1JY3P

Crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
46
structure length
46
Chain Sequence
VATRDNCCILDERFGSYCPTTCGIADFLNNYQTSVDKDLRTLEGIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords FIBRINOGEN ALPHA CHAIN
publication title Crystal structure of the central region of bovine fibrinogen (E5 fragment) at 1.4-A resolution.
pubmed doi rcsb
total genus 11
structure length 46
sequence length 46
chains with identical sequence S
ec nomenclature
pdb deposition date 2001-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jy3P00
1N73C 1LWUC 1LTJC 2FFDA 1JY3O 3BVHA 1JY3N 1FZCA 1N73B 1LWUB 2H43A 2HPCA 2OYHC 2HODA 3GHGA 1LTJB 2OYHB 3E1IA 1FZAA 1M1JC 2A45H 3HUSC 1W2EA 2OYIC 1M1JB 1FZBA 1RE3A 1RE4C 1LT9A 2OYIB 1JY2P 2HLOA 1RF0C 1T3UA 3H32B 3HUSB 1RF1A 2Q9IA 1FZFA 1N73A 1LWUA 2OYHA 1LTJA 2Z4EA 2FFDC 1FZCC 1JY3P 3GHGC 1FZEA 2FFDB 1M1JA 1JY2O 2HPCB 1FZCB 1RE4A 2HODB 3HUSA 1FZGA 2OYIA 1N86A 1JY2N 1RE3C 3GHGB 3H32A 1LT9C 1RF0A 1RF1C 2A45I 1LT9B 2XNXA 1RF1B 2A45G
chains in the Genus database with same CATH superfamily
2R3SA 3GMAA 1GL2A 1SQVE 1OW6A 2IX7C 3TGUE 1KYOI 3D6YA 2ZT9D 1JY2P 3HUSB 1GTWA 2D2CD 1GU4A 1KQGB 4AYCA 1NTKE 1Q81Q 3M9BA 3H1IE 3FGAD 1SQPJ 2NPSB 4D6TJ 2HODB 3L71E 3GF7A 3CMAP 1PP9D 2E75D 2QJPB 3OW2O 3B5NB 4LGDE 4WBAA 2JP3A 5KLIC 3F89A 3FXEA 2BASA 1N7SA 2PAJA 3E1RA 1JCCA 2QVAA 1AVYA 1LTIC 1UIXA 3G6EP 1RHZB 2IYOA 1KILA 3CXHD 1SLQA 1WT6A 1QLED 3Q1MA 5AVRB 1ZRTD 3T97A 1EDLA 1YYCA 1YJNP 1MUUA 2Q5UA 2V7QJ 1CSBA 3VYIA 3H1KE 4OVNF 2IBZE 1SQVD 3TGUD 1AJYA 1NJIQ 3GG2A 4IL6H 1KQLA 1KILE 5BU5A 1KB9I 1FDOA 1VQ4P 3L71D 1S5LH 4OGQB 2H88C 3MUDC 1BSNA 1T3JA 1DEBA 3CC4P 5KLVE 3P32A 1LWUC 3L73J 3G71P 3A3YB 1EZVI 1IFJA 2I1JA 3TF5A 5TISH 1GL2D 1FS0E 4XA4A 1BGYD 3L75G 4M3LA 1JTHB 3AE8C 1NTME 1DH3A 1SS1A 3MZWB 1QL2A 4K3AA 1X9VA 3RK2D 1YIJP 3MP7B 4KT0J 3WUTA 1NKNA 3H1KD 2OYHA 3PRJA 3CI9A 2IDBA 3L70G 1N7SD 3FWNA 1U57A 4Y99C 2IBZD 1LT9C 1L0LK 2QJYC 5AW4B 1KILD 3H1LE 1FZAA 2W6BA 1EZVG 3H1HD 1CW5A 2Z5HA 3RK3E 3V5BA 1J1EC 1PP9J 5KLVD 2AXTE 2NZ2A 2KZJA 1LTJC 4JQ0D 2WQYC 3IF4A 4TLFA 3M0DC 2XU6A 1NTMD 4HJGH 3A0BH 2JR8A 3VP8A 5CHXA 1SQXD 2P67A 3HUSA 4BXLA 2FBWC 3NTNA 1MFZA 5B66H 4IOIH 4UB8H 2KIKA 3G9RA 3HE5B 1NAYA 3U1CA 1IFNA 2E74B 3I56P 5GTIH 1N73A 3L72E 4NPDA 4U3FD 1SQQK 4Z1MH 1SQVJ 3V2PA 3H1LD 1YTZI 1X8YA 2POHA 2FYNC 1J1DB 2RH0A 3RK3D 1NU1K 2ZFCA 5AVWB 3L71J 4WY4B 1URQC 1PV3A 2I1KA 1L0NK 2HR3A 1SP4A 1T2KD 4ZNCA 5TJHA 4I1LA 1BE3G 4D6TG 1PL5A 4KHXA 2Q3EA 2P58A 2HPCA 2L91A 1VQLP 1VQ8P 1BGYJ 2Q9IA 4L74A 4C7RA 2GM4A 3JC22 4W7ZA 5AW7B 3SWYA 1IK9A 1S9KE 3CWBE 4KJMA 3B8EB 2M8RA 1LJ2A 1U7MA 1RE3A 2N1TB 3L72D 1EQ7A 3H1KJ 4L73A 4DJGA 1AFOA 3P8MC 2WSSH 1JMMA 1SQBE 1EXJA 3H32A 1LTAC 2Y9YA 3RGUA 4N78E 1SQQG 2P7JA 4H0LD 3H1HJ 1T3UA 3P7KA 2O01N 1IJDB 2XNDH 2G3AA 4RO0A 4XFJA 1H89A 1NU1G 1M1JA 2OYIA 1N86A 2E5TA 1BCCE 1L0NG 2W83C 2C9LY 2XDJA 2E76D 3HD7C 1IFDA 3MGNA 1FJKA 3N4XA 3L73G 1S5LE 1VDFA 1DD3A 1KN7A 5APTA 2QE7H 1JM0A 1SQXJ 1S9KD 3CWBD 1X0TA 2GUSA 1IFMA 1ZN5A 2LXBA 5KKZB 1BDCA 5TISE 2WPVB 1YHQP 1GMJA 4GOFA 1MKMA 1KMIZ 1NTZE 4N6JA 1HF9A 4U3FJ 1RE4A 3H1LJ 1VQ7P 4N78D 2AEFA 1SFCC 2B87B 5AW6B 1NTKK 2M3EA 3HTKB 1NYHA 4OGQD 2HLOA 2ZT9C 4DOJA 3KZIH 2D2CC 3PTZA 1FZCB 3V2RA 3H25A 1BCCD 1LTSC 2KB7P 2CPBA 1CI6B 1PP9G 5DJUB 2E75C 2BEZF 3BASA 1D7MA 3W67A 2JDIH 5BVZA 2QEXP 1PPJG 2R5DA 3RBXA 3CL3D 2H43A 1M90Q 3L72J 3AEAC 3A0BE 5KLIB 3WUVA 3SWKA 3EQ2A 2IPPA 5AW9B 1NTZD 3VTPC 1LP1B 4EDFA 5B66E 2YMYA 2JKVA 2G8YA 4UB8E 1KFNA 1BSHA 1AQTA 1G2CB 2H7HA 1SQVG 1JNMA 3TGUG 5GTIE 1JMBA 1GD2E 3CCRP 5CJ0A 2O01J 2WWWA 3NXSA 1S2EA 1NTKG 3ITKA 1FOSE 3H1IG 1YI2P 5C39A 2N1TA 4HKZH 5KLVK 2QM8A 4I6MC 3BCCE 5K5GB 2SPZA 2WTYA 3AEFC 4IFDK 1FDIA 4DCKA 4GKGA 1N8RQ 2J59M 1NTMK 4O9BA 3H6PA 1GL2C 2QJKB 2FFDB 3A0HH 2Q3IA 1YQ4C 2ITAA 1R8EA 1LWUB 3TNUB 3AE7C 3S1KA 3N7NA 2UWJE 3RK2C 5CCGA 2V4HA 5L8RJ 4YTPC 2QSIA 5APVA 3VP9A 1OW7A 4BWNA 1KB9H 4EYYQ 2E43A 3H1KG 3NFQA 1WRGA 1N7SC 2IBZG 1M8OB 1K9MQ 2KSEA 3MIWA 2FXMA 1PZQA 2O3JA 1H88A 1NAFA 1KILC 1KQSO 4UB6H 2QA4P 2BCCJ 1BCCJ 3BCCD 3M9HA 2WSCJ 1LT9B 1H0TB 1R5SA 3OJAB 5KLVG 3L4FA 1CZQA 1A02J 1L4AA 3HTKA 3C8VA 1VL2A 1FZEA 1YJ9P 1NTMG 1BGYE 5KJ7D 2N1TD 2P10A 3VMXA 5B5EH 1FZCA 2HG5D 4WWIA 3KPEA 2A45H 1PGJA 3KQGA 1CI6A 3VMAA 4JYBA 3CX5I 1NTZJ 2KK7A 1G1JA 2K9JB 2I8DA 1KV4A 2O1JA 1AV1A 5EFWB 2FYUD 3A2AA 2GUVA 3FXDA 1VQMP 3CCLP 5DJTB 3CC7P 3A7OA 2WSCH 3H1HE 3RK3C 5CCGD 3RL0D 3Q2YA 1FU1A 3GHGB 2WT7A 2P1JA 3V6IA 1ZP0C 1T2KC 1JY3N 2JWDA 2IFMA 2FYNB 4GT1A 3KZIE 1RF1A 4IL6X 1YITP 2KS1B 2NRGA 2KNCB 2KZIA 2R5BA 4Y28J 2C0XA 4H44C 1SQXE 4LLHA 1HTLC 2OARA 1R5LA 3ZDMA 1W2BO 3AE6C 1W2EA 4B86A 5CJ4A 1SQBK 2A06D 2R44A 3L72G 2CK3H 1JO5A 2KSJA 5AW3B 1L4AD 1USDA 4U3FE 2FFDA 4K35A 4PV1D 1Q82Q 3L35A 3HUSC 3D6ZA 5KAIE 1RQUA 4MN4C 1FZFA 1M7LA 2W8ZA 4H0LC 3TNUA 3O8ZA 3BCCJ 3O6QB 1SQPK 2QJPC 4BRYB 1N73C 3EWKA 2H8PD 3AEEC 1QGKB 3VMZA 2E76C 3CCEP 2YIUB 1XTCC 1OXZA 1P84H 3CWBG 1VF5D 3M91A 2WSFH 3PH0A 2NPSA 2HODA 1JEKA 3HD7B 3ABVC 1YTZT 1VQPP 3A0HE 1FDMA 3B5NA 1VQOP 4JPZB 1SQBG 1K8AQ 2FYUJ 1G1IA 4C46A 1OVVA 1KYOD 1PIXA 2M5AB 1DD4A 1KB9E 3S9OA 3H1JE 2KUBA 1XTGB 4OGQC 1LGHB 1DIPA 1RE3C 2Y0DA 1X79B 5M1BA 2K9JA 1NKZB 1BCCG 2IYPA 1SQPG 1SFCB 1OW8A 1OZHA 1MZ9A 4UB6E 2OYOA 2W27A 4PD4I 2ZT9B 2D2CB 1KD1Q 2YNYA 5CMZA 1VQ5P 2KI7B 1JY3O 3GF3A 3GHGA 2E75B 1M1JC 3CMEP 1IC2A 3TYYA 2OYIC 1FZBA 2WSEJ 1K04A 3C9IA 1ZW0A 2ZYAA 1KC8Q 5B5EE 2ZVOB 1FC2C 5KTBA 5KAFH 2KNCA 2YXRB 1JTHA 1SVFA 2K1AA 5APYA 1KB9D 3H1JD 1IFIA 2NPSD 3L70D 4WB4A 3HE4B 3U59A 3A5TA 5AW0B 2RN0A 3B5ND 4H13B 4JF7A 3OAKA 2BCCE 5APQA 1EZVD 4HYTB 3UIAA 1L0LE 5AVQB 3G4SP 1QX8A 1JY2O 1ZOYC 3JCUH 2ZYGA 4EIJA 1QEXA 2WSEH 3O6QA 2KYVA 3FX0A 3Q3DA 1RH5B 4BRYA 2H89C 4C7NB 3SSUA 5AW1B 2OGUA 2FY8A 2ZXXA 3MHVA 1RF0A 1SQVK 5AVVB 1A02F 2ZJSE 3CXHI 3TK1A 1NO4A 1HBWA 2O1KA 3U1AA 2ZXEB 3RK2B 4I2LC 1IK7A 3AE1C 4QMAA 3HE5A 1KZUB 5GTHH 1MFTA 1ZV8A 1NWQA 4OH8B 2BCCD 3BCCG 1KQFB 1L0LD 1N7SB 3B71A 5H2FH 3LIDA 1M1KQ 2N9BA 1Y9BA 3WUUA 2RMZA 3CCVP 1KILB 2R3CA 3AEDC 1LTBC 4XE5B 1BE3D 2E5YA 3SFEC 2B89A 4RJTA 1AA0A 1L0NE 4WY4A 1QL1A 1IFPA 2YKPA 4ASVA 2QM7A 5CCHA 5KJ7C 2N1TC 1ZR4A 3WU2H 1W5CE 2Q7CA 1P84E 3M06A 1USEA 1KYOH 2YXQB 3RL0g 5KAIH 1E79H 1FJPA 3H1JJ 1Y47A 1VQKP 3L70J 2AEJA 2JO1A 1GW4A 2ZAEB 1FAVA 5AVZB 3AEBC 3L71G 5CCGC 3RL0C 1SQQD 2IBZI 3IAOA 1VPCA 2K88A 2JJLA 3PLNA 1NH4A 1KFMA 1NU1D 1SQXK 5CBNA 1DX7A 1OVRA 2JWAA 1JY3P 3CX5H 3RK3B 1LNQA 1BGYG 2WPSA 1FOSF 1L0ND 1AQ5A 3SFDC 2FXOA 1PFIA 1HWTC 2Y9ZA 2C9NY 3CLQA 2E74D 3L36A 1OFCX 4YPCA 1P84D 3V4QA 3KYQA 5AVSB 1JCDA 4YXWH 1GK4A 1PPJE 2J58A 4H44B 1L4AC 2FYUE 1UIIA 3RBZA 4WY4D 2YO3A 2XZRA 3PP5A 4PV1C 5CCHD 3S4RA 4LC1A 1OIPA 3H1HG 3GW6A 5KAFE 2Y0CA 4OWFA 2OTKE 1L0LJ 4Y99B 2QJYB 2PFXA 4NPFX 2KOGA 3GLMA 1EXIA 1BDDA 2B87A 2M0BA 3M0AA 4H0LB 1BE3J 1J1EB 4ASWA 1SQXG 2QG4A 4RKUJ 2YKOA 1S1CX 4W80A 3L74E 5APSA 1VF5C 1N73B 1VQNP 1LTJB 3E1IA 1Q7YQ 2WPRA 2Q6QA 2E76B 3JCUE 1HJBA 1HH0A 2A06E 1PPJD 3LIEA 1RF1C 1ZMEC 4U3FG 4A7PA 3CCSP 1DEEG 3BRVB 3L37A 3H1LG 3B4SA 4I7ZC 1X22A 4H13D 4NPEA 5AVTB 2HFED 2HPCB 1SQQJ 2FYZA 1KORA 2WITA 3QWOC 1LP1A 2OYHC 4L75A 1JB0J 1QVFO 4L76A 1NTKD 3V2NA 1NU1J 5GTHE 3AE5C 3H1ID 1G2CA 1PGQA 2QJKC 2J5UA 5AVYB 2FFDC 3I55P 1L0NJ 1URQB 3P8CE 3CC2P 5H2FE 2AXCA 1JOCA 3KHUA 2B9BA 3EFGA 3L74D 2YO2A 4CPGA 3V2QA 2L5GB 1S5LX 3II6A 3W68A 1Q86Q 2B88A 2N9YB 2WSFJ 3H32B 2PGDA 1HGVA 1WMKA 1GK6A 1IO4A 3AE2C 3WU2E 1E5WA 3E7KA 4GOEA 2V7QH 1GZLA 2CPSA 3C1LA 1VQ6P 1PGPA 1KYOE 2DW3A 1M1JB 3MUDA 2OYIB 3H1JG 1ZXGA 1LWUA 2YKQA 2WZ7A 4PD4H 2NPSC 4PJ0H 4N3YB 1JY2N 5APWA 4R4MA 2BEQD 3I5CA 2A45I 3B5NC 2W6JH 3MD0A 4TT3H 1HUCA 3P8CD 4JYCA 1OVUA 5AW8B 2WVRA 2K9YA 4IFFA 4EI2A 2GA1A 2P2UA 1NOHA 1LT9A 1H0TA 3CX5E 1NTZK 2XV5A 1IZNB 3Q5PA 3L75E 2LXCB 1GDTA 4GIFA 2A45G 5CBOA 1Z56A 2K3RA 3BATA 3Q5SA 4ZKPA 3PHLA 3IFMA 1LTJA 3L70E 2OTJP 3GHGC 3M9QA 4YXDC 3CCQP 1M57D 1Y8AA 3TGUJ 4W7YA 2QRXA 3M0DA 2BCCG 1L0LG 2OQQA 1NTKJ 1RQVA 1EZVE 1HJ0A 1AVOA 3H1IJ 1M56D 1LTTC 2Z4EA 3QH9A 3KXDA 3L74J 5AW5B 5E79H 3USSA 3G3ZA 3CCJP 1QVGO 3CX5D 4AQRD 3CXHH 2HYNA 3L75D 2Y0EA 4H44D 2IZ0A 1NTZG 4GDOA 3CCUP 1GU5A 2PP6A 2XNXA 2KS1A 1URQA 4EOTA 4U7JA 3VOPA 1K73Q 3CD6P 1P84I 3V4WA 2ZYDA 4ZMDA 2PRRA 1Q2NA 1NVOA 2OTLP 3NMDA 2VRSA 2FKWB 2MKVA 3BVHA 3AE3C 1LTGC 2YIUC 3TDKA 1N7LA 1RE4C 4R4LA 3EFFK 1RF0C 4WVZA 3JSVC 2YMKA 5KLVJ 4IL6E 2KLVA 2M3BA 1LT1A 1BE3E 1SQPE 2Q1KA 4D6TE 3RL0B 3IN6A 3WMM0 1NGMB 2W6AA 3AE4C 2E74C 2R32A 1NTMJ 5BU8B 2AEMA 1GL2B 2FYUK 1T6AA 1L2PA 4ZKUA 3F5HA 2LR2A 3SWFA 1J1DC 1EDKA 2WPQA 1S3JA 2C0WA 4AUWA 4WY4C 5AVUB 1SQBD 3AEGC 2E42A 3HD7A 5CCHC 3R4YA 1EDIA 1EDJA 1L4AB 1SQQE 4DT0A 5APUA 4PD4E 2RKLA 4PJ0E 1URQD 4PV1B 1MV8A 4JBZA 3AE9C 2M5AA 3Q5RA 2XKMA 1NU1E 3LW5J 1SQPD 4D6TD 3T97B 1J2JB 3HRNA 3D71A 4RESB 3K5BA 5AW2B 2K37A 3L73E 3L75J 4GODA 1YJWP 1T8ZA 1SFCA 1K05A 2Z5IA 1U7JA 1OMIA 3BRTB 2W90A 3D70A 4HH2A 1FZGA 2FYUG 5APXA 1OWAA 4DZOA 1VF5B 1PGOA 1GW3A 2WT7B 1HVVA 4H13C 1RF1B 2IFNA 1TU3F 3IR9A 4PD4D 1ZLLA 2AXTH 3TSIA 4I7ZB 3LW5H 1FBMA 2MJZA 2QIWA 3CCMP 1HGZA 5KJ7A 1FE6A 1ZR2A 3OA7A 3HE4A 3HD7D 1VQ9P 5KKZC 1PP9E 3L74G 3FWLA 2WMMA 3L73D 2OYHB 5AVXB 1OX3A 1RY3A 1KTMA 3R2PA 1S4XA 2KP8A 3CWBJ 3AECC 1YBKA 2FXPA 2A06G 5E79E 1H8AA 3CPWO 1JUNA 3VMYA 3PJSK 2LKMA 3KDPB 3CXHE 1S72P 3VN0A 1YQ3C 1N2DC 1SQBJ 2KLUA 1ZRTE 3MTUE 1NHLA 1FZCC 2ZVNB 2KXPB 2IZ1A 1SFCD 1Q90D 4IFMA 2O01H 1EC5A 4C7NA 2JEEA 4HB1A
chains in the Genus database with same CATH topology
1JY3O 1GL2A 1GZLA 2CPSA 2IX7C 3GHGA 1M1JC 3BASA 1IC2A 3TYYA 2OYIC 1M1JB 1FZBA 3MUDA 2OYIB 1JY2P 3HUSB 1GTWA 1GU4A 4AYCA 1LWUA 2YKQA 5BVZA 2WZ7A 3M9BA 2NPSC 3C9IA 2NPSB 2HODB 4N3YB 1JY2N 5APWA 3I5CA 2A45I 5KTBA 3B5NC 2R5DA 3B5NB 4LGDE 1JTHA 1SVFA 3CL3D 2H43A 5APYA 4WBAA 3MD0A 1IFIA 2BASA 2NPSD 4WB4A 3HE4B 1N7SA 2PAJA 3EQ2A 2IPPA 5AW9B 3U59A 1JCCA 1HUCA 3P8CD 3A5TA 5AW0B 4JYCA 3VTPC 5AW8B 1LTIC 2YMYA 3B5ND 4JF7A 1KILA 1KFNA 3OAKA 4IFFA 1SLQA 1G2CB 5APQA 4HYTB 3UIAA 1WT6A 2H7HA 2P2UA 1JNMA 1GD2E 5AVRB 1NOHA 3T97A 1LT9A 1YYCA 2WWWA 5CJ0A 3NXSA 1NTZK 2XV5A 1MUUA 2Q5UA 5AVQB 1FOSE 1CSBA 3VYIA 2N1TA 5KLVK 1JY2O 1GDTA 2QM8A 4I6MC 4GIFA 4EIJA 2A45G 2WSEH 2WTYA 4IFDK 2KYVA 4GKGA 1KQLA 1Z56A 5BU5A 3BATA 2J59M 1NTMK 4ZKPA 4O9BA 3H6PA 4C7NB 3IFMA 1LTJA 1GL2C 3GHGC 3M9QA 2FFDB 5AW1B 2Q3IA 4W7YA 1RF0A 1SQVK 1T3JA 5AVVB 1A02F 1DEBA 3M0DA 3P32A 1LWUC 1LWUB 3A3YB 3TK1A 3TNUB 1NO4A 1IFJA 2I1JA 1HBWA 2O1KA 3N7NA 3U1AA 3RK2C 1GL2D 2ZXEB 4XA4A 5CCGA 3RK2B 4I2LC 1LTTC 5APVA 3VP9A 2Z4EA 3HE5A 1KZUB 2E43A 4M3LA 1JTHB 3NFQA 1ZV8A 1NWQA 4OH8B 1DH3A 5AW5B 1QL2A 1WRGA 1N7SC 1N7SB 3G3ZA 1X9VA 3RK2D 3LIDA 3MIWA 2FXMA 4AQRD 1H88A 2N9BA 1NAFA 1KILC 2HYNA 1KILB 1NKNA 2OYHA 2R3CA 3CI9A 1LTBC 4XE5B 1N7SD 3M9HA 4Y99C 1LT9C 1GU5A 2PP6A 1L0LK 1LT9B 2XNXA 4WY4A 1QL1A 3OJAB 2YKPA 1URQA 2QM7A 5CCHA 5AW4B 4EOTA 1KILD 3L4FA 5KJ7C 2N1TC 1FZAA 1ZR4A 2W6BA 1CZQA 3VOPA 2Q7CA 1CW5A 2Z5HA 3M06A 3V4WA 1A02J 1L4AA 3V5BA 1J1EC 3HTKA 1FZEA 3NMDA 2VRSA 5KJ7D 1FJPA 2N1TD 2FKWB 1LTJC 3VMXA 3BVHA 1FZCA 2HG5D 1LTGC 3KPEA 2A45H 1N7LA 1RE4C 3KQGA 1CI6A 1GW4A 4JYBA 1RF0C 3M0DC 1G1JA 2XU6A 3VP8A 5CHXA 1FAVA 2P67A 5AVZB 3HUSA 2O1JA 2KLVA 2M3BA 3NTNA 5CCGC 1MFZA 3RL0C 3A2AA 1VPCA 2GUVA 3RL0B 3WMM0 3HE5B 2W6AA 2R32A 3A7OA 3U1CA 1IFNA 5BU8B 2JJLA 1NH4A 1KFMA 2WSCH 1N73A 3RK3C 1SQXK 1DX7A 1JY3P 5CCGD 3RK3B 3RL0D 1GL2B 2FYUK 1FOSF 2WPSA 1AQ5A 1FU1A 3GHGB 2WT7A 1SQQK 3V2PA 1PFIA 1HWTC 2P1JA 4ZKUA 2C9NY 3CLQA 1T2KC 1YTZI 1X8YA 2POHA 1JY3N 3SWFA 1J1DC 2IFMA 2WPQA 3L36A 1J1DB 4GT1A 2C0WA 4AUWA 3RK3D 1RF1A 1NU1K 2ZFCA 4WY4C 5AVUB 5AVWB 3V4QA 3KYQA 5AVSB 4WY4B 1URQC 2E42A 1JCDA 3HD7A 5CCHC 2I1KA 1L0NK 1GK4A 1SP4A 2R5BA 1T2KD 2C0XA 2J58A 4I1LA 4LLHA 1HTLC 2OARA 1L4AC 4KHXA 1L4AB 2HPCA 4WY4D 5APUA 2YO3A 1W2EA 2XZRA 3PP5A 4B86A 1URQD 5CJ4A 1SQBK 5CCHD 2Q9IA 1MV8A 4LC1A 4C7RA 2GM4A 4W7ZA 2XKMA 5AW7B 3SWYA 1IK9A 1JO5A 2KSJA 5AW3B 1S9KE 1L4AD 4Y99B 3B8EB 1J2JB 2M8RA 3HRNA 2FFDA 4RESB 3L35A 3HUSC 5AW2B 1RE3A 2KOGA 2N1TB 1EQ7A 1AFOA 3P8MC 1T8ZA 1M7LA 1FZFA 3TNUA 1SFCA 3O8ZA 2Z5IA 3M0AA 1JMMA 1J1EB 1SQPK 3H32A 3BRTB 2YKOA 4HH2A 1FZGA 1N73C 4W80A 1LTAC 5APXA 5APSA 1OWAA 1N73B 2H8PD 4N78E 4DZOA 2P7JA 1LTJB 3E1IA 1GW3A 3VMZA 2WPRA 1T3UA 2WT7B 1HVVA 3P7KA 1XTCC 1IJDB 1HJBA 1HH0A 1H89A 1OXZA 1M1JA 3LIEA 2OYIA 1N86A 3M91A 1RF1C 2WSFH 1RF1B 2IFNA 2C9LY 2XDJA 3BRVB 2NPSA 3IR9A 3HD7C 2HODA 1ZLLA 3L37A 1IFDA 3HD7B 3MGNA 1FJKA 3N4XA 3TSIA 3LW5H 1YTZT 1FBMA 1VDFA 1FDMA 2MJZA 3B5NA 5APTA 1HGZA 5AVTB 5KJ7A 1S9KD 2HFED 2HPCB 2GUSA 1IFMA 1G1IA 3OA7A 1ZR2A 3HE4A 2FYZA 1ZN5A 2WITA 3HD7D 4C46A 2OYHC 2OYHB 5AVXB 1RY3A 3V2NA 3R2PA 1G2CA 2KP8A 1XTGB 5AVYB 2FFDC 1LGHB 4N6JA 1H8AA 1URQB 1JUNA 3P8CE 1RE4A 3VMYA 1RE3C 1JOCA 1X79B 3EFGA 2YO2A 1NKZB 3V2QA 2LKMA 4N78D 2L5GB 1SFCC 3KDPB 3II6A 1SFCB 3VN0A 5AW6B 1NTKK 1MZ9A 3HTKB 2W27A 1N2DC 2HLOA 3H32B 3MTUE 4DOJA 1NHLA 1FZCC 1HGVA 1FZCB 1GK6A 1IO4A 3V2RA 1SFCD 1LTSC 4IFMA 2KB7P 2O01H 2CPBA 4C7NA 2YNYA 2JEEA 1CI6B 1E5WA 5CMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N73 C;  1LWU C;  1LTJ C;  2FFD A;  1JY3 O;  3BVH A;  1JY3 N;  1FZC A;  1N73 B;  1LWU B;  2H43 A;  2HPC A;  2OYH C;  2HOD A;  3GHG A;  1LTJ B;  2OYH B;  3E1I A;  1FZA A;  1M1J C;  2A45 H;  3HUS C;  1W2E A;  2OYI C;  1M1J B;  1FZB A;  1RE3 A;  1RE4 C;  1LT9 A;  2OYI B;  1JY2 P;  2HLO A;  1RF0 C;  1T3U A;  3H32 B;  3HUS B;  1RF1 A;  2Q9I A;  1FZF A;  1N73 A;  1LWU A;  2OYH A;  1LTJ A;  2Z4E A;  2FFD C;  1FZC C;  1JY3 P;  3GHG C;  1FZE A;  2FFD B;  1M1J A;  1JY2 O;  2HPC B;  1FZC B;  1RE4 A;  2HOD B;  3HUS A;  1FZG A;  2OYI A;  1N86 A;  1JY2 N;  1RE3 C;  3GHG B;  3H32 A;  1LT9 C;  1RF0 A;  1RF1 C;  2A45 I;  1LT9 B;  2XNX A;  1RF1 B;  2A45 G; 
#chains in the Genus database with same CATH topology
 2R3S A;  3GMA A;  1GL2 A;  1SQV E;  1OW6 A;  2IX7 C;  3TGU E;  1KYO I;  3D6Y A;  2ZT9 D;  1JY2 P;  3HUS B;  1GTW A;  2D2C D;  1GU4 A;  1KQG B;  4AYC A;  1NTK E;  1Q81 Q;  3M9B A;  3H1I E;  3FGA D;  1SQP J;  2NPS B;  4D6T J;  2HOD B;  3L71 E;  3GF7 A;  3CMA P;  1PP9 D;  2E75 D;  2QJP B;  3OW2 O;  3B5N B;  4LGD E;  4WBA A;  2JP3 A;  5KLI C;  3F89 A;  3FXE A;  2BAS A;  1N7S A;  2PAJ A;  3E1R A;  1JCC A;  2QVA A;  1AVY A;  1LTI C;  1UIX A;  3G6E P;  1RHZ B;  2IYO A;  1KIL A;  3CXH D;  1SLQ A;  1WT6 A;  1QLE D;  3Q1M A;  5AVR B;  1ZRT D;  3T97 A;  1EDL A;  1YYC A;  1YJN P;  1MUU A;  2Q5U A;  2V7Q J;  1CSB A;  3VYI A;  3H1K E;  4OVN F;  2IBZ E;  1SQV D;  3TGU D;  1AJY A;  1NJI Q;  3GG2 A;  4IL6 H;  1KQL A;  1KIL E;  5BU5 A;  1KB9 I;  1FDO A;  1VQ4 P;  3L71 D;  1S5L H;  4OGQ B;  2H88 C;  3MUD C;  1BSN A;  1T3J A;  1DEB A;  3CC4 P;  5KLV E;  3P32 A;  1LWU C;  3L73 J;  3G71 P;  3A3Y B;  1EZV I;  1IFJ A;  2I1J A;  3TF5 A;  5TIS H;  1GL2 D;  1FS0 E;  4XA4 A;  1BGY D;  3L75 G;  4M3L A;  1JTH B;  3AE8 C;  1NTM E;  1DH3 A;  1SS1 A;  3MZW B;  1QL2 A;  4K3A A;  1X9V A;  3RK2 D;  1YIJ P;  3MP7 B;  4KT0 J;  3WUT A;  1NKN A;  3H1K D;  2OYH A;  3PRJ A;  3CI9 A;  2IDB A;  3L70 G;  1N7S D;  3FWN A;  1U57 A;  4Y99 C;  2IBZ D;  1LT9 C;  1L0L K;  2QJY C;  5AW4 B;  1KIL D;  3H1L E;  1FZA A;  2W6B A;  1EZV G;  3H1H D;  1CW5 A;  2Z5H A;  3RK3 E;  3V5B A;  1J1E C;  1PP9 J;  5KLV D;  2AXT E;  2NZ2 A;  2KZJ A;  1LTJ C;  4JQ0 D;  2WQY C;  3IF4 A;  4TLF A;  3M0D C;  2XU6 A;  1NTM D;  4HJG H;  3A0B H;  2JR8 A;  3VP8 A;  5CHX A;  1SQX D;  2P67 A;  3HUS A;  4BXL A;  2FBW C;  3NTN A;  1MFZ A;  5B66 H;  4IOI H;  4UB8 H;  2KIK A;  3G9R A;  3HE5 B;  1NAY A;  3U1C A;  1IFN A;  2E74 B;  3I56 P;  5GTI H;  1N73 A;  3L72 E;  4NPD A;  4U3F D;  1SQQ K;  4Z1M H;  1SQV J;  3V2P A;  3H1L D;  1YTZ I;  1X8Y A;  2POH A;  2FYN C;  1J1D B;  2RH0 A;  3RK3 D;  1NU1 K;  2ZFC A;  5AVW B;  3L71 J;  4WY4 B;  1URQ C;  1PV3 A;  2I1K A;  1L0N K;  2HR3 A;  1SP4 A;  1T2K D;  4ZNC A;  5TJH A;  4I1L A;  1BE3 G;  4D6T G;  1PL5 A;  4KHX A;  2Q3E A;  2P58 A;  2HPC A;  2L91 A;  1VQL P;  1VQ8 P;  1BGY J;  2Q9I A;  4L74 A;  4C7R A;  2GM4 A;  3JC2 2;  4W7Z A;  5AW7 B;  3SWY A;  1IK9 A;  1S9K E;  3CWB E;  4KJM A;  3B8E B;  2M8R A;  1LJ2 A;  1U7M A;  1RE3 A;  2N1T B;  3L72 D;  1EQ7 A;  3H1K J;  4L73 A;  4DJG A;  1AFO A;  3P8M C;  2WSS H;  1JMM A;  1SQB E;  1EXJ A;  3H32 A;  1LTA C;  2Y9Y A;  3RGU A;  4N78 E;  1SQQ G;  2P7J A;  4H0L D;  3H1H J;  1T3U A;  3P7K A;  2O01 N;  1IJD B;  2XND H;  2G3A A;  4RO0 A;  4XFJ A;  1H89 A;  1NU1 G;  1M1J A;  2OYI A;  1N86 A;  2E5T A;  1BCC E;  1L0N G;  2W83 C;  2C9L Y;  2XDJ A;  2E76 D;  3HD7 C;  1IFD A;  3MGN A;  1FJK A;  3N4X A;  3L73 G;  1S5L E;  1VDF A;  1DD3 A;  1KN7 A;  5APT A;  2QE7 H;  1JM0 A;  1SQX J;  1S9K D;  3CWB D;  1X0T A;  2GUS A;  1IFM A;  1ZN5 A;  2LXB A;  5KKZ B;  1BDC A;  5TIS E;  2WPV B;  1YHQ P;  1GMJ A;  4GOF A;  1MKM A;  1KMI Z;  1NTZ E;  4N6J A;  1HF9 A;  4U3F J;  1RE4 A;  3H1L J;  1VQ7 P;  4N78 D;  2AEF A;  1SFC C;  2B87 B;  5AW6 B;  1NTK K;  2M3E A;  3HTK B;  1NYH A;  4OGQ D;  2HLO A;  2ZT9 C;  4DOJ A;  3KZI H;  2D2C C;  3PTZ A;  1FZC B;  3V2R A;  3H25 A;  1BCC D;  1LTS C;  2KB7 P;  2CPB A;  1CI6 B;  1PP9 G;  5DJU B;  2E75 C;  2BEZ F;  3BAS A;  1D7M A;  3W67 A;  2JDI H;  5BVZ A;  2QEX P;  1PPJ G;  2R5D A;  3RBX A;  3CL3 D;  2H43 A;  1M90 Q;  3L72 J;  3AEA C;  3A0B E;  5KLI B;  3WUV A;  3SWK A;  3EQ2 A;  2IPP A;  5AW9 B;  1NTZ D;  3VTP C;  1LP1 B;  4EDF A;  5B66 E;  2YMY A;  2JKV A;  2G8Y A;  4UB8 E;  1KFN A;  1BSH A;  1AQT A;  1G2C B;  2H7H A;  1SQV G;  1JNM A;  3TGU G;  5GTI E;  1JMB A;  1GD2 E;  3CCR P;  5CJ0 A;  2O01 J;  2WWW A;  3NXS A;  1S2E A;  1NTK G;  3ITK A;  1FOS E;  3H1I G;  1YI2 P;  5C39 A;  2N1T A;  4HKZ H;  5KLV K;  2QM8 A;  4I6M C;  3BCC E;  5K5G B;  2SPZ A;  2WTY A;  3AEF C;  4IFD K;  1FDI A;  4DCK A;  4GKG A;  1N8R Q;  2J59 M;  1NTM K;  4O9B A;  3H6P A;  1GL2 C;  2QJK B;  2FFD B;  3A0H H;  2Q3I A;  1YQ4 C;  2ITA A;  1R8E A;  1LWU B;  3TNU B;  3AE7 C;  3S1K A;  3N7N A;  2UWJ E;  3RK2 C;  5CCG A;  2V4H A;  5L8R J;  4YTP C;  2QSI A;  5APV A;  3VP9 A;  1OW7 A;  4BWN A;  1KB9 H;  4EYY Q;  2E43 A;  3H1K G;  3NFQ A;  1WRG A;  1N7S C;  2IBZ G;  1M8O B;  1K9M Q;  2KSE A;  3MIW A;  2FXM A;  1PZQ A;  2O3J A;  1H88 A;  1NAF A;  1KIL C;  1KQS O;  4UB6 H;  2QA4 P;  2BCC J;  1BCC J;  3BCC D;  3M9H A;  2WSC J;  1LT9 B;  1H0T B;  1R5S A;  3OJA B;  5KLV G;  3L4F A;  1CZQ A;  1A02 J;  1L4A A;  3HTK A;  3C8V A;  1VL2 A;  1FZE A;  1YJ9 P;  1NTM G;  1BGY E;  5KJ7 D;  2N1T D;  2P10 A;  3VMX A;  5B5E H;  1FZC A;  2HG5 D;  4WWI A;  3KPE A;  2A45 H;  1PGJ A;  3KQG A;  1CI6 A;  3VMA A;  4JYB A;  3CX5 I;  1NTZ J;  2KK7 A;  1G1J A;  2K9J B;  2I8D A;  1KV4 A;  2O1J A;  1AV1 A;  5EFW B;  2FYU D;  3A2A A;  2GUV A;  3FXD A;  1VQM P;  3CCL P;  5DJT B;  3CC7 P;  3A7O A;  2WSC H;  3H1H E;  3RK3 C;  5CCG D;  3RL0 D;  3Q2Y A;  1FU1 A;  3GHG B;  2WT7 A;  2P1J A;  3V6I A;  1ZP0 C;  1T2K C;  1JY3 N;  2JWD A;  2IFM A;  2FYN B;  4GT1 A;  3KZI E;  1RF1 A;  4IL6 X;  1YIT P;  2KS1 B;  2NRG A;  2KNC B;  2KZI A;  2R5B A;  4Y28 J;  2C0X A;  4H44 C;  1SQX E;  4LLH A;  1HTL C;  2OAR A;  1R5L A;  3ZDM A;  1W2B O;  3AE6 C;  1W2E A;  4B86 A;  5CJ4 A;  1SQB K;  2A06 D;  2R44 A;  3L72 G;  2CK3 H;  1JO5 A;  2KSJ A;  5AW3 B;  1L4A D;  1USD A;  4U3F E;  2FFD A;  4K35 A;  4PV1 D;  1Q82 Q;  3L35 A;  3HUS C;  3D6Z A;  5KAI E;  1RQU A;  4MN4 C;  1FZF A;  1M7L A;  2W8Z A;  4H0L C;  3TNU A;  3O8Z A;  3BCC J;  3O6Q B;  1SQP K;  2QJP C;  4BRY B;  1N73 C;  3EWK A;  2H8P D;  3AEE C;  1QGK B;  3VMZ A;  2E76 C;  3CCE P;  2YIU B;  1XTC C;  1OXZ A;  1P84 H;  3CWB G;  1VF5 D;  3M91 A;  2WSF H;  3PH0 A;  2NPS A;  2HOD A;  1JEK A;  3HD7 B;  3ABV C;  1YTZ T;  1VQP P;  3A0H E;  1FDM A;  3B5N A;  1VQO P;  4JPZ B;  1SQB G;  1K8A Q;  2FYU J;  1G1I A;  4C46 A;  1OVV A;  1KYO D;  1PIX A;  2M5A B;  1DD4 A;  1KB9 E;  3S9O A;  3H1J E;  2KUB A;  1XTG B;  4OGQ C;  1LGH B;  1DIP A;  1RE3 C;  2Y0D A;  1X79 B;  5M1B A;  2K9J A;  1NKZ B;  1BCC G;  2IYP A;  1SQP G;  1SFC B;  1OW8 A;  1OZH A;  1MZ9 A;  4UB6 E;  2OYO A;  2W27 A;  4PD4 I;  2ZT9 B;  2D2C B;  1KD1 Q;  2YNY A;  5CMZ A;  1VQ5 P;  2KI7 B;  1JY3 O;  3GF3 A;  3GHG A;  2E75 B;  1M1J C;  3CME P;  1IC2 A;  3TYY A;  2OYI C;  1FZB A;  2WSE J;  1K04 A;  3C9I A;  1ZW0 A;  2ZYA A;  1KC8 Q;  5B5E E;  2ZVO B;  1FC2 C;  5KTB A;  5KAF H;  2KNC A;  2YXR B;  1JTH A;  1SVF A;  2K1A A;  5APY A;  1KB9 D;  3H1J D;  1IFI A;  2NPS D;  3L70 D;  4WB4 A;  3HE4 B;  3U59 A;  3A5T A;  5AW0 B;  2RN0 A;  3B5N D;  4H13 B;  4JF7 A;  3OAK A;  2BCC E;  5APQ A;  1EZV D;  4HYT B;  3UIA A;  1L0L E;  5AVQ B;  3G4S P;  1QX8 A;  1JY2 O;  1ZOY C;  3JCU H;  2ZYG A;  4EIJ A;  1QEX A;  2WSE H;  3O6Q A;  2KYV A;  3FX0 A;  3Q3D A;  1RH5 B;  4BRY A;  2H89 C;  4C7N B;  3SSU A;  5AW1 B;  2OGU A;  2FY8 A;  2ZXX A;  3MHV A;  1RF0 A;  1SQV K;  5AVV B;  1A02 F;  2ZJS E;  3CXH I;  3TK1 A;  1NO4 A;  1HBW A;  2O1K A;  3U1A A;  2ZXE B;  3RK2 B;  4I2L C;  1IK7 A;  3AE1 C;  4QMA A;  3HE5 A;  1KZU B;  5GTH H;  1MFT A;  1ZV8 A;  1NWQ A;  4OH8 B;  2BCC D;  3BCC G;  1KQF B;  1L0L D;  1N7S B;  3B71 A;  5H2F H;  3LID A;  1M1K Q;  2N9B A;  1Y9B A;  3WUU A;  2RMZ A;  3CCV P;  1KIL B;  2R3C A;  3AED C;  1LTB C;  4XE5 B;  1BE3 D;  2E5Y A;  3SFE C;  2B89 A;  4RJT A;  1AA0 A;  1L0N E;  4WY4 A;  1QL1 A;  1IFP A;  2YKP A;  4ASV A;  2QM7 A;  5CCH A;  5KJ7 C;  2N1T C;  1ZR4 A;  3WU2 H;  1W5C E;  2Q7C A;  1P84 E;  3M06 A;  1USE A;  1KYO H;  2YXQ B;  3RL0 g;  5KAI H;  1E79 H;  1FJP A;  3H1J J;  1Y47 A;  1VQK P;  3L70 J;  2AEJ A;  2JO1 A;  1GW4 A;  2ZAE B;  1FAV A;  5AVZ B;  3AEB C;  3L71 G;  5CCG C;  3RL0 C;  1SQQ D;  2IBZ I;  3IAO A;  1VPC A;  2K88 A;  2JJL A;  3PLN A;  1NH4 A;  1KFM A;  1NU1 D;  1SQX K;  5CBN A;  1DX7 A;  1OVR A;  2JWA A;  1JY3 P;  3CX5 H;  3RK3 B;  1LNQ A;  1BGY G;  2WPS A;  1FOS F;  1L0N D;  1AQ5 A;  3SFD C;  2FXO A;  1PFI A;  1HWT C;  2Y9Z A;  2C9N Y;  3CLQ A;  2E74 D;  3L36 A;  1OFC X;  4YPC A;  1P84 D;  3V4Q A;  3KYQ A;  5AVS B;  1JCD A;  4YXW H;  1GK4 A;  1PPJ E;  2J58 A;  4H44 B;  1L4A C;  2FYU E;  1UII A;  3RBZ A;  4WY4 D;  2YO3 A;  2XZR A;  3PP5 A;  4PV1 C;  5CCH D;  3S4R A;  4LC1 A;  1OIP A;  3H1H G;  3GW6 A;  5KAF E;  2Y0C A;  4OWF A;  2OTK E;  1L0L J;  4Y99 B;  2QJY B;  2PFX A;  4NPF X;  2KOG A;  3GLM A;  1EXI A;  1BDD A;  2B87 A;  2M0B A;  3M0A A;  4H0L B;  1BE3 J;  1J1E B;  4ASW A;  1SQX G;  2QG4 A;  4RKU J;  2YKO A;  1S1C X;  4W80 A;  3L74 E;  5APS A;  1VF5 C;  1N73 B;  1VQN P;  1LTJ B;  3E1I A;  1Q7Y Q;  2WPR A;  2Q6Q A;  2E76 B;  3JCU E;  1HJB A;  1HH0 A;  2A06 E;  1PPJ D;  3LIE A;  1RF1 C;  1ZME C;  4U3F G;  4A7P A;  3CCS P;  1DEE G;  3BRV B;  3L37 A;  3H1L G;  3B4S A;  4I7Z C;  1X22 A;  4H13 D;  4NPE A;  5AVT B;  2HFE D;  2HPC B;  1SQQ J;  2FYZ A;  1KOR A;  2WIT A;  3QWO C;  1LP1 A;  2OYH C;  4L75 A;  1JB0 J;  1QVF O;  4L76 A;  1NTK D;  3V2N A;  1NU1 J;  5GTH E;  3AE5 C;  3H1I D;  1G2C A;  1PGQ A;  2QJK C;  2J5U A;  5AVY B;  2FFD C;  3I55 P;  1L0N J;  1URQ B;  3P8C E;  3CC2 P;  5H2F E;  2AXC A;  1JOC A;  3KHU A;  2B9B A;  3EFG A;  3L74 D;  2YO2 A;  4CPG A;  3V2Q A;  2L5G B;  1S5L X;  3II6 A;  3W68 A;  1Q86 Q;  2B88 A;  2N9Y B;  2WSF J;  3H32 B;  2PGD A;  1HGV A;  1WMK A;  1GK6 A;  1IO4 A;  3AE2 C;  3WU2 E;  1E5W A;  3E7K A;  4GOE A;  2V7Q H;  1GZL A;  2CPS A;  3C1L A;  1VQ6 P;  1PGP A;  1KYO E;  2DW3 A;  1M1J B;  3MUD A;  2OYI B;  3H1J G;  1ZXG A;  1LWU A;  2YKQ A;  2WZ7 A;  4PD4 H;  2NPS C;  4PJ0 H;  4N3Y B;  1JY2 N;  5APW A;  4R4M A;  2BEQ D;  3I5C A;  2A45 I;  3B5N C;  2W6J H;  3MD0 A;  4TT3 H;  1HUC A;  3P8C D;  4JYC A;  1OVU A;  5AW8 B;  2WVR A;  2K9Y A;  4IFF A;  4EI2 A;  2GA1 A;  2P2U A;  1NOH A;  1LT9 A;  1H0T A;  3CX5 E;  1NTZ K;  2XV5 A;  1IZN B;  3Q5P A;  3L75 E;  2LXC B;  1GDT A;  4GIF A;  2A45 G;  5CBO A;  1Z56 A;  2K3R A;  3BAT A;  3Q5S A;  4ZKP A;  3PHL A;  3IFM A;  1LTJ A;  3L70 E;  2OTJ P;  3GHG C;  3M9Q A;  4YXD C;  3CCQ P;  1M57 D;  1Y8A A;  3TGU J;  4W7Y A;  2QRX A;  3M0D A;  2BCC G;  1L0L G;  2OQQ A;  1NTK J;  1RQV A;  1EZV E;  1HJ0 A;  1AVO A;  3H1I J;  1M56 D;  1LTT C;  2Z4E A;  3QH9 A;  3KXD A;  3L74 J;  5AW5 B;  5E79 H;  3USS A;  3G3Z A;  3CCJ P;  1QVG O;  3CX5 D;  4AQR D;  3CXH H;  2HYN A;  3L75 D;  2Y0E A;  4H44 D;  2IZ0 A;  1NTZ G;  4GDO A;  3CCU P;  1GU5 A;  2PP6 A;  2XNX A;  2KS1 A;  1URQ A;  4EOT A;  4U7J A;  3VOP A;  1K73 Q;  3CD6 P;  1P84 I;  3V4W A;  2ZYD A;  4ZMD A;  2PRR A;  1Q2N A;  1NVO A;  2OTL P;  3NMD A;  2VRS A;  2FKW B;  2MKV A;  3BVH A;  3AE3 C;  1LTG C;  2YIU C;  3TDK A;  1N7L A;  1RE4 C;  4R4L A;  3EFF K;  1RF0 C;  4WVZ A;  3JSV C;  2YMK A;  5KLV J;  4IL6 E;  2KLV A;  2M3B A;  1LT1 A;  1BE3 E;  1SQP E;  2Q1K A;  4D6T E;  3RL0 B;  3IN6 A;  3WMM 0;  1NGM B;  2W6A A;  3AE4 C;  2E74 C;  2R32 A;  1NTM J;  5BU8 B;  2AEM A;  1GL2 B;  2FYU K;  1T6A A;  1L2P A;  4ZKU A;  3F5H A;  2LR2 A;  3SWF A;  1J1D C;  1EDK A;  2WPQ A;  1S3J A;  2C0W A;  4AUW A;  4WY4 C;  5AVU B;  1SQB D;  3AEG C;  2E42 A;  3HD7 A;  5CCH C;  3R4Y A;  1EDI A;  1EDJ A;  1L4A B;  1SQQ E;  4DT0 A;  5APU A;  4PD4 E;  2RKL A;  4PJ0 E;  1URQ D;  4PV1 B;  1MV8 A;  4JBZ A;  3AE9 C;  2M5A A;  3Q5R A;  2XKM A;  1NU1 E;  3LW5 J;  1SQP D;  4D6T D;  3T97 B;  1J2J B;  3HRN A;  3D71 A;  4RES B;  3K5B A;  5AW2 B;  2K37 A;  3L73 E;  3L75 J;  4GOD A;  1YJW P;  1T8Z A;  1SFC A;  1K05 A;  2Z5I A;  1U7J A;  1OMI A;  3BRT B;  2W90 A;  3D70 A;  4HH2 A;  1FZG A;  2FYU G;  5APX A;  1OWA A;  4DZO A;  1VF5 B;  1PGO A;  1GW3 A;  2WT7 B;  1HVV A;  4H13 C;  1RF1 B;  2IFN A;  1TU3 F;  3IR9 A;  4PD4 D;  1ZLL A;  2AXT H;  3TSI A;  4I7Z B;  3LW5 H;  1FBM A;  2MJZ A;  2QIW A;  3CCM P;  1HGZ A;  5KJ7 A;  1FE6 A;  1ZR2 A;  3OA7 A;  3HE4 A;  3HD7 D;  1VQ9 P;  5KKZ C;  1PP9 E;  3L74 G;  3FWL A;  2WMM A;  3L73 D;  2OYH B;  5AVX B;  1OX3 A;  1RY3 A;  1KTM A;  3R2P A;  1S4X A;  2KP8 A;  3CWB J;  3AEC C;  1YBK A;  2FXP A;  2A06 G;  5E79 E;  1H8A A;  3CPW O;  1JUN A;  3VMY A;  3PJS K;  2LKM A;  3KDP B;  3CXH E;  1S72 P;  3VN0 A;  1YQ3 C;  1N2D C;  1SQB J;  2KLU A;  1ZRT E;  3MTU E;  1NHL A;  1FZC C;  2ZVN B;  2KXP B;  2IZ1 A;  1SFC D;  1Q90 D;  4IFM A;  2O01 H;  1EC5 A;  4C7N A;  2JEE A;  4HB1 A; 
#chains in the Genus database with same CATH homology
 1JY3 O;  1GL2 A;  1GZL A;  2CPS A;  2IX7 C;  3GHG A;  1M1J C;  3BAS A;  1IC2 A;  3TYY A;  2OYI C;  1M1J B;  1FZB A;  3MUD A;  2OYI B;  1JY2 P;  3HUS B;  1GTW A;  1GU4 A;  4AYC A;  1LWU A;  2YKQ A;  5BVZ A;  2WZ7 A;  3M9B A;  2NPS C;  3C9I A;  2NPS B;  2HOD B;  4N3Y B;  1JY2 N;  5APW A;  3I5C A;  2A45 I;  5KTB A;  3B5N C;  2R5D A;  3B5N B;  4LGD E;  1JTH A;  1SVF A;  3CL3 D;  2H43 A;  5APY A;  4WBA A;  3MD0 A;  1IFI A;  2BAS A;  2NPS D;  4WB4 A;  3HE4 B;  1N7S A;  2PAJ A;  3EQ2 A;  2IPP A;  5AW9 B;  3U59 A;  1JCC A;  1HUC A;  3P8C D;  3A5T A;  5AW0 B;  4JYC A;  3VTP C;  5AW8 B;  1LTI C;  2YMY A;  3B5N D;  4JF7 A;  1KIL A;  1KFN A;  3OAK A;  4IFF A;  1SLQ A;  1G2C B;  5APQ A;  4HYT B;  3UIA A;  1WT6 A;  2H7H A;  2P2U A;  1JNM A;  1GD2 E;  5AVR B;  1NOH A;  3T97 A;  1LT9 A;  1YYC A;  2WWW A;  5CJ0 A;  3NXS A;  1NTZ K;  2XV5 A;  1MUU A;  2Q5U A;  5AVQ B;  1FOS E;  1CSB A;  3VYI A;  2N1T A;  5KLV K;  1JY2 O;  1GDT A;  2QM8 A;  4I6M C;  4GIF A;  4EIJ A;  2A45 G;  2WSE H;  2WTY A;  4IFD K;  2KYV A;  4GKG A;  1KQL A;  1Z56 A;  5BU5 A;  3BAT A;  2J59 M;  1NTM K;  4ZKP A;  4O9B A;  3H6P A;  4C7N B;  3IFM A;  1LTJ A;  1GL2 C;  3GHG C;  3M9Q A;  2FFD B;  5AW1 B;  2Q3I A;  4W7Y A;  1RF0 A;  1SQV K;  1T3J A;  5AVV B;  1A02 F;  1DEB A;  3M0D A;  3P32 A;  1LWU C;  1LWU B;  3A3Y B;  3TK1 A;  3TNU B;  1NO4 A;  1IFJ A;  2I1J A;  1HBW A;  2O1K A;  3N7N A;  3U1A A;  3RK2 C;  1GL2 D;  2ZXE B;  4XA4 A;  5CCG A;  3RK2 B;  4I2L C;  1LTT C;  5APV A;  3VP9 A;  2Z4E A;  3HE5 A;  1KZU B;  2E43 A;  4M3L A;  1JTH B;  3NFQ A;  1ZV8 A;  1NWQ A;  4OH8 B;  1DH3 A;  5AW5 B;  1QL2 A;  1WRG A;  1N7S C;  1N7S B;  3G3Z A;  1X9V A;  3RK2 D;  3LID A;  3MIW A;  2FXM A;  4AQR D;  1H88 A;  2N9B A;  1NAF A;  1KIL C;  2HYN A;  1KIL B;  1NKN A;  2OYH A;  2R3C A;  3CI9 A;  1LTB C;  4XE5 B;  1N7S D;  3M9H A;  4Y99 C;  1LT9 C;  1GU5 A;  2PP6 A;  1L0L K;  1LT9 B;  2XNX A;  4WY4 A;  1QL1 A;  3OJA B;  2YKP A;  1URQ A;  2QM7 A;  5CCH A;  5AW4 B;  4EOT A;  1KIL D;  3L4F A;  5KJ7 C;  2N1T C;  1FZA A;  1ZR4 A;  2W6B A;  1CZQ A;  3VOP A;  2Q7C A;  1CW5 A;  2Z5H A;  3M06 A;  3V4W A;  1A02 J;  1L4A A;  3V5B A;  1J1E C;  3HTK A;  1FZE A;  3NMD A;  2VRS A;  5KJ7 D;  1FJP A;  2N1T D;  2FKW B;  1LTJ C;  3VMX A;  3BVH A;  1FZC A;  2HG5 D;  1LTG C;  3KPE A;  2A45 H;  1N7L A;  1RE4 C;  3KQG A;  1CI6 A;  1GW4 A;  4JYB A;  1RF0 C;  3M0D C;  1G1J A;  2XU6 A;  3VP8 A;  5CHX A;  1FAV A;  2P67 A;  5AVZ B;  3HUS A;  2O1J A;  2KLV A;  2M3B A;  3NTN A;  5CCG C;  1MFZ A;  3RL0 C;  3A2A A;  1VPC A;  2GUV A;  3RL0 B;  3WMM 0;  3HE5 B;  2W6A A;  2R32 A;  3A7O A;  3U1C A;  1IFN A;  5BU8 B;  2JJL A;  1NH4 A;  1KFM A;  2WSC H;  1N73 A;  3RK3 C;  1SQX K;  1DX7 A;  1JY3 P;  5CCG D;  3RK3 B;  3RL0 D;  1GL2 B;  2FYU K;  1FOS F;  2WPS A;  1AQ5 A;  1FU1 A;  3GHG B;  2WT7 A;  1SQQ K;  3V2P A;  1PFI A;  1HWT C;  2P1J A;  4ZKU A;  2C9N Y;  3CLQ A;  1T2K C;  1YTZ I;  1X8Y A;  2POH A;  1JY3 N;  3SWF A;  1J1D C;  2IFM A;  2WPQ A;  3L36 A;  1J1D B;  4GT1 A;  2C0W A;  4AUW A;  3RK3 D;  1RF1 A;  1NU1 K;  2ZFC A;  4WY4 C;  5AVU B;  5AVW B;  3V4Q A;  3KYQ A;  5AVS B;  4WY4 B;  1URQ C;  2E42 A;  1JCD A;  3HD7 A;  5CCH C;  2I1K A;  1L0N K;  1GK4 A;  1SP4 A;  2R5B A;  1T2K D;  2C0X A;  2J58 A;  4I1L A;  4LLH A;  1HTL C;  2OAR A;  1L4A C;  4KHX A;  1L4A B;  2HPC A;  4WY4 D;  5APU A;  2YO3 A;  1W2E A;  2XZR A;  3PP5 A;  4B86 A;  1URQ D;  5CJ4 A;  1SQB K;  5CCH D;  2Q9I A;  1MV8 A;  4LC1 A;  4C7R A;  2GM4 A;  4W7Z A;  2XKM A;  5AW7 B;  3SWY A;  1IK9 A;  1JO5 A;  2KSJ A;  5AW3 B;  1S9K E;  1L4A D;  4Y99 B;  3B8E B;  1J2J B;  2M8R A;  3HRN A;  2FFD A;  4RES B;  3L35 A;  3HUS C;  5AW2 B;  1RE3 A;  2KOG A;  2N1T B;  1EQ7 A;  1AFO A;  3P8M C;  1T8Z A;  1M7L A;  1FZF A;  3TNU A;  1SFC A;  3O8Z A;  2Z5I A;  3M0A A;  1JMM A;  1J1E B;  1SQP K;  3H32 A;  3BRT B;  2YKO A;  4HH2 A;  1FZG A;  1N73 C;  4W80 A;  1LTA C;  5APX A;  5APS A;  1OWA A;  1N73 B;  2H8P D;  4N78 E;  4DZO A;  2P7J A;  1LTJ B;  3E1I A;  1GW3 A;  3VMZ A;  2WPR A;  1T3U A;  2WT7 B;  1HVV A;  3P7K A;  1XTC C;  1IJD B;  1HJB A;  1HH0 A;  1H89 A;  1OXZ A;  1M1J A;  3LIE A;  2OYI A;  1N86 A;  3M91 A;  1RF1 C;  2WSF H;  1RF1 B;  2IFN A;  2C9L Y;  2XDJ A;  3BRV B;  2NPS A;  3IR9 A;  3HD7 C;  2HOD A;  1ZLL A;  3L37 A;  1IFD A;  3HD7 B;  3MGN A;  1FJK A;  3N4X A;  3TSI A;  3LW5 H;  1YTZ T;  1FBM A;  1VDF A;  1FDM A;  2MJZ A;  3B5N A;  5APT A;  1HGZ A;  5AVT B;  5KJ7 A;  1S9K D;  2HFE D;  2HPC B;  2GUS A;  1IFM A;  1G1I A;  3OA7 A;  1ZR2 A;  3HE4 A;  2FYZ A;  1ZN5 A;  2WIT A;  3HD7 D;  4C46 A;  2OYH C;  2OYH B;  5AVX B;  1RY3 A;  3V2N A;  3R2P A;  1G2C A;  2KP8 A;  1XTG B;  5AVY B;  2FFD C;  1LGH B;  4N6J A;  1H8A A;  1URQ B;  1JUN A;  3P8C E;  1RE4 A;  3VMY A;  1RE3 C;  1JOC A;  1X79 B;  3EFG A;  2YO2 A;  1NKZ B;  3V2Q A;  2LKM A;  4N78 D;  2L5G B;  1SFC C;  3KDP B;  3II6 A;  1SFC B;  3VN0 A;  5AW6 B;  1NTK K;  1MZ9 A;  3HTK B;  2W27 A;  1N2D C;  2HLO A;  3H32 B;  3MTU E;  4DOJ A;  1NHL A;  1FZC C;  1HGV A;  1FZC B;  1GK6 A;  1IO4 A;  3V2R A;  1SFC D;  1LTS C;  4IFM A;  2KB7 P;  2O01 H;  2CPB A;  4C7N A;  2YNY A;  2JEE A;  1CI6 B;  1E5W A;  5CMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...