1XTCC 4WY4A 1HGZA 2E42A 1N73C 3HE5A 2R5DA 2WTYA 1HVVA 5APXA 5APYA 4B86A 5KJ7D 1NTMK 3B8EB 2OYIB 5CCHC 1J2JB 1N86A 3HUSB 1MV8A 3B5NA 2WZ7A 4GT1A 4KHXA 1JY2N 1KQLA 3VOPA 1SFCC 1IO4A 1N7SB 2L5GB 3EQ2A 4JF7A 4WY4C 1HBWA 2P7JA 3IR9A 3HE4B 2N1TD 3M06A 3R2PA 1URQA 1KFNA 2YKOA 2J59M 3VMXA 3H32A 1LT9C 1G1IA 2O01H 3U1AA 1FBMA 5AVUB 1GW3A 3BASA 1JY2P 1SQVK 5AW5B 1FZEA 5AW8B 2N9BA 1XTGB 3P7KA 2OYIA 1G1JA 1KFMA 3M91A 3HUSA 2P2UA 3M9BA 1YTZI 1NH4A 1JCCA 3TK1A 1URQC 4W7ZA 4HH2A 1N7SA 3P8CD 2MJZA 3HE4A 1GL2D 1X9VA 2WPRA 1H8AA 5AW7B 5BU5A 3BRTB 1L4AC 1N73B 1FJKA 1RE3A 1GD2E 4JYBA 1H89A 5AW4B 1AFOA 3SWYA 3TSIA 1LTGC 1N7SC 1JNMA 1YYCA 3NFQA 3KYQA 1NHLA 1SFCB 3NTNA 1HWTC 4N3YB 1OWAA 2HG5D 2C0XA 5CCGA 2M3BA 1RE3C 3O8ZA 4AYCA 2WSFH 4N78D 5CJ0A 1LT9B 2OARA 3M0AA 1YTZT 3BATA 4OH8B 2FXMA 2N1TC 3MTUE 1N73A 1DX7A 2WSEH 2R32A 1EQ7A 4IFFA 3LW5H 3KPEA 1J1DB 2BASA 5APSA 5CCHA 3A2AA 1MUUA 4W7YA 1JCDA 3RL0D 2HPCB 1WRGA 3KDPB 4Y99C 1FZFA 1ZLLA 4EOTA 1SFCA 3A3YB 4LGDE 1M7LA 1T8ZA 3V2PA 5APQA 1QL2A 3II6A 1MFZA 1JMMA 3V2QA 1ZR4A 2A45H 1NWQA 1LT9A 1E5WA 1L4AB 5APWA 1NU1K 4WB4A 1JY3O 3RK2C 1ZR2A 2QM7A 2YO2A 1GTWA 2GM4A 4WBAA 2HPCA 2FYZA 1JUNA 5APVA 1G2CB 3MD0A 2H43A 3V2NA 5CHXA 5AVRB 2FKWB 2NPSD 1SQQK 3M9HA 3BVHA 1KILD 3VMYA 3U1CA 3OJAB 3G3ZA 3P8MC 1FZBA 5AW0B 1FOSE 5CMZA 1LGHB 3P8CE 2H7HA 1J1DC 1GW4A 1X8YA 1L4AA 2N1TB 1MZ9A 1IFIA 3VMZA 1SVFA 1SP4A 4LLHA 2J58A 2YKQA 4M3LA 2GUVA 5AW3B 1LTIC 1LWUB 3VTPC 1SLQA 3HTKB 4Y99B 1G2CA 5KJ7A 1RF0C 1A02J 2KLVA 3CI9A 2C9LY 2XZRA 3MGNA 1HUCA 1NOHA 3NMDA 1SQPK 5AVXB 1IJDB 4LC1A 5APTA 2A45G 2FYUK 2KYVA 3UIAA 2KOGA 3V2RA 1IFJA 4I1LA 2OYHB 1NTZK 2IFNA 2WITA 2N1TA 1RE4A 1FZAA 3HD7D 2HYNA 5CJ4A 4N78E 3RK2B 1GL2B 1FOSF 3U59A 5KJ7C 3VP9A 2IX7C 3VP8A 1NKZB 3LIEA 3SWFA 1LWUA 5AVZB 3HTKA 2QM8A 4WY4D 1N7LA 3RK3D 4I2LC 3GHGC 2C9NY 3M0DC 2Z5HA 4C46A 1HH0A 1GU5A 1RE4C 3V5BA 1HGVA 2NPSC 1S9KE 3B5ND 2ZXEB 1X79B 1QL1A 3EFGA 5AVWB 3P32A 2IFMA 4C7RA 1KILC 2Z4EA 2OYHA 4HYTB 1AQ5A 2HLOA 4ZKPA 3CLQA 2XNXA 1LWUC 1GL2A 2ZFCA 5KTBA 1URQD 1S9KD 1M1JC 2VRSA 3KQGA 2Z5IA 2WPQA 1T2KD 1JY3N 3RL0B 2P67A 2I1JA 2W27A 1CZQA 2OYHC 3TNUB 4XE5B 1H88A 2R5BA 3NXSA 1J1EB 1LTJB 5AVQB 1JTHB 2YNYA 3A7OA 1GL2C 2CPBA 4GKGA 1LTTC 4RESB 1FZCB 1RF1B 3A5TA 1IK9A 3L4FA 5BU8B 1N7SD 3C9IA 1SQBK 3L37A 1JY3P 1FAVA 2KB7P 3HD7C 1CI6B 2Q5UA 4I6MC 1RF0A 4O9BA 3V4QA 2R3CA 1ZV8A 2HFED 2JEEA 2O1JA 3GHGB 1HTLC 2H8PD 4IFMA 2A45I 2JJLA 1LTSC 1JY2O 2WSCH 3TNUA 3LIDA 1LTJA 3T97A 1JOCA 1JTHA 5KLVK 1NAFA 3RK3C 2NPSB 1L0LK 1KILB 1OXZA 1HJBA 1W2EA 2KSJA 1FZCA 1A02F 1RF1A 3B5NC 3MIWA 2WWWA 2WT7B 1L0NK 5AVTB 5CCGD 3PP5A 3RL0C 3E1IA 1CI6A 5AVSB 1M1JB 2P1JA 1J1EC 1LTJC 4AQRD 2W6AA 3GHGA 2YKPA 3WMM0 3M9QA 4C7NB 5AVYB 5BVZA 2FFDB 3M0DA 2HODB 5CCHD 1FZCC 1RF1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G3Z A;  1SQV K;  1NU1 K;  2LKM A;  1L0N K;  4IFD K;  1NTK K;  3CLQ A;  1SQP K;  1SQX K;  2WSC H;  2FYU K;  2WSF H;  5KLV K;  3M9Q A;  2OAR A;  1L0L K;  1NTZ K;  1SQB K;  2WSE H;  2J59 M;  1SQQ K;  1NTM K;  3LW5 H;  2O01 H; 
#chains in the Genus database with same CATH topology
 2JKV A;  5GTI E;  5APU A;  5AW2 B;  3RK2 D;  2H89 C;  1Z56 A;  2G3A A;  1RY3 A;  3CMA P;  1NKN A;  2Q3I A;  2QJK B;  1OFC X;  3L36 A;  1FJP A;  2PFX A;  3HD7 B;  2L91 A;  1VQ8 P;  1M1J A;  2IPP A;  2G8Y A;  1AVY A;  2E76 B;  2D2C C;  4U3F G;  2N9Y B;  3AEC C;  1IFM A;  1DEB A;  2Y9Y A;  1S5L E;  5AW1 B;  2I1K A;  2E74 D;  2KP8 A;  2OQQ A;  1SQX D;  3VYI A;  4EIJ A;  3HD7 A;  4PD4 E;  3CCJ P;  2E43 A;  1ZN5 A;  5CCG C;  1S1C X;  3OAK A;  1CW5 A;  1JM0 A;  2YMK A;  4EYY Q;  1K8A Q;  2R5D A;  2WTY A;  1BGY E;  3B8E B;  3L70 D;  3H1J E;  1J2J B;  3AE5 C;  1KQL A;  3CCE P;  1L0N E;  3EFF K;  3C1L A;  1N7S B;  2JWD A;  1S2E A;  3CCV P;  1RQU A;  4WY4 C;  1HBW A;  3IR9 A;  1QGK B;  4I7Z B;  3VMX A;  2IYP A;  1Q82 Q;  3U1A A;  3BAS A;  1SQV K;  2HR3 A;  5AW8 B;  2GA1 A;  1P84 D;  3M9B A;  3QH9 A;  3PTZ A;  3L71 E;  1BGY J;  1N7S A;  2E74 C;  5KKZ B;  3JCU H;  2WSS H;  1SQV J;  2WPR A;  1H8A A;  1USD A;  2Y0C A;  1L0N J;  3Q3D A;  1N73 B;  3AEG C;  1RE3 A;  1PP9 D;  1U7M A;  1YJN P;  1AFO A;  3SWY A;  1KB9 I;  3NFQ A;  3L75 J;  3NTN A;  4N3Y B;  2W90 A;  2C0X A;  2QIW A;  4A7P A;  4N78 D;  3LW5 J;  5CJ0 A;  1LT9 B;  2OAR A;  4OH8 B;  2FXM A;  5GTH H;  1N73 A;  2WSE H;  4IFF A;  2BAS A;  2ZT9 D;  4W7Y A;  1JCD A;  4EOT A;  2IDB A;  1S72 P;  4LGD E;  4DCK A;  1M7L A;  3WUT A;  1BGY G;  1VL2 A;  3JSV C;  3JCU E;  1QL2 A;  1KQF B;  2QE7 H;  1SQV G;  1NWQ A;  1LT9 A;  3Q2Y A;  5KLI C;  1K73 Q;  1L0N G;  1NU1 K;  1JY3 O;  1ZRT D;  1ZR2 A;  2QM7 A;  1GTW A;  1PGQ A;  3L74 E;  2FYZ A;  2W6J H;  1G2C B;  3V2N A;  5CHX A;  5AVR B;  2FKW B;  1ZP0 C;  3L75 G;  5KAI H;  1NU1 J;  1LGH B;  1BCC E;  3VMA A;  5GTH E;  2N1T B;  1MZ9 A;  1PPJ D;  2P10 A;  3ABV C;  1KYO D;  1BE3 D;  4LLH A;  2BCC D;  2GUV A;  2R44 A;  4H13 B;  1LTI C;  3H1H D;  1G2C A;  5KJ7 A;  1A02 J;  2KLV A;  1AA0 A;  2ZT9 C;  3MGN A;  2LR2 A;  1NOH A;  2WQY C;  1JEK A;  1PGJ A;  1IZN B;  2QRX A;  1LP1 B;  3MHV A;  2YIU C;  3AE7 C;  5APT A;  3L74 J;  2IFN A;  2N1T A;  4PD4 I;  3RK3 E;  3HD7 D;  2A06 E;  3RK2 B;  3U59 A;  3VP9 A;  2E76 D;  5AVZ B;  1BCC J;  4YXW H;  5DJT B;  3GHG C;  2WSE J;  2C9N Y;  3SSU A;  1LP1 A;  5KAI E;  1R5S A;  1RE4 C;  1QX8 A;  2KK7 A;  1QL1 A;  3EFG A;  3P32 A;  2Z4E A;  3H1I J;  1NU1 G;  2E5Y A;  4PJ0 E;  2HLO A;  3O6Q B;  3L72 J;  5B66 H;  1S9K D;  3A0H H;  4XFJ A;  2V7Q H;  1M1J C;  4D6T E;  1DIP A;  1HJ0 A;  3CCU P;  1JY3 N;  2OYH C;  4XE5 B;  2AEF A;  1VQN P;  1KQS O;  1GL2 C;  2CPB A;  3L74 G;  4GKG A;  5B5E H;  4RES B;  5BU8 B;  4YXD C;  2QJK C;  1N7S D;  1SQB K;  3O6Q A;  3L37 A;  1JY3 P;  2Y0D A;  2KB7 P;  3HD7 C;  1M90 Q;  1CI6 B;  4I6M C;  2JEE A;  1BCC G;  1PIX A;  2H8P D;  4PV1 C;  1L0L D;  2JJL A;  4UB6 H;  1YJ9 P;  5KLV K;  1W5C E;  1NAF A;  1NTZ E;  1OXZ A;  1SQB J;  3AEF C;  2KUB A;  3H1I G;  2BEQ D;  3IN6 A;  4NPE A;  4MN4 C;  3PP5 A;  2AEM A;  5B66 E;  3L72 G;  1VQ4 P;  3F5H A;  3A0H E;  1CI6 A;  1J1E C;  1LTJ C;  4AQR D;  2W6A A;  1PL5 A;  3TGU J;  4C7N B;  2FFD B;  3CX5 D;  1M8O B;  1EDK A;  1KZU B;  4UB8 H;  3PH0 A;  5B5E E;  4JBZ A;  1EDI A;  4OGQ B;  1DEE G;  3MUD A;  1T3J A;  4W80 A;  3FXE A;  2POH A;  2WPS A;  2W83 C;  4Z1M H;  1DH3 A;  1WT6 A;  2C0W A;  1NTZ J;  4ZKU A;  1T3U A;  1PFI A;  4C7N A;  2FFD A;  4I7Z C;  4UB6 E;  1MFT A;  1NTK K;  4XA4 A;  1SQX E;  1GU4 A;  3H1K D;  1EDJ A;  1SQB G;  1BDC A;  2IYO A;  3N7N A;  3IFM A;  2O3J A;  2XV5 A;  3IAO A;  3V4W A;  1GZL A;  5AW9 B;  1NTK J;  1SQX K;  1URQ B;  4HJG H;  2M8R A;  2Q7C A;  3I5C A;  3TGU G;  3BCC D;  3H32 B;  1NTM D;  3CL3 D;  2Q9I A;  1N73 C;  5APX A;  5APY A;  4UB8 E;  5KJ7 D;  3ITK A;  1N86 A;  1MV8 A;  2WZ7 A;  3S4R A;  4GOF A;  3FWN A;  3VOP A;  5KLV D;  1Q86 Q;  5TIS E;  1SQX J;  2PRR A;  2QSI A;  1FE6 A;  3EQ2 A;  2RN0 A;  2P7J A;  1KMI Z;  1NTZ G;  2N1T D;  3HE4 B;  1URQ A;  1KFN A;  3H32 A;  3CC4 P;  3D71 A;  1LT9 C;  3RBX A;  1GW3 A;  2E75 B;  2Y9Z A;  1FZE A;  2N9B A;  1XTG B;  3L70 J;  3M91 A;  3D6Z A;  3CD6 P;  4ZMD A;  2P2U A;  2E5T A;  2K3R A;  1NH4 A;  1JCC A;  4W7Z A;  1YIT P;  1OW6 A;  3HE4 A;  1X22 A;  4BXL A;  2ZXX A;  5AW7 B;  3WU2 H;  4JYB A;  5AW4 B;  2AXT H;  4JQ0 D;  1LTG C;  4ASV A;  1JNM A;  2ZJS E;  1YYC A;  1NTK D;  1NHL A;  1SFC B;  1KYO H;  1SQX G;  1OWA A;  2HG5 D;  1PV3 A;  3CCR P;  3O8Z A;  2WSF H;  2JWA A;  4KT0 J;  2XND H;  3Q5P A;  1D7M A;  2N1T C;  3MTU E;  1DX7 A;  1PP9 J;  3LW5 H;  1J1D B;  1RQV A;  3A2A A;  1MUU A;  3KHU A;  3G6E P;  3L70 G;  4H13 C;  1ZLL A;  1SFC A;  3A3Y B;  1ZRT E;  4EDF A;  3AE3 C;  1T8Z A;  3MZW B;  5APQ A;  1Q90 D;  2ZYG A;  3II6 A;  1X0T A;  3SFD C;  3WU2 E;  1L4A B;  1SQV E;  4YTP C;  1YIJ P;  3RK2 C;  1QLE D;  2AXT E;  2B87 B;  2OTJ P;  1KQG B;  1KB9 D;  1Q2N A;  1SQQ K;  3AEB C;  1KYO E;  1BE3 E;  3VMY A;  2BCC E;  3G3Z A;  1FOS E;  3L75 E;  1VQM P;  3P8C E;  4ZNC A;  2H7H A;  3K5B A;  2NZ2 A;  1L4A A;  1IFI A;  3AE1 C;  2W8Z A;  2J58 A;  1PP9 G;  2YKQ A;  3GG2 A;  4M3L A;  1LWU B;  3VTP C;  3HTK B;  2B87 A;  5E79 H;  1HUC A;  2JDI H;  1IJD B;  2NRG A;  4LC1 A;  4OGQ D;  2A45 G;  2KYV A;  5C39 A;  4I1L A;  4BRY B;  1T6A A;  3AE6 C;  5CJ4 A;  3H25 A;  1BE3 J;  2BCC J;  1NKZ B;  1DD3 A;  2WSF J;  3SFE C;  1LWU A;  3H1H J;  3HTK A;  3CME P;  1E79 H;  4KJM A;  2ZVO B;  3PRJ A;  2Z5H A;  4C46 A;  1Y47 A;  1GU5 A;  3V5B A;  4H44 B;  2UWJ E;  1S9K E;  2ZYA A;  5AVW B;  2KI7 B;  4OVN F;  4BRY A;  2KIK A;  1NU1 E;  3MUD C;  4ZKP A;  1VF5 B;  1MKM A;  5M1B A;  2K1A A;  3GF3 A;  1URQ D;  1K9M Q;  2M3E A;  2KS1 B;  3EWK A;  5E79 E;  3RL0 B;  1WMK A;  1CZQ A;  3TNU B;  3E7K A;  1U7J A;  3PLN A;  3T97 B;  1FDO A;  1SQQ D;  4OGQ C;  1FZC B;  1RF1 B;  4Y28 J;  3C9I A;  1LNQ A;  1PPJ G;  1BE3 G;  2BCC G;  1FAV A;  1NYH A;  2KS1 A;  3CCQ P;  3H1H G;  2E75 D;  2A45 I;  3F89 A;  3TNU A;  3T97 A;  3H1J D;  1OW7 A;  1Y9B A;  1L0L K;  1KIL B;  4IL6 H;  1LT1 A;  2KSJ A;  1FZC A;  3RBZ A;  1RF1 A;  3JC2 2;  3H1I E;  2WWW A;  2QEX P;  5AVT B;  1RH5 B;  2WMM A;  2B88 A;  5AVS B;  2P1J A;  3L72 E;  3WMM 0;  5AVY B;  3M0D A;  2LXC B;  2HOD B;  1L0L J;  2JO1 A;  2ZAE B;  1M56 D;  2KNC B;  3TYY A;  2SPZ A;  1KIL A;  2XU6 A;  1YHQ P;  2PAJ A;  1JO5 A;  3L35 A;  3GW6 A;  1SFC D;  3L71 D;  1NO4 A;  5AVV B;  1IFD A;  1LTB C;  3TF5 A;  4GIF A;  3H1K E;  1IC2 A;  2RMZ A;  3HRN A;  1VDF A;  1NGM B;  4N6J A;  2WPV B;  4HB1 A;  4L73 A;  5AW6 B;  2HOD A;  4DZO A;  2LKM A;  4IFD K;  2YMY A;  4WY4 B;  2KNC A;  2E75 C;  3HE5 B;  2QJP B;  4EI2 A;  2O1K A;  4IL6 E;  1BSH A;  1GDT A;  1KYO I;  3G9R A;  1N2D C;  1SQB E;  3CPW O;  2W6B A;  2XKM A;  2DW3 A;  1L4A D;  2CPS A;  3G4S P;  3OA7 A;  1VQL P;  3W67 A;  1L0L G;  5KLV E;  1XTC C;  4WY4 A;  3TGU E;  3S9O A;  3HE5 A;  1QEX A;  3H1K J;  4B86 A;  1NTM K;  2OYI B;  3FXD A;  2KZJ A;  3HUS B;  4KHX A;  1JMB A;  3G71 P;  1TU3 F;  1SFC C;  2E76 C;  1IO4 A;  2IZ0 A;  3I56 P;  3FX0 A;  2L5G B;  2KSE A;  3R2P A;  2YKO A;  1JB0 J;  5L8R J;  1BSN A;  1L2P A;  3BCC J;  1G1I A;  1NTM J;  2O01 H;  5TJH A;  5AVU B;  3D70 A;  3P7K A;  1QVF O;  2OYI A;  1G1J A;  2FBW C;  3HUS A;  5KLV J;  3TK1 A;  2Q3E A;  2QJY B;  2MJZ A;  1EZV D;  2OGU A;  4RKU J;  3CWB J;  5BU5 A;  1NTK E;  1L4A C;  1Y8A A;  1FJK A;  1GD2 E;  3H1K G;  4H0L D;  1BDD A;  4NPF X;  1N7S C;  3A0B H;  3MP7 B;  1EC5 A;  3KYQ A;  4H44 D;  1P84 H;  2Q6Q A;  3CXH D;  1RE3 C;  1W2B O;  2A06 D;  1VF5 D;  3M0A A;  1YTZ T;  3BCC G;  4RJT A;  1NTM G;  2R32 A;  1EQ7 A;  3L73 J;  2Q1K A;  3KPE A;  3CCM P;  5APS A;  5CCH A;  2IZ1 A;  1AV1 A;  3RL0 D;  2V4H A;  1K04 A;  5KKZ C;  1FZF A;  3L70 E;  2IBZ D;  3H1L D;  4L76 A;  5KLV G;  3V2P A;  1DD4 A;  1QVG O;  4JPZ B;  3SWK A;  3AE9 C;  1MFZ A;  3V2Q A;  2A45 H;  2YIU B;  1E5W A;  1USE A;  2AEJ A;  2WVR A;  4D6T D;  1UII A;  2YO2 A;  1KN7 A;  2GM4 A;  1AQT A;  2O01 J;  2H43 A;  1PGO A;  4GDO A;  1P84 E;  3CWB D;  3BVH A;  1KIL D;  3OJA B;  2ITA A;  4H44 C;  2FY8 A;  1YJW P;  1M57 D;  1NAY A;  1SP4 A;  4K3A A;  2I8D A;  1VF5 C;  2LXB A;  1OVR A;  1PP9 E;  1SQP D;  1SLQ A;  4Y99 B;  2FYU D;  1NTK G;  3KZI H;  2O01 N;  3NMD A;  4TT3 H;  2BEZ F;  5AVX B;  1S4X A;  3L73 D;  3UIA A;  1IFJ A;  2OYH B;  1Q7Y Q;  2WIT A;  4YPC A;  3RL0 g;  1RE4 A;  1FZA A;  4N78 E;  1GL2 B;  1FOS F;  5KJ7 C;  4R4L A;  1ZXG A;  2IX7 C;  3VP8 A;  1KOR A;  3LIE A;  4ASW A;  2QM8 A;  4WY4 D;  1N7L A;  2ZVN B;  3AEA C;  1VQ7 P;  2B89 A;  3M0D C;  1HH0 A;  1X79 B;  2ZXE B;  4PV1 B;  2IFM A;  4C7R A;  1KIL C;  2OYH A;  1AJY A;  1AQ5 A;  3CLQ A;  2XNX A;  1GL2 A;  1VQO P;  1R5L A;  2ZFC A;  3USS A;  5KTB A;  1IK7 A;  2MKV A;  2AXC A;  2VRS A;  3KQG A;  2WPQ A;  1SQQ E;  1T2K D;  3KZI E;  2P67 A;  4U3F D;  2Y0E A;  3I55 P;  1H88 A;  2R5B A;  1J1E B;  1LTJ B;  2YXR B;  5AVQ B;  1NJI Q;  2YNY A;  4QMA A;  3PHL A;  4K35 A;  3A5T A;  1PPJ E;  2Q5U A;  4O9B A;  1RF0 A;  3V4Q A;  1ZV8 A;  2HFE D;  2O1J A;  1HTL C;  1PZQ A;  3H1H E;  4HKZ H;  1LTS C;  1JY2 O;  2WSC H;  3LID A;  1LTJ A;  1R8E A;  2NPS B;  2QJP C;  1KV4 A;  3V6I A;  5CBN A;  4DT0 A;  1SQQ J;  1A02 F;  1S5L X;  1ZW0 A;  2QVA A;  2WT7 B;  1L0N K;  1YQ3 C;  3C8V A;  2R3S A;  1AVO A;  3M9Q A;  3RGU A;  3CCL P;  5BVZ A;  5CCH D;  4U7J A;  3H1J J;  4TLF A;  2NPS A;  1T2K C;  1GK6 A;  2OYI C;  1LTA C;  3HUS C;  1OW8 A;  3WUV A;  1IFN A;  1CSB A;  2WT7 A;  3E1R A;  4H0L B;  5CBO A;  3H6P A;  1FU1 A;  4R4M A;  4AUW A;  4BWN A;  4GOD A;  1GK4 A;  2K37 A;  1FDM A;  3PJS K;  1FZG A;  4DOJ A;  2FXO A;  3Q5S A;  3D6Y A;  3RK3 B;  2FYN B;  2GUS A;  2RKL A;  2PP6 A;  3AE8 C;  3CX5 H;  2YO3 A;  1P84 I;  3VN0 A;  3BRV B;  2FXP A;  2JR8 A;  3L71 J;  2K9J B;  3B5N B;  1VPC A;  1SQQ G;  1OMI A;  2XDJ A;  3B71 A;  1KC8 Q;  2FFD C;  2KZI A;  4JYC A;  2QJY C;  3N4X A;  2CK3 H;  1HGZ A;  2E42 A;  1HVV A;  1L0L E;  3H1J G;  4PD4 D;  3CXH H;  3Q1M A;  5CCH C;  1VQ9 P;  2P58 A;  2K9J A;  3B5N A;  4GT1 A;  1JY2 N;  2WSC J;  1BGY D;  4JF7 A;  1YQ4 C;  3M06 A;  3CCS P;  1SQV D;  1OVU A;  2D2C B;  2J59 M;  1L0N D;  1FBM A;  4NPD A;  1JY2 P;  5AW5 B;  3CX5 E;  3CC2 P;  1OX3 A;  1KFM A;  1EZV E;  4PJ0 H;  3CC7 P;  1YTZ I;  2QG4 A;  3L71 G;  1URQ C;  3L75 D;  4HH2 A;  3P8C D;  3OW2 O;  2J5U A;  1EXJ A;  1KTM A;  1GL2 D;  1X9V A;  2QA4 P;  3BRT B;  2PGD A;  3CXH E;  1H89 A;  3TSI A;  3ZDM A;  2OTL P;  1YBK A;  1HWT C;  4PV1 D;  2OTK E;  4CPG A;  5CCG A;  2M3B A;  4WVZ A;  2RH0 A;  4AYC A;  4GOE A;  2B9B A;  3BAT A;  2IBZ E;  3H1L E;  1HF9 A;  3BCC E;  1NTM E;  2HPC B;  1WRG A;  3KDP B;  4Y99 C;  2OYO A;  5DJU B;  1RHZ B;  1OVV A;  2E74 B;  3GLM A;  1NU1 D;  1JMM A;  1ZR4 A;  2H88 C;  5APW A;  5K5G B;  4WB4 A;  2M0B A;  3CWB E;  2JP3 A;  1FS0 E;  1KIL E;  1VQ6 P;  3IF4 A;  4WBA A;  2HPC A;  4WWI A;  1JUN A;  5APV A;  3MD0 A;  3S1K A;  3AED C;  1KD1 Q;  3H1L J;  2NPS D;  3M9H A;  3U1C A;  3P8M C;  1FZB A;  5AW0 B;  3L74 D;  5CMZ A;  1EZV G;  1J1D C;  1SQP E;  1GW4 A;  1X8Y A;  1H0T B;  2FYU E;  3VMZ A;  1SVF A;  4L74 A;  4IL6 X;  4D6T J;  1FC2 C;  1SS1 A;  1M1K Q;  5H2F H;  3L73 E;  5AW3 B;  1BCC D;  1RF0 C;  3CI9 A;  2C9L Y;  2XZR A;  3AEE C;  2KLU A;  4RO0 A;  4IOI H;  1SQP K;  1OIP A;  5EFW B;  1KB9 H;  2FYU K;  2KOG A;  3V2R A;  3H1I D;  1NTZ K;  3FGA D;  5KLI B;  2A06 G;  1H0T A;  2HYN A;  2M5A B;  3L72 D;  3SWF A;  1S3J A;  1SQP J;  1EDL A;  3AE4 C;  2ZYD A;  1Q81 Q;  3RK3 D;  4I2L C;  5TIS H;  2FYU J;  3AE2 C;  2IBZ G;  3H1L G;  3KXD A;  1OZH A;  1VQ5 P;  1HGV A;  2NPS C;  3B5N D;  4HYT B;  3R4Y A;  1LWU C;  2M5A A;  4U3F E;  1K05 A;  2V7Q J;  1VQK P;  5KAF H;  2YXQ B;  4D6T G;  5H2F E;  3TDK A;  2Z5I A;  1EXI A;  2ZT9 B;  3CX5 I;  2W27 A;  2I1J A;  3GMA A;  1EZV I;  3CWB G;  3NXS A;  1JTH B;  1KB9 E;  3A7O A;  5GTI H;  1SQB D;  1LTT C;  2KXP B;  4OWF A;  1IK9 A;  3L4F A;  3A0B E;  1GMJ A;  1N8R Q;  4H0L C;  2K9Y A;  2D2C D;  4L75 A;  2R3C A;  1UIX A;  1SQP G;  3TGU D;  1PGP A;  3GHG B;  3GF7 A;  3CXH I;  4IFM A;  4U3F J;  1ZOY C;  2FYU G;  3WUU A;  3Q5R A;  1JOC A;  1JTH A;  3QWO C;  3RK3 C;  2FYN C;  1FDI A;  1IFP A;  1VQP P;  3L73 G;  1HJB A;  4DJG A;  1W2E A;  1U57 A;  1S5L H;  3B5N C;  3MIW A;  4H13 D;  2K88 A;  3W68 A;  5KAF E;  5CCG D;  3B4S A;  3FWL A;  1LJ2 A;  1ZME C;  3RL0 C;  3E1I A;  4PD4 H;  1M1J B;  1NTZ D;  2IBZ I;  1NVO A;  3GHG A;  2YKP A;  1YI2 P;  1FZC C;  1RF1 C; 
#chains in the Genus database with same CATH homology
 2NPS A;  3TYY A;  1T2K C;  1KZU B;  5APU A;  5AW2 B;  3RK2 D;  1KIL A;  1GK6 A;  2XU6 A;  1Z56 A;  2OYI C;  1RY3 A;  2PAJ A;  1JO5 A;  3L35 A;  1LTA C;  1NKN A;  1SFC D;  2Q3I A;  3HUS C;  3MUD A;  1NO4 A;  1T3J A;  1IFN A;  4W80 A;  1CSB A;  2WT7 A;  5AVV B;  2POH A;  2WPS A;  3L36 A;  1DH3 A;  1IFD A;  1FJP A;  1LTB C;  3H6P A;  1FU1 A;  3HD7 B;  4GIF A;  1M1J A;  4AUW A;  1WT6 A;  2C0W A;  1IC2 A;  1GK4 A;  1FDM A;  3HRN A;  1VDF A;  4ZKU A;  2IPP A;  1FZG A;  1T3U A;  4N6J A;  1PFI A;  5AW6 B;  4C7N A;  4DOJ A;  2FFD A;  2HOD A;  4DZO A;  2LKM A;  4IFD K;  2YMY A;  4WY4 B;  1IFM A;  1NTK K;  4XA4 A;  3RK3 B;  3HE5 B;  1GU4 A;  2GUS A;  1DEB A;  2O1K A;  2PP6 A;  2YO3 A;  1GDT A;  3VN0 A;  3BRV B;  1N2D C;  3B5N B;  1VPC A;  5AW1 B;  2I1K A;  2KP8 A;  3N7N A;  2XDJ A;  3IFM A;  3VYI A;  2XV5 A;  3V4W A;  4EIJ A;  3HD7 A;  2FFD C;  4JYC A;  2E43 A;  2W6B A;  1ZN5 A;  2XKM A;  1GZL A;  5AW9 B;  5CCG C;  1L4A D;  3OAK A;  1SQX K;  1URQ B;  2Q7C A;  2M8R A;  2CPS A;  1CW5 A;  3I5C A;  3N4X A;  3OA7 A;  3H32 B;  3CL3 D;  2Q9I A;  1XTC C;  4WY4 A;  1HGZ A;  2E42 A;  1N73 C;  3HE5 A;  2R5D A;  2WTY A;  1HVV A;  5APX A;  5APY A;  4B86 A;  5KJ7 D;  1NTM K;  3B8E B;  2OYI B;  5CCH C;  1J2J B;  1N86 A;  3HUS B;  1MV8 A;  3B5N A;  2WZ7 A;  4GT1 A;  4KHX A;  1JY2 N;  1KQL A;  3VOP A;  1SFC C;  1IO4 A;  1N7S B;  2L5G B;  3EQ2 A;  4JF7 A;  4WY4 C;  1HBW A;  2P7J A;  3IR9 A;  3HE4 B;  2N1T D;  3M06 A;  3R2P A;  1URQ A;  1KFN A;  2YKO A;  2J59 M;  3VMX A;  3H32 A;  1LT9 C;  1G1I A;  2O01 H;  3U1A A;  1FBM A;  5AVU B;  1GW3 A;  3BAS A;  1JY2 P;  1SQV K;  5AW5 B;  1FZE A;  5AW8 B;  2N9B A;  1XTG B;  3P7K A;  2OYI A;  1G1J A;  1KFM A;  3M91 A;  3HUS A;  2P2U A;  3M9B A;  1YTZ I;  1NH4 A;  1JCC A;  3TK1 A;  1URQ C;  4W7Z A;  4HH2 A;  1N7S A;  3P8C D;  2MJZ A;  3HE4 A;  1GL2 D;  1X9V A;  2WPR A;  1H8A A;  5AW7 B;  5BU5 A;  3BRT B;  1L4A C;  1N73 B;  1FJK A;  1RE3 A;  1GD2 E;  4JYB A;  1H89 A;  5AW4 B;  1AFO A;  3SWY A;  3TSI A;  1LTG C;  1N7S C;  1JNM A;  1YYC A;  3NFQ A;  3KYQ A;  1NHL A;  1SFC B;  3NTN A;  1HWT C;  4N3Y B;  1OWA A;  2HG5 D;  2C0X A;  5CCG A;  2M3B A;  1RE3 C;  3O8Z A;  4AYC A;  2WSF H;  4N78 D;  5CJ0 A;  1LT9 B;  2OAR A;  3M0A A;  1YTZ T;  3BAT A;  4OH8 B;  2FXM A;  2N1T C;  3MTU E;  1N73 A;  1DX7 A;  2WSE H;  2R32 A;  1EQ7 A;  4IFF A;  3LW5 H;  3KPE A;  1J1D B;  2BAS A;  5APS A;  5CCH A;  3A2A A;  1MUU A;  4W7Y A;  1JCD A;  3RL0 D;  2HPC B;  1WRG A;  3KDP B;  4Y99 C;  1FZF A;  1ZLL A;  4EOT A;  1SFC A;  3A3Y B;  4LGD E;  1M7L A;  1T8Z A;  3V2P A;  5APQ A;  1QL2 A;  3II6 A;  1MFZ A;  1JMM A;  3V2Q A;  1ZR4 A;  2A45 H;  1NWQ A;  1LT9 A;  1E5W A;  1L4A B;  5APW A;  1NU1 K;  4WB4 A;  1JY3 O;  3RK2 C;  1ZR2 A;  2QM7 A;  2YO2 A;  1GTW A;  2GM4 A;  4WBA A;  2HPC A;  2FYZ A;  1JUN A;  5APV A;  1G2C B;  3MD0 A;  2H43 A;  3V2N A;  5CHX A;  5AVR B;  2FKW B;  2NPS D;  1SQQ K;  3M9H A;  3BVH A;  1KIL D;  3VMY A;  3U1C A;  3OJA B;  3G3Z A;  3P8M C;  1FZB A;  5AW0 B;  1FOS E;  5CMZ A;  1LGH B;  3P8C E;  2H7H A;  1J1D C;  1GW4 A;  1X8Y A;  1L4A A;  2N1T B;  1MZ9 A;  1IFI A;  3VMZ A;  1SVF A;  1SP4 A;  4LLH A;  2J58 A;  2YKQ A;  4M3L A;  2GUV A;  5AW3 B;  1LTI C;  1LWU B;  3VTP C;  1SLQ A;  3HTK B;  4Y99 B;  1G2C A;  5KJ7 A;  1RF0 C;  1A02 J;  2KLV A;  3CI9 A;  2C9L Y;  2XZR A;  3MGN A;  1HUC A;  1NOH A;  3NMD A;  1SQP K;  5AVX B;  1IJD B;  4LC1 A;  5APT A;  2A45 G;  2FYU K;  2KYV A;  3UIA A;  2KOG A;  3V2R A;  1IFJ A;  4I1L A;  2OYH B;  1NTZ K;  2IFN A;  2WIT A;  2N1T A;  1RE4 A;  1FZA A;  3HD7 D;  2HYN A;  5CJ4 A;  4N78 E;  3RK2 B;  1GL2 B;  1FOS F;  3U59 A;  5KJ7 C;  3VP9 A;  2IX7 C;  3VP8 A;  1NKZ B;  3LIE A;  3SWF A;  1LWU A;  5AVZ B;  3HTK A;  2QM8 A;  4WY4 D;  1N7L A;  3RK3 D;  4I2L C;  3GHG C;  2C9N Y;  3M0D C;  2Z5H A;  4C46 A;  1HH0 A;  1GU5 A;  1RE4 C;  3V5B A;  1HGV A;  2NPS C;  1S9K E;  3B5N D;  2ZXE B;  1X79 B;  1QL1 A;  3EFG A;  5AVW B;  3P32 A;  2IFM A;  4C7R A;  1KIL C;  2Z4E A;  2OYH A;  4HYT B;  1AQ5 A;  2HLO A;  4ZKP A;  3CLQ A;  2XNX A;  1LWU C;  1GL2 A;  2ZFC A;  5KTB A;  1URQ D;  1S9K D;  1M1J C;  2VRS A;  3KQG A;  2Z5I A;  2WPQ A;  1T2K D;  1JY3 N;  3RL0 B;  2P67 A;  2I1J A;  2W27 A;  1CZQ A;  2OYH C;  3TNU B;  4XE5 B;  1H88 A;  2R5B A;  3NXS A;  1J1E B;  1LTJ B;  5AVQ B;  1JTH B;  2YNY A;  3A7O A;  1GL2 C;  2CPB A;  4GKG A;  1LTT C;  4RES B;  1FZC B;  1RF1 B;  3A5T A;  1IK9 A;  3L4F A;  5BU8 B;  1N7S D;  3C9I A;  1SQB K;  3L37 A;  1JY3 P;  1FAV A;  2KB7 P;  3HD7 C;  1CI6 B;  2Q5U A;  4I6M C;  1RF0 A;  4O9B A;  3V4Q A;  2R3C A;  1ZV8 A;  2HFE D;  2JEE A;  2O1J A;  3GHG B;  1HTL C;  2H8P D;  4IFM A;  2A45 I;  2JJL A;  1LTS C;  1JY2 O;  2WSC H;  3TNU A;  3LID A;  1LTJ A;  3T97 A;  1JOC A;  1JTH A;  5KLV K;  1NAF A;  3RK3 C;  2NPS B;  1L0L K;  1KIL B;  1OXZ A;  1HJB A;  1W2E A;  2KSJ A;  1FZC A;  1A02 F;  1RF1 A;  3B5N C;  3MIW A;  2WWW A;  2WT7 B;  1L0N K;  5AVT B;  5CCG D;  3PP5 A;  3RL0 C;  3E1I A;  1CI6 A;  5AVS B;  1M1J B;  2P1J A;  1J1E C;  1LTJ C;  4AQR D;  2W6A A;  3GHG A;  2YKP A;  3WMM 0;  3M9Q A;  4C7N B;  5AVY B;  5BVZ A;  2FFD B;  3M0D A;  2HOD B;  5CCH D;  1FZC C;  1RF1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...