1JY3P

Crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
46
structure length
46
Chain Sequence
VATRDNCCILDERFGSYCPTTCGIADFLNNYQTSVDKDLRTLEGIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRINOGEN ALPHA CHAIN
publication title Crystal structure of the central region of bovine fibrinogen (E5 fragment) at 1.4-A resolution.
pubmed doi rcsb
molecule tags Blood clotting
total genus 11
structure length 46
sequence length 46
chains with identical sequence S
ec nomenclature
pdb deposition date 2001-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jy3P00
3GHGC 1RE4C 3GHGB 3GHGA 2OYHC 1JY3P 1T3UA 1N73C 1N73B 1N73A 3E1IA 1FZFA 2OYIA 2HPCB 2FFDB 1JY3N 2HLOA 2HPCA 1RE3C 2FFDC 2FFDA 1RE3A 1JY2O 2Q9IA 2XNXA 2A45G 3H32B 3BVHA 3H32A 1RF1B 1LWUB 1LWUA 1FZEA 2OYIC 1RF1C 1LWUC 1RF1A 1FZGA 2HODB 1FZCB 2HODA 1FZCA 1FZBA 1FZCC 1JY2P 2Z4EA 2OYIB 1RF0A 2OYHB 1LT9C 1LT9B 1M1JC 1LT9A 1LTJC 1LTJB 1M1JA 1JY2N 1LTJA 1M1JB 1RF0C 2A45H 3HUSB 3HUSC 3HUSA 2OYHA 1JY3O 1N86A 2H43A 1FZAA 2A45I 1W2EA 1RE4A
chains in the Genus database with same CATH superfamily
4WWIA 1XTCC 4JYBA 3OW2O 2Y9YA 4K35A 1NAFA 1VQOP 2NPSD 4N78E 1HJBA 2B88A 1JY2P 3Q2YA 1YQ3C 1JTHA 2KSEA 3A7OA 5AVZB 1NTKD 5BU8B 1RE3C 5CCHD 1QLED 5DJTB 5BU5A 3CWBJ 2E75D 2HODA 2PRRA 2KK7A 3SSUA 3F5HA 1SQXG 3BCCG 2QM8A 3HE5B 1FE6A 4LLHA 2QJPC 5AW2B 3L37A 1NTMK 3JSVC 2NPSA 1KILB 2V4HA 2N1TB 2BCCD 2KOGA 2QJYC 1AA0A 1L0NG 3L72J 3RL0B 2N9YB 4YTPC 5TISE 1IFMA 5CCHA 2C0XA 1IFIA 4WY4C 4H0LD 2HLOA 1EDKA 1QVGO 2FYUJ 3WU2H 3H1HE 1PFIA 3L36A 2PAJA 2A06G 2IYPA 4KJMA 2XNDH 5AW3B 1SFCD 3TF5A 2J58A 3UIAA 2JJLA 1S1CX 1BSHA 4ASVA 1T6AA 1H8AA 1L0LD 2H89C 3S4RA 2OTKE 1DD3A 3CPWO 3USSA 1HWTC 3CCMP 1MFZA 1DD4A 2QG4A 2KS1B 1NTKK 2R3SA 1PV3A 1K73Q 2WSFJ 1NVOA 1YJWP 2E5TA 3GLMA 3H1IJ 1SFCA 1E79H 3FXDA 3EWKA 1CI6A 1KN7A 3H1KG 2IYOA 2YKOA 3M06A 1QX8A 3QWOC 3B5NC 2YMYA 1Q90D 3MUDA 3II6A 3L74D 2WT7B 3L71G 2W6BA 5C39A 1FDOA 1NKZB 1N73A 3KZIH 1FZFA 5GTIE 2P58A 1K8AQ 3H32A 2W6AA 1S5LX 1PP9J 1RF1A 2H7HA 2P67A 3D6ZA 3VN0A 1HTLC 1NJIQ 1KYOH 1YTZT 3Q5SA 3V2NA 1DEEG 2B87A 1NWQA 3H1HJ 4WB4A 1T2KD 3O6QA 3O8ZA 4RJTA 2OQQA 2LXBA 1KILD 1JOCA 2N1TD 1X0TA 2QEXP 3TNUA 5AW6B 1SLQA 3RL0D 3SWKA 1YBKA 5KKZB 2AXTH 3ZDMA 2E76C 2E76B 2YXQB 1KQFB 1JY2O 3AE3C 1G1IA 1OMIA 4D6TJ 1KILE 1LWUB 4OGQC 4OGQB 1GMJA 5KAIE 5K5GB 4H44D 1X79B 4AQRD 3KDPB 2ZFCA 4UB6E 5CHXA 2WSCJ 2M8RA 1EZVG 2FFDA 4W80A 4NPEA 1KZUB 2B89A 1S72P 1URQD 1KILA 1NKNA 1LTSC 2N1TA 4PJ0E 3AE8C 1WMKA 3MIWA 1DEBA 2O3JA 4W7ZA 3L70E 2C0WA 3V4QA 1SQQD 1IJDB 1VQ9P 2W6JH 3HUSC 1Q2NA 1SQPD 1MV8A 1HH0A 2JDIH 4WVZA 5E79E 1BGYD 2D2CD 3BRTB 2HFED 4ZNCA 1RY3A 5AW9B 1SQQE 1HJ0A 1URQA 3PP5A 3V2QA 2HYNA 4M3LA 3HTKA 1S2EA 1ZOYC 2ZT9C 1SQVD 2ZT9B 3HE4B 3CC7P 1SQPE 2Y9ZA 2XV5A 3RGUA 4L74A 4Z1MH 1L4AB 4O9BA 2OYOA 3TGUE 2KYVA 3EFGA 3G3ZA 1SQVE 2I1KA 3PHLA 1FZEA 1OW6A 1FZCC 1YJ9P 1JTHB 5AVSB 3HD7B 1SQBD 1BCCD 3OA7A 3D71A 1JEKA 1NTZE 1PL5A 2Q9IA 4B86A 2HODB 2WWWA 3NTNA 2Q1KA 5AVQB 1BDCA 3OJAB 2WSCH 3L73J 3AE4C 3C8VA 1USEA 5APYA 2YMKA 1RE4A 4TLFA 2WT7A 1G2CA 2Y0CA 3H1JD 1U57A 2E74D 4C7NA 3CXHH 4OWFA 2NPSC 2NPSB 3PH0A 3A5TA 1LTBC 1FOSE 3IF4A 2ZYDA 1VQ8P 1LTTC 5B5EE 1VQ5P 1SQQK 2YIUB 3E1RA 1OFCX 2M5AA 3L70J 3G9RA 1MFTA 4ASWA 5CCHC 1SQPK 2E75B 2Q5UA 2O1JA 4W7YA 3A0HH 1M57D 4GT1A 4UB8H 3SWYA 1NOHA 3CWBG 1SP4A 1SQVK 3FWNA 1GK4A 1NO4A 4U7JA 2WPSA 2HPCA 5AVUB 3IAOA 1W2BO 4AUWA 3H1LE 3GF3A 1ZW0A 5B66H 3TGUJ 4I2LC 1JCCA 1ZR4A 4I7ZC 4I7ZB 1NTZK 1NU1E 3L72G 2IBZD 4H0LB 2XZRA 4K3AA 2KI7B 5KLVE 1CW5A 1SQBK 1MZ9A 2ZXEB 5AVRB 1IC2A 1OX3A 3S1KA 4JBZA 1VF5C 1JB0J 2WITA 4NPDA 2V7QJ 2FYUG 2C9NY 1N2DC 1P84H 1NTZJ 3N7NA 1H88A 4BWNA 1SFCC 1BDDA 2WSEH 1CI6B 3TK1A 1PGPA 1ZV8A 2Z5HA 1Q81Q 3CCJP 3AEDC 2OYHB 1NTME 3MUDC 3P7KA 1BE3E 2R3CA 1N73C 1GTWA 3HD7D 1N73B 3WMM0 3CX5H 1W5CE 3AEEC 4PV1B 3H32B 3KYQA 1RF1C 2WQYC 2Q3EA 1K05A 5GTHH 1DH3A 3B71A 3MGNA 2AEJA 1EXJA 1VQMP 1G1JA 4LC1A 2OTLP 3BRVB 3L75E 1S9KD 2B87B 3VYIA 1IFPA 3O6QB 2O01N 1NU1K 3H1IG 2ZJSE 4U3FE 1PGOA 3MP7B 3L4FA 5KLVK 3TNUB 3MHVA 3VMXA 3HD7A 3Q3DA 1AJYA 1ZMEC 1PPJG 3H1LJ 2W27A 1M90Q 3U1CA 1IZNB 1UIIA 5AVXB 4QMAA 1EC5A 1NU1J 1X8YA 3H1ID 1YQ4C 4IFFA 3EFFK 1USDA 1PP9G 3VOPA 5KLVJ 1JMMA 3A0BE 1FOSF 1NTKE 1GW4A 1T2KC 4GODA 2FFDB 3GG2A 2AEMA 3IFMA 1KILC 2N1TC 1T8ZA 3H1HG 5APVA 5AW5B 1M1JA 2NZ2A 3RL0C 3VMYA 5KAFE 3I55P 1SQXD 5EFWB 3CCUP 4OVNF 2BASA 3BCCD 3W68A 5AW4B 4KHXA 2BCCE 4OH8B 1NTMJ 4C7RA 3RK3B 1BE3J 4H44B 1LJ2A 1L0ND 1PGJA 2IPPA 4D6TG 4I1LA 1VQ4P 4EOTA 1U7MA 3L35A 1JY3N 1URQB 4ZMDA 3CCLP 3HTKB 2XNXA 2L5GB 1EDJA 1CZQA 2K88A 1ZN5A 2Z4EA 1LT1A 3L75J 2KZJA 3VMZA 2PFXA 2ZYGA 1EDIA 2A06D 4IFDK 1FBMA 4U3FJ 3C9IA 2G3AA 3CCVP 2JP3A 1FZBA 1L0LE 4PV1D 4NPFX 5AW8B 3H25A 1Y9BA 2KLVA 2A06E 2D2CC 2D2CB 2IX7C 3JCUE 3CD6P 5APQA 4DT0A 3CXHD 2QM7A 4PD4D 4JQ0D 4YXWH 1EQ7A 1S3JA 1AFOA 2WTYA 2FBWC 2I1JA 4RKUJ 3BATA 1NTKJ 3AE2C 2OYHA 4JPZB 4PD4E 1JCDA 3KQGA 2WZ7A 2BEZF 1G2CB 1VQKP 2XKMA 4C7NB 1SQXK 3CMAP 3CI9A 1L2PA 4DOJA 4YXDC 2B9BA 1S5LH 1JUNA 3H1KD 3IR9A 3M0AA 3AEGC 1KB9D 3L74E 1VQ7P 2M5AB 1W2EA 4IOIH 2BCCJ 1VPCA 5KJ7C 3K5BA 3L71D 2J5UA 1TU3F 3WUVA 1KB9E 1RF0C 2VRSA 1CSBA 1XTGB 3FXEA 3L71E 2E74B 4IL6E 3ITKA 1GL2B 1L0LK 5KKZC 3L73G 1KQSO 2HPCB 5H2FE 3CC4P 2RKLA 1LWUC 1X9VA 3MTUE 1P84D 3RBXA 2QVAA 3RK3D 1VL2A 2IDBA 1H0TA 3KHUA 3Q5RA 1FJPA 3V5BA 1HBWA 1L0LJ 3L70G 4WY4D 5TJHA 3EQ2A 1KMIZ 2WSFH 1OVRA 3M9HA 3RK2B 3RK3E 1LTJA 1JNMA 1Z56A 3QH9A 3JC22 1JMBA 3CX5D 4JF7A 2SPZA 2BEQD 3P8CD 1EZVD 3W67A 3WUTA 1Q82Q 2OARA 3WUUA 2A45I 2E5YA 3HRNA 1DX7A 1NH4A 3TGUG 2FYNB 4WY4A 2W8ZA 1LTAC 5TISH 4DJGA 1LP1B 1ZLLA 3L74J 2WPVB 2JKVA 2I8DA 5CBNA 2R5DA 2W83C 1BGYE 3SFDC 1L4AC 2OTJP 2GUSA 1YITP 3H6PA 2KSJA 1NTZG 1VDFA 5KTBA 2AEFA 3GF7A 2OYIB 2HR3A 1H89A 3HD7C 5AW0B 2H8PD 1KFNA 3BVHA 1Q7YQ 2JWAA 2M3EA 4JYCA 1SQBE 1BCCE 1J1EC 1J1EB 1IFJA 3LW5J 4GOFA 1OXZA 4C46A 5CJ4A 1K04A 3PRJA 2KXPB 1GL2D 5AVYB 1HF9A 3OAKA 1M1JC 1M1JB 2YIUC 1PIXA 1LGHB 3H1JE 1YIJP 3WU2E 2E75C 1KD1Q 1AQ5A 2K9JB 2W90A 3V2PA 3H1LG 5GTIH 3PTZA 2WSSH 3R4YA 2N9BA 3RK2D 1NU1G 1SQQJ 2H88C 1ZRTD 1VQPP 1GL2A 1Q86Q 1WRGA 5KLVG 1FAVA 1SQPJ 2JR8A 1BGYJ 1U7JA 1N7LA 3CWBD 1YTZI 2P10A 1SQVJ 4H0LC 2QJKB 1LTGC 1A02J 2Q3IA 4IL6X 5CCGD 3MZWB 2UWJE 2IBZI 2K3RA 1IK7A 3SWFA 1NTMG 3TDKA 3R2PA 1J2JB 1SVFA 2IBZE 1BE3G 1R5LA 5KAIH 1OZHA 3L72D 1RQVA 1OIPA 2Y0DA 1MKMA 1NAYA 4UB6H 1NHLA 3P32A 1SQBJ 1BCCJ 1FZGA 2JEEA 2M3BA 2FXMA 3GW6A 5AW1B 2P7JA 1KYOD 3IN6A 1LT9A 2OYHC 4EI2A 3KZIE 4AYCA 3RBZA 4HJGH 4PJ0H 3CMEP 2FYUD 3L75G 1JY3P 2FYZA 5CCGA 2FXPA 3S9OA 2KNCB 4PV1C 1LP1A 1KYOE 1YYCA 1OVUA 4U3FG 3H1JJ 4R4LA 3HUSA 2FYUE 5L8RJ 4H13B 1HGVA 3M0DA 1T3JA 1ZP0C 5KLIC 5KLIB 1A02F 5E79H 2R5BA 1KQGB 4N78D 2OYIA 4ZKPA 2AXTE 1HUCA 3CCQP 1S9KE 1NTKG 3PJSK 1OW8A 1K9MQ 3A3YB 4BXLA 1FZCA 1RQUA 2KZIA 1H0TB 1OW7A 1VQLP 4EDFA 2Z5IA 5M1BA 2FFDC 1PPJD 5CJ0A 2BCCG 2CPSA 3D6YA 3H1IE 2V7QH 1FS0E 1LNQA 2ZVNB 1HGZA 1LTJC 1LTJB 4L75A 4TT3H 3AECC 2QE7H 1PP9D 2KUBA 3GHGA 2KLUA 2GA1A 2R44A 2QJPB 1PPJE 2YO3A 2K37A 2FYUK 3CCSP 2K9JA 2QJYB 2KP8A 3N4XA 1YI2P 1MUUA 1QEXA 3RK3C 4XFJA 1GD2E 4H44C 1SQXE 3H1HD 1PP9E 2YXRB 1AV1A 2NRGA 3BCCE 3Q1MA 4WY4B 2RN0A 3VMAA 5B5EH 1R8EA 4RESB 1URQC 4HKZH 3FX0A 4MN4C 3Q5PA 1L0LG 1L0NE 1VF5D 2WPQA 1J1DC 1J1DB 1N86A 4I6MC 4D6TD 1DIPA 3SFEC 2GUVA 2RMZA 1FDMA 2QRXA 1N7SD 4RO0A 4DCKA 3FWLA 3T97A 4D6TE 1M56D 1GU4A 2L91A 1QL2A 4H13D 1NYHA 4R4MA 1LTIC 5APUA 3LIEA 5CBOA 3CXHI 4PD4I 1SS1A 3VP8A 3KPEA 3F89A 1JY2N 1FU1A 2P2UA 3L74G 1GZLA 3CXHE 2YNYA 1RE4C 1X22A 3U59A 1T3UA 1YJNP 4BRYA 1N7SA 2KNCA 3AE7C 1FJKA 2JO1A 3MD0A 3B5NB 1JY3O 2O1KA 2G8YA 3BASA 2XU6A 3A0HE 2JWDA 1L0NK 4UB8E 2KIKA 1KB9I 3C1LA 2POHA 1SQXJ 1VQNP 3H1KE 2RH0A 3AEAC 1RH5B 3P8MC 3BCCJ 4N6JA 5AVWB 2Q7CA 2E74C 2J59M 1N8RQ 1GL2C 1KTMA 1R5SA 1L0NJ 5B66E 2ITAA 2ZVOB 3VP9A 1AQTA 5AVTB 5APSA 4XE5B 3NFQA 4XA4A 5CMZA 3NMDA 3M91A 1P84I 2QA4P 5APTA 1RE3A 3L73D 3TYYA 1P84E 1PZQA 1JO5A 2OGUA 3RK2C 3VTPC 3PLNA 3LIDA 3RL0g 3HE5A 2WMMA 3L73E 1QVFO 1SQQG 2FXOA 3A0BH 1KFMA 2A45G 5AVVB 3CX5I 3L70D 1YHQP 1GDTA 4ZKUA 1SQPG 3U1AA 1LT9C 1LT9B 2IZ1A 1EZVI 3V6IA 3M9QA 3CX5E 1BGYG 2GM4A 1FDIA 2FYNC 2PGDA 5GTHE 3P8CE 5KAFH 1EZVE 5CCGC 1EXIA 4EYYQ 1SQVG 4L73A 3V2RA 1KQLA 1UIXA 3HUSB 2FY8A 1E5WA 1M1KQ 2WVRA 3M0DC 3H1KJ 4L76A 3G4SP 4GDOA 3TGUD 1ZXGA 1AVOA 4GOEA 1KV4A 2R32A 3AE1C 3CC2P 3L71J 1WT6A 3GMAA 2OYIC 3G6EP 1AVYA 1SQBG 1BCCG 1OVVA 2AXCA 3B5ND 1Y8AA 3B8EB 3CL3D 4YPCA 4HB1A 2O01J 2YO2A 3I56P 1GW3A 1NTZD 2PP6A 1FZCB 2IFNA 2KS1A 3AE9C 4Y28J 1IK9A 2HG5D 4WBAA 3H1JG 1IFNA 3E7KA 3V4WA 4DZOA 1M7LA 1KC8Q 5DJUB 5APWA 5KJ7D 3JCUH 2YKQA 1PGQA 5BVZA 2LKMA 2E43A 2WSEJ 2Q6QA 2IFMA 4N3YB 2M0BA 3B5NA 1FC2C 3GHGC 3GHGB 1BSNA 1D7MA 3I5CA 4PD4H 1KORA 2E76D 2Y0EA 4OGQD 2MJZA 3AEBC 1ZR2A 2H43A 1Y47A 5KJ7A 1GK6A 2YKPA 1RHZB 3D70A 3M9BA 3CCRP 1RF0A 3H1LD 2QIWA 2ZYAA 2QSIA 2IBZG 4GIFA 1ZRTE 1KB9H 1NU1D 3AE6C 3AE5C 3E1IA 4Y99C 4Y99B 2QJKC 1S4XA 4CPGA 1QL1A 3B4SA 4IL6H 2CPBA 5KLVD 1LWUA 5AW7B 2LXCB 1IFDA 3T97B 2K9YA 5H2FH 2XDJA 3A2AA 3FGAD 3CWBE 1OWAA 2O01H 4A7PA 2DW3A 4IFMA 3G71P 5APXA 1QGKB 3KXDA 2E42A 2ZXXA 1HVVA 2IZ0A 1VF5B 2ZT9D 3LW5H 3CLQA 3AEFC 1NTMD 1FZAA 3L72E 1S5LE 1L4AD 1NGMB 1KYOI 1SFCB 1BE3D 4HH2A 2ZAEB 2LR2A 1GU5A 4BRYB 1N7SC 1N7SB 2K1AA 4LGDE 2FKWB 3TSIA 2CK3H 1M8OB 2KB7P 2MKVA 4HYTB 3CCEP 4H13C 2C9LY 2P1JA 4GKGA 3L75D 3NXSA 1JM0A 1RF1B 1VQ6P 1IO4A 3HE4A 4KT0J 2WPRA 4U3FD 4EIJA 2A45H 1EDLA 3ABVC 1L4AA
chains in the Genus database with same CATH topology
1XTCC 1QL2A 4JYBA 4JF7A 5CCHC 1SQPK 2Q5UA 1LTIC 1NAFA 2O1JA 4W7YA 5APUA 3P8CD 3LIEA 4GT1A 2NPSD 4N78E 1HJBA 1JY2P 3SWYA 2OARA 3VP8A 1NOHA 3KPEA 1SP4A 1JY2N 1JTHA 1FU1A 1SQVK 2P2UA 1GZLA 3A7OA 1GK4A 2YNYA 2A45I 1NO4A 5AVZB 1RE4C 3HRNA 1DX7A 1NH4A 3U59A 1T3UA 4WY4A 2WPSA 5BU8B 2HPCA 1RE3C 1LTAC 5CCHD 1N7SA 5BU5A 1ZLLA 5AVUB 1FJKA 2HODA 4AUWA 3MD0A 4I2LC 1JCCA 3B5NB 2R5DA 1ZR4A 1JY3O 1NTZK 2O1KA 3BASA 1L4AC 2XU6A 2QM8A 2GUSA 3HE5B 4LLHA 1L0NK 2XZRA 5AW2B 3L37A 1NTMK 1CW5A 3H6PA 1SQBK 1MZ9A 1VDFA 2KSJA 2NPSA 2POHA 5KTBA 1KILB 2ZXEB 5AVRB 1IC2A 2N1TB 2KOGA 3P8MC 2OYIB 2WITA 3RL0B 1H89A 4N6JA 5AVWB 2Q7CA 2C9NY 1N2DC 3HD7C 3N7NA 1H88A 2J59M 1IFMA 5CCHA 1GL2C 1SFCC 2C0XA 1IFIA 4WY4C 5AW0B 2H8PD 2WSEH 2HLOA 1KFNA 1CI6B 3TK1A 1ZV8A 2Z5HA 3BVHA 3VP9A 5AVTB 5APSA 2OYHB 4XE5B 1PFIA 3NFQA 4JYCA 3L36A 4XA4A 5CMZA 1J1EC 1J1EB 2PAJA 3NMDA 1IFJA 3P7KA 3M91A 2R3CA 5AW3B 1N73C 1GTWA 3HD7D 1N73B 3WMM0 1OXZA 4C46A 5CJ4A 5APTA 1RE3A 3TYYA 1GL2D 1SFCD 5AVYB 3H32B 3KYQA 2J58A 3UIAA 1RF1C 2JJLA 3OAKA 1DH3A 3MGNA 1JO5A 1H8AA 3RK2C 1M1JC 1M1JB 1G1JA 4LC1A 3VTPC 1LGHB 3BRVB 3LIDA 3HE5A 1S9KD 3VYIA 1HWTC 1AQ5A 1MFZA 1KFMA 2A45G 5AVVB 1NU1K 3V2PA 1GDTA 1NTKK 4ZKUA 3U1AA 1LT9C 1LT9B 3L4FA 5KLVK 3TNUB 2N9BA 3VMXA 3M9QA 3RK2D 2GM4A 3HD7A 1GL2A 1SFCA 1WRGA 3P8CE 2W27A 5CCGC 1CI6A 1FAVA 3U1CA 5AVXB 3V2RA 1KQLA 2YKOA 1X8YA 3M06A 4IFFA 3HUSB 3B5NC 1E5WA 2YMYA 1N7LA 1YTZI 3MUDA 3VOPA 3II6A 3M0DC 2WT7B 1JMMA 1FOSF 2W6BA 1GW4A 1NKZB 1N73A 1T2KC 1FZFA 2FFDB 1LTGC 3IFMA 1A02J 2Q3IA 3H32A 1KILC 5CCGD 2R32A 2W6AA 2N1TC 1T8ZA 1RF1A 2H7HA 2P67A 3VN0A 1HTLC 1WT6A 5APVA 3SWFA 5AW5B 2OYIC 1M1JA 3RL0C 3VMYA 3R2PA 1J2JB 1SVFA 1YTZT 3B5ND 3B8EB 3CL3D 3V2NA 2BASA 5AW4B 2YO2A 1NWQA 4KHXA 4WB4A 1T2KD 4OH8B 4C7RA 1GW3A 3O8ZA 1NHLA 3P32A 2PP6A 1FZGA 1FZCB 2JEEA 2IFNA 2M3BA 1KILD 1JOCA 2FXMA 3RK3B 2N1TD 5AW1B 2P7JA 1LT9A 2IPPA 2OYHC 4AYCA 3TNUA 5AW6B 4I1LA 1IK9A 1SLQA 4EOTA 3RL0D 2HG5D 4WBAA 1IFNA 4DZOA 3V4WA 1M7LA 3L35A 1JY3P 5APWA 1JY3N 2FYZA 1URQB 5KJ7D 5CCGA 2YKQA 1JY2O 3HTKB 2XNXA 1G1IA 2L5GB 5BVZA 1LWUB 2LKMA 2E43A 1CZQA 1ZN5A 1YYCA 2Z4EA 2IFMA 4N3YB 3HUSA 3B5NA 1HGVA 1X79B 4AQRD 3VMZA 3M0DA 3GHGC 3GHGB 3KDPB 2ZFCA 1T3JA 5CHXA 4IFDK 2M8RA 3I5CA 1FBMA 1A02F 2FFDA 3C9IA 4W80A 1KZUB 2R5BA 1URQD 1KILA 1NKNA 1LTSC 2N1TA 1FZBA 4N78D 5AW8B 2MJZA 1ZR2A 2OYIA 4ZKPA 2KLVA 1HUCA 2H43A 3MIWA 2IX7C 5APQA 1S9KE 2QM7A 1DEBA 5KJ7A 1EQ7A 1GK6A 2YKPA 1AFOA 4W7ZA 2WTYA 2I1JA 2C0WA 3V4QA 3A3YB 3M9BA 1FZCA 1IJDB 3BATA 1RF0A 2OYHA 3HUSC 1MV8A 1JCDA 1HH0A 3KQGA 2WZ7A 4GIFA 1G2CB 2Z5IA 3BRTB 2HFED 2XKMA 3E1IA 4C7NB 1SQXK 1RY3A 3CI9A 4Y99C 4Y99B 5AW9B 3PP5A 1URQA 3V2QA 2FFDC 1QL1A 2HYNA 4M3LA 2CPSA 5CJ0A 3HTKA 4DOJA 2CPBA 1LWUA 5AW7B 3HE4B 1JUNA 1IFDA 3IR9A 3M0AA 2XDJA 1HGZA 3A2AA 1LTJC 1LTJB 1OWAA 2XV5A 2O01H 4IFMA 1L4AB 1W2EA 4O9BA 3GHGA 5APXA 1VPCA 5KJ7C 2KYVA 2E42A 3EFGA 2YO3A 3G3ZA 1HVVA 2FYUK 2I1KA 1FZEA 2KP8A 3N4XA 1FZCC 1MUUA 3RK3C 1GD2E 1RF0C 2VRSA 1JTHB 3LW5H 3CLQA 1CSBA 5AVSB 3HD7B 1FZAA 1XTGB 3OA7A 1GL2B 1SFCB 1L4AD 1L0LK 4HH2A 4WY4B 1GU5A 2HPCB 4RESB 1N7SC 1N7SB 1URQC 2Q9IA 4B86A 4LGDE 1LWUC 2HODB 2FKWB 2WWWA 1X9VA 3NTNA 3MTUE 5AVQB 3TSIA 3OJAB 2KB7P 2WPQA 2WSCH 4HYTB 1J1DC 1J1DB 3RK3D 1N86A 4I6MC 5APYA 2C9LY 1RE4A 1FJPA 3V5BA 2WT7A 1G2CA 2P1JA 1HBWA 2GUVA 4GKGA 1FDMA 4C7NA 3NXSA 4WY4D 2NPSC 2NPSB 3A5TA 3EQ2A 1RF1B 1LTBC 1N7SD 1FOSE 1IO4A 3HE4A 2WSFH 3M9HA 3T97A 3RK2B 2WPRA 1LTTC 1LTJA 1SQQK 4EIJA 2A45H 1JNMA 1Z56A 1GU4A 1L4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GHG C;  1RE4 C;  3GHG B;  3GHG A;  2OYH C;  1JY3 P;  1T3U A;  1N73 C;  1N73 B;  1N73 A;  3E1I A;  1FZF A;  2OYI A;  2HPC B;  2FFD B;  1JY3 N;  2HLO A;  2HPC A;  1RE3 C;  2FFD C;  2FFD A;  1RE3 A;  1JY2 O;  2Q9I A;  2XNX A;  2A45 G;  3H32 B;  3BVH A;  3H32 A;  1RF1 B;  1LWU B;  1LWU A;  1FZE A;  2OYI C;  1RF1 C;  1LWU C;  1RF1 A;  1FZG A;  2HOD B;  1FZC B;  2HOD A;  1FZC A;  1FZB A;  1FZC C;  1JY2 P;  2Z4E A;  2OYI B;  1RF0 A;  2OYH B;  1LT9 C;  1LT9 B;  1M1J C;  1LT9 A;  1LTJ C;  1LTJ B;  1M1J A;  1JY2 N;  1LTJ A;  1M1J B;  1RF0 C;  2A45 H;  3HUS B;  3HUS C;  3HUS A;  2OYH A;  1JY3 O;  1N86 A;  2H43 A;  1FZA A;  2A45 I;  1W2E A;  1RE4 A; 
#chains in the Genus database with same CATH topology
 4WWI A;  1XTC C;  4JYB A;  3OW2 O;  2Y9Y A;  4K35 A;  1NAF A;  1VQO P;  2NPS D;  4N78 E;  1HJB A;  2B88 A;  1JY2 P;  3Q2Y A;  1YQ3 C;  1JTH A;  2KSE A;  3A7O A;  5AVZ B;  1NTK D;  5BU8 B;  1RE3 C;  5CCH D;  1QLE D;  5DJT B;  5BU5 A;  3CWB J;  2E75 D;  2HOD A;  2PRR A;  2KK7 A;  3SSU A;  3F5H A;  1SQX G;  3BCC G;  2QM8 A;  3HE5 B;  1FE6 A;  4LLH A;  2QJP C;  5AW2 B;  3L37 A;  1NTM K;  3JSV C;  2NPS A;  1KIL B;  2V4H A;  2N1T B;  2BCC D;  2KOG A;  2QJY C;  1AA0 A;  1L0N G;  3L72 J;  3RL0 B;  2N9Y B;  4YTP C;  5TIS E;  1IFM A;  5CCH A;  2C0X A;  1IFI A;  4WY4 C;  4H0L D;  2HLO A;  1EDK A;  1QVG O;  2FYU J;  3WU2 H;  3H1H E;  1PFI A;  3L36 A;  2PAJ A;  2A06 G;  2IYP A;  4KJM A;  2XND H;  5AW3 B;  1SFC D;  3TF5 A;  2J58 A;  3UIA A;  2JJL A;  1S1C X;  1BSH A;  4ASV A;  1T6A A;  1H8A A;  1L0L D;  2H89 C;  3S4R A;  2OTK E;  1DD3 A;  3CPW O;  3USS A;  1HWT C;  3CCM P;  1MFZ A;  1DD4 A;  2QG4 A;  2KS1 B;  1NTK K;  2R3S A;  1PV3 A;  1K73 Q;  2WSF J;  1NVO A;  1YJW P;  2E5T A;  3GLM A;  3H1I J;  1SFC A;  1E79 H;  3FXD A;  3EWK A;  1CI6 A;  1KN7 A;  3H1K G;  2IYO A;  2YKO A;  3M06 A;  1QX8 A;  3QWO C;  3B5N C;  2YMY A;  1Q90 D;  3MUD A;  3II6 A;  3L74 D;  2WT7 B;  3L71 G;  2W6B A;  5C39 A;  1FDO A;  1NKZ B;  1N73 A;  3KZI H;  1FZF A;  5GTI E;  2P58 A;  1K8A Q;  3H32 A;  2W6A A;  1S5L X;  1PP9 J;  1RF1 A;  2H7H A;  2P67 A;  3D6Z A;  3VN0 A;  1HTL C;  1NJI Q;  1KYO H;  1YTZ T;  3Q5S A;  3V2N A;  1DEE G;  2B87 A;  1NWQ A;  3H1H J;  4WB4 A;  1T2K D;  3O6Q A;  3O8Z A;  4RJT A;  2OQQ A;  2LXB A;  1KIL D;  1JOC A;  2N1T D;  1X0T A;  2QEX P;  3TNU A;  5AW6 B;  1SLQ A;  3RL0 D;  3SWK A;  1YBK A;  5KKZ B;  2AXT H;  3ZDM A;  2E76 C;  2E76 B;  2YXQ B;  1KQF B;  1JY2 O;  3AE3 C;  1G1I A;  1OMI A;  4D6T J;  1KIL E;  1LWU B;  4OGQ C;  4OGQ B;  1GMJ A;  5KAI E;  5K5G B;  4H44 D;  1X79 B;  4AQR D;  3KDP B;  2ZFC A;  4UB6 E;  5CHX A;  2WSC J;  2M8R A;  1EZV G;  2FFD A;  4W80 A;  4NPE A;  1KZU B;  2B89 A;  1S72 P;  1URQ D;  1KIL A;  1NKN A;  1LTS C;  2N1T A;  4PJ0 E;  3AE8 C;  1WMK A;  3MIW A;  1DEB A;  2O3J A;  4W7Z A;  3L70 E;  2C0W A;  3V4Q A;  1SQQ D;  1IJD B;  1VQ9 P;  2W6J H;  3HUS C;  1Q2N A;  1SQP D;  1MV8 A;  1HH0 A;  2JDI H;  4WVZ A;  5E79 E;  1BGY D;  2D2C D;  3BRT B;  2HFE D;  4ZNC A;  1RY3 A;  5AW9 B;  1SQQ E;  1HJ0 A;  1URQ A;  3PP5 A;  3V2Q A;  2HYN A;  4M3L A;  3HTK A;  1S2E A;  1ZOY C;  2ZT9 C;  1SQV D;  2ZT9 B;  3HE4 B;  3CC7 P;  1SQP E;  2Y9Z A;  2XV5 A;  3RGU A;  4L74 A;  4Z1M H;  1L4A B;  4O9B A;  2OYO A;  3TGU E;  2KYV A;  3EFG A;  3G3Z A;  1SQV E;  2I1K A;  3PHL A;  1FZE A;  1OW6 A;  1FZC C;  1YJ9 P;  1JTH B;  5AVS B;  3HD7 B;  1SQB D;  1BCC D;  3OA7 A;  3D71 A;  1JEK A;  1NTZ E;  1PL5 A;  2Q9I A;  4B86 A;  2HOD B;  2WWW A;  3NTN A;  2Q1K A;  5AVQ B;  1BDC A;  3OJA B;  2WSC H;  3L73 J;  3AE4 C;  3C8V A;  1USE A;  5APY A;  2YMK A;  1RE4 A;  4TLF A;  2WT7 A;  1G2C A;  2Y0C A;  3H1J D;  1U57 A;  2E74 D;  4C7N A;  3CXH H;  4OWF A;  2NPS C;  2NPS B;  3PH0 A;  3A5T A;  1LTB C;  1FOS E;  3IF4 A;  2ZYD A;  1VQ8 P;  1LTT C;  5B5E E;  1VQ5 P;  1SQQ K;  2YIU B;  3E1R A;  1OFC X;  2M5A A;  3L70 J;  3G9R A;  1MFT A;  4ASW A;  5CCH C;  1SQP K;  2E75 B;  2Q5U A;  2O1J A;  4W7Y A;  3A0H H;  1M57 D;  4GT1 A;  4UB8 H;  3SWY A;  1NOH A;  3CWB G;  1SP4 A;  1SQV K;  3FWN A;  1GK4 A;  1NO4 A;  4U7J A;  2WPS A;  2HPC A;  5AVU B;  3IAO A;  1W2B O;  4AUW A;  3H1L E;  3GF3 A;  1ZW0 A;  5B66 H;  3TGU J;  4I2L C;  1JCC A;  1ZR4 A;  4I7Z C;  4I7Z B;  1NTZ K;  1NU1 E;  3L72 G;  2IBZ D;  4H0L B;  2XZR A;  4K3A A;  2KI7 B;  5KLV E;  1CW5 A;  1SQB K;  1MZ9 A;  2ZXE B;  5AVR B;  1IC2 A;  1OX3 A;  3S1K A;  4JBZ A;  1VF5 C;  1JB0 J;  2WIT A;  4NPD A;  2V7Q J;  2FYU G;  2C9N Y;  1N2D C;  1P84 H;  1NTZ J;  3N7N A;  1H88 A;  4BWN A;  1SFC C;  1BDD A;  2WSE H;  1CI6 B;  3TK1 A;  1PGP A;  1ZV8 A;  2Z5H A;  1Q81 Q;  3CCJ P;  3AED C;  2OYH B;  1NTM E;  3MUD C;  3P7K A;  1BE3 E;  2R3C A;  1N73 C;  1GTW A;  3HD7 D;  1N73 B;  3WMM 0;  3CX5 H;  1W5C E;  3AEE C;  4PV1 B;  3H32 B;  3KYQ A;  1RF1 C;  2WQY C;  2Q3E A;  1K05 A;  5GTH H;  1DH3 A;  3B71 A;  3MGN A;  2AEJ A;  1EXJ A;  1VQM P;  1G1J A;  4LC1 A;  2OTL P;  3BRV B;  3L75 E;  1S9K D;  2B87 B;  3VYI A;  1IFP A;  3O6Q B;  2O01 N;  1NU1 K;  3H1I G;  2ZJS E;  4U3F E;  1PGO A;  3MP7 B;  3L4F A;  5KLV K;  3TNU B;  3MHV A;  3VMX A;  3HD7 A;  3Q3D A;  1AJY A;  1ZME C;  1PPJ G;  3H1L J;  2W27 A;  1M90 Q;  3U1C A;  1IZN B;  1UII A;  5AVX B;  4QMA A;  1EC5 A;  1NU1 J;  1X8Y A;  3H1I D;  1YQ4 C;  4IFF A;  3EFF K;  1USD A;  1PP9 G;  3VOP A;  5KLV J;  1JMM A;  3A0B E;  1FOS F;  1NTK E;  1GW4 A;  1T2K C;  4GOD A;  2FFD B;  3GG2 A;  2AEM A;  3IFM A;  1KIL C;  2N1T C;  1T8Z A;  3H1H G;  5APV A;  5AW5 B;  1M1J A;  2NZ2 A;  3RL0 C;  3VMY A;  5KAF E;  3I55 P;  1SQX D;  5EFW B;  3CCU P;  4OVN F;  2BAS A;  3BCC D;  3W68 A;  5AW4 B;  4KHX A;  2BCC E;  4OH8 B;  1NTM J;  4C7R A;  3RK3 B;  1BE3 J;  4H44 B;  1LJ2 A;  1L0N D;  1PGJ A;  2IPP A;  4D6T G;  4I1L A;  1VQ4 P;  4EOT A;  1U7M A;  3L35 A;  1JY3 N;  1URQ B;  4ZMD A;  3CCL P;  3HTK B;  2XNX A;  2L5G B;  1EDJ A;  1CZQ A;  2K88 A;  1ZN5 A;  2Z4E A;  1LT1 A;  3L75 J;  2KZJ A;  3VMZ A;  2PFX A;  2ZYG A;  1EDI A;  2A06 D;  4IFD K;  1FBM A;  4U3F J;  3C9I A;  2G3A A;  3CCV P;  2JP3 A;  1FZB A;  1L0L E;  4PV1 D;  4NPF X;  5AW8 B;  3H25 A;  1Y9B A;  2KLV A;  2A06 E;  2D2C C;  2D2C B;  2IX7 C;  3JCU E;  3CD6 P;  5APQ A;  4DT0 A;  3CXH D;  2QM7 A;  4PD4 D;  4JQ0 D;  4YXW H;  1EQ7 A;  1S3J A;  1AFO A;  2WTY A;  2FBW C;  2I1J A;  4RKU J;  3BAT A;  1NTK J;  3AE2 C;  2OYH A;  4JPZ B;  4PD4 E;  1JCD A;  3KQG A;  2WZ7 A;  2BEZ F;  1G2C B;  1VQK P;  2XKM A;  4C7N B;  1SQX K;  3CMA P;  3CI9 A;  1L2P A;  4DOJ A;  4YXD C;  2B9B A;  1S5L H;  1JUN A;  3H1K D;  3IR9 A;  3M0A A;  3AEG C;  1KB9 D;  3L74 E;  1VQ7 P;  2M5A B;  1W2E A;  4IOI H;  2BCC J;  1VPC A;  5KJ7 C;  3K5B A;  3L71 D;  2J5U A;  1TU3 F;  3WUV A;  1KB9 E;  1RF0 C;  2VRS A;  1CSB A;  1XTG B;  3FXE A;  3L71 E;  2E74 B;  4IL6 E;  3ITK A;  1GL2 B;  1L0L K;  5KKZ C;  3L73 G;  1KQS O;  2HPC B;  5H2F E;  3CC4 P;  2RKL A;  1LWU C;  1X9V A;  3MTU E;  1P84 D;  3RBX A;  2QVA A;  3RK3 D;  1VL2 A;  2IDB A;  1H0T A;  3KHU A;  3Q5R A;  1FJP A;  3V5B A;  1HBW A;  1L0L J;  3L70 G;  4WY4 D;  5TJH A;  3EQ2 A;  1KMI Z;  2WSF H;  1OVR A;  3M9H A;  3RK2 B;  3RK3 E;  1LTJ A;  1JNM A;  1Z56 A;  3QH9 A;  3JC2 2;  1JMB A;  3CX5 D;  4JF7 A;  2SPZ A;  2BEQ D;  3P8C D;  1EZV D;  3W67 A;  3WUT A;  1Q82 Q;  2OAR A;  3WUU A;  2A45 I;  2E5Y A;  3HRN A;  1DX7 A;  1NH4 A;  3TGU G;  2FYN B;  4WY4 A;  2W8Z A;  1LTA C;  5TIS H;  4DJG A;  1LP1 B;  1ZLL A;  3L74 J;  2WPV B;  2JKV A;  2I8D A;  5CBN A;  2R5D A;  2W83 C;  1BGY E;  3SFD C;  1L4A C;  2OTJ P;  2GUS A;  1YIT P;  3H6P A;  2KSJ A;  1NTZ G;  1VDF A;  5KTB A;  2AEF A;  3GF7 A;  2OYI B;  2HR3 A;  1H89 A;  3HD7 C;  5AW0 B;  2H8P D;  1KFN A;  3BVH A;  1Q7Y Q;  2JWA A;  2M3E A;  4JYC A;  1SQB E;  1BCC E;  1J1E C;  1J1E B;  1IFJ A;  3LW5 J;  4GOF A;  1OXZ A;  4C46 A;  5CJ4 A;  1K04 A;  3PRJ A;  2KXP B;  1GL2 D;  5AVY B;  1HF9 A;  3OAK A;  1M1J C;  1M1J B;  2YIU C;  1PIX A;  1LGH B;  3H1J E;  1YIJ P;  3WU2 E;  2E75 C;  1KD1 Q;  1AQ5 A;  2K9J B;  2W90 A;  3V2P A;  3H1L G;  5GTI H;  3PTZ A;  2WSS H;  3R4Y A;  2N9B A;  3RK2 D;  1NU1 G;  1SQQ J;  2H88 C;  1ZRT D;  1VQP P;  1GL2 A;  1Q86 Q;  1WRG A;  5KLV G;  1FAV A;  1SQP J;  2JR8 A;  1BGY J;  1U7J A;  1N7L A;  3CWB D;  1YTZ I;  2P10 A;  1SQV J;  4H0L C;  2QJK B;  1LTG C;  1A02 J;  2Q3I A;  4IL6 X;  5CCG D;  3MZW B;  2UWJ E;  2IBZ I;  2K3R A;  1IK7 A;  3SWF A;  1NTM G;  3TDK A;  3R2P A;  1J2J B;  1SVF A;  2IBZ E;  1BE3 G;  1R5L A;  5KAI H;  1OZH A;  3L72 D;  1RQV A;  1OIP A;  2Y0D A;  1MKM A;  1NAY A;  4UB6 H;  1NHL A;  3P32 A;  1SQB J;  1BCC J;  1FZG A;  2JEE A;  2M3B A;  2FXM A;  3GW6 A;  5AW1 B;  2P7J A;  1KYO D;  3IN6 A;  1LT9 A;  2OYH C;  4EI2 A;  3KZI E;  4AYC A;  3RBZ A;  4HJG H;  4PJ0 H;  3CME P;  2FYU D;  3L75 G;  1JY3 P;  2FYZ A;  5CCG A;  2FXP A;  3S9O A;  2KNC B;  4PV1 C;  1LP1 A;  1KYO E;  1YYC A;  1OVU A;  4U3F G;  3H1J J;  4R4L A;  3HUS A;  2FYU E;  5L8R J;  4H13 B;  1HGV A;  3M0D A;  1T3J A;  1ZP0 C;  5KLI C;  5KLI B;  1A02 F;  5E79 H;  2R5B A;  1KQG B;  4N78 D;  2OYI A;  4ZKP A;  2AXT E;  1HUC A;  3CCQ P;  1S9K E;  1NTK G;  3PJS K;  1OW8 A;  1K9M Q;  3A3Y B;  4BXL A;  1FZC A;  1RQU A;  2KZI A;  1H0T B;  1OW7 A;  1VQL P;  4EDF A;  2Z5I A;  5M1B A;  2FFD C;  1PPJ D;  5CJ0 A;  2BCC G;  2CPS A;  3D6Y A;  3H1I E;  2V7Q H;  1FS0 E;  1LNQ A;  2ZVN B;  1HGZ A;  1LTJ C;  1LTJ B;  4L75 A;  4TT3 H;  3AEC C;  2QE7 H;  1PP9 D;  2KUB A;  3GHG A;  2KLU A;  2GA1 A;  2R44 A;  2QJP B;  1PPJ E;  2YO3 A;  2K37 A;  2FYU K;  3CCS P;  2K9J A;  2QJY B;  2KP8 A;  3N4X A;  1YI2 P;  1MUU A;  1QEX A;  3RK3 C;  4XFJ A;  1GD2 E;  4H44 C;  1SQX E;  3H1H D;  1PP9 E;  2YXR B;  1AV1 A;  2NRG A;  3BCC E;  3Q1M A;  4WY4 B;  2RN0 A;  3VMA A;  5B5E H;  1R8E A;  4RES B;  1URQ C;  4HKZ H;  3FX0 A;  4MN4 C;  3Q5P A;  1L0L G;  1L0N E;  1VF5 D;  2WPQ A;  1J1D C;  1J1D B;  1N86 A;  4I6M C;  4D6T D;  1DIP A;  3SFE C;  2GUV A;  2RMZ A;  1FDM A;  2QRX A;  1N7S D;  4RO0 A;  4DCK A;  3FWL A;  3T97 A;  4D6T E;  1M56 D;  1GU4 A;  2L91 A;  1QL2 A;  4H13 D;  1NYH A;  4R4M A;  1LTI C;  5APU A;  3LIE A;  5CBO A;  3CXH I;  4PD4 I;  1SS1 A;  3VP8 A;  3KPE A;  3F89 A;  1JY2 N;  1FU1 A;  2P2U A;  3L74 G;  1GZL A;  3CXH E;  2YNY A;  1RE4 C;  1X22 A;  3U59 A;  1T3U A;  1YJN P;  4BRY A;  1N7S A;  2KNC A;  3AE7 C;  1FJK A;  2JO1 A;  3MD0 A;  3B5N B;  1JY3 O;  2O1K A;  2G8Y A;  3BAS A;  2XU6 A;  3A0H E;  2JWD A;  1L0N K;  4UB8 E;  2KIK A;  1KB9 I;  3C1L A;  2POH A;  1SQX J;  1VQN P;  3H1K E;  2RH0 A;  3AEA C;  1RH5 B;  3P8M C;  3BCC J;  4N6J A;  5AVW B;  2Q7C A;  2E74 C;  2J59 M;  1N8R Q;  1GL2 C;  1KTM A;  1R5S A;  1L0N J;  5B66 E;  2ITA A;  2ZVO B;  3VP9 A;  1AQT A;  5AVT B;  5APS A;  4XE5 B;  3NFQ A;  4XA4 A;  5CMZ A;  3NMD A;  3M91 A;  1P84 I;  2QA4 P;  5APT A;  1RE3 A;  3L73 D;  3TYY A;  1P84 E;  1PZQ A;  1JO5 A;  2OGU A;  3RK2 C;  3VTP C;  3PLN A;  3LID A;  3RL0 g;  3HE5 A;  2WMM A;  3L73 E;  1QVF O;  1SQQ G;  2FXO A;  3A0B H;  1KFM A;  2A45 G;  5AVV B;  3CX5 I;  3L70 D;  1YHQ P;  1GDT A;  4ZKU A;  1SQP G;  3U1A A;  1LT9 C;  1LT9 B;  2IZ1 A;  1EZV I;  3V6I A;  3M9Q A;  3CX5 E;  1BGY G;  2GM4 A;  1FDI A;  2FYN C;  2PGD A;  5GTH E;  3P8C E;  5KAF H;  1EZV E;  5CCG C;  1EXI A;  4EYY Q;  1SQV G;  4L73 A;  3V2R A;  1KQL A;  1UIX A;  3HUS B;  2FY8 A;  1E5W A;  1M1K Q;  2WVR A;  3M0D C;  3H1K J;  4L76 A;  3G4S P;  4GDO A;  3TGU D;  1ZXG A;  1AVO A;  4GOE A;  1KV4 A;  2R32 A;  3AE1 C;  3CC2 P;  3L71 J;  1WT6 A;  3GMA A;  2OYI C;  3G6E P;  1AVY A;  1SQB G;  1BCC G;  1OVV A;  2AXC A;  3B5N D;  1Y8A A;  3B8E B;  3CL3 D;  4YPC A;  4HB1 A;  2O01 J;  2YO2 A;  3I56 P;  1GW3 A;  1NTZ D;  2PP6 A;  1FZC B;  2IFN A;  2KS1 A;  3AE9 C;  4Y28 J;  1IK9 A;  2HG5 D;  4WBA A;  3H1J G;  1IFN A;  3E7K A;  3V4W A;  4DZO A;  1M7L A;  1KC8 Q;  5DJU B;  5APW A;  5KJ7 D;  3JCU H;  2YKQ A;  1PGQ A;  5BVZ A;  2LKM A;  2E43 A;  2WSE J;  2Q6Q A;  2IFM A;  4N3Y B;  2M0B A;  3B5N A;  1FC2 C;  3GHG C;  3GHG B;  1BSN A;  1D7M A;  3I5C A;  4PD4 H;  1KOR A;  2E76 D;  2Y0E A;  4OGQ D;  2MJZ A;  3AEB C;  1ZR2 A;  2H43 A;  1Y47 A;  5KJ7 A;  1GK6 A;  2YKP A;  1RHZ B;  3D70 A;  3M9B A;  3CCR P;  1RF0 A;  3H1L D;  2QIW A;  2ZYA A;  2QSI A;  2IBZ G;  4GIF A;  1ZRT E;  1KB9 H;  1NU1 D;  3AE6 C;  3AE5 C;  3E1I A;  4Y99 C;  4Y99 B;  2QJK C;  1S4X A;  4CPG A;  1QL1 A;  3B4S A;  4IL6 H;  2CPB A;  5KLV D;  1LWU A;  5AW7 B;  2LXC B;  1IFD A;  3T97 B;  2K9Y A;  5H2F H;  2XDJ A;  3A2A A;  3FGA D;  3CWB E;  1OWA A;  2O01 H;  4A7P A;  2DW3 A;  4IFM A;  3G71 P;  5APX A;  1QGK B;  3KXD A;  2E42 A;  2ZXX A;  1HVV A;  2IZ0 A;  1VF5 B;  2ZT9 D;  3LW5 H;  3CLQ A;  3AEF C;  1NTM D;  1FZA A;  3L72 E;  1S5L E;  1L4A D;  1NGM B;  1KYO I;  1SFC B;  1BE3 D;  4HH2 A;  2ZAE B;  2LR2 A;  1GU5 A;  4BRY B;  1N7S C;  1N7S B;  2K1A A;  4LGD E;  2FKW B;  3TSI A;  2CK3 H;  1M8O B;  2KB7 P;  2MKV A;  4HYT B;  3CCE P;  4H13 C;  2C9L Y;  2P1J A;  4GKG A;  3L75 D;  3NXS A;  1JM0 A;  1RF1 B;  1VQ6 P;  1IO4 A;  3HE4 A;  4KT0 J;  2WPR A;  4U3F D;  4EIJ A;  2A45 H;  1EDL A;  3ABV C;  1L4A A; 
#chains in the Genus database with same CATH homology
 1XTC C;  1QL2 A;  4JYB A;  4JF7 A;  5CCH C;  1SQP K;  2Q5U A;  1LTI C;  1NAF A;  2O1J A;  4W7Y A;  5APU A;  3P8C D;  3LIE A;  4GT1 A;  2NPS D;  4N78 E;  1HJB A;  1JY2 P;  3SWY A;  2OAR A;  3VP8 A;  1NOH A;  3KPE A;  1SP4 A;  1JY2 N;  1JTH A;  1FU1 A;  1SQV K;  2P2U A;  1GZL A;  3A7O A;  1GK4 A;  2YNY A;  2A45 I;  1NO4 A;  5AVZ B;  1RE4 C;  3HRN A;  1DX7 A;  1NH4 A;  3U59 A;  1T3U A;  4WY4 A;  2WPS A;  5BU8 B;  2HPC A;  1RE3 C;  1LTA C;  5CCH D;  1N7S A;  5BU5 A;  1ZLL A;  5AVU B;  1FJK A;  2HOD A;  4AUW A;  3MD0 A;  4I2L C;  1JCC A;  3B5N B;  2R5D A;  1ZR4 A;  1JY3 O;  1NTZ K;  2O1K A;  3BAS A;  1L4A C;  2XU6 A;  2QM8 A;  2GUS A;  3HE5 B;  4LLH A;  1L0N K;  2XZR A;  5AW2 B;  3L37 A;  1NTM K;  1CW5 A;  3H6P A;  1SQB K;  1MZ9 A;  1VDF A;  2KSJ A;  2NPS A;  2POH A;  5KTB A;  1KIL B;  2ZXE B;  5AVR B;  1IC2 A;  2N1T B;  2KOG A;  3P8M C;  2OYI B;  2WIT A;  3RL0 B;  1H89 A;  4N6J A;  5AVW B;  2Q7C A;  2C9N Y;  1N2D C;  3HD7 C;  3N7N A;  1H88 A;  2J59 M;  1IFM A;  5CCH A;  1GL2 C;  1SFC C;  2C0X A;  1IFI A;  4WY4 C;  5AW0 B;  2H8P D;  2WSE H;  2HLO A;  1KFN A;  1CI6 B;  3TK1 A;  1ZV8 A;  2Z5H A;  3BVH A;  3VP9 A;  5AVT B;  5APS A;  2OYH B;  4XE5 B;  1PFI A;  3NFQ A;  4JYC A;  3L36 A;  4XA4 A;  5CMZ A;  1J1E C;  1J1E B;  2PAJ A;  3NMD A;  1IFJ A;  3P7K A;  3M91 A;  2R3C A;  5AW3 B;  1N73 C;  1GTW A;  3HD7 D;  1N73 B;  3WMM 0;  1OXZ A;  4C46 A;  5CJ4 A;  5APT A;  1RE3 A;  3TYY A;  1GL2 D;  1SFC D;  5AVY B;  3H32 B;  3KYQ A;  2J58 A;  3UIA A;  1RF1 C;  2JJL A;  3OAK A;  1DH3 A;  3MGN A;  1JO5 A;  1H8A A;  3RK2 C;  1M1J C;  1M1J B;  1G1J A;  4LC1 A;  3VTP C;  1LGH B;  3BRV B;  3LID A;  3HE5 A;  1S9K D;  3VYI A;  1HWT C;  1AQ5 A;  1MFZ A;  1KFM A;  2A45 G;  5AVV B;  1NU1 K;  3V2P A;  1GDT A;  1NTK K;  4ZKU A;  3U1A A;  1LT9 C;  1LT9 B;  3L4F A;  5KLV K;  3TNU B;  2N9B A;  3VMX A;  3M9Q A;  3RK2 D;  2GM4 A;  3HD7 A;  1GL2 A;  1SFC A;  1WRG A;  3P8C E;  2W27 A;  5CCG C;  1CI6 A;  1FAV A;  3U1C A;  5AVX B;  3V2R A;  1KQL A;  2YKO A;  1X8Y A;  3M06 A;  4IFF A;  3HUS B;  3B5N C;  1E5W A;  2YMY A;  1N7L A;  1YTZ I;  3MUD A;  3VOP A;  3II6 A;  3M0D C;  2WT7 B;  1JMM A;  1FOS F;  2W6B A;  1GW4 A;  1NKZ B;  1N73 A;  1T2K C;  1FZF A;  2FFD B;  1LTG C;  3IFM A;  1A02 J;  2Q3I A;  3H32 A;  1KIL C;  5CCG D;  2R32 A;  2W6A A;  2N1T C;  1T8Z A;  1RF1 A;  2H7H A;  2P67 A;  3VN0 A;  1HTL C;  1WT6 A;  5APV A;  3SWF A;  5AW5 B;  2OYI C;  1M1J A;  3RL0 C;  3VMY A;  3R2P A;  1J2J B;  1SVF A;  1YTZ T;  3B5N D;  3B8E B;  3CL3 D;  3V2N A;  2BAS A;  5AW4 B;  2YO2 A;  1NWQ A;  4KHX A;  4WB4 A;  1T2K D;  4OH8 B;  4C7R A;  1GW3 A;  3O8Z A;  1NHL A;  3P32 A;  2PP6 A;  1FZG A;  1FZC B;  2JEE A;  2IFN A;  2M3B A;  1KIL D;  1JOC A;  2FXM A;  3RK3 B;  2N1T D;  5AW1 B;  2P7J A;  1LT9 A;  2IPP A;  2OYH C;  4AYC A;  3TNU A;  5AW6 B;  4I1L A;  1IK9 A;  1SLQ A;  4EOT A;  3RL0 D;  2HG5 D;  4WBA A;  1IFN A;  4DZO A;  3V4W A;  1M7L A;  3L35 A;  1JY3 P;  5APW A;  1JY3 N;  2FYZ A;  1URQ B;  5KJ7 D;  5CCG A;  2YKQ A;  1JY2 O;  3HTK B;  2XNX A;  1G1I A;  2L5G B;  5BVZ A;  1LWU B;  2LKM A;  2E43 A;  1CZQ A;  1ZN5 A;  1YYC A;  2Z4E A;  2IFM A;  4N3Y B;  3HUS A;  3B5N A;  1HGV A;  1X79 B;  4AQR D;  3VMZ A;  3M0D A;  3GHG C;  3GHG B;  3KDP B;  2ZFC A;  1T3J A;  5CHX A;  4IFD K;  2M8R A;  3I5C A;  1FBM A;  1A02 F;  2FFD A;  3C9I A;  4W80 A;  1KZU B;  2R5B A;  1URQ D;  1KIL A;  1NKN A;  1LTS C;  2N1T A;  1FZB A;  4N78 D;  5AW8 B;  2MJZ A;  1ZR2 A;  2OYI A;  4ZKP A;  2KLV A;  1HUC A;  2H43 A;  3MIW A;  2IX7 C;  5APQ A;  1S9K E;  2QM7 A;  1DEB A;  5KJ7 A;  1EQ7 A;  1GK6 A;  2YKP A;  1AFO A;  4W7Z A;  2WTY A;  2I1J A;  2C0W A;  3V4Q A;  3A3Y B;  3M9B A;  1FZC A;  1IJD B;  3BAT A;  1RF0 A;  2OYH A;  3HUS C;  1MV8 A;  1JCD A;  1HH0 A;  3KQG A;  2WZ7 A;  4GIF A;  1G2C B;  2Z5I A;  3BRT B;  2HFE D;  2XKM A;  3E1I A;  4C7N B;  1SQX K;  1RY3 A;  3CI9 A;  4Y99 C;  4Y99 B;  5AW9 B;  3PP5 A;  1URQ A;  3V2Q A;  2FFD C;  1QL1 A;  2HYN A;  4M3L A;  2CPS A;  5CJ0 A;  3HTK A;  4DOJ A;  2CPB A;  1LWU A;  5AW7 B;  3HE4 B;  1JUN A;  1IFD A;  3IR9 A;  3M0A A;  2XDJ A;  1HGZ A;  3A2A A;  1LTJ C;  1LTJ B;  1OWA A;  2XV5 A;  2O01 H;  4IFM A;  1L4A B;  1W2E A;  4O9B A;  3GHG A;  5APX A;  1VPC A;  5KJ7 C;  2KYV A;  2E42 A;  3EFG A;  2YO3 A;  3G3Z A;  1HVV A;  2FYU K;  2I1K A;  1FZE A;  2KP8 A;  3N4X A;  1FZC C;  1MUU A;  3RK3 C;  1GD2 E;  1RF0 C;  2VRS A;  1JTH B;  3LW5 H;  3CLQ A;  1CSB A;  5AVS B;  3HD7 B;  1FZA A;  1XTG B;  3OA7 A;  1GL2 B;  1SFC B;  1L4A D;  1L0L K;  4HH2 A;  4WY4 B;  1GU5 A;  2HPC B;  4RES B;  1N7S C;  1N7S B;  1URQ C;  2Q9I A;  4B86 A;  4LGD E;  1LWU C;  2HOD B;  2FKW B;  2WWW A;  1X9V A;  3NTN A;  3MTU E;  5AVQ B;  3TSI A;  3OJA B;  2KB7 P;  2WPQ A;  2WSC H;  4HYT B;  1J1D C;  1J1D B;  3RK3 D;  1N86 A;  4I6M C;  5APY A;  2C9L Y;  1RE4 A;  1FJP A;  3V5B A;  2WT7 A;  1G2C A;  2P1J A;  1HBW A;  2GUV A;  4GKG A;  1FDM A;  4C7N A;  3NXS A;  4WY4 D;  2NPS C;  2NPS B;  3A5T A;  3EQ2 A;  1RF1 B;  1LTB C;  1N7S D;  1FOS E;  1IO4 A;  3HE4 A;  2WSF H;  3M9H A;  3T97 A;  3RK2 B;  2WPR A;  1LTT C;  1LTJ A;  1SQQ K;  4EIJ A;  2A45 H;  1JNM A;  1Z56 A;  1GU4 A;  1L4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...