1JY3P

Crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
46
structure length
46
Chain Sequence
VATRDNCCILDERFGSYCPTTCGIADFLNNYQTSVDKDLRTLEGIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the central region of bovine fibrinogen (E5 fragment) at 1.4-A resolution.
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords FIBRINOGEN ALPHA CHAIN
total genus 11
structure length 46
sequence length 46
chains with identical sequence S
ec nomenclature
pdb deposition date 2001-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jy3P00
1JY2N 1M1JC 1FZCA 3HUSC 2HPCA 1M1JA 1FZGA 2OYHB 1N73B 1N73C 2OYHA 1T3UA 2HPCB 1M1JB 2OYHC 1LWUA 1JY2P 1LWUC 3HUSB 2OYIA 1LT9B 2A45G 1RE3C 3GHGC 3H32A 1LTJB 1JY3N 2A45I 1W2EA 1FZEA 1LT9A 1RE4C 1FZFA 2XNXA 2FFDB 1FZCC 1RF1B 1N86A 3GHGA 1JY2O 2OYIC 2OYIB 1RE4A 1N73A 1RF1C 1FZCB 1RF0C 2HLOA 1RF1A 2Z4EA 2FFDC 2FFDA 2HODB 1JY3P 2Q9IA 1LTJC 3HUSA 1FZAA 1JY3O 2A45H 1RF0A 1FZBA 3H32B 3GHGB 3E1IA 2H43A 3BVHA 1LT9C 1LTJA 2HODA 1RE3A 1LWUB
chains in the Genus database with same CATH superfamily
2B87B 1VQ4P 2A06E 3AE6C 3L73E 4GOEA 3B71A 2ZXXA 3RBZA 2KSEA 1VQNP 2P2UA 1N7SA 4PV1C 4TLFA 3VTPC 1M1JB 1OFCX 3M9QA 1NU1D 1SQQG 1MZ9A 2KB7P 1KFNA 5APTA 3TNUA 1CZQA 5DJUB 4RKUJ 1JMMA 1LNQA 1NYHA 1JY3N 5CHXA 1W2EA 2KZIA 1GK6A 3VMZA 3Q2YA 1NKNA 1FZCC 4B86A 3CWBG 4XFJA 5AVUB 4H13D 1GW4A 3MGNA 3E7KA 2QG4A 1QL2A 1NTMD 1BCCJ 3H1LJ 4H0LD 3T97A 2XV5A 4ASWA 4ZKUA 4Y99C 5AW9B 1ZR4A 1RF1A 1FZCB 5KLVG 3O6QB 3HE4A 2OYOA 1SQBD 3HTKA 5B5EE 1GW3A 2K9YA 2QEXP 1EDKA 2LXBA 4N78D 1LT9C 2BCCD 1GU4A 1J1EB 3GF7A 2NPSB 1NTKG 1MFTA 1M1JC 1PZQA 1SQVG 1WMKA 1XTCC 1SQBE 3KXDA 2IZ1A 3PHLA 4GOFA 4WWIA 3RK3B 3SFEC 1H8AA 3TSIA 1MFZA 2WSCJ 3KDPB 1SQVK 1SFCC 2FYUD 4CPGA 1S72P 4YPCA 3B4SA 1FS0E 2Q3EA 4TT3H 5AW7B 1FDOA 3AEBC 5GTIE 1DIPA 2FYNC 1GU5A 4JYBA 1NHLA 2IYPA 2A45I 1IFIA 4OGQB 2C9LY 2FYUJ 3L70D 2WSFJ 2PRRA 1IFDA 4PJ0H 4U3FE 4RJTA 3U1CA 1L2PA 1SFCD 2YMYA 3O6QA 2Y9YA 2M5AA 1KV4A 4M3LA 2OTKE 1CI6B 2FXOA 2HLOA 3TK1A 5K5GB 1PGJA 3HD7D 3QWOC 3IFMA 2O3JA 3L70E 1CSBA 1YBKA 1BDDA 1KQGB 1NKZB 3H32B 1SQBJ 2ZAEB 1X79B 2YKOA 3HE4B 3HTKB 4DJGA 1VQMP 3L74E 1H0TA 1M1KQ 1LTTC 2C0XA 1HJBA 1VL2A 3P8CE 4UB8H 1BCCD 3H1LG 3B8EB 3M9BA 2OQQA 4L73A 3CX5D 4PD4I 5AVWB 2K9JB 1NTMK 3T97B 3P8MC 1FE6A 1NTMJ 1S5LE 4RO0A 1NTZK 2IBZD 3KZIE 1HUCA 1JY2P 4L76A 4C46A 3CCSP 4GDOA 2ZFCA 4NPDA 1L0LJ 4XA4A 5BU8B 3CC7P 1NTKJ 2DW3A 3H1ID 3NXSA 3FWNA 4IFFA 1FAVA 1SQVD 2KK7A 3H1HG 5KKZC 2D2CD 5AVRB 5KAIH 1NAFA 3ABVC 4DCKA 1SLQA 2I8DA 5AW8B 3V2QA 3I56P 3Q3DA 3A0BE 2E42A 1NAYA 1G2CB 1NOHA 3H1IE 3PLNA 2P1JA 5KAIE 4OGQC 3BRTB 1S4XA 2A06D 4BWNA 1HGZA 1JB0J 2FYNB 1SQBK 2NPSD 2AXTH 1LP1B 1URQA 1HBWA 1NU1E 2R3CA 2ZVNB 1JOCA 2G3AA 4I6MC 1BE3G 4L74A 3C1LA 4NPFX 1JEKA 5KAFE 2QA4P 3RK3C 3M0DC 1FDIA 1ZMEC 1VQKP 1Y47A 2NPSC 3AEGC 1J1EC 1N8RQ 3P32A 1PP9G 1LT9B 1QEXA 4R4LA 1LT1A 2MJZA 3H6PA 5APXA 3WU2H 2N1TA 1VQOP 3RK2C 3H1IJ 1KYOE 1L0LD 4GT1A 1NVOA 2PFXA 4Y99B 5AVXB 1DH3A 3D70A 2WSEJ 3W68A 3CCJP 1L0ND 2SPZA 3CCUP 4IFDK 3V2NA 3RGUA 1PV3A 2KNCA 3VN0A 3CCVP 3GLMA 2BCCE 2WSSH 1BE3E 1N73A 1YQ3C 3A5TA 1URQD 1L0LE 3BCCG 2FFDA 1YJNP 2YO2A 1NU1G 5H2FH 5AVZB 4A7PA 1NTKK 1L0NE 1U57A 2QRXA 3TGUJ 1NTZE 3E1IA 1KORA 2M3BA 4ZKPA 1NTME 1KILE 3EFFK 3H1HD 1CW5A 1JM0A 2HPCA 2XZRA 2OYHB 4PV1B 2E5TA 1W5CE 3RBXA 3U59A 3V4QA 3EQ2A 3CCQP 4N78E 2QJPC 1G1JA 3H1HE 4C7RA 5AVYB 1NWQA 3CWBJ 1IK9A 1JTHB 2KS1A 1Z56A 2E5YA 2FYZA 2L5GB 2L91A 3JSVC 1LTAC 1DD4A 4U3FJ 1YTZT 2E74B 1EZVG 2FFDB 1SQPE 1RF1B 1N86A 2V7QJ 1YI2P 1NTZJ 2KOGA 2H7HA 2UWJE 3TGUE 1IJDB 4EYYQ 4H0LB 4JF7A 1JCDA 4UB8E 1RHZB 1ZXGA 3L74G 4L75A 2BCCJ 3L36A 3BRVB 2A45H 1MKMA 2W90A 3CXHI 4IL6X 5AW1B 3WUTA 3BVHA 1LTGC 1GTWA 4JPZB 2V4HA 2R32A 2W6AA 3B5NA 4JYCA 5CMZA 4D6TD 4Z1MH 1IK7A 5KJ7A 1FZGA 5CJ0A 1HVVA 3CXHD 3SSUA 3R2PA 5AW6B 1AVOA 1DEBA 3H1KD 4H44D 2KZJA 1OVVA 2QJYC 4HH2A 1YITP 3MTUE 4BXLA 2KLVA 2ZT9D 3GHGC 4WY4A 4O9BA 2KSJA 3SWYA 5CCHA 3H1KJ 3R4YA 5B66E 3Q1MA 1VQ7P 1AVYA 4WVZA 4EDFA 3PJSK 1SQXD 3AEFC 1L0NK 4H44C 1Q7YQ 2OYIB 2GUSA 4D6TG 1SQBG 2IX7C 2CK3H 2NPSA 1SQVE 1NTKE 3M0DA 3HE5B 3AE1C 2P58A 2JWAA 3TYYA 1P84H 3AE4C 3FXEA 5KTBA 2YNYA 5CCGC 1KB9H 2NZ2A 1FZBA 2IFNA 3CMAP 1KN7A 3RL0g 1OWAA 3L73J 3GHGA 1JTHA 2KS1B 3KHUA 5TJHA 2YKQA 2OGUA 1BGYJ 4LLHA 5KAFH 1YIJP 2Z5IA 2C9NY 3CWBE 1KQLA 3C8VA 3S9OA 2YO3A 2CPBA 1HWTC 2E76C 3I55P 1E5WA 2KI7B 2WPVB 4ZMDA 4IL6H 1LP1A 1URQB 2O01J 1LTIC 2KIKA 1SQPK 1SFCA 2OARA 3CWBD 5BU5A 1U7MA 4OH8B 3G6EP 2N1TD 1L4AA 1W2BO 2AEFA 1T2KD 3A0BH 3FXDA 3OAKA 2E76D 2Y0EA 2WT7A 1MUUA 2A06G 1N7LA 3CCEP 1JO5A 4EIJA 1Q86Q 1GMJA 2W6JH 3H1JJ 5AW5B 2HG5D 5KLIB 3LW5H 1QVGO 4KJMA 2LXCB 2Q3IA 1FDMA 1BE3D 2XNXA 3AE8C 1FC2C 2FYUE 1LWUB 2ZVOB 2B88A 2RN0A 2WPQA 3A3YB 1PP9J 3H1LD 3G71P 1NGMB 2AXCA 1KD1Q 1ZW0A 1N73B 1L0NJ 1T3UA 2H8PD 1YJWP 2HFED 2R5DA 1L4AC 1KILD 1KB9I 2OYIA 3KPEA 1M57D 3L72D 2P7JA 1N7SD 3EWKA 1KZUB 1GL2D 4GKGA 4RESB 4W7ZA 3USSA 2KNCB 1GZLA 1YQ4C 4PV1D 1PGQA 1IFJA 1VF5C 5KJ7C 4WY4B 1JUNA 1K8AQ 1SQQJ 1JMBA 3WUVA 3CPWO 2E75B 1FOSF 1S1CX 2JR8A 3NFQA 3L75J 3L74D 1AQTA 4HYTB 4I7ZB 1BGYD 5AW2B 2XNDH 1G1IA 2FYUG 3L71J 4D6TE 5GTIH 3JCUE 5KJ7D 4ASVA 1FU1A 3L71D 1YJ9P 1X22A 4H13C 1LTSC 5L8RJ 1U7JA 1K9MQ 2ZT9C 4C7NB 2Q5UA 3JC22 1JY2N 1KILA 3CCLP 1X8YA 4I1LA 3VMXA 4OVNF 5KLVJ 4YTPC 2D2CC 2ZYAA 1OVRA 3HD7B 4PD4H 4AQRD 3H25A 3D71A 2QIWA 2OYHA 2FXMA 2P67A 1J2JB 1X0TA 2KYVA 5AW4B 3HUSB 5BVZA 1KQSO 1SS1A 3VMAA 1AJYA 1OXZA 1K04A 2BASA 2FXPA 4WB4A 4AYCA 3L72J 1J1DB 1KILC 1OW8A 3KYQA 3L37A 5CCHC 1NTKD 1YHQP 2E75D 2XDJA 4R4MA 3RL0D 3TF5A 4U7JA 2K37A 1PGOA 2RKLA 2YIUC 2QJKB 2VRSA 4WY4D 2IZ0A 3KZIH 2QSIA 3H1JE 2O01H 2K9JA 2NRGA 2XU6A 5AVVB 1YYCA 1EXIA 2GM4A 1RF0C 1GL2B 2BEQD 2YIUB 3B5NC 2B89A 3CXHH 1IFMA 3G9RA 1VQLP 3OW2O 1MV8A 3CL3D 1LTJC 1KC8Q 3CD6P 1KILB 1KMIZ 1M56D 3SWKA 1SQPJ 1SVFA 2YKPA 2Q1KA 4LGDE 1A02J 1GD2E 2M0BA 1IO4A 1AQ5A 3HUSC 2K1AA 3L75G 1RE3A 4W80A 3RK3D 3OA7A 5E79E 1M1JA 3I5CA 3RL0B 2D2CB 3HD7C 3L71G 4IFMA 2HR3A 3L70J 1R5LA 1KYOD 1FBMA 5CCGA 1LWUA 1K05A 2N1TC 2WZ7A 2J59M 1Y8AA 2K88A 2WSFH 1M8OB 4H13B 4IL6E 2IYOA 1PFIA 3CLQA 1HGVA 1KYOI 1FZFA 2JDIH 4DT0A 4HB1A 1OMIA 3GMAA 4I7ZC 1PPJG 2E75C 1S3JA 2C0WA 2ZXEB 1OW7A 3PTZA 4WY4C 1VF5B 2I1JA 1H88A 1OZHA 3H1HJ 1QGKB 3CI9A 1ZV8A 5APWA 2E43A 1FZAA 1RF0A 1PPJD 3B5ND 3GW6A 3MUDA 2JKVA 2YMKA 1LTBC 1N7SC 3JCUH 1L4AB 3CC2P 3PH0A 3AE3C 1SQQK 1PIXA 1Q90D 1Q82Q 3TGUG 4QMAA 3NTNA 3D6ZA 1SQXJ 1N73C 1S5LX 1GDTA 1VF5D 3CCMP 1SQPG 2Z5HA 3BASA 3KQGA 1EZVE 1KFMA 1N7SB 4YXWH 3F5HA 3OJAB 2WT7B 1H0TB 4XE5B 1T8ZA 2Y0CA 3F89A 1RQUA 2KUBA 2QM7A 1BGYE 3A0HH 3TNUB 1S2EA 1BCCG 3V2PA 2QM8A 2PGDA 1X9VA 5CBNA 2M5AB 3L72E 2ZYDA 4BRYA 3PP5A 5APUA 2B9BA 1EZVI 5KLVD 2M8RA 4PJ0E 3E1RA 1Q81Q 1XTGB 3A7OA 1NTMG 1JY3P 3FWLA 3IN6A 1NTZG 5B5EH 1URQC 1L0NG 2RH0A 3CXHE 1EDJA 2E76B 2OTLP 2AEJA 3V4WA 1VQ9P 1YTZI 1L0LG 2R5BA 2N1TB 1QX8A 1OX3A 1PL5A 3BCCE 2BCCG 3L74J 3L75D 3N7NA 2ITAA 4OWFA 4UB6H 5AVSB 3VYIA 3RL0C 2I1KA 2J5UA 2R3SA 3PRJA 1USEA 2O1KA 2AEMA 2GA1A 5E79H 3AECC 3VP8A 3WMM0 1ZOYC 3M91A 3UIAA 3BCCD 1SQXE 2A45G 1K73Q 1KQFB 2KP8A 2LR2A 2IDBA 4GODA 4KHXA 3O8ZA 1L4AD 3MP7B 3AEEC 3H32A 1LTJB 1PGPA 5DJTB 3G4SP 1SQXG 1PP9E 2W83C 1GL2C 3B5NB 4I2LC 2GUVA 5GTHH 2IFMA 1RH5B 2OYIC 3V2RA 3CCRP 3Q5PA 2QJKC 1S5LH 1BE3J 1PP9D 1JCCA 1VQPP 2WPRA 1VPCA 2JJLA 3GG2A 2CPSA 1FZCA 1LJ2A 3BATA 2Y9ZA 2AXTE 1S9KD 1J1DC 3H1JD 1Q2NA 2IBZI 2J58A 1JNMA 1BSNA 3VMYA 1P84I 2PP6A 2HPCB 2G8YA 2K3RA 2M3EA 2QJYB 1AFOA 1FJPA 1HF9A 1DEEG 5AW0B 4AUWA 1G2CA 1NU1K 5KLVK 1NO4A 3H1IG 2Q7CA 3C9IA 3MHVA 3L72G 1GL2A 2P10A 2JP3A 3AE2C 4LC1A 2ZT9B 2WWWA 1T2KC 1BCCE 1BGYG 4NPEA 1RE3C 3L4FA 1AV1A 2WQYC 1WT6A 3BCCJ 1RE4C 2WTYA 5TISE 1M90Q 1QVFO 5M1BA 2Y0DA 4K35A 5AVQB 4DZOA 1N2DC 1GK4A 1OIPA 3SFDC 3H1LE 1ZR2A 2FFDC 1T3JA 2E74C 1FOSE 1RQVA 1HJ0A 2V7QH 1FJKA 1KYOH 1TU3F 2H43A 3D6YA 1KB9E 2RMZA 2KXPB 3L70G 3WU2E 4IOIH 1EZVD 1D7MA 2HODA 1ZLLA 3IAOA 1CI6A 1ZRTE 2QE7H 3GF3A 2H88C 5AVTB 3TDKA 4Y28J 2YXRB 3LW5J 1ZN5A 3V6IA 1PPJE 1SQXK 1KB9D 4MN4C 4K3AA 4U3FG 2OYHC 1IFPA 4UB6E 1LWUC 1A02F 1QL1A 3A2AA 1SQVJ 2WSEH 3MIWA 1DX7A 2WVRA 1KTMA 3HE5A 5KLIC 2O1JA 5H2FE 3U1AA 3EFGA 5APSA 1VQ5P 1LGHB 1R8EA 2Q6QA 2FY8A 4EI2A 1NU1J 3RK2D 2W6BA 3S4RA 4YXDC 1JY2O 3L71E 4D6TJ 1OVUA 1RE4A 3AE5C 4N6JA 5GTHE 1M7LA 1IC2A 1VDFA 4DOJA 3L75E 2HODB 1OW6A 2R44A 4N3YB 3CMEP 3LIDA 1AA0A 3A0HE 3MZWB 5APQA 2WPSA 3RK2B 4ZNCA 2N9BA 4HJGH 1E79H 4WBAA 2W8ZA 1SP4A 3W67A 5KLVE 3V5BA 3WUUA 2ZYGA 3L35A 3N4XA 1EDLA 3H1JG 3VOPA 1RY3A 1NTZD 3M0AA 5C39A 1SQQD 3VP9A 5CCHD 2WMMA 3NMDA 4PD4D 4U3FD 1DD3A 3CX5I 2B87A 3FGAD 3MD0A 4BRYB 3QH9A 1FZEA 1SQQE 3CX5H 1Y9BA 4W7YA 3Q5RA 3ZDMA 4PD4E 2QVAA 3HD7A 2FBWC 2LKMA 4OGQD 3S1KA 1T6AA 1QLED 2W27A 4H44B 3L73G 4JQ0D 3P8CD 2PAJA 3RK3E 2Z4EA 5KKZB 2Q9IA 1VQ8P 1SQPD 3HUSA 4GIFA 1JY3O 3P7KA 3AEDC 5B66H 3GHGB 2YXQB 1BSHA 3TGUD 4KT0J 1UIIA 5AW3B 2JO1A 2WSCH 1LTJA 2IPPA 3ITKA 1USDA 3LIEA 3MUDC 3K5BA 3G3ZA 2FKWB 2FYUK 4EOTA 1IFNA 1H89A 1BDCA 4C7NA 2BEZF 1EC5A 1S9KE 1NJIQ 3SWFA 3Q5SA 1UIXA 3H1KG 2KLUA 2N9YB 1WRGA 5EFWB 1L0LK 2IBZG 3CX5E 3HRNA 3M9HA 1VQ6P 1P84E 2E74D 3II6A 2IBZE 3FX0A 1EDIA 1LT9A 3AE9C 4H0LC 5CJ4A 2WITA 2OTJP 3AE7C 3H1KE 1ZP0C 2JEEA 1EQ7A 1EXJA 1P84D 2H89C 1HTLC 1NH4A 1HH0A 5APYA 1RF1C 1IZNB 3M06A 2ZJSE 2O01N 3IR9A 3IF4A 4JBZA 1R5SA 1ZRTD 3L73D 5TISH 3AEAC 2XKMA 2HYNA 5CBOA 3CC4P 2JWDA 4HKZH 5APVA 2QJPB 1SFCB 2MKVA 5CCGD 2POHA
chains in the Genus database with same CATH topology
2P2UA 1N7SA 3VTPC 1M1JB 3M9QA 1MZ9A 2KB7P 1KFNA 5APTA 3TNUA 1CZQA 1JMMA 1JY3N 5CHXA 1W2EA 1GK6A 3VMZA 1NKNA 1FZCC 4B86A 5AVUB 1GW4A 3MGNA 1QL2A 4ZKUA 1ZR4A 3T97A 2XV5A 1FZCB 1RF1A 4Y99C 5AW9B 3HE4A 3HTKA 1GW3A 1GU4A 4N78D 1LT9C 1J1EB 2NPSB 1M1JC 1XTCC 3RK3B 1H8AA 3TSIA 1MFZA 3KDPB 1SQVK 1SFCC 5AW7B 1GU5A 4JYBA 1NHLA 2A45I 1IFIA 2C9LY 3U1CA 1IFDA 1SFCD 2YMYA 4M3LA 1CI6B 2HLOA 3TK1A 3HD7D 3IFMA 1CSBA 1NKZB 3H32B 1X79B 2YKOA 3HE4B 3HTKB 1LTTC 2C0XA 1HJBA 3P8CE 3M9BA 5AVWB 3B8EB 4IFDK 1FZCA 1NTMK 3P8MC 1NTZK 1HUCA 1JY2P 4C46A 2ZFCA 4XA4A 5BU8B 4IFFA 3NXSA 1FAVA 5AVRB 1NAFA 2E42A 1SLQA 5AW8B 3V2QA 1G2CB 1NOHA 2P1JA 3BRTB 1HGZA 1SQBK 2NPSD 1URQA 1HBWA 2R3CA 1JOCA 4I6MC 3RK3C 3M0DC 2NPSC 1J1EC 3P32A 1LT9B 2MJZA 3H6PA 5APXA 2N1TA 3RK2C 4GT1A 5AVXB 4Y99B 1DH3A 3V2NA 3VN0A 1N73A 2FFDA 3A5TA 1URQD 2YO2A 5AVZB 1NTKK 3E1IA 2M3BA 4ZKPA 1CW5A 2HPCA 2XZRA 2OYHB 3U59A 3V4QA 3EQ2A 4N78E 1G1JA 4C7RA 5AVYB 1NWQA 1IK9A 1JTHB 2L5GB 1Z56A 2FYZA 1LTAC 1YTZT 2FFDB 1RF1B 1N86A 2H7HA 2KOGA 1IJDB 4JF7A 1JCDA 3L36A 3BRVB 2A45H 3BVHA 1LTGC 1GTWA 2R32A 2W6AA 3B5NA 4JYCA 5CMZA 5KJ7A 1FZGA 5CJ0A 1HVVA 3R2PA 5AW6B 1DEBA 4HH2A 3MTUE 2KLVA 3GHGC 4WY4A 4O9BA 2KSJA 3SWYA 5CCHA 1L0NK 2OYIB 2GUSA 2IX7C 2NPSA 3M0DA 3HE5B 3TYYA 5KTBA 2YNYA 5CCGC 1FZBA 2IFNA 1OWAA 3GHGA 1JTHA 2YKQA 4LLHA 2Z5IA 2C9NY 1KQLA 2YO3A 2CPBA 1HWTC 1E5WA 1URQB 1LTIC 1SQPK 1SFCA 2OARA 5BU5A 4OH8B 2N1TD 1L4AA 1T2KD 3OAKA 2WT7A 1MUUA 1JO5A 1N7LA 4EIJA 5AW5B 2HG5D 3LW5H 2Q3IA 1FDMA 2XNXA 3A3YB 1LWUB 2WPQA 1N73B 1T3UA 2H8PD 2HFED 2R5DA 1L4AC 1KILD 2OYIA 3KPEA 4GKGA 2P7JA 1N7SD 1KZUB 1GL2D 4RESB 4W7ZA 1GZLA 1IFJA 5KJ7C 4WY4B 1JUNA 1FOSF 3NFQA 5AW2B 4HYTB 1G1IA 5KJ7D 1FU1A 1LTSC 4C7NB 2Q5UA 1JY2N 1KILA 1X8YA 4I1LA 3VMXA 3HD7B 4AQRD 2OYHA 2HPCB 2FXMA 2P67A 1J2JB 2KYVA 5AW4B 3HUSB 5BVZA 1OXZA 4WB4A 2BASA 4AYCA 1J1DB 1KILC 3KYQA 5CCHC 3L37A 2XDJA 3RL0D 2VRSA 4WY4D 2O01H 2XU6A 5AVVB 2GM4A 1YYCA 1RF0C 1GL2B 3B5NC 1IFMA 1MV8A 3CL3D 1LTJC 1KILB 1SVFA 2YKPA 1A02J 4LGDE 1GD2E 1IO4A 1AQ5A 3HUSC 1RE3A 4W80A 3RK3D 3OA7A 1M1JA 3I5CA 3RL0B 3HD7C 4IFMA 1FBMA 5CCGA 1LWUA 2N1TC 2WZ7A 2J59M 2WSFH 1PFIA 3CLQA 1HGVA 1FZFA 2C0WA 2ZXEB 4WY4C 2I1JA 3CI9A 1ZV8A 5APWA 2E43A 1FZAA 1RF0A 3B5ND 3MUDA 1LTBC 1N7SC 1L4AB 1SQQK 3NTNA 1N73C 1GDTA 3KQGA 2Z5HA 3BASA 2WT7B 1KFMA 1N7SB 3OJAB 4XE5B 1T8ZA 2QM7A 3TNUB 3V2PA 2QM8A 1X9VA 3PP5A 5APUA 2M8RA 1XTGB 3A7OA 1JY3P 1URQC 3V4WA 1YTZI 2R5BA 2N1TB 5AW1B 3N7NA 5AVSB 3VYIA 3RL0C 2I1KA 2O1KA 3VP8A 3WMM0 3M91A 3UIAA 2A45G 2KP8A 4KHXA 3O8ZA 1L4AD 3H32A 1LTJB 1GL2C 3B5NB 4I2LC 2GUVA 2IFMA 2OYIC 3V2RA 1JCCA 2WPRA 1VPCA 2JJLA 2CPSA 3BATA 1S9KD 1J1DC 2J58A 1JNMA 3VMYA 2PP6A 1AFOA 1FJPA 5AW0B 4AUWA 1G2CA 1NU1K 5KLVK 1NO4A 2Q7CA 3C9IA 1GL2A 4LC1A 2WWWA 1T2KC 1RE3C 3L4FA 1WT6A 1RE4C 2WTYA 5AVQB 4DZOA 1N2DC 1GK4A 1ZR2A 2FFDC 1T3JA 1FOSE 1FJKA 2H43A 2HODA 1ZLLA 1CI6A 5AVTB 1H88A 1ZN5A 1SQXK 2OYHC 1LWUC 1A02F 1QL1A 3A2AA 2WSEH 3MIWA 1DX7A 3HE5A 2O1JA 3U1AA 3EFGA 5APSA 1LGHB 3RK2D 2W6BA 1JY2O 1RE4A 4N6JA 1M7LA 1IC2A 1VDFA 4DOJA 2HODB 4N3YB 3LIDA 5APQA 3RK2B 2WPSA 2N9BA 4WBAA 1SP4A 3V5BA 3L35A 3N4XA 3VOPA 1RY3A 3M0AA 3VP9A 5CCHD 3NMDA 3MD0A 1FZEA 4W7YA 3HD7A 2LKMA 2W27A 3P8CD 2PAJA 2Z4EA 2Q9IA 3HUSA 4GIFA 1JY3O 3P7KA 3GHGB 5AW3B 2WSCH 1LTJA 3LIEA 2IPPA 3G3ZA 2FKWB 2FYUK 4EOTA 1IFNA 1H89A 4C7NA 1S9KE 3SWFA 1WRGA 1L0LK 3HRNA 3M9HA 3II6A 1LT9A 5CJ4A 2WITA 2JEEA 1EQ7A 1HTLC 1NH4A 1HH0A 5APYA 1RF1C 3M06A 3IR9A 2XKMA 2HYNA 5APVA 1SFCB 5CCGD 2POHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY2 N;  1M1J C;  1FZC A;  3HUS C;  2HPC A;  1M1J A;  1FZG A;  2OYH B;  1N73 B;  1N73 C;  2OYH A;  1T3U A;  2HPC B;  1M1J B;  2OYH C;  1LWU A;  1JY2 P;  1LWU C;  3HUS B;  2OYI A;  1LT9 B;  2A45 G;  1RE3 C;  3GHG C;  3H32 A;  1LTJ B;  1JY3 N;  2A45 I;  1W2E A;  1FZE A;  1LT9 A;  1RE4 C;  1FZF A;  2XNX A;  2FFD B;  1FZC C;  1RF1 B;  1N86 A;  3GHG A;  1JY2 O;  2OYI C;  2OYI B;  1RE4 A;  1N73 A;  1RF1 C;  1FZC B;  1RF0 C;  2HLO A;  1RF1 A;  2Z4E A;  2FFD C;  2FFD A;  2HOD B;  1JY3 P;  2Q9I A;  1LTJ C;  3HUS A;  1FZA A;  1JY3 O;  2A45 H;  1RF0 A;  1FZB A;  3H32 B;  3GHG B;  3E1I A;  2H43 A;  3BVH A;  1LT9 C;  1LTJ A;  2HOD A;  1RE3 A;  1LWU B; 
#chains in the Genus database with same CATH topology
 2B87 B;  1VQ4 P;  2A06 E;  3AE6 C;  3L73 E;  4GOE A;  3B71 A;  2ZXX A;  3RBZ A;  2KSE A;  1VQN P;  2P2U A;  1N7S A;  4PV1 C;  4TLF A;  3VTP C;  1M1J B;  1OFC X;  3M9Q A;  1NU1 D;  1SQQ G;  1MZ9 A;  2KB7 P;  1KFN A;  5APT A;  3TNU A;  1CZQ A;  5DJU B;  4RKU J;  1JMM A;  1LNQ A;  1NYH A;  1JY3 N;  5CHX A;  1W2E A;  2KZI A;  1GK6 A;  3VMZ A;  3Q2Y A;  1NKN A;  1FZC C;  4B86 A;  3CWB G;  4XFJ A;  5AVU B;  4H13 D;  1GW4 A;  3MGN A;  3E7K A;  2QG4 A;  1QL2 A;  1NTM D;  1BCC J;  3H1L J;  4H0L D;  3T97 A;  2XV5 A;  4ASW A;  4ZKU A;  4Y99 C;  5AW9 B;  1ZR4 A;  1RF1 A;  1FZC B;  5KLV G;  3O6Q B;  3HE4 A;  2OYO A;  1SQB D;  3HTK A;  5B5E E;  1GW3 A;  2K9Y A;  2QEX P;  1EDK A;  2LXB A;  4N78 D;  1LT9 C;  2BCC D;  1GU4 A;  1J1E B;  3GF7 A;  2NPS B;  1NTK G;  1MFT A;  1M1J C;  1PZQ A;  1SQV G;  1WMK A;  1XTC C;  1SQB E;  3KXD A;  2IZ1 A;  3PHL A;  4GOF A;  4WWI A;  3RK3 B;  3SFE C;  1H8A A;  3TSI A;  1MFZ A;  2WSC J;  3KDP B;  1SQV K;  1SFC C;  2FYU D;  4CPG A;  1S72 P;  4YPC A;  3B4S A;  1FS0 E;  2Q3E A;  4TT3 H;  5AW7 B;  1FDO A;  3AEB C;  5GTI E;  1DIP A;  2FYN C;  1GU5 A;  4JYB A;  1NHL A;  2IYP A;  2A45 I;  1IFI A;  4OGQ B;  2C9L Y;  2FYU J;  3L70 D;  2WSF J;  2PRR A;  1IFD A;  4PJ0 H;  4U3F E;  4RJT A;  3U1C A;  1L2P A;  1SFC D;  2YMY A;  3O6Q A;  2Y9Y A;  2M5A A;  1KV4 A;  4M3L A;  2OTK E;  1CI6 B;  2FXO A;  2HLO A;  3TK1 A;  5K5G B;  1PGJ A;  3HD7 D;  3QWO C;  3IFM A;  2O3J A;  3L70 E;  1CSB A;  1YBK A;  1BDD A;  1KQG B;  1NKZ B;  3H32 B;  1SQB J;  2ZAE B;  1X79 B;  2YKO A;  3HE4 B;  3HTK B;  4DJG A;  1VQM P;  3L74 E;  1H0T A;  1M1K Q;  1LTT C;  2C0X A;  1HJB A;  1VL2 A;  3P8C E;  4UB8 H;  1BCC D;  3H1L G;  3B8E B;  3M9B A;  2OQQ A;  4L73 A;  3CX5 D;  4PD4 I;  5AVW B;  2K9J B;  1NTM K;  3T97 B;  3P8M C;  1FE6 A;  1NTM J;  1S5L E;  4RO0 A;  1NTZ K;  2IBZ D;  3KZI E;  1HUC A;  1JY2 P;  4L76 A;  4C46 A;  3CCS P;  4GDO A;  2ZFC A;  4NPD A;  1L0L J;  4XA4 A;  5BU8 B;  3CC7 P;  1NTK J;  2DW3 A;  3H1I D;  3NXS A;  3FWN A;  4IFF A;  1FAV A;  1SQV D;  2KK7 A;  3H1H G;  5KKZ C;  2D2C D;  5AVR B;  5KAI H;  1NAF A;  3ABV C;  4DCK A;  1SLQ A;  2I8D A;  5AW8 B;  3V2Q A;  3I56 P;  3Q3D A;  3A0B E;  2E42 A;  1NAY A;  1G2C B;  1NOH A;  3H1I E;  3PLN A;  2P1J A;  5KAI E;  4OGQ C;  3BRT B;  1S4X A;  2A06 D;  4BWN A;  1HGZ A;  1JB0 J;  2FYN B;  1SQB K;  2NPS D;  2AXT H;  1LP1 B;  1URQ A;  1HBW A;  1NU1 E;  2R3C A;  2ZVN B;  1JOC A;  2G3A A;  4I6M C;  1BE3 G;  4L74 A;  3C1L A;  4NPF X;  1JEK A;  5KAF E;  2QA4 P;  3RK3 C;  3M0D C;  1FDI A;  1ZME C;  1VQK P;  1Y47 A;  2NPS C;  3AEG C;  1J1E C;  1N8R Q;  3P32 A;  1PP9 G;  1LT9 B;  1QEX A;  4R4L A;  1LT1 A;  2MJZ A;  3H6P A;  5APX A;  3WU2 H;  2N1T A;  1VQO P;  3RK2 C;  3H1I J;  1KYO E;  1L0L D;  4GT1 A;  1NVO A;  2PFX A;  4Y99 B;  5AVX B;  1DH3 A;  3D70 A;  2WSE J;  3W68 A;  3CCJ P;  1L0N D;  2SPZ A;  3CCU P;  4IFD K;  3V2N A;  3RGU A;  1PV3 A;  2KNC A;  3VN0 A;  3CCV P;  3GLM A;  2BCC E;  2WSS H;  1BE3 E;  1N73 A;  1YQ3 C;  3A5T A;  1URQ D;  1L0L E;  3BCC G;  2FFD A;  1YJN P;  2YO2 A;  1NU1 G;  5H2F H;  5AVZ B;  4A7P A;  1NTK K;  1L0N E;  1U57 A;  2QRX A;  3TGU J;  1NTZ E;  3E1I A;  1KOR A;  2M3B A;  4ZKP A;  1NTM E;  1KIL E;  3EFF K;  3H1H D;  1CW5 A;  1JM0 A;  2HPC A;  2XZR A;  2OYH B;  4PV1 B;  2E5T A;  1W5C E;  3RBX A;  3U59 A;  3V4Q A;  3EQ2 A;  3CCQ P;  4N78 E;  2QJP C;  1G1J A;  3H1H E;  4C7R A;  5AVY B;  1NWQ A;  3CWB J;  1IK9 A;  1JTH B;  2KS1 A;  1Z56 A;  2E5Y A;  2FYZ A;  2L5G B;  2L91 A;  3JSV C;  1LTA C;  1DD4 A;  4U3F J;  1YTZ T;  2E74 B;  1EZV G;  2FFD B;  1SQP E;  1RF1 B;  1N86 A;  2V7Q J;  1YI2 P;  1NTZ J;  2KOG A;  2H7H A;  2UWJ E;  3TGU E;  1IJD B;  4EYY Q;  4H0L B;  4JF7 A;  1JCD A;  4UB8 E;  1RHZ B;  1ZXG A;  3L74 G;  4L75 A;  2BCC J;  3L36 A;  3BRV B;  2A45 H;  1MKM A;  2W90 A;  3CXH I;  4IL6 X;  5AW1 B;  3WUT A;  3BVH A;  1LTG C;  1GTW A;  4JPZ B;  2V4H A;  2R32 A;  2W6A A;  3B5N A;  4JYC A;  5CMZ A;  4D6T D;  4Z1M H;  1IK7 A;  5KJ7 A;  1FZG A;  5CJ0 A;  1HVV A;  3CXH D;  3SSU A;  3R2P A;  5AW6 B;  1AVO A;  1DEB A;  3H1K D;  4H44 D;  2KZJ A;  1OVV A;  2QJY C;  4HH2 A;  1YIT P;  3MTU E;  4BXL A;  2KLV A;  2ZT9 D;  3GHG C;  4WY4 A;  4O9B A;  2KSJ A;  3SWY A;  5CCH A;  3H1K J;  3R4Y A;  5B66 E;  3Q1M A;  1VQ7 P;  1AVY A;  4WVZ A;  4EDF A;  3PJS K;  1SQX D;  3AEF C;  1L0N K;  4H44 C;  1Q7Y Q;  2OYI B;  2GUS A;  4D6T G;  1SQB G;  2IX7 C;  2CK3 H;  2NPS A;  1SQV E;  1NTK E;  3M0D A;  3HE5 B;  3AE1 C;  2P58 A;  2JWA A;  3TYY A;  1P84 H;  3AE4 C;  3FXE A;  5KTB A;  2YNY A;  5CCG C;  1KB9 H;  2NZ2 A;  1FZB A;  2IFN A;  3CMA P;  1KN7 A;  3RL0 g;  1OWA A;  3L73 J;  3GHG A;  1JTH A;  2KS1 B;  3KHU A;  5TJH A;  2YKQ A;  2OGU A;  1BGY J;  4LLH A;  5KAF H;  1YIJ P;  2Z5I A;  2C9N Y;  3CWB E;  1KQL A;  3C8V A;  3S9O A;  2YO3 A;  2CPB A;  1HWT C;  2E76 C;  3I55 P;  1E5W A;  2KI7 B;  2WPV B;  4ZMD A;  4IL6 H;  1LP1 A;  1URQ B;  2O01 J;  1LTI C;  2KIK A;  1SQP K;  1SFC A;  2OAR A;  3CWB D;  5BU5 A;  1U7M A;  4OH8 B;  3G6E P;  2N1T D;  1L4A A;  1W2B O;  2AEF A;  1T2K D;  3A0B H;  3FXD A;  3OAK A;  2E76 D;  2Y0E A;  2WT7 A;  1MUU A;  2A06 G;  1N7L A;  3CCE P;  1JO5 A;  4EIJ A;  1Q86 Q;  1GMJ A;  2W6J H;  3H1J J;  5AW5 B;  2HG5 D;  5KLI B;  3LW5 H;  1QVG O;  4KJM A;  2LXC B;  2Q3I A;  1FDM A;  1BE3 D;  2XNX A;  3AE8 C;  1FC2 C;  2FYU E;  1LWU B;  2ZVO B;  2B88 A;  2RN0 A;  2WPQ A;  3A3Y B;  1PP9 J;  3H1L D;  3G71 P;  1NGM B;  2AXC A;  1KD1 Q;  1ZW0 A;  1N73 B;  1L0N J;  1T3U A;  2H8P D;  1YJW P;  2HFE D;  2R5D A;  1L4A C;  1KIL D;  1KB9 I;  2OYI A;  3KPE A;  1M57 D;  3L72 D;  2P7J A;  1N7S D;  3EWK A;  1KZU B;  1GL2 D;  4GKG A;  4RES B;  4W7Z A;  3USS A;  2KNC B;  1GZL A;  1YQ4 C;  4PV1 D;  1PGQ A;  1IFJ A;  1VF5 C;  5KJ7 C;  4WY4 B;  1JUN A;  1K8A Q;  1SQQ J;  1JMB A;  3WUV A;  3CPW O;  2E75 B;  1FOS F;  1S1C X;  2JR8 A;  3NFQ A;  3L75 J;  3L74 D;  1AQT A;  4HYT B;  4I7Z B;  1BGY D;  5AW2 B;  2XND H;  1G1I A;  2FYU G;  3L71 J;  4D6T E;  5GTI H;  3JCU E;  5KJ7 D;  4ASV A;  1FU1 A;  3L71 D;  1YJ9 P;  1X22 A;  4H13 C;  1LTS C;  5L8R J;  1U7J A;  1K9M Q;  2ZT9 C;  4C7N B;  2Q5U A;  3JC2 2;  1JY2 N;  1KIL A;  3CCL P;  1X8Y A;  4I1L A;  3VMX A;  4OVN F;  5KLV J;  4YTP C;  2D2C C;  2ZYA A;  1OVR A;  3HD7 B;  4PD4 H;  4AQR D;  3H25 A;  3D71 A;  2QIW A;  2OYH A;  2FXM A;  2P67 A;  1J2J B;  1X0T A;  2KYV A;  5AW4 B;  3HUS B;  5BVZ A;  1KQS O;  1SS1 A;  3VMA A;  1AJY A;  1OXZ A;  1K04 A;  2BAS A;  2FXP A;  4WB4 A;  4AYC A;  3L72 J;  1J1D B;  1KIL C;  1OW8 A;  3KYQ A;  3L37 A;  5CCH C;  1NTK D;  1YHQ P;  2E75 D;  2XDJ A;  4R4M A;  3RL0 D;  3TF5 A;  4U7J A;  2K37 A;  1PGO A;  2RKL A;  2YIU C;  2QJK B;  2VRS A;  4WY4 D;  2IZ0 A;  3KZI H;  2QSI A;  3H1J E;  2O01 H;  2K9J A;  2NRG A;  2XU6 A;  5AVV B;  1YYC A;  1EXI A;  2GM4 A;  1RF0 C;  1GL2 B;  2BEQ D;  2YIU B;  3B5N C;  2B89 A;  3CXH H;  1IFM A;  3G9R A;  1VQL P;  3OW2 O;  1MV8 A;  3CL3 D;  1LTJ C;  1KC8 Q;  3CD6 P;  1KIL B;  1KMI Z;  1M56 D;  3SWK A;  1SQP J;  1SVF A;  2YKP A;  2Q1K A;  4LGD E;  1A02 J;  1GD2 E;  2M0B A;  1IO4 A;  1AQ5 A;  3HUS C;  2K1A A;  3L75 G;  1RE3 A;  4W80 A;  3RK3 D;  3OA7 A;  5E79 E;  1M1J A;  3I5C A;  3RL0 B;  2D2C B;  3HD7 C;  3L71 G;  4IFM A;  2HR3 A;  3L70 J;  1R5L A;  1KYO D;  1FBM A;  5CCG A;  1LWU A;  1K05 A;  2N1T C;  2WZ7 A;  2J59 M;  1Y8A A;  2K88 A;  2WSF H;  1M8O B;  4H13 B;  4IL6 E;  2IYO A;  1PFI A;  3CLQ A;  1HGV A;  1KYO I;  1FZF A;  2JDI H;  4DT0 A;  4HB1 A;  1OMI A;  3GMA A;  4I7Z C;  1PPJ G;  2E75 C;  1S3J A;  2C0W A;  2ZXE B;  1OW7 A;  3PTZ A;  4WY4 C;  1VF5 B;  2I1J A;  1H88 A;  1OZH A;  3H1H J;  1QGK B;  3CI9 A;  1ZV8 A;  5APW A;  2E43 A;  1FZA A;  1RF0 A;  1PPJ D;  3B5N D;  3GW6 A;  3MUD A;  2JKV A;  2YMK A;  1LTB C;  1N7S C;  3JCU H;  1L4A B;  3CC2 P;  3PH0 A;  3AE3 C;  1SQQ K;  1PIX A;  1Q90 D;  1Q82 Q;  3TGU G;  4QMA A;  3NTN A;  3D6Z A;  1SQX J;  1N73 C;  1S5L X;  1GDT A;  1VF5 D;  3CCM P;  1SQP G;  2Z5H A;  3BAS A;  3KQG A;  1EZV E;  1KFM A;  1N7S B;  4YXW H;  3F5H A;  3OJA B;  2WT7 B;  1H0T B;  4XE5 B;  1T8Z A;  2Y0C A;  3F89 A;  1RQU A;  2KUB A;  2QM7 A;  1BGY E;  3A0H H;  3TNU B;  1S2E A;  1BCC G;  3V2P A;  2QM8 A;  2PGD A;  1X9V A;  5CBN A;  2M5A B;  3L72 E;  2ZYD A;  4BRY A;  3PP5 A;  5APU A;  2B9B A;  1EZV I;  5KLV D;  2M8R A;  4PJ0 E;  3E1R A;  1Q81 Q;  1XTG B;  3A7O A;  1NTM G;  1JY3 P;  3FWL A;  3IN6 A;  1NTZ G;  5B5E H;  1URQ C;  1L0N G;  2RH0 A;  3CXH E;  1EDJ A;  2E76 B;  2OTL P;  2AEJ A;  3V4W A;  1VQ9 P;  1YTZ I;  1L0L G;  2R5B A;  2N1T B;  1QX8 A;  1OX3 A;  1PL5 A;  3BCC E;  2BCC G;  3L74 J;  3L75 D;  3N7N A;  2ITA A;  4OWF A;  4UB6 H;  5AVS B;  3VYI A;  3RL0 C;  2I1K A;  2J5U A;  2R3S A;  3PRJ A;  1USE A;  2O1K A;  2AEM A;  2GA1 A;  5E79 H;  3AEC C;  3VP8 A;  3WMM 0;  1ZOY C;  3M91 A;  3UIA A;  3BCC D;  1SQX E;  2A45 G;  1K73 Q;  1KQF B;  2KP8 A;  2LR2 A;  2IDB A;  4GOD A;  4KHX A;  3O8Z A;  1L4A D;  3MP7 B;  3AEE C;  3H32 A;  1LTJ B;  1PGP A;  5DJT B;  3G4S P;  1SQX G;  1PP9 E;  2W83 C;  1GL2 C;  3B5N B;  4I2L C;  2GUV A;  5GTH H;  2IFM A;  1RH5 B;  2OYI C;  3V2R A;  3CCR P;  3Q5P A;  2QJK C;  1S5L H;  1BE3 J;  1PP9 D;  1JCC A;  1VQP P;  2WPR A;  1VPC A;  2JJL A;  3GG2 A;  2CPS A;  1FZC A;  1LJ2 A;  3BAT A;  2Y9Z A;  2AXT E;  1S9K D;  1J1D C;  3H1J D;  1Q2N A;  2IBZ I;  2J58 A;  1JNM A;  1BSN A;  3VMY A;  1P84 I;  2PP6 A;  2HPC B;  2G8Y A;  2K3R A;  2M3E A;  2QJY B;  1AFO A;  1FJP A;  1HF9 A;  1DEE G;  5AW0 B;  4AUW A;  1G2C A;  1NU1 K;  5KLV K;  1NO4 A;  3H1I G;  2Q7C A;  3C9I A;  3MHV A;  3L72 G;  1GL2 A;  2P10 A;  2JP3 A;  3AE2 C;  4LC1 A;  2ZT9 B;  2WWW A;  1T2K C;  1BCC E;  1BGY G;  4NPE A;  1RE3 C;  3L4F A;  1AV1 A;  2WQY C;  1WT6 A;  3BCC J;  1RE4 C;  2WTY A;  5TIS E;  1M90 Q;  1QVF O;  5M1B A;  2Y0D A;  4K35 A;  5AVQ B;  4DZO A;  1N2D C;  1GK4 A;  1OIP A;  3SFD C;  3H1L E;  1ZR2 A;  2FFD C;  1T3J A;  2E74 C;  1FOS E;  1RQV A;  1HJ0 A;  2V7Q H;  1FJK A;  1KYO H;  1TU3 F;  2H43 A;  3D6Y A;  1KB9 E;  2RMZ A;  2KXP B;  3L70 G;  3WU2 E;  4IOI H;  1EZV D;  1D7M A;  2HOD A;  1ZLL A;  3IAO A;  1CI6 A;  1ZRT E;  2QE7 H;  3GF3 A;  2H88 C;  5AVT B;  3TDK A;  4Y28 J;  2YXR B;  3LW5 J;  1ZN5 A;  3V6I A;  1PPJ E;  1SQX K;  1KB9 D;  4MN4 C;  4K3A A;  4U3F G;  2OYH C;  1IFP A;  4UB6 E;  1LWU C;  1A02 F;  1QL1 A;  3A2A A;  1SQV J;  2WSE H;  3MIW A;  1DX7 A;  2WVR A;  1KTM A;  3HE5 A;  5KLI C;  2O1J A;  5H2F E;  3U1A A;  3EFG A;  5APS A;  1VQ5 P;  1LGH B;  1R8E A;  2Q6Q A;  2FY8 A;  4EI2 A;  1NU1 J;  3RK2 D;  2W6B A;  3S4R A;  4YXD C;  1JY2 O;  3L71 E;  4D6T J;  1OVU A;  1RE4 A;  3AE5 C;  4N6J A;  5GTH E;  1M7L A;  1IC2 A;  1VDF A;  4DOJ A;  3L75 E;  2HOD B;  1OW6 A;  2R44 A;  4N3Y B;  3CME P;  3LID A;  1AA0 A;  3A0H E;  3MZW B;  5APQ A;  2WPS A;  3RK2 B;  4ZNC A;  2N9B A;  4HJG H;  1E79 H;  4WBA A;  2W8Z A;  1SP4 A;  3W67 A;  5KLV E;  3V5B A;  3WUU A;  2ZYG A;  3L35 A;  3N4X A;  1EDL A;  3H1J G;  3VOP A;  1RY3 A;  1NTZ D;  3M0A A;  5C39 A;  1SQQ D;  3VP9 A;  5CCH D;  2WMM A;  3NMD A;  4PD4 D;  4U3F D;  1DD3 A;  3CX5 I;  2B87 A;  3FGA D;  3MD0 A;  4BRY B;  3QH9 A;  1FZE A;  1SQQ E;  3CX5 H;  1Y9B A;  4W7Y A;  3Q5R A;  3ZDM A;  4PD4 E;  2QVA A;  3HD7 A;  2FBW C;  2LKM A;  4OGQ D;  3S1K A;  1T6A A;  1QLE D;  2W27 A;  4H44 B;  3L73 G;  4JQ0 D;  3P8C D;  2PAJ A;  3RK3 E;  2Z4E A;  5KKZ B;  2Q9I A;  1VQ8 P;  1SQP D;  3HUS A;  4GIF A;  1JY3 O;  3P7K A;  3AED C;  5B66 H;  3GHG B;  2YXQ B;  1BSH A;  3TGU D;  4KT0 J;  1UII A;  5AW3 B;  2JO1 A;  2WSC H;  1LTJ A;  2IPP A;  3ITK A;  1USD A;  3LIE A;  3MUD C;  3K5B A;  3G3Z A;  2FKW B;  2FYU K;  4EOT A;  1IFN A;  1H89 A;  1BDC A;  4C7N A;  2BEZ F;  1EC5 A;  1S9K E;  1NJI Q;  3SWF A;  3Q5S A;  1UIX A;  3H1K G;  2KLU A;  2N9Y B;  1WRG A;  5EFW B;  1L0L K;  2IBZ G;  3CX5 E;  3HRN A;  3M9H A;  1VQ6 P;  1P84 E;  2E74 D;  3II6 A;  2IBZ E;  3FX0 A;  1EDI A;  1LT9 A;  3AE9 C;  4H0L C;  5CJ4 A;  2WIT A;  2OTJ P;  3AE7 C;  3H1K E;  1ZP0 C;  2JEE A;  1EQ7 A;  1EXJ A;  1P84 D;  2H89 C;  1HTL C;  1NH4 A;  1HH0 A;  5APY A;  1RF1 C;  1IZN B;  3M06 A;  2ZJS E;  2O01 N;  3IR9 A;  3IF4 A;  4JBZ A;  1R5S A;  1ZRT D;  3L73 D;  5TIS H;  3AEA C;  2XKM A;  2HYN A;  5CBO A;  3CC4 P;  2JWD A;  4HKZ H;  5APV A;  2QJP B;  1SFC B;  2MKV A;  5CCG D;  2POH A; 
#chains in the Genus database with same CATH homology
 2P2U A;  1N7S A;  3VTP C;  1M1J B;  3M9Q A;  1MZ9 A;  2KB7 P;  1KFN A;  5APT A;  3TNU A;  1CZQ A;  1JMM A;  1JY3 N;  5CHX A;  1W2E A;  1GK6 A;  3VMZ A;  1NKN A;  1FZC C;  4B86 A;  5AVU B;  1GW4 A;  3MGN A;  1QL2 A;  4ZKU A;  1ZR4 A;  3T97 A;  2XV5 A;  1FZC B;  1RF1 A;  4Y99 C;  5AW9 B;  3HE4 A;  3HTK A;  1GW3 A;  1GU4 A;  4N78 D;  1LT9 C;  1J1E B;  2NPS B;  1M1J C;  1XTC C;  3RK3 B;  1H8A A;  3TSI A;  1MFZ A;  3KDP B;  1SQV K;  1SFC C;  5AW7 B;  1GU5 A;  4JYB A;  1NHL A;  2A45 I;  1IFI A;  2C9L Y;  3U1C A;  1IFD A;  1SFC D;  2YMY A;  4M3L A;  1CI6 B;  2HLO A;  3TK1 A;  3HD7 D;  3IFM A;  1CSB A;  1NKZ B;  3H32 B;  1X79 B;  2YKO A;  3HE4 B;  3HTK B;  1LTT C;  2C0X A;  1HJB A;  3P8C E;  3M9B A;  5AVW B;  3B8E B;  4IFD K;  1FZC A;  1NTM K;  3P8M C;  1NTZ K;  1HUC A;  1JY2 P;  4C46 A;  2ZFC A;  4XA4 A;  5BU8 B;  4IFF A;  3NXS A;  1FAV A;  5AVR B;  1NAF A;  2E42 A;  1SLQ A;  5AW8 B;  3V2Q A;  1G2C B;  1NOH A;  2P1J A;  3BRT B;  1HGZ A;  1SQB K;  2NPS D;  1URQ A;  1HBW A;  2R3C A;  1JOC A;  4I6M C;  3RK3 C;  3M0D C;  2NPS C;  1J1E C;  3P32 A;  1LT9 B;  2MJZ A;  3H6P A;  5APX A;  2N1T A;  3RK2 C;  4GT1 A;  5AVX B;  4Y99 B;  1DH3 A;  3V2N A;  3VN0 A;  1N73 A;  2FFD A;  3A5T A;  1URQ D;  2YO2 A;  5AVZ B;  1NTK K;  3E1I A;  2M3B A;  4ZKP A;  1CW5 A;  2HPC A;  2XZR A;  2OYH B;  3U59 A;  3V4Q A;  3EQ2 A;  4N78 E;  1G1J A;  4C7R A;  5AVY B;  1NWQ A;  1IK9 A;  1JTH B;  2L5G B;  1Z56 A;  2FYZ A;  1LTA C;  1YTZ T;  2FFD B;  1RF1 B;  1N86 A;  2H7H A;  2KOG A;  1IJD B;  4JF7 A;  1JCD A;  3L36 A;  3BRV B;  2A45 H;  3BVH A;  1LTG C;  1GTW A;  2R32 A;  2W6A A;  3B5N A;  4JYC A;  5CMZ A;  5KJ7 A;  1FZG A;  5CJ0 A;  1HVV A;  3R2P A;  5AW6 B;  1DEB A;  4HH2 A;  3MTU E;  2KLV A;  3GHG C;  4WY4 A;  4O9B A;  2KSJ A;  3SWY A;  5CCH A;  1L0N K;  2OYI B;  2GUS A;  2IX7 C;  2NPS A;  3M0D A;  3HE5 B;  3TYY A;  5KTB A;  2YNY A;  5CCG C;  1FZB A;  2IFN A;  1OWA A;  3GHG A;  1JTH A;  2YKQ A;  4LLH A;  2Z5I A;  2C9N Y;  1KQL A;  2YO3 A;  2CPB A;  1HWT C;  1E5W A;  1URQ B;  1LTI C;  1SQP K;  1SFC A;  2OAR A;  5BU5 A;  4OH8 B;  2N1T D;  1L4A A;  1T2K D;  3OAK A;  2WT7 A;  1MUU A;  1JO5 A;  1N7L A;  4EIJ A;  5AW5 B;  2HG5 D;  3LW5 H;  2Q3I A;  1FDM A;  2XNX A;  3A3Y B;  1LWU B;  2WPQ A;  1N73 B;  1T3U A;  2H8P D;  2HFE D;  2R5D A;  1L4A C;  1KIL D;  2OYI A;  3KPE A;  4GKG A;  2P7J A;  1N7S D;  1KZU B;  1GL2 D;  4RES B;  4W7Z A;  1GZL A;  1IFJ A;  5KJ7 C;  4WY4 B;  1JUN A;  1FOS F;  3NFQ A;  5AW2 B;  4HYT B;  1G1I A;  5KJ7 D;  1FU1 A;  1LTS C;  4C7N B;  2Q5U A;  1JY2 N;  1KIL A;  1X8Y A;  4I1L A;  3VMX A;  3HD7 B;  4AQR D;  2OYH A;  2HPC B;  2FXM A;  2P67 A;  1J2J B;  2KYV A;  5AW4 B;  3HUS B;  5BVZ A;  1OXZ A;  4WB4 A;  2BAS A;  4AYC A;  1J1D B;  1KIL C;  3KYQ A;  5CCH C;  3L37 A;  2XDJ A;  3RL0 D;  2VRS A;  4WY4 D;  2O01 H;  2XU6 A;  5AVV B;  2GM4 A;  1YYC A;  1RF0 C;  1GL2 B;  3B5N C;  1IFM A;  1MV8 A;  3CL3 D;  1LTJ C;  1KIL B;  1SVF A;  2YKP A;  1A02 J;  4LGD E;  1GD2 E;  1IO4 A;  1AQ5 A;  3HUS C;  1RE3 A;  4W80 A;  3RK3 D;  3OA7 A;  1M1J A;  3I5C A;  3RL0 B;  3HD7 C;  4IFM A;  1FBM A;  5CCG A;  1LWU A;  2N1T C;  2WZ7 A;  2J59 M;  2WSF H;  1PFI A;  3CLQ A;  1HGV A;  1FZF A;  2C0W A;  2ZXE B;  4WY4 C;  2I1J A;  3CI9 A;  1ZV8 A;  5APW A;  2E43 A;  1FZA A;  1RF0 A;  3B5N D;  3MUD A;  1LTB C;  1N7S C;  1L4A B;  1SQQ K;  3NTN A;  1N73 C;  1GDT A;  3KQG A;  2Z5H A;  3BAS A;  2WT7 B;  1KFM A;  1N7S B;  3OJA B;  4XE5 B;  1T8Z A;  2QM7 A;  3TNU B;  3V2P A;  2QM8 A;  1X9V A;  3PP5 A;  5APU A;  2M8R A;  1XTG B;  3A7O A;  1JY3 P;  1URQ C;  3V4W A;  1YTZ I;  2R5B A;  2N1T B;  5AW1 B;  3N7N A;  5AVS B;  3VYI A;  3RL0 C;  2I1K A;  2O1K A;  3VP8 A;  3WMM 0;  3M91 A;  3UIA A;  2A45 G;  2KP8 A;  4KHX A;  3O8Z A;  1L4A D;  3H32 A;  1LTJ B;  1GL2 C;  3B5N B;  4I2L C;  2GUV A;  2IFM A;  2OYI C;  3V2R A;  1JCC A;  2WPR A;  1VPC A;  2JJL A;  2CPS A;  3BAT A;  1S9K D;  1J1D C;  2J58 A;  1JNM A;  3VMY A;  2PP6 A;  1AFO A;  1FJP A;  5AW0 B;  4AUW A;  1G2C A;  1NU1 K;  5KLV K;  1NO4 A;  2Q7C A;  3C9I A;  1GL2 A;  4LC1 A;  2WWW A;  1T2K C;  1RE3 C;  3L4F A;  1WT6 A;  1RE4 C;  2WTY A;  5AVQ B;  4DZO A;  1N2D C;  1GK4 A;  1ZR2 A;  2FFD C;  1T3J A;  1FOS E;  1FJK A;  2H43 A;  2HOD A;  1ZLL A;  1CI6 A;  5AVT B;  1H88 A;  1ZN5 A;  1SQX K;  2OYH C;  1LWU C;  1A02 F;  1QL1 A;  3A2A A;  2WSE H;  3MIW A;  1DX7 A;  3HE5 A;  2O1J A;  3U1A A;  3EFG A;  5APS A;  1LGH B;  3RK2 D;  2W6B A;  1JY2 O;  1RE4 A;  4N6J A;  1M7L A;  1IC2 A;  1VDF A;  4DOJ A;  2HOD B;  4N3Y B;  3LID A;  5APQ A;  3RK2 B;  2WPS A;  2N9B A;  4WBA A;  1SP4 A;  3V5B A;  3L35 A;  3N4X A;  3VOP A;  1RY3 A;  3M0A A;  3VP9 A;  5CCH D;  3NMD A;  3MD0 A;  1FZE A;  4W7Y A;  3HD7 A;  2LKM A;  2W27 A;  3P8C D;  2PAJ A;  2Z4E A;  2Q9I A;  3HUS A;  4GIF A;  1JY3 O;  3P7K A;  3GHG B;  5AW3 B;  2WSC H;  1LTJ A;  3LIE A;  2IPP A;  3G3Z A;  2FKW B;  2FYU K;  4EOT A;  1IFN A;  1H89 A;  4C7N A;  1S9K E;  3SWF A;  1WRG A;  1L0L K;  3HRN A;  3M9H A;  3II6 A;  1LT9 A;  5CJ4 A;  2WIT A;  2JEE A;  1EQ7 A;  1HTL C;  1NH4 A;  1HH0 A;  5APY A;  1RF1 C;  3M06 A;  3IR9 A;  2XKM A;  2HYN A;  5APV A;  1SFC B;  5CCG D;  2POH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...