2LKMA

Structural basis for molecular interactions involving mrg domains: implications in chromatin biology
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
42
structure length
42
Chain Sequence
b'DYVQPQLRRPFELLIAAAMERNPTQFQLPNELTCTTALPGSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHD finger protein 12
publication title Structural basis for molecular interactions involving MRG domains: implications in chromatin biology.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 5
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2011-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16737 PHF12_MRG_bd PHD finger protein 12 MRG binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2lkmA01
2LKMA 1NTKK 1NTZK 2WSEH 1SQQK 1SQVK 1SQXK 3M9QA 1L0NK 2O01H 4IFDK 2J59M 2WSCH 3G3ZA 3CLQA 1NTMK 3LW5H 1NU1K 1SQPK 1SQBK 2FYUK 2WSFH 5KLVK 2OARA 1L0LK
chains in the Genus database with same CATH superfamily
5AW7B 1OXZA 3SFDC 1KMIZ 1ZRTD 3RK3B 3HD7B 1K05A 1DD4A 1H0TB 4ASVA 3AE9C 1S4XA 4TT3H 3CXHD 1PPJD 4TLFA 4JBZA 1FOSE 1W5CE 3U1AA 4Y28J 2WT7A 1S5LE 1N7SD 1MUUA 1NTKD 3TGUD 2V4HA 5KLVE 2JKVA 3H1HD 1AVYA 1BDDA 2YO2A 1NTZG 2N1TA 1LTJA 5AVTB 3RK2C 3B5NB 2Q7CA 1PGQA 1LTBC 1L4AC 1GU4A 1U57A 2QSIA 4RJTA 2W83C 3A7OA 5TJHA 1N8RQ 1NHLA 3ZDMA 4L75A 1OVRA 2POHA 1QX8A 1SP4A 4KJMA 2H8PD 4H13B 5KLVD 2HR3A 2JEEA 2E5YA 1TU3F 1N7SB 5APUA 2Z5IA 4OGQD 1QL1A 3P8CE 4NPEA 2WMMA 5AVVB 2JR8A 3QWOC 2IYOA 2KUBA 3MUDA 2M0BA 2Y0EA 4ZNCA 2W90A 3TNUA 4N78E 2H88C 1IFNA 1E5WA 1ZV8A 3VTPC 1KFMA 1KYOI 2FXOA 4HB1A 3TGUJ 1SQPE 3P8CD 5E79H 2WSCJ 5L8RJ 3Q5PA 1PV3A 1ZW0A 1AQ5A 1BE3E 3H1KG 2WSFJ 3CL3D 4L76A 1QVGO 5KJ7D 1FDMA 1LTJC 4N78D 3JSVC 5AVYB 2Z4EA 2B89A 1LT1A 1MKMA 2A06E 4GOFA 1JOCA 2OGUA 2R44A 1R8EA 3VMAA 3HD7A 2QJKC 1H0TA 2SPZA 2YKOA 1SQPD 1KB9I 4RESB 1L2PA 3L70E 2KIKA 2WSEJ 2E76D 2O3JA 3L75D 5APYA 2Y0DA 1VQ6P 2ZJSE 3FWNA 1EDLA 2J5UA 4HYTB 2WSCH 1FC2C 3MUDC 2IZ1A 2KYVA 1SQBD 2HPCB 3RGUA 1GK4A 1Q7YQ 3FXEA 1GL2B 3QH9A 3B5NA 3VMZA 4C7NB 4WWIA 2I1JA 3GHGB 4DOJA 3BRVB 1NTZE 2ITAA 1SQQG 1OMIA 3KPEA 1GU5A 5DJUB 1LT9B 2QJYB 1YQ4C 4PD4H 3R4YA 1N7SA 5KTBA 2AEMA 1SQXG 4W7YA 2OYOA 4I7ZC 1HWTC 2E74C 3HUSB 1NTZD 2YIUB 1T3JA 1P84H 2RKLA 1VQ8P 3EFGA 4NPDA 3RBZA 3LW5J 3JCUH 1SQPJ 1FZCB 3RK2D 1VL2A 3HD7C 5GTIE 2QG4A 1L4AD 2OQQA 3CC4P 3CCJP 1VQNP 2H43A 5AW3B 3SWKA 2L5GB 1BE3J 1XTCC 1EZVI 4PV1D 1UIXA 1ZMEC 1IZNB 1J1DC 2C0XA 3AEFC 3E7KA 5CHXA 1Z56A 4EOTA 3P32A 1OW7A 1RE4A 2WQYC 2ZYAA 2FYZA 3B5NC 4UB8H 1KB9E 3CI9A 3L70J 1NTMJ 2P1JA 1NH4A 1GMJA 2YMKA 3H1KE 5AVXB 3EFFK 2PRRA 1K9MQ 3Q5SA 3LIEA 1NU1G 4EI2A 4H13C 1OFCX 4UB6E 4PV1B 2PFXA 4R4LA 1N7SC 3CX5H 3KDPB 3CCQP 3D70A 3CMAP 1DIPA 2WPRA 1KB9D 3H1LG 2HPCA 1HBWA 3E1IA 1PFIA 4C7NA 4WVZA 2N1TD 1IK9A 3GHGA 3OAKA 4XA4A 3BASA 1Y8AA 5BVZA 2H7HA 3A0HH 1J1EB 1JTHB 1PZQA 1LT9A 1NTKK 3PTZA 4U3FG 5AVQB 1VQ5P 1QL2A 3C9IA 5M1BA 2E43A 1SQQE 1PIXA 1URQB 2QIWA 3JC22 1RQUA 4OGQC 2YKQA 4BRYA 4ZKUA 4WY4B 2IZ0A 1RE4C 2B88A 1AFOA 3VOPA 2J58A 3HUSA 2DW3A 4O9BA 1D7MA 1SQXE 1N86A 1EZVE 1ZLLA 1FZCA 2Q6QA 1H8AA 3G4SP 5EFWB 4GOEA 1T2KD 5C39A 3U59A 4PD4I 1EXJA 5KLVK 4YXDC 3ITKA 1SQQD 2ZYDA 3AE4C 3BCCJ 4XFJA 1MFZA 2UWJE 3TDKA 1AQTA 3RK3E 1EXIA 2M5AB 1M1JB 2K1AA 1G1IA 3B71A 3WMM0 1KYOH 3H1KJ 2FYUG 1P84I 5CCGD 3D6YA 5AVSB 3CD6P 3GHGC 3V6IA 3G71P 1HVVA 2E74D 2LR2A 2WITA 1GW3A 4Z1MH 1X9VA 2O01J 1R5SA 1LT9C 1JY2N 3RK3D 2QJYC 4HJGH 2E76C 3U1CA 3L36A 5AW9B 4DZOA 4I2LC 2GM4A 2XNXA 2FYNB 2QM7A 3L35A 3AE2C 4EYYQ 1IK7A 2XDJA 4CPGA 1Y9BA 2KP8A 1NU1E 4JQ0D 2OTJP 4AQRD 3M91A 4AUWA 4K3AA 3SWFA 4QMAA 3VMXA 3M0AA 1OW8A 1T3UA 2YIUC 1J2JB 2KXPB 1YIJP 2QA4P 1FZCC 1AJYA 1EC5A 3L70G 3H1LE 1NTMG 1Q82Q 2FFDA 1JTHA 4LLHA 3MHVA 3CX5I 2O01H 1MV8A 1N73B 2D2CB 3CCMP 1URQA 2RMZA 3M06A 4H13D 1SQBK 1JCDA 3ABVC 1SQXJ 1FS0E 1L0NJ 4WY4A 1KORA 2M3BA 2IX7C 5AW4B 1S2EA 4U3FE 3MTUE 1USDA 1IJDB 4KT0J 1K73Q 1KILE 2P10A 1M7LA 1YI2P 1CZQA 3WUVA 1YJNP 1QGKB 1NKNA 1VDFA 1JY2O 1OWAA 2KNCB 1JB0J 3AEEC 4IFFA 1PGPA 3CWBG 2XV5A 5APVA 2BASA 2XNDH 1RQVA 1MFTA 3R2PA 1P84E 4PV1C 2AXCA 2KOGA 2XKMA 3JCUE 2M5AA 1M1JA 1RHZB 3HE4B 1T8ZA 2KS1B 1Q90D 2IBZI 3AEGC 2VRSA 3OW2O 3O8ZA 1NTZK 1KILD 1YBKA 3Q1MA 2BEZF 3FXDA 4GDOA 2B87B 3HE5B 1JEKA 3CLQA 2QJPB 5DJTB 2R5BA 3WUTA 1HGVA 2Q1KA 1M57D 2KI7B 2CPSA 3CCUP 3BRTB 4DT0A 2FYUE 2FFDC 1J1EC 2KZIA 4H44B 2NPSD 3IR9A 4UB8E 1NU1J 1ZP0C 2OTKE 1IFPA 1QLED 1URQC 2JO1A 5APSA 3BCCG 1FZAA 5AVRB 2PAJA 4WY4C 2C9NY 3PH0A 4L74A 3IF4A 2K3RA 1LTGC 1NKZB 3H1LJ 1KILB 2J59M 3CCVP 5CCGA 4Y99B 5BU5A 2N1TC 2W27A 3G9RA 2HODB 1WT6A 1GL2D 2RN0A 3L72G 4NPFX 2IDBA 1PP9J 1KFNA 4GKGA 1L0LG 2MKVA 1XTGB 5KLIB 2O1KA 2NPSB 3W68A 1N73A 3L74G 3V2PA 1G2CB 4U3FJ 1M1JC 1SFCD 1S3JA 1YHQP 1NTME 4JF7A 1YQ3C 1IO4A 3A0HE 1BE3D 5B66H 3VP8A 1KQSO 2OYHB 2HYNA 2A06D 2MJZA 5K5GB 2IFMA 3NTNA 1SQVJ 2JJLA 1T2KC 1GK6A 2KNCA 3M9QA 1G1JA 4IFDK 1N2DC 3L70D 5TISH 1NTMD 1FE6A 1LWUB 2FYNC 1NWQA 3AECC 3CPWO 3RL0B 1AA0A 1SFCB 2E75B 3HE4A 2KS1A 1ZN5A 3D71A 3CWBE 2Y9YA 1HJ0A 2YO3A 2WPQA 4LGDE 1A02F 5CCGC 2FYUJ 3A0BH 1L0NG 3FGAD 1EZVG 2B87A 3HE5A 4L73A 1Y47A 1GDTA 2KK7A 2C0WA 3F5HA 4N3YB 4D6TG 2W6AA 1SQQK 4DCKA 1KYOE 5BU8B 2CK3H 2Q5UA 3RK3C 1N73C 3Q5RA 2WPSA 1M8OB 4IL6H 3T97B 3H1IJ 2P58A 1H88A 1PL5A 1S72P 1QEXA 2IFNA 3GG2A 3AE8C 3H1JJ 5APTA 1JMBA 5AW1B 1KILA 1ZR2A 2OTLP 2I8DA 4JYCA 1IFIA 3BCCE 3KQGA 2ZT9B 2HODA 1KYOD 1YTZI 4U7JA 5H2FH 3PP5A 1KV4A 5AW6B 3L4FA 2NPSA 4H0LD 1SVFA 2LXBA 1G2CA 2FXMA 3S4RA 1FDOA 2ZXXA 3L72E 1HGZA 3S9OA 1L0LE 3G6EP 1URQD 1X79B 3BCCD 3L74E 3USSA 4WY4D 2OYHA 3M9HA 1T6AA 3AEAC 1WMKA 1GL2A 2HG5D 3H1KD 1DX7A 3H6PA 3A3YB 2GUVA 1QVFO 3CWBJ 1PP9G 2QE7H 3L73J 4H0LB 1LWUA 2LXCB 3A2AA 3L71G 2A45H 1L0LD 1PGJA 3KZIH 3CC2P 1SFCA 4B86A 1AVOA 4A7PA 5APQA 3IAOA 3CXHI 2ZVOB 1E79H 1KILC 5AVUB 1GW4A 1JUNA 4Y99C 1RF1B 1DEEG 2KLUA 2Q9IA 4W7ZA 3C8VA 3KHUA 4GT1A 1YJWP 4MN4C 3MP7B 1SQVG 1L0NE 5KLIC 2NPSC 1YJ9P 3T97A 4I1LA 1KQFB 1VQ7P 1FBMA 5KAFH 4D6TE 3FWLA 2PP6A 2G3AA 1LTJB 1EQ7A 5CMZA 1CSBA 1RF0A 3V5BA 5CJ4A 1BGYG 2QVAA 2HFED 2OARA 4GIFA 3I5CA 4K35A 1GL2C 1LJ2A 1SQXD 4YTPC 1DD3A 1L0ND 1EZVD 3L72J 5E79E 1LP1B 3MD0A 4W80A 3C1LA 1L0LJ 2YXQB 2ZAEB 1LWUC 3GF7A 3L74J 4XE5B 1JY3O 3RL0C 1SFCC 1S1CX 2D2CD 1OX3A 3SFEC 1IFDA 3H1IG 4PJ0H 2Q3IA 3V2QA 3CCLP 3H1JG 4IFMA 3M9BA 3W67A 2HLOA 3AE7C 3HRNA 3HUSC 2FXPA 3IFMA 3L75G 5B66E 2ZYGA 4OH8B 1SQPK 3HTKB 2IPPA 2BCCJ 3V2RA 1FAVA 2A45G 4I7ZB 5GTHH 3OJAB 1JO5A 3AE5C 4ZMDA 2GA1A 2Y9ZA 1RF0C 1PP9E 1NU1D 2B9BA 3FX0A 4HH2A 5CJ0A 5TISE 5AW0B 1BCCJ 3L71E 1RF1A 2ZT9C 1DH3A 1NAYA 3M0DA 1BSHA 4EIJA 2KZJA 3H25A 4PD4E 5APWA 2IBZG 1KC8Q 2P7JA 2R3SA 3G3ZA 4D6TJ 3H1LD 1KTMA 2ZVNB 1NTMK 5B5EH 3A0BE 2ZXEB 1JNMA 2A45I 1W2BO 5CCHA 1J1DB 4H44D 1LTAC 2H89C 3L37A 1NGMB 1OIPA 3L73G 2V7QH 1PP9D 1DEBA 1SQVE 3Q2YA 1LTIC 2K9YA 2XZRA 3L71D 1X0TA 2ZFCA 2G8YA 2QEXP 4IL6E 4BXLA 4U3FD 1AV1A 4PD4D 2AEJA 1KN7A 1JY2P 2M3EA 2NZ2A 4JPZB 3EWKA 1VQPP 3F89A 1JM0A 1UIIA 2FKWB 1LP1A 4ZKPA 1BGYE 5KAIH 3A5TA 1IFJA 4H0LC 4IOIH 1JMMA 2FY8A 1SQVD 5KKZB 1P84D 5AW8B 5H2FE 3TSIA 1KZUB 3OA7A 2Z5HA 2FBWC 1S5LX 3D6ZA 1RF1C 1KQGB 3VMYA 3M0DC 4M3LA 1Q2NA 1U7JA 1EDIA 4WB4A 3H1IE 2AXTH 4AYCA 1BGYD 3TF5A 2IYPA 1VQMP 1VF5D 1NTKJ 3CX5E 3H1JE 2FYUD 4IL6X 1BSNA 3H1HJ 3HTKA 1FOSF 1OZHA 1JCCA 5CCHC 4HKZH 2YNYA 2YKPA 2W8ZA 3L71J 3L75E 4OGQB 3V4WA 3GF3A 4C7RA 1LTTC 3RL0D 2E75D 2WWWA 1SQBE 3H1ID 3GW6A 2WPVB 1EDKA 1IFMA 2CPBA 4I6MC 3SSUA 1WRGA 3KZIE 4WBAA 1OVUA 3CX5D 3H1JD 2W6JH 5KLVJ 3CXHH 3AEDC 3WU2H 1VF5B 1L0LK 3GMAA 1KD1Q 4DJGA 2E5TA 2N9YB 1M90Q 1VQOP 2JP3A 1X8YA 3MZWB 2IBZE 2L91A 2BCCG 2XU6A 1LNQA 1OW6A 1FZFA 2WSFH 1FU1A 5APXA 2OYIB 1BGYJ 2PGDA 2JWAA 2Y0CA 2N9BA 3L73E 3MIWA 5KAFE 1FJPA 2BEQD 1BCCG 1N7LA 1OVVA 1S5LH 2ZT9D 3Q3DA 3WUUA 2E76B 3H32B 2KSJA 2WSEH 2IBZD 3CMEP 3K5BA 1A02J 4BRYB 2D2CC 1BDCA 1S9KE 3AE3C 3CWBD 3TK1A 3P8MC 3L73D 3V2NA 1SQXK 2R5DA 1L0NK 4R4MA 2JDIH 4YPCA 1R5LA 3B8EB 3AE6C 4BWNA 1HF9A 1NJIQ 1SS1A 4PJ0E 1FZEA 3L75J 5AW5B 5AW2B 2E42A 2O01N 4RO0A 3RBXA 3RL0g 1S9KD 1ZXGA 1GTWA 1SQBJ 2WTYA 1KQLA 1Q81Q 3NFQA 3N7NA 1HH0A 1FJKA 2QM8A 1SLQA 1VQ9P 2JWDA 3UIAA 1ZOYC 1RE3A 3II6A 4N6JA 1USEA 3V4QA 3MGNA 3RK2B 3E1RA 5GTHE 2KLVA 3LW5H 1L4AB 2QJPC 1PPJG 5AVZB 1U7MA 3VYIA 1LTSC 3CCEP 3LIDA 3O6QB 1NTKG 2YMYA 3TGUG 4H44C 5KKZC 2I1KA 3H1HG 1Q86Q 3L72D 2YXRB 1NTZJ 1NU1K 5CCHD 2QRXA 5B5EE 5KJ7A 1IC2A 2OYIA 3L74D 1NOHA 1JY3N 1CW5A 2K9JB 4GODA 5CBOA 1M1KQ 2BCCE 3CCSP 1CI6B 1FDIA 2FFDB 2GUSA 3PHLA 3I55P 1W2EA 3H32A 5KLVG 3N4XA 3S1KA 3KXDA 2M8RA 1BCCE 2WT7B 4ASWA 2K37A 2NRGA 5KAIE 1LGHB 1HJBA 3CC7P 3TYYA 1VPCA 2WSSH 2BCCD 2N1TB 1M56D 1K8AQ 1RE3C 2Q3EA 3AE1C 2AEFA 4KHXA 2P2UA 4OVNF 2OYHC 3KYQA 2WZ7A 1HUCA 3GLMA 3SWYA 1VF5C 2C9LY 1YYCA 3IN6A 1NO4A 1BCCD 1FZBA 1SQVK 1YITP 1PGOA 2WVRA 2QJKB 1HTLC 2AXTE 2KSEA 3BVHA 1GD2E 1NVOA 2R3CA 1ZR4A 2O1JA 3VN0A 1X22A 4D6TD 3AEBC 2W6BA 5KJ7C 1FZGA 2LKMA 2KB7P 1VQKP 3EQ2A 2OYIC 2P67A 2E75C 3CCRP 4JYBA 4YXWH 5GTIH 4RKUJ 3P7KA 1K04A 1NYHA 1EDJA 1H89A 3TNUB 2FYUK 1L4AA 1VQ4P 1SQPG 4LC1A 3PLNA 3NMDA 3HD7D 3I56P 2R32A 3B4SA 1JY3P 1RY3A 3O6QA 1BE3G 1ZRTE 4OWFA 3VP9A 3NXSA 1KB9H 1MZ9A 3CXHE 1PPJE 2A06G 3PJSK 2V7QJ 3WU2E 1SQBG 1GZLA 2K88A 1NTKE 5AVWB 1VQLP 3TGUE 3BATA 1RH5B 1YTZT 3PRJA 3H1HE 3B5ND 2RH0A 4EDFA 2E74B 2K9JA 4C46A 1CI6A 1SQQJ 5CBNA 4UB6H 1NAFA
chains in the Genus database with same CATH topology
1AFOA 5AW7B 1OXZA 3VOPA 2YNYA 2J58A 2YKPA 3HUSA 3RK3B 5APTA 4O9BA 3HD7B 5AW1B 1N86A 1KILA 3V4WA 1ZLLA 1ZR2A 1FZCA 4JYCA 1H8AA 1FOSE 4C7RA 1LTTC 1IFIA 1T2KD 3RL0D 3KQGA 3U1AA 2WT7A 2HODA 3U59A 2WWWA 5KLVK 1N7SD 1MUUA 1YTZI 1IFMA 2CPBA 4I6MC 1WRGA 1MFZA 3PP5A 4WBAA 2YO2A 5AW6B 2N1TA 1M1JB 3L4FA 2NPSA 1LTJA 5AVTB 1SVFA 3RK2C 3B5NB 1G1IA 1G2CA 2FXMA 2Q7CA 1LTBC 1L4AC 3WMM0 1GU4A 1HGZA 1L0LK 5CCGD 3A7OA 1NHLA 1X8YA 5AVSB 3GHGC 1URQD 1X79B 1HVVA 2POHA 1SP4A 4WY4D 2OYHA 2XU6A 3M9HA 2WITA 2H8PD 1GW3A 1FZFA 2WSFH 1X9VA 1FU1A 5APXA 2OYIB 1GL2A 1LT9C 1JY2N 2JEEA 3RK3D 1N7SB 5APUA 2HG5D 3U1CA 2N9BA 3L36A 5AW9B 3MIWA 2Z5IA 4DZOA 1DX7A 1QL1A 1FJPA 3P8CE 3H6PA 3A3YB 4I2LC 5AVVB 2GM4A 2GUVA 2XNXA 1N7LA 3MUDA 2QM7A 3L35A 2XDJA 1LWUA 2KP8A 3A2AA 3TNUA 2A45H 4N78E 4AQRD 3H32B 3M91A 4AUWA 2KSJA 2WSEH 1IFNA 3SWFA 1SFCA 1E5WA 3M0AA 3VMXA 4B86A 1ZV8A 1T3UA 5APQA 3VTPC 1KFMA 1A02J 1J2JB 1KILC 5AVUB 1FZCC 1GW4A 1S9KE 1JUNA 4Y99C 1RF1B 2Q9IA 3TK1A 4W7ZA 3P8MC 2FFDA 3V2NA 3P8CD 4GT1A 1JTHA 4LLHA 1SQXK 2R5DA 1L0NK 2O01H 1MV8A 1N73B 1AQ5A 3B8EB 2NPSC 3CL3D 1URQA 5KJ7D 1FDMA 1LTJC 3M06A 4N78D 1FZEA 5AVYB 1SQBK 2Z4EA 3T97A 1JCDA 4I1LA 5AW5B 4WY4A 5AW2B 1JOCA 2M3BA 2IX7C 1FBMA 2E42A 5AW4B 3MTUE 2PP6A 1IJDB 1S9KD 1GTWA 1LTJB 3HD7A 1EQ7A 1M7LA 5CMZA 2WTYA 1CSBA 1RF0A 1CZQA 3V5BA 1KQLA 2YKOA 5CJ4A 4RESB 3NFQA 3N7NA 1HH0A 2HFED 1NKNA 1FJKA 1VDFA 2QM8A 1JY2O 2OARA 4GIFA 1OWAA 1SLQA 3I5CA 4IFFA 1GL2C 2XV5A 5APVA 3UIAA 2BASA 3II6A 1RE3A 5APYA 4N6JA 3R2PA 3V4QA 3MGNA 4HYTB 3RK2B 2WSCH 2KOGA 2XKMA 3MD0A 2KLVA 4W80A 1M1JA 2KYVA 3LW5H 1L4AB 2HPCB 1GK4A 3HE4B 1GL2B 1T8ZA 3B5NA 5AVZB 1LWUC 3VMZA 2VRSA 4XE5B 4C7NB 3O8ZA 1NTZK 1JY3O 3RL0C 2I1JA 3VYIA 1KILD 1LTSC 1SFCC 3GHGB 4DOJA 3LIDA 3BRVB 1IFDA 2YMYA 2I1KA 3HE5B 2Q3IA 3V2QA 3CLQA 3KPEA 1GU5A 2R5BA 1NU1K 5CCHD 1HGVA 4IFMA 1LT9B 2CPSA 3M9BA 5KJ7A 3BRTB 2HLOA 1IC2A 2FFDC 1J1EC 2OYIA 3IR9A 2NPSD 3HRNA 3HUSC 1NOHA 1JY3N 3IFMA 1N7SA 5KTBA 1CW5A 4W7YA 4OH8B 1CI6B 1URQC 1SQPK 5APSA 3HTKB 1HWTC 1FZAA 2FFDB 5AVRB 2PAJA 2GUSA 2IPPA 3HUSB 4WY4C 2C9NY 3V2RA 1W2EA 1FAVA 3H32A 2A45G 1T3JA 1LTGC 1NKZB 3EFGA 1KILB 2J59M 3OJAB 1FZCB 5CCGA 1JO5A 3RK2D 3N4XA 2M8RA 3HD7C 4Y99B 5BU5A 2N1TC 1L4AD 2W27A 1RF0C 2WT7B 2HODB 1WT6A 4HH2A 5CJ0A 1GL2D 2H43A 5AW3B 2L5GB 5AW0B 1XTCC 1RF1A 1DH3A 1LGHB 3M0DA 1HJBA 4EIJA 3TYYA 1KFNA 1VPCA 4GKGA 1J1DC 2C0XA 1XTGB 2N1TB 2O1KA 5CHXA 2NPSB 5APWA 1RE3C 1Z56A 4EOTA 2P7JA 1N73A 3V2PA 3G3ZA 1G2CB 4KHXA 1NTMK 2P2UA 1M1JC 2ZXEB 3P32A 1JNMA 2OYHC 2A45I 3KYQA 1SFCD 2WZ7A 1RE4A 2FYZA 4JF7A 1HUCA 3B5NC 1IO4A 3SWYA 5CCHA 1J1DB 2C9LY 1YYCA 1LTAC 3CI9A 1NO4A 1FZBA 1SQVK 3L37A 2P1JA 1NH4A 3VP8A 1DEBA 1HTLC 1LTIC 2OYHB 5AVXB 2HYNA 3BVHA 2XZRA 1GD2E 2R3CA 2MJZA 1ZR4A 2O1JA 2ZFCA 3VN0A 2IFMA 3LIEA 3NTNA 2W6BA 5KJ7C 2JJLA 1FZGA 2LKMA 2KB7P 1T2KC 1GK6A 3EQ2A 1JY2P 2OYIC 2P67A 3M9QA 1G1JA 4JYBA 4IFDK 1N2DC 1N7SC 3P7KA 3KDPB 2FKWB 4ZKPA 1LWUB 2WPRA 1H89A 1NWQA 3TNUB 3A5TA 2FYUK 1IFJA 1L4AA 3RL0B 2HPCA 1SFCB 4LC1A 1HBWA 3HE4A 1ZN5A 3E1IA 1JMMA 3NMDA 1PFIA 3HD7D 4C7NA 2YO3A 2N1TD 2WPQA 1IK9A 4LGDE 2R32A 1A02F 1JY3P 3GHGA 3OAKA 4XA4A 1RY3A 5AW8B 3BASA 5CCGC 3TSIA 1KZUB 3OA7A 2Z5HA 2H7HA 5BVZA 3HE5A 1GDTA 3VP9A 3NXSA 1MZ9A 1J1EB 2C0WA 1JTHB 1RF1C 3VMYA 1LT9A 1NTKK 3M0DC 1GZLA 4M3LA 4N3YB 2W6AA 1SQQK 5AVQB 1QL2A 4WB4A 3C9IA 4AYCA 1JCCA 5BU8B 2Q5UA 2E43A 5AVWB 3BATA 1YTZT 1URQB 3RK3C 1N73C 3B5ND 2WPSA 2YKQA 4ZKUA 4WY4B 4C46A 1H88A 1CI6A 1RE4C 3HTKA 1FOSF 1NAFA 2IFNA 5CCHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKM A;  1NTK K;  1NTZ K;  2WSE H;  1SQQ K;  1SQV K;  1SQX K;  3M9Q A;  1L0N K;  2O01 H;  4IFD K;  2J59 M;  2WSC H;  3G3Z A;  3CLQ A;  1NTM K;  3LW5 H;  1NU1 K;  1SQP K;  1SQB K;  2FYU K;  2WSF H;  5KLV K;  2OAR A;  1L0L K; 
#chains in the Genus database with same CATH topology
 5AW7 B;  1OXZ A;  3SFD C;  1KMI Z;  1ZRT D;  3RK3 B;  3HD7 B;  1K05 A;  1DD4 A;  1H0T B;  4ASV A;  3AE9 C;  1S4X A;  4TT3 H;  3CXH D;  1PPJ D;  4TLF A;  4JBZ A;  1FOS E;  1W5C E;  3U1A A;  4Y28 J;  2WT7 A;  1S5L E;  1N7S D;  1MUU A;  1NTK D;  3TGU D;  2V4H A;  5KLV E;  2JKV A;  3H1H D;  1AVY A;  1BDD A;  2YO2 A;  1NTZ G;  2N1T A;  1LTJ A;  5AVT B;  3RK2 C;  3B5N B;  2Q7C A;  1PGQ A;  1LTB C;  1L4A C;  1GU4 A;  1U57 A;  2QSI A;  4RJT A;  2W83 C;  3A7O A;  5TJH A;  1N8R Q;  1NHL A;  3ZDM A;  4L75 A;  1OVR A;  2POH A;  1QX8 A;  1SP4 A;  4KJM A;  2H8P D;  4H13 B;  5KLV D;  2HR3 A;  2JEE A;  2E5Y A;  1TU3 F;  1N7S B;  5APU A;  2Z5I A;  4OGQ D;  1QL1 A;  3P8C E;  4NPE A;  2WMM A;  5AVV B;  2JR8 A;  3QWO C;  2IYO A;  2KUB A;  3MUD A;  2M0B A;  2Y0E A;  4ZNC A;  2W90 A;  3TNU A;  4N78 E;  2H88 C;  1IFN A;  1E5W A;  1ZV8 A;  3VTP C;  1KFM A;  1KYO I;  2FXO A;  4HB1 A;  3TGU J;  1SQP E;  3P8C D;  5E79 H;  2WSC J;  5L8R J;  3Q5P A;  1PV3 A;  1ZW0 A;  1AQ5 A;  1BE3 E;  3H1K G;  2WSF J;  3CL3 D;  4L76 A;  1QVG O;  5KJ7 D;  1FDM A;  1LTJ C;  4N78 D;  3JSV C;  5AVY B;  2Z4E A;  2B89 A;  1LT1 A;  1MKM A;  2A06 E;  4GOF A;  1JOC A;  2OGU A;  2R44 A;  1R8E A;  3VMA A;  3HD7 A;  2QJK C;  1H0T A;  2SPZ A;  2YKO A;  1SQP D;  1KB9 I;  4RES B;  1L2P A;  3L70 E;  2KIK A;  2WSE J;  2E76 D;  2O3J A;  3L75 D;  5APY A;  2Y0D A;  1VQ6 P;  2ZJS E;  3FWN A;  1EDL A;  2J5U A;  4HYT B;  2WSC H;  1FC2 C;  3MUD C;  2IZ1 A;  2KYV A;  1SQB D;  2HPC B;  3RGU A;  1GK4 A;  1Q7Y Q;  3FXE A;  1GL2 B;  3QH9 A;  3B5N A;  3VMZ A;  4C7N B;  4WWI A;  2I1J A;  3GHG B;  4DOJ A;  3BRV B;  1NTZ E;  2ITA A;  1SQQ G;  1OMI A;  3KPE A;  1GU5 A;  5DJU B;  1LT9 B;  2QJY B;  1YQ4 C;  4PD4 H;  3R4Y A;  1N7S A;  5KTB A;  2AEM A;  1SQX G;  4W7Y A;  2OYO A;  4I7Z C;  1HWT C;  2E74 C;  3HUS B;  1NTZ D;  2YIU B;  1T3J A;  1P84 H;  2RKL A;  1VQ8 P;  3EFG A;  4NPD A;  3RBZ A;  3LW5 J;  3JCU H;  1SQP J;  1FZC B;  3RK2 D;  1VL2 A;  3HD7 C;  5GTI E;  2QG4 A;  1L4A D;  2OQQ A;  3CC4 P;  3CCJ P;  1VQN P;  2H43 A;  5AW3 B;  3SWK A;  2L5G B;  1BE3 J;  1XTC C;  1EZV I;  4PV1 D;  1UIX A;  1ZME C;  1IZN B;  1J1D C;  2C0X A;  3AEF C;  3E7K A;  5CHX A;  1Z56 A;  4EOT A;  3P32 A;  1OW7 A;  1RE4 A;  2WQY C;  2ZYA A;  2FYZ A;  3B5N C;  4UB8 H;  1KB9 E;  3CI9 A;  3L70 J;  1NTM J;  2P1J A;  1NH4 A;  1GMJ A;  2YMK A;  3H1K E;  5AVX B;  3EFF K;  2PRR A;  1K9M Q;  3Q5S A;  3LIE A;  1NU1 G;  4EI2 A;  4H13 C;  1OFC X;  4UB6 E;  4PV1 B;  2PFX A;  4R4L A;  1N7S C;  3CX5 H;  3KDP B;  3CCQ P;  3D70 A;  3CMA P;  1DIP A;  2WPR A;  1KB9 D;  3H1L G;  2HPC A;  1HBW A;  3E1I A;  1PFI A;  4C7N A;  4WVZ A;  2N1T D;  1IK9 A;  3GHG A;  3OAK A;  4XA4 A;  3BAS A;  1Y8A A;  5BVZ A;  2H7H A;  3A0H H;  1J1E B;  1JTH B;  1PZQ A;  1LT9 A;  1NTK K;  3PTZ A;  4U3F G;  5AVQ B;  1VQ5 P;  1QL2 A;  3C9I A;  5M1B A;  2E43 A;  1SQQ E;  1PIX A;  1URQ B;  2QIW A;  3JC2 2;  1RQU A;  4OGQ C;  2YKQ A;  4BRY A;  4ZKU A;  4WY4 B;  2IZ0 A;  1RE4 C;  2B88 A;  1AFO A;  3VOP A;  2J58 A;  3HUS A;  2DW3 A;  4O9B A;  1D7M A;  1SQX E;  1N86 A;  1EZV E;  1ZLL A;  1FZC A;  2Q6Q A;  1H8A A;  3G4S P;  5EFW B;  4GOE A;  1T2K D;  5C39 A;  3U59 A;  4PD4 I;  1EXJ A;  5KLV K;  4YXD C;  3ITK A;  1SQQ D;  2ZYD A;  3AE4 C;  3BCC J;  4XFJ A;  1MFZ A;  2UWJ E;  3TDK A;  1AQT A;  3RK3 E;  1EXI A;  2M5A B;  1M1J B;  2K1A A;  1G1I A;  3B71 A;  3WMM 0;  1KYO H;  3H1K J;  2FYU G;  1P84 I;  5CCG D;  3D6Y A;  5AVS B;  3CD6 P;  3GHG C;  3V6I A;  3G71 P;  1HVV A;  2E74 D;  2LR2 A;  2WIT A;  1GW3 A;  4Z1M H;  1X9V A;  2O01 J;  1R5S A;  1LT9 C;  1JY2 N;  3RK3 D;  2QJY C;  4HJG H;  2E76 C;  3U1C A;  3L36 A;  5AW9 B;  4DZO A;  4I2L C;  2GM4 A;  2XNX A;  2FYN B;  2QM7 A;  3L35 A;  3AE2 C;  4EYY Q;  1IK7 A;  2XDJ A;  4CPG A;  1Y9B A;  2KP8 A;  1NU1 E;  4JQ0 D;  2OTJ P;  4AQR D;  3M91 A;  4AUW A;  4K3A A;  3SWF A;  4QMA A;  3VMX A;  3M0A A;  1OW8 A;  1T3U A;  2YIU C;  1J2J B;  2KXP B;  1YIJ P;  2QA4 P;  1FZC C;  1AJY A;  1EC5 A;  3L70 G;  3H1L E;  1NTM G;  1Q82 Q;  2FFD A;  1JTH A;  4LLH A;  3MHV A;  3CX5 I;  2O01 H;  1MV8 A;  1N73 B;  2D2C B;  3CCM P;  1URQ A;  2RMZ A;  3M06 A;  4H13 D;  1SQB K;  1JCD A;  3ABV C;  1SQX J;  1FS0 E;  1L0N J;  4WY4 A;  1KOR A;  2M3B A;  2IX7 C;  5AW4 B;  1S2E A;  4U3F E;  3MTU E;  1USD A;  1IJD B;  4KT0 J;  1K73 Q;  1KIL E;  2P10 A;  1M7L A;  1YI2 P;  1CZQ A;  3WUV A;  1YJN P;  1QGK B;  1NKN A;  1VDF A;  1JY2 O;  1OWA A;  2KNC B;  1JB0 J;  3AEE C;  4IFF A;  1PGP A;  3CWB G;  2XV5 A;  5APV A;  2BAS A;  2XND H;  1RQV A;  1MFT A;  3R2P A;  1P84 E;  4PV1 C;  2AXC A;  2KOG A;  2XKM A;  3JCU E;  2M5A A;  1M1J A;  1RHZ B;  3HE4 B;  1T8Z A;  2KS1 B;  1Q90 D;  2IBZ I;  3AEG C;  2VRS A;  3OW2 O;  3O8Z A;  1NTZ K;  1KIL D;  1YBK A;  3Q1M A;  2BEZ F;  3FXD A;  4GDO A;  2B87 B;  3HE5 B;  1JEK A;  3CLQ A;  2QJP B;  5DJT B;  2R5B A;  3WUT A;  1HGV A;  2Q1K A;  1M57 D;  2KI7 B;  2CPS A;  3CCU P;  3BRT B;  4DT0 A;  2FYU E;  2FFD C;  1J1E C;  2KZI A;  4H44 B;  2NPS D;  3IR9 A;  4UB8 E;  1NU1 J;  1ZP0 C;  2OTK E;  1IFP A;  1QLE D;  1URQ C;  2JO1 A;  5APS A;  3BCC G;  1FZA A;  5AVR B;  2PAJ A;  4WY4 C;  2C9N Y;  3PH0 A;  4L74 A;  3IF4 A;  2K3R A;  1LTG C;  1NKZ B;  3H1L J;  1KIL B;  2J59 M;  3CCV P;  5CCG A;  4Y99 B;  5BU5 A;  2N1T C;  2W27 A;  3G9R A;  2HOD B;  1WT6 A;  1GL2 D;  2RN0 A;  3L72 G;  4NPF X;  2IDB A;  1PP9 J;  1KFN A;  4GKG A;  1L0L G;  2MKV A;  1XTG B;  5KLI B;  2O1K A;  2NPS B;  3W68 A;  1N73 A;  3L74 G;  3V2P A;  1G2C B;  4U3F J;  1M1J C;  1SFC D;  1S3J A;  1YHQ P;  1NTM E;  4JF7 A;  1YQ3 C;  1IO4 A;  3A0H E;  1BE3 D;  5B66 H;  3VP8 A;  1KQS O;  2OYH B;  2HYN A;  2A06 D;  2MJZ A;  5K5G B;  2IFM A;  3NTN A;  1SQV J;  2JJL A;  1T2K C;  1GK6 A;  2KNC A;  3M9Q A;  1G1J A;  4IFD K;  1N2D C;  3L70 D;  5TIS H;  1NTM D;  1FE6 A;  1LWU B;  2FYN C;  1NWQ A;  3AEC C;  3CPW O;  3RL0 B;  1AA0 A;  1SFC B;  2E75 B;  3HE4 A;  2KS1 A;  1ZN5 A;  3D71 A;  3CWB E;  2Y9Y A;  1HJ0 A;  2YO3 A;  2WPQ A;  4LGD E;  1A02 F;  5CCG C;  2FYU J;  3A0B H;  1L0N G;  3FGA D;  1EZV G;  2B87 A;  3HE5 A;  4L73 A;  1Y47 A;  1GDT A;  2KK7 A;  2C0W A;  3F5H A;  4N3Y B;  4D6T G;  2W6A A;  1SQQ K;  4DCK A;  1KYO E;  5BU8 B;  2CK3 H;  2Q5U A;  3RK3 C;  1N73 C;  3Q5R A;  2WPS A;  1M8O B;  4IL6 H;  3T97 B;  3H1I J;  2P58 A;  1H88 A;  1PL5 A;  1S72 P;  1QEX A;  2IFN A;  3GG2 A;  3AE8 C;  3H1J J;  5APT A;  1JMB A;  5AW1 B;  1KIL A;  1ZR2 A;  2OTL P;  2I8D A;  4JYC A;  1IFI A;  3BCC E;  3KQG A;  2ZT9 B;  2HOD A;  1KYO D;  1YTZ I;  4U7J A;  5H2F H;  3PP5 A;  1KV4 A;  5AW6 B;  3L4F A;  2NPS A;  4H0L D;  1SVF A;  2LXB A;  1G2C A;  2FXM A;  3S4R A;  1FDO A;  2ZXX A;  3L72 E;  1HGZ A;  3S9O A;  1L0L E;  3G6E P;  1URQ D;  1X79 B;  3BCC D;  3L74 E;  3USS A;  4WY4 D;  2OYH A;  3M9H A;  1T6A A;  3AEA C;  1WMK A;  1GL2 A;  2HG5 D;  3H1K D;  1DX7 A;  3H6P A;  3A3Y B;  2GUV A;  1QVF O;  3CWB J;  1PP9 G;  2QE7 H;  3L73 J;  4H0L B;  1LWU A;  2LXC B;  3A2A A;  3L71 G;  2A45 H;  1L0L D;  1PGJ A;  3KZI H;  3CC2 P;  1SFC A;  4B86 A;  1AVO A;  4A7P A;  5APQ A;  3IAO A;  3CXH I;  2ZVO B;  1E79 H;  1KIL C;  5AVU B;  1GW4 A;  1JUN A;  4Y99 C;  1RF1 B;  1DEE G;  2KLU A;  2Q9I A;  4W7Z A;  3C8V A;  3KHU A;  4GT1 A;  1YJW P;  4MN4 C;  3MP7 B;  1SQV G;  1L0N E;  5KLI C;  2NPS C;  1YJ9 P;  3T97 A;  4I1L A;  1KQF B;  1VQ7 P;  1FBM A;  5KAF H;  4D6T E;  3FWL A;  2PP6 A;  2G3A A;  1LTJ B;  1EQ7 A;  5CMZ A;  1CSB A;  1RF0 A;  3V5B A;  5CJ4 A;  1BGY G;  2QVA A;  2HFE D;  2OAR A;  4GIF A;  3I5C A;  4K35 A;  1GL2 C;  1LJ2 A;  1SQX D;  4YTP C;  1DD3 A;  1L0N D;  1EZV D;  3L72 J;  5E79 E;  1LP1 B;  3MD0 A;  4W80 A;  3C1L A;  1L0L J;  2YXQ B;  2ZAE B;  1LWU C;  3GF7 A;  3L74 J;  4XE5 B;  1JY3 O;  3RL0 C;  1SFC C;  1S1C X;  2D2C D;  1OX3 A;  3SFE C;  1IFD A;  3H1I G;  4PJ0 H;  2Q3I A;  3V2Q A;  3CCL P;  3H1J G;  4IFM A;  3M9B A;  3W67 A;  2HLO A;  3AE7 C;  3HRN A;  3HUS C;  2FXP A;  3IFM A;  3L75 G;  5B66 E;  2ZYG A;  4OH8 B;  1SQP K;  3HTK B;  2IPP A;  2BCC J;  3V2R A;  1FAV A;  2A45 G;  4I7Z B;  5GTH H;  3OJA B;  1JO5 A;  3AE5 C;  4ZMD A;  2GA1 A;  2Y9Z A;  1RF0 C;  1PP9 E;  1NU1 D;  2B9B A;  3FX0 A;  4HH2 A;  5CJ0 A;  5TIS E;  5AW0 B;  1BCC J;  3L71 E;  1RF1 A;  2ZT9 C;  1DH3 A;  1NAY A;  3M0D A;  1BSH A;  4EIJ A;  2KZJ A;  3H25 A;  4PD4 E;  5APW A;  2IBZ G;  1KC8 Q;  2P7J A;  2R3S A;  3G3Z A;  4D6T J;  3H1L D;  1KTM A;  2ZVN B;  1NTM K;  5B5E H;  3A0B E;  2ZXE B;  1JNM A;  2A45 I;  1W2B O;  5CCH A;  1J1D B;  4H44 D;  1LTA C;  2H89 C;  3L37 A;  1NGM B;  1OIP A;  3L73 G;  2V7Q H;  1PP9 D;  1DEB A;  1SQV E;  3Q2Y A;  1LTI C;  2K9Y A;  2XZR A;  3L71 D;  1X0T A;  2ZFC A;  2G8Y A;  2QEX P;  4IL6 E;  4BXL A;  4U3F D;  1AV1 A;  4PD4 D;  2AEJ A;  1KN7 A;  1JY2 P;  2M3E A;  2NZ2 A;  4JPZ B;  3EWK A;  1VQP P;  3F89 A;  1JM0 A;  1UII A;  2FKW B;  1LP1 A;  4ZKP A;  1BGY E;  5KAI H;  3A5T A;  1IFJ A;  4H0L C;  4IOI H;  1JMM A;  2FY8 A;  1SQV D;  5KKZ B;  1P84 D;  5AW8 B;  5H2F E;  3TSI A;  1KZU B;  3OA7 A;  2Z5H A;  2FBW C;  1S5L X;  3D6Z A;  1RF1 C;  1KQG B;  3VMY A;  3M0D C;  4M3L A;  1Q2N A;  1U7J A;  1EDI A;  4WB4 A;  3H1I E;  2AXT H;  4AYC A;  1BGY D;  3TF5 A;  2IYP A;  1VQM P;  1VF5 D;  1NTK J;  3CX5 E;  3H1J E;  2FYU D;  4IL6 X;  1BSN A;  3H1H J;  3HTK A;  1FOS F;  1OZH A;  1JCC A;  5CCH C;  4HKZ H;  2YNY A;  2YKP A;  2W8Z A;  3L71 J;  3L75 E;  4OGQ B;  3V4W A;  3GF3 A;  4C7R A;  1LTT C;  3RL0 D;  2E75 D;  2WWW A;  1SQB E;  3H1I D;  3GW6 A;  2WPV B;  1EDK A;  1IFM A;  2CPB A;  4I6M C;  3SSU A;  1WRG A;  3KZI E;  4WBA A;  1OVU A;  3CX5 D;  3H1J D;  2W6J H;  5KLV J;  3CXH H;  3AED C;  3WU2 H;  1VF5 B;  1L0L K;  3GMA A;  1KD1 Q;  4DJG A;  2E5T A;  2N9Y B;  1M90 Q;  1VQO P;  2JP3 A;  1X8Y A;  3MZW B;  2IBZ E;  2L91 A;  2BCC G;  2XU6 A;  1LNQ A;  1OW6 A;  1FZF A;  2WSF H;  1FU1 A;  5APX A;  2OYI B;  1BGY J;  2PGD A;  2JWA A;  2Y0C A;  2N9B A;  3L73 E;  3MIW A;  5KAF E;  1FJP A;  2BEQ D;  1BCC G;  1N7L A;  1OVV A;  1S5L H;  2ZT9 D;  3Q3D A;  3WUU A;  2E76 B;  3H32 B;  2KSJ A;  2WSE H;  2IBZ D;  3CME P;  3K5B A;  1A02 J;  4BRY B;  2D2C C;  1BDC A;  1S9K E;  3AE3 C;  3CWB D;  3TK1 A;  3P8M C;  3L73 D;  3V2N A;  1SQX K;  2R5D A;  1L0N K;  4R4M A;  2JDI H;  4YPC A;  1R5L A;  3B8E B;  3AE6 C;  4BWN A;  1HF9 A;  1NJI Q;  1SS1 A;  4PJ0 E;  1FZE A;  3L75 J;  5AW5 B;  5AW2 B;  2E42 A;  2O01 N;  4RO0 A;  3RBX A;  3RL0 g;  1S9K D;  1ZXG A;  1GTW A;  1SQB J;  2WTY A;  1KQL A;  1Q81 Q;  3NFQ A;  3N7N A;  1HH0 A;  1FJK A;  2QM8 A;  1SLQ A;  1VQ9 P;  2JWD A;  3UIA A;  1ZOY C;  1RE3 A;  3II6 A;  4N6J A;  1USE A;  3V4Q A;  3MGN A;  3RK2 B;  3E1R A;  5GTH E;  2KLV A;  3LW5 H;  1L4A B;  2QJP C;  1PPJ G;  5AVZ B;  1U7M A;  3VYI A;  1LTS C;  3CCE P;  3LID A;  3O6Q B;  1NTK G;  2YMY A;  3TGU G;  4H44 C;  5KKZ C;  2I1K A;  3H1H G;  1Q86 Q;  3L72 D;  2YXR B;  1NTZ J;  1NU1 K;  5CCH D;  2QRX A;  5B5E E;  5KJ7 A;  1IC2 A;  2OYI A;  3L74 D;  1NOH A;  1JY3 N;  1CW5 A;  2K9J B;  4GOD A;  5CBO A;  1M1K Q;  2BCC E;  3CCS P;  1CI6 B;  1FDI A;  2FFD B;  2GUS A;  3PHL A;  3I55 P;  1W2E A;  3H32 A;  5KLV G;  3N4X A;  3S1K A;  3KXD A;  2M8R A;  1BCC E;  2WT7 B;  4ASW A;  2K37 A;  2NRG A;  5KAI E;  1LGH B;  1HJB A;  3CC7 P;  3TYY A;  1VPC A;  2WSS H;  2BCC D;  2N1T B;  1M56 D;  1K8A Q;  1RE3 C;  2Q3E A;  3AE1 C;  2AEF A;  4KHX A;  2P2U A;  4OVN F;  2OYH C;  3KYQ A;  2WZ7 A;  1HUC A;  3GLM A;  3SWY A;  1VF5 C;  2C9L Y;  1YYC A;  3IN6 A;  1NO4 A;  1BCC D;  1FZB A;  1SQV K;  1YIT P;  1PGO A;  2WVR A;  2QJK B;  1HTL C;  2AXT E;  2KSE A;  3BVH A;  1GD2 E;  1NVO A;  2R3C A;  1ZR4 A;  2O1J A;  3VN0 A;  1X22 A;  4D6T D;  3AEB C;  2W6B A;  5KJ7 C;  1FZG A;  2LKM A;  2KB7 P;  1VQK P;  3EQ2 A;  2OYI C;  2P67 A;  2E75 C;  3CCR P;  4JYB A;  4YXW H;  5GTI H;  4RKU J;  3P7K A;  1K04 A;  1NYH A;  1EDJ A;  1H89 A;  3TNU B;  2FYU K;  1L4A A;  1VQ4 P;  1SQP G;  4LC1 A;  3PLN A;  3NMD A;  3HD7 D;  3I56 P;  2R32 A;  3B4S A;  1JY3 P;  1RY3 A;  3O6Q A;  1BE3 G;  1ZRT E;  4OWF A;  3VP9 A;  3NXS A;  1KB9 H;  1MZ9 A;  3CXH E;  1PPJ E;  2A06 G;  3PJS K;  2V7Q J;  3WU2 E;  1SQB G;  1GZL A;  2K88 A;  1NTK E;  5AVW B;  1VQL P;  3TGU E;  3BAT A;  1RH5 B;  1YTZ T;  3PRJ A;  3H1H E;  3B5N D;  2RH0 A;  4EDF A;  2E74 B;  2K9J A;  4C46 A;  1CI6 A;  1SQQ J;  5CBN A;  4UB6 H;  1NAF A; 
#chains in the Genus database with same CATH homology
 1AFO A;  5AW7 B;  1OXZ A;  3VOP A;  2YNY A;  2J58 A;  2YKP A;  3HUS A;  3RK3 B;  5APT A;  4O9B A;  3HD7 B;  5AW1 B;  1N86 A;  1KIL A;  3V4W A;  1ZLL A;  1ZR2 A;  1FZC A;  4JYC A;  1H8A A;  1FOS E;  4C7R A;  1LTT C;  1IFI A;  1T2K D;  3RL0 D;  3KQG A;  3U1A A;  2WT7 A;  2HOD A;  3U59 A;  2WWW A;  5KLV K;  1N7S D;  1MUU A;  1YTZ I;  1IFM A;  2CPB A;  4I6M C;  1WRG A;  1MFZ A;  3PP5 A;  4WBA A;  2YO2 A;  5AW6 B;  2N1T A;  1M1J B;  3L4F A;  2NPS A;  1LTJ A;  5AVT B;  1SVF A;  3RK2 C;  3B5N B;  1G1I A;  1G2C A;  2FXM A;  2Q7C A;  1LTB C;  1L4A C;  3WMM 0;  1GU4 A;  1HGZ A;  1L0L K;  5CCG D;  3A7O A;  1NHL A;  1X8Y A;  5AVS B;  3GHG C;  1URQ D;  1X79 B;  1HVV A;  2POH A;  1SP4 A;  4WY4 D;  2OYH A;  2XU6 A;  3M9H A;  2WIT A;  2H8P D;  1GW3 A;  1FZF A;  2WSF H;  1X9V A;  1FU1 A;  5APX A;  2OYI B;  1GL2 A;  1LT9 C;  1JY2 N;  2JEE A;  3RK3 D;  1N7S B;  5APU A;  2HG5 D;  3U1C A;  2N9B A;  3L36 A;  5AW9 B;  3MIW A;  2Z5I A;  4DZO A;  1DX7 A;  1QL1 A;  1FJP A;  3P8C E;  3H6P A;  3A3Y B;  4I2L C;  5AVV B;  2GM4 A;  2GUV A;  2XNX A;  1N7L A;  3MUD A;  2QM7 A;  3L35 A;  2XDJ A;  1LWU A;  2KP8 A;  3A2A A;  3TNU A;  2A45 H;  4N78 E;  4AQR D;  3H32 B;  3M91 A;  4AUW A;  2KSJ A;  2WSE H;  1IFN A;  3SWF A;  1SFC A;  1E5W A;  3M0A A;  3VMX A;  4B86 A;  1ZV8 A;  1T3U A;  5APQ A;  3VTP C;  1KFM A;  1A02 J;  1J2J B;  1KIL C;  5AVU B;  1FZC C;  1GW4 A;  1S9K E;  1JUN A;  4Y99 C;  1RF1 B;  2Q9I A;  3TK1 A;  4W7Z A;  3P8M C;  2FFD A;  3V2N A;  3P8C D;  4GT1 A;  1JTH A;  4LLH A;  1SQX K;  2R5D A;  1L0N K;  2O01 H;  1MV8 A;  1N73 B;  1AQ5 A;  3B8E B;  2NPS C;  3CL3 D;  1URQ A;  5KJ7 D;  1FDM A;  1LTJ C;  3M06 A;  4N78 D;  1FZE A;  5AVY B;  1SQB K;  2Z4E A;  3T97 A;  1JCD A;  4I1L A;  5AW5 B;  4WY4 A;  5AW2 B;  1JOC A;  2M3B A;  2IX7 C;  1FBM A;  2E42 A;  5AW4 B;  3MTU E;  2PP6 A;  1IJD B;  1S9K D;  1GTW A;  1LTJ B;  3HD7 A;  1EQ7 A;  1M7L A;  5CMZ A;  2WTY A;  1CSB A;  1RF0 A;  1CZQ A;  3V5B A;  1KQL A;  2YKO A;  5CJ4 A;  4RES B;  3NFQ A;  3N7N A;  1HH0 A;  2HFE D;  1NKN A;  1FJK A;  1VDF A;  2QM8 A;  1JY2 O;  2OAR A;  4GIF A;  1OWA A;  1SLQ A;  3I5C A;  4IFF A;  1GL2 C;  2XV5 A;  5APV A;  3UIA A;  2BAS A;  3II6 A;  1RE3 A;  5APY A;  4N6J A;  3R2P A;  3V4Q A;  3MGN A;  4HYT B;  3RK2 B;  2WSC H;  2KOG A;  2XKM A;  3MD0 A;  2KLV A;  4W80 A;  1M1J A;  2KYV A;  3LW5 H;  1L4A B;  2HPC B;  1GK4 A;  3HE4 B;  1GL2 B;  1T8Z A;  3B5N A;  5AVZ B;  1LWU C;  3VMZ A;  2VRS A;  4XE5 B;  4C7N B;  3O8Z A;  1NTZ K;  1JY3 O;  3RL0 C;  2I1J A;  3VYI A;  1KIL D;  1LTS C;  1SFC C;  3GHG B;  4DOJ A;  3LID A;  3BRV B;  1IFD A;  2YMY A;  2I1K A;  3HE5 B;  2Q3I A;  3V2Q A;  3CLQ A;  3KPE A;  1GU5 A;  2R5B A;  1NU1 K;  5CCH D;  1HGV A;  4IFM A;  1LT9 B;  2CPS A;  3M9B A;  5KJ7 A;  3BRT B;  2HLO A;  1IC2 A;  2FFD C;  1J1E C;  2OYI A;  3IR9 A;  2NPS D;  3HRN A;  3HUS C;  1NOH A;  1JY3 N;  3IFM A;  1N7S A;  5KTB A;  1CW5 A;  4W7Y A;  4OH8 B;  1CI6 B;  1URQ C;  1SQP K;  5APS A;  3HTK B;  1HWT C;  1FZA A;  2FFD B;  5AVR B;  2PAJ A;  2GUS A;  2IPP A;  3HUS B;  4WY4 C;  2C9N Y;  3V2R A;  1W2E A;  1FAV A;  3H32 A;  2A45 G;  1T3J A;  1LTG C;  1NKZ B;  3EFG A;  1KIL B;  2J59 M;  3OJA B;  1FZC B;  5CCG A;  1JO5 A;  3RK2 D;  3N4X A;  2M8R A;  3HD7 C;  4Y99 B;  5BU5 A;  2N1T C;  1L4A D;  2W27 A;  1RF0 C;  2WT7 B;  2HOD B;  1WT6 A;  4HH2 A;  5CJ0 A;  1GL2 D;  2H43 A;  5AW3 B;  2L5G B;  5AW0 B;  1XTC C;  1RF1 A;  1DH3 A;  1LGH B;  3M0D A;  1HJB A;  4EIJ A;  3TYY A;  1KFN A;  1VPC A;  4GKG A;  1J1D C;  2C0X A;  1XTG B;  2N1T B;  2O1K A;  5CHX A;  2NPS B;  5APW A;  1RE3 C;  1Z56 A;  4EOT A;  2P7J A;  1N73 A;  3V2P A;  3G3Z A;  1G2C B;  4KHX A;  1NTM K;  2P2U A;  1M1J C;  2ZXE B;  3P32 A;  1JNM A;  2OYH C;  2A45 I;  3KYQ A;  1SFC D;  2WZ7 A;  1RE4 A;  2FYZ A;  4JF7 A;  1HUC A;  3B5N C;  1IO4 A;  3SWY A;  5CCH A;  1J1D B;  2C9L Y;  1YYC A;  1LTA C;  3CI9 A;  1NO4 A;  1FZB A;  1SQV K;  3L37 A;  2P1J A;  1NH4 A;  3VP8 A;  1DEB A;  1HTL C;  1LTI C;  2OYH B;  5AVX B;  2HYN A;  3BVH A;  2XZR A;  1GD2 E;  2R3C A;  2MJZ A;  1ZR4 A;  2O1J A;  2ZFC A;  3VN0 A;  2IFM A;  3LIE A;  3NTN A;  2W6B A;  5KJ7 C;  2JJL A;  1FZG A;  2LKM A;  2KB7 P;  1T2K C;  1GK6 A;  3EQ2 A;  1JY2 P;  2OYI C;  2P67 A;  3M9Q A;  1G1J A;  4JYB A;  4IFD K;  1N2D C;  1N7S C;  3P7K A;  3KDP B;  2FKW B;  4ZKP A;  1LWU B;  2WPR A;  1H89 A;  1NWQ A;  3TNU B;  3A5T A;  2FYU K;  1IFJ A;  1L4A A;  3RL0 B;  2HPC A;  1SFC B;  4LC1 A;  1HBW A;  3HE4 A;  1ZN5 A;  3E1I A;  1JMM A;  3NMD A;  1PFI A;  3HD7 D;  4C7N A;  2YO3 A;  2N1T D;  2WPQ A;  1IK9 A;  4LGD E;  2R32 A;  1A02 F;  1JY3 P;  3GHG A;  3OAK A;  4XA4 A;  1RY3 A;  5AW8 B;  3BAS A;  5CCG C;  3TSI A;  1KZU B;  3OA7 A;  2Z5H A;  2H7H A;  5BVZ A;  3HE5 A;  1GDT A;  3VP9 A;  3NXS A;  1MZ9 A;  1J1E B;  2C0W A;  1JTH B;  1RF1 C;  3VMY A;  1LT9 A;  1NTK K;  3M0D C;  1GZL A;  4M3L A;  4N3Y B;  2W6A A;  1SQQ K;  5AVQ B;  1QL2 A;  4WB4 A;  3C9I A;  4AYC A;  1JCC A;  5BU8 B;  2Q5U A;  2E43 A;  5AVW B;  3BAT A;  1YTZ T;  1URQ B;  3RK3 C;  1N73 C;  3B5N D;  2WPS A;  2YKQ A;  4ZKU A;  4WY4 B;  4C46 A;  1H88 A;  1CI6 A;  1RE4 C;  3HTK A;  1FOS F;  1NAF A;  2IFN A;  5CCH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...