5GTHH

Native xfel structure of photosystem ii (dark dataset)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1
total genus 14
structure length 64
sequence length 64
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5gthH01
5TISH 4IL6H 5GTIH 5KAFH 2AXTH 4PJ0H 3A0BH 5B66H 5E79H 3JCUH 4UB8H 3WU2H 5GTHH 3KZIH 5H2FH 5B5EH 3A0HH 4UB6H 5KAIH 1S5LH
chains in the Genus database with same CATH superfamily
1USDA 1VDFA 4KT0J 3A7OA 2RMZA 2Y0CA 3R2PA 4U3FE 4D6TD 4PV1D 1FC2C 1NKNA 3H1ID 3WUVA 3L71D 1K05A 3O6QA 1DD3A 1PGJA 1WMKA 2W83C 3H1IG 3VTPC 2LXBA 2WPQA 1HH0A 1ZR4A 2WSSH 1QX8A 3M9HA 2KS1A 2XKMA 3G4SP 2BCCG 1KZUB 1N8RQ 2WSCJ 3KDPB 5AVYB 1KQLA 4L76A 1K04A 1HGZA 3H1HE 4M3LA 2ZXXA 3AE1C 2I1KA 2JKVA 2RKLA 3HUSC 1KYOH 3JCUH 3N4XA 3BCCG 4OGQB 2OYHC 1LTIC 1LWUC 4O9BA 5KLVD 1T2KC 1FDOA 2HPCB 3I55P 2W90A 1JB0J 1VF5B 2IYOA 2ZT9B 1N7SB 3OAKA 1GL2A 4NPFX 1SFCB 4Y99B 5APQA 5L8RJ 3TK1A 3VOPA 4OVNF 2NRGA 2OTKE 2JDIH 5AVQB 5TISH 2WTYA 2AEMA 3L70G 2P7JA 3CXHI 4GODA 2RH0A 4UB6E 1NTMJ 2A45I 2P2UA 1G1JA 1RF1B 3V2RA 2L91A 1OXZA 1A02F 2A06E 1Q82Q 2YNYA 4I2LC 1EZVI 2P58A 1H0TB 2OTLP 1J1DB 3D6YA 1LTBC 2FYUE 2WZ7A 1VQ7P 2K9YA 1CSBA 3HD7B 5KAIE 5KAFH 1Z56A 4XA4A 1P84I 1Q81Q 5TISE 2E5YA 1GL2D 4N6JA 2LR2A 1J2JB 1FJPA 4XE5B 1YI2P 2ITAA 3O8ZA 5DJTB 2R3SA 5KKZB 3JSVC 1IO4A 1M57D 1BSHA 1L0LK 2E75D 3TGUE 4EOTA 3L75D 2VRSA 5KTBA 3H1LG 5AW6B 1AFOA 1FS0E 1BCCG 3ABVC 1U7JA 1FZAA 3VMXA 2LKMA 2M0BA 2FFDA 1NTMG 1SS1A 1SQPG 4ASWA 1NTKK 1Q7YQ 3H1LE 4UB8H 5AW8B 1SQPD 2OYIA 1L2PA 1QGKB 1LNQA 2YO3A 3TDKA 2P10A 1SQXE 2KP8A 4NPEA 1SFCA 1PP9J 4HH2A 2KZIA 3VP9A 5GTHE 5KJ7C 1OVVA 3CPWO 2E74D 2UWJE 1NTMK 1KB9E 2C0XA 1LT9C 2WPSA 1IFIA 3L74G 2XU6A 4HJGH 3VMZA 2E76D 4PD4I 2Q6QA 3L72G 5APTA 2E42A 4N3YB 3T97B 1NOHA 2E74C 2HYNA 3F89A 1X22A 2QG4A 3B71A 2IBZE 3AE9C 3H1HG 5AVRB 1KILD 2JEEA 2OYOA 4GOEA 1M8OB 3L74E 5AVTB 2K88A 1K8AQ 1MV8A 2AEJA 3MUDC 5H2FH 1YJNP 1FZCC 2OYIB 4K3AA 1URQD 2HFED 2OQQA 2H8PD 1L4AD 1NH4A 3H1JD 3V2QA 1CI6B 1G2CA 3RL0g 1ZV8A 4JQ0D 3RL0C 1KORA 3D6ZA 1GU5A 5CJ0A 1NTKD 3LW5H 3OW2O 1YTZT 2PRRA 2YIUB 1PIXA 3OA7A 2DW3A 4EIJA 1IC2A 3AEFC 5APWA 1RE3C 2N1TC 1JEKA 3MD0A 1LTJC 1GDTA 3H1KE 4IL6H 1URQA 1MZ9A 3MP7B 1LTGC 3AE5C 4L73A 1IFPA 2KNCB 3AEEC 3PRJA 4C46A 1SQVG 5GTIE 4QMAA 1NJIQ 1N7SC 3A5TA 1PGOA 1M1JB 1SQXK 1ZW0A 3FWNA 3L75E 1M90Q 1PV3A 3CCMP 1S72P 3H1KJ 2AXCA 5K5GB 2E5TA 3AEDC 1SQVE 1IFDA 3E1RA 3P8CD 3HUSB 2QRXA 1Y9BA 3B5NA 3GLMA 3MZWB 2FBWC 3NFQA 3TNUA 3H1JE 2Z5HA 1PGQA 3SSUA 1HJBA 2A45H 1OX3A 4TT3H 2SPZA 1YBKA 3HD7C 4H0LD 4D6TG 2H7HA 3MIWA 2IDBA 3FX0A 4IOIH 3GF3A 1PP9E 3L71G 4UB8E 1EZVG 5AW1B 5AVXB 3L70E 3V4WA 3WU2E 1KB9H 4DZOA 1JY2P 3B4SA 1S5LE 1J1EB 2Z4EA 3RL0B 5TJHA 2POHA 2LXCB 3AE2C 1EQ7A 2OYHA 2Z5IA 4IFDK 3CL3D 1DIPA 1OW7A 1L0LG 4GOFA 4KHXA 3AECC 1Y8AA 1XTCC 1P84D 2L5GB 3RK2C 1SFCC 3VN0A 1AV1A 1NTME 2KK7A 2YMYA 3GMAA 3AE3C 1L0NK 5KLIB 2WT7A 1HWTC 2M8RA 1JO5A 5KAIH 2QA4P 4JBZA 2E43A 1JCCA 2WITA 1GTWA 2O01J 3D70A 2M5AA 3RK2D 3CCEP 2IFNA 2HR3A 3H1JJ 1FJKA 1NAYA 4GDOA 4GIFA 3CX5E 1YJ9P 1VF5D 2ZT9D 3Q2YA 1T2KD 1FZCA 3CD6P 1RE4A 5AW0B 1ZP0C 1QVFO 1Y47A 4LGDE 3CCLP 1OVRA 4WY4A 1N73C 4U7JA 1WT6A 3WUTA 2V7QJ 1RY3A 4WY4C 3WUUA 5EFWB 5CCHC 1L0LE 3CCRP 1ZR2A 1OW8A 1BSNA 1X0TA 1H8AA 1LWUA 2O01N 1JNMA 2IZ1A 2KI7B 3PTZA 4ASVA 5CCGD 4H13C 1SQBE 3JC22 5AVUB 3CX5D 2V7QH 3NXSA 3C8VA 2WT7B 2FY8A 3F5HA 1KYOI 1FU1A 2FYUD 3GHGB 3MHVA 3P7KA 2ZYGA 2PP6A 5KLIC 1YQ3C 5AVZB 5KJ7A 1DX7A 2QE7H 4HB1A 1E79H 3AEAC 2BASA 2A06D 1EDKA 2FYNC 3BCCE 3HD7D 3LIDA 4I7ZB 2A06G 3A0HH 3PJSK 1AA0A 2AEFA 1BCCD 5M1BA 1NTMD 2NPSD 4W80A 3VP8A 4A7PA 1S5LX 1U57A 1CZQA 3M0AA 2QJYC 3ITKA 2P67A 3IR9A 1ZOYC 3KZIH 2E75B 4IL6X 2FYNB 2I1JA 3KQGA 1X8YA 2R5DA 3H25A 1H89A 1NO4A 2I8DA 1E5WA 1BE3E 3CLQA 3GHGC 3SWKA 2BEQD 1SVFA 4WB4A 5E79E 5B66H 3WU2H 1JOCA 4H13B 1R5LA 2W6AA 3IF4A 4OGQC 1DH3A 3PH0A 1NYHA 4BRYB 3VYIA 4DOJA 3A0BH 2R5BA 2IPPA 1P84H 1KD1Q 1EDLA 2M3EA 3BRTB 1M1JA 3E7KA 3MUDA 4R4MA 1RF0A 4U3FJ 1H88A 2OTJP 1IK7A 1JTHA 1JY3N 1OMIA 3M06A 5CCGC 1JM0A 1EXJA 4C7RA 2D2CB 1JY3O 2HLOA 4L75A 1YJWP 1K73Q 3SWFA 2E76B 1VQMP 5AW7B 3BRVB 1PP9G 3L71E 3L71J 1NTKJ 1RH5B 1DEEG 3AE6C 5AW4B 5AW3B 2ZJSE 3ZDMA 4D6TE 2KYVA 3HE4B 1LGHB 2ZYDA 3CWBE 3L37A 1KILB 1JMBA 2FYZA 2N1TA 5H2FE 4WVZA 4K35A 2XV5A 1SP4A 3H1KD 1KB9I 1JTHB 2KXPB 1NU1E 1GL2C 1IZNB 1WRGA 4PV1C 1Q86Q 1L4AB 2GUSA 2MJZA 3L73G 1VQKP 1YYCA 1T6AA 4EDFA 1YTZI 3P32A 1KTMA 2KLUA 5BVZA 4ZMDA 3EWKA 4EYYQ 1NWQA 2BCCD 2IBZI 4W7YA 1KQSO 1FE6A 1NTKE 2Q1KA 4PD4H 1VQNP 2N1TD 1L0NG 2P1JA 3KXDA 1YITP 1A02J 3CC7P 1QEXA 1SQBG 1LP1B 1OVUA 1KILE 1PP9D 2KOGA 2QSIA 2WMMA 2K37A 3A0HE 2K1AA 1N73A 3TSIA 5CMZA 5KLVG 3CCUP 3L4FA 4BRYA 3M9BA 5AW5B 3CX5H 1KV4A 3W67A 1IFMA 1S1CX 3KZIE 3FWLA 4H44D 5APVA 2IBZG 2Y0DA 2ZVOB 1W5CE 3H1KG 2R32A 1OWAA 2WPRA 1BGYE 1FBMA 1RQUA 1GZLA 1SQXG 1GMJA 1GK6A 2K9JB 2ZT9C 3V2NA 4YXWH 5BU5A 4Z1MH 1SQXD 2B88A 2WSEH 1KYOE 3JCUE 2IX7C 3L75J 3QWOC 1RE3A 4HKZH 4I6MC 4OWFA 3M0DA 4H0LC 3CCQP 1TU3F 1BE3G 2HODA 4H0LB 3V2PA 3CWBD 1NVOA 1LWUB 1SQBD 4JPZB 1NTZD 1ZRTE 3CC2P 1S5LH 1L0LD 2NPSC 2V4HA 2Y9YA 1JCDA 1NTZG 3G3ZA 3GHGA 3NTNA 4WY4B 2YMKA 5CCHA 4ZNCA 1VQ8P 3FXDA 4N78D 2C9LY 2O1KA 4RJTA 2KSJA 5CJ4A 1YIJP 2QJKC 3QH9A 3HD7A 4NPDA 4AYCA 2N9BA 4B86A 2CPBA 3C1LA 3KHUA 1H0TA 2N9YB 2XZRA 5KJ7D 1NAFA 3H1IE 1GK4A 1MFZA 5GTHH 1AQ5A 1QL1A 3MGNA 3H32A 1HJ0A 2QJKB 3EFFK 1DEBA 3SWYA 5CCGA 1BE3D 4C7NA 3RGUA 1YHQP 1EXIA 3L72J 1LT1A 2QJYB 5APYA 3RK2B 4UB6H 1FZFA 5KLVJ 3CC4P 1HGVA 1W2BO 1LTSC 2E75C 3AE4C 3IAOA 4RO0A 2W6JH 2HODB 2BCCJ 1AJYA 2CPSA 4BWNA 2OARA 1Q90D 1MKMA 1CW5A 3CCSP 1SQBK 2W6BA 1BCCE 5CCHD 1SQPK 2YKPA 1AVYA 4Y99C 1KQFB 3V5BA 1NKZB 1NU1J 3IFMA 3L70D 1FAVA 3H6PA 1SQPE 3BVHA 1VQ5P 4YXDC 3H1LD 3CCJP 4KJMA 1N7SA 1S4XA 2ZYAA 4MN4C 1RF0C 5APXA 5APUA 2JO1A 3B5NB 1VQOP 3HUSA 1OFCX 4ZKPA 3TGUG 2FYUK 1EZVE 5AW2B 3CMAP 3SFDC 1PFIA 1VQ4P 5AVVB 3TGUD 3L70J 3O6QB 2BEZF 2JR8A 1LP1A 4DJGA 1FZEA 2RN0A 2KIKA 2NPSB 2QM8A 3AEGC 3E1IA 5AW9B 1L0NE 3RK3B 2OGUA 2O1JA 3TNUB 1BDCA 4HYTB 2KNCA 2Q9IA 2KS1B 1QL2A 2ZVNB 4U3FD 5GTIH 2B87A 2WVRA 2H43A 1VQ9P 3L73D 1GD2E 3GG2A 1HTLC 2WSCH 2A45G 4XFJA 1S2EA 1URQC 1SQQK 2W27A 1HVVA 4L74A 3U1AA 5KLVK 4PD4E 4I1LA 2H89C 2W8ZA 2KZJA 4H13D 1RF1C 2YKOA 1X79B 1DD4A 3CX5I 3K5BA 3AEBC 4WWIA 1P84E 1HUCA 1FOSF 2B9BA 1QVGO 1SQPJ 1ZLLA 2WSFJ 3H1IJ 3HE4A 2K9JA 1USEA 1SQQG 1PPJD 2YKQA 3VMAA 3EQ2A 3VMYA 1BCCJ 3RBZA 3V6IA 2JJLA 2WSFH 3II6A 2D2CD 4R4LA 2E76C 2XNDH 3BCCJ 2KLVA 1SQQE 3L74D 1SQVJ 1EZVD 2FYUJ 1QLED 2R44A 3RK3C 2Q5UA 2PFXA 1RE4C 3L72E 4GKGA 2IYPA 2M3BA 1AQTA 2NZ2A 2WSEJ 3H1HD 2O01H 3I5CA 4LC1A 2XDJA 1LTTC 4CPGA 4DT0A 3H1HJ 3D71A 4YPCA 3SFEC 1LTJA 4PJ0E 4PV1B 1SQVD 3P8CE 2K3RA 1OZHA 3CXHD 3T97A 3L74J 3UIAA 3L36A 3L35A 5CBNA 3H1JG 2Q3EA 2JP3A 2ZFCA 1FDIA 2GM4A 1SQQJ 1PL5A 3RK3E 3HE5B 4BXLA 1NGMB 2N1TB 2FFDB 1BDDA 1KILA 2KSEA 1EDJA 3TYYA 2JWAA 4WBAA 5CBOA 2J5UA 3M0DC 1N7LA 4OH8B 3G71P 4OGQD 2J59M 1S3JA 2WQYC 1VQPP 1L0NJ 1JY2O 3GF7A 1IFJA 1JY3P 2GUVA 4AUWA 4H44B 2QVAA 2QJPB 1N7SD 1OW6A 2NPSA 3CWBG 1SFCD 1S9KE 1J1EC 5DJUB 1W2EA 2CK3H 1Q2NA 2FXMA 3L73J 3L73E 2IFMA 3BATA 3W68A 1GW3A 3CMEP 4EI2A 1PZQA 4IL6E 1R8EA 5C39A 2HG5D 3Q5SA 3LIEA 4W7ZA 1FZGA 1IK9A 1R5SA 1FZBA 3R4YA 4N78E 1N86A 3M9QA 3TGUJ 4DCKA 3Q5PA 2IBZD 3A2AA 1X9VA 2YO2A 2KUBA 3FXEA 2G3AA 5APSA 4D6TJ 2PGDA 3G6EP 3OJAB 1LJ2A 4IFFA 1NTZK 4WY4D 1KFMA 1LT9B 2B89A 1EC5A 1EDIA 1KB9D 3CI9A 1GL2B 3H1LJ 2WPVB 2ZXEB 1RF1A 1IJDB 1IFNA 1KYOD 5AVWB 3S9OA 1KC8Q 1JMMA 1ZXGA 1M7LA 3LW5J 1YQ4C 3B8EB 3U59A 1VQ6P 3C9IA 1SLQA 3CXHE 4C7NB 1K9MQ 3FGAD 2OYHB 1M56D 4RESB 1VQLP 3AE7C 3H32B 4LLHA 1VPCA 2FKWB 3KYQA 1LTAC 3WMM0 1LT9A 2HPCA 1SQVK 3L72D 3GW6A 2KB7P 2G8YA 1BE3J 3MTUE 3RBXA 1JUNA 3PLNA 3PP5A 3KPEA 3L75G 1KMIZ 1KN7A 3S1KA 1ZN5A 3Q3DA 1FOSE 1NHLA 2OYIC 4RKUJ 2E74B 1FZCB 2QJPC 3AE8C 5E79H 2M5AB 3BASA 4ZKUA 3EFGA 4JYBA 1G1IA 1NU1D 4H44C 4TLFA 3RL0D 3NMDA 1UIXA 4U3FG 1M1JC 2H88C 2R3CA 3B5ND 1NTZE 1ZRTD 3HE5A 1KILC 2QM7A 3U1CA 2FYUG 3V4QA 1RQVA 1SQBJ 2AXTH 1URQB 1MFTA 2J58A 4JYCA 5AVSB 3TF5A 1ZMEC 3N7NA 2FXPA 2C9NY 1XTGB 2ZAEB 5B5EH 5KAFE 5B66E 3Q1MA 2FFDC 1NU1K 3RK3D 4YTPC 3IN6A 1T3UA 1LTJB 1FDMA 3M91A 3USSA 3I56P 1HF9A 1L0ND 2O3JA 1SQXJ 5BU8B 1VL2A 2Q7CA 1JY2N 1RHZB 1BGYD 2D2CC 1KFNA 4Y28J 5KLVE 1CI6A 1G2CB 4AQRD 2QEXP 5KKZC 1N73B 4PJ0H 2PAJA 3Q5RA 1GW4A 1NU1G 5CHXA 1SQQD 1BGYJ 2AXTE 2JWDA 3B5NC 3PHLA 2YXQB 3HTKA 1NTKG 3A3YB 3HTKB 1UIIA 2FXOA 5B5EE 1T8ZA 2GA1A 1J1DC 1U7MA 2IZ0A 2MKVA 3CCVP 3HRNA 1M1KQ 2Y9ZA 1L0LJ 1N2DC 2C0WA 1OIPA 1NTZJ 2Y0EA 1S9KD 4JF7A 1T3JA 2XNXA 2BCCE 2WWWA 3S4RA 3CWBJ 3CXHH 2YXRB 1PPJE 4GT1A 4IFMA 1MUUA 3G9RA 1KQGB 4PD4D 1L4AC 4I7ZC 3A0BE 1BGYG 1D7MA 2Q3IA 1L4AA 3BCCD 1AVOA 2QIWA 2YIUC 1HBWA 1GU4A 1PGPA 3P8MC 1VF5C 1PPJG 2B87B
chains in the Genus database with same CATH topology
5TISH 4IL6H 5GTIH 5KAFH 2AXTH 4PJ0H 3A0BH 5B66H 5E79H 3JCUH 4UB8H 3WU2H 5GTHH 3KZIH 5H2FH 5B5EH 3A0HH 4UB6H 5KAIH 1S5LH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS H;  4IL6 H;  5GTI H;  5KAF H;  2AXT H;  4PJ0 H;  3A0B H;  5B66 H;  5E79 H;  3JCU H;  4UB8 H;  3WU2 H;  5GTH H;  3KZI H;  5H2F H;  5B5E H;  3A0H H;  4UB6 H;  5KAI H;  1S5L H; 
#chains in the Genus database with same CATH topology
 1USD A;  1VDF A;  4KT0 J;  3A7O A;  2RMZ A;  2Y0C A;  3R2P A;  4U3F E;  4D6T D;  4PV1 D;  1FC2 C;  1NKN A;  3H1I D;  3WUV A;  3L71 D;  1K05 A;  3O6Q A;  1DD3 A;  1PGJ A;  1WMK A;  2W83 C;  3H1I G;  3VTP C;  2LXB A;  2WPQ A;  1HH0 A;  1ZR4 A;  2WSS H;  1QX8 A;  3M9H A;  2KS1 A;  2XKM A;  3G4S P;  2BCC G;  1KZU B;  1N8R Q;  2WSC J;  3KDP B;  5AVY B;  1KQL A;  4L76 A;  1K04 A;  1HGZ A;  3H1H E;  4M3L A;  2ZXX A;  3AE1 C;  2I1K A;  2JKV A;  2RKL A;  3HUS C;  1KYO H;  3JCU H;  3N4X A;  3BCC G;  4OGQ B;  2OYH C;  1LTI C;  1LWU C;  4O9B A;  5KLV D;  1T2K C;  1FDO A;  2HPC B;  3I55 P;  2W90 A;  1JB0 J;  1VF5 B;  2IYO A;  2ZT9 B;  1N7S B;  3OAK A;  1GL2 A;  4NPF X;  1SFC B;  4Y99 B;  5APQ A;  5L8R J;  3TK1 A;  3VOP A;  4OVN F;  2NRG A;  2OTK E;  2JDI H;  5AVQ B;  5TIS H;  2WTY A;  2AEM A;  3L70 G;  2P7J A;  3CXH I;  4GOD A;  2RH0 A;  4UB6 E;  1NTM J;  2A45 I;  2P2U A;  1G1J A;  1RF1 B;  3V2R A;  2L91 A;  1OXZ A;  1A02 F;  2A06 E;  1Q82 Q;  2YNY A;  4I2L C;  1EZV I;  2P58 A;  1H0T B;  2OTL P;  1J1D B;  3D6Y A;  1LTB C;  2FYU E;  2WZ7 A;  1VQ7 P;  2K9Y A;  1CSB A;  3HD7 B;  5KAI E;  5KAF H;  1Z56 A;  4XA4 A;  1P84 I;  1Q81 Q;  5TIS E;  2E5Y A;  1GL2 D;  4N6J A;  2LR2 A;  1J2J B;  1FJP A;  4XE5 B;  1YI2 P;  2ITA A;  3O8Z A;  5DJT B;  2R3S A;  5KKZ B;  3JSV C;  1IO4 A;  1M57 D;  1BSH A;  1L0L K;  2E75 D;  3TGU E;  4EOT A;  3L75 D;  2VRS A;  5KTB A;  3H1L G;  5AW6 B;  1AFO A;  1FS0 E;  1BCC G;  3ABV C;  1U7J A;  1FZA A;  3VMX A;  2LKM A;  2M0B A;  2FFD A;  1NTM G;  1SS1 A;  1SQP G;  4ASW A;  1NTK K;  1Q7Y Q;  3H1L E;  4UB8 H;  5AW8 B;  1SQP D;  2OYI A;  1L2P A;  1QGK B;  1LNQ A;  2YO3 A;  3TDK A;  2P10 A;  1SQX E;  2KP8 A;  4NPE A;  1SFC A;  1PP9 J;  4HH2 A;  2KZI A;  3VP9 A;  5GTH E;  5KJ7 C;  1OVV A;  3CPW O;  2E74 D;  2UWJ E;  1NTM K;  1KB9 E;  2C0X A;  1LT9 C;  2WPS A;  1IFI A;  3L74 G;  2XU6 A;  4HJG H;  3VMZ A;  2E76 D;  4PD4 I;  2Q6Q A;  3L72 G;  5APT A;  2E42 A;  4N3Y B;  3T97 B;  1NOH A;  2E74 C;  2HYN A;  3F89 A;  1X22 A;  2QG4 A;  3B71 A;  2IBZ E;  3AE9 C;  3H1H G;  5AVR B;  1KIL D;  2JEE A;  2OYO A;  4GOE A;  1M8O B;  3L74 E;  5AVT B;  2K88 A;  1K8A Q;  1MV8 A;  2AEJ A;  3MUD C;  5H2F H;  1YJN P;  1FZC C;  2OYI B;  4K3A A;  1URQ D;  2HFE D;  2OQQ A;  2H8P D;  1L4A D;  1NH4 A;  3H1J D;  3V2Q A;  1CI6 B;  1G2C A;  3RL0 g;  1ZV8 A;  4JQ0 D;  3RL0 C;  1KOR A;  3D6Z A;  1GU5 A;  5CJ0 A;  1NTK D;  3LW5 H;  3OW2 O;  1YTZ T;  2PRR A;  2YIU B;  1PIX A;  3OA7 A;  2DW3 A;  4EIJ A;  1IC2 A;  3AEF C;  5APW A;  1RE3 C;  2N1T C;  1JEK A;  3MD0 A;  1LTJ C;  1GDT A;  3H1K E;  4IL6 H;  1URQ A;  1MZ9 A;  3MP7 B;  1LTG C;  3AE5 C;  4L73 A;  1IFP A;  2KNC B;  3AEE C;  3PRJ A;  4C46 A;  1SQV G;  5GTI E;  4QMA A;  1NJI Q;  1N7S C;  3A5T A;  1PGO A;  1M1J B;  1SQX K;  1ZW0 A;  3FWN A;  3L75 E;  1M90 Q;  1PV3 A;  3CCM P;  1S72 P;  3H1K J;  2AXC A;  5K5G B;  2E5T A;  3AED C;  1SQV E;  1IFD A;  3E1R A;  3P8C D;  3HUS B;  2QRX A;  1Y9B A;  3B5N A;  3GLM A;  3MZW B;  2FBW C;  3NFQ A;  3TNU A;  3H1J E;  2Z5H A;  1PGQ A;  3SSU A;  1HJB A;  2A45 H;  1OX3 A;  4TT3 H;  2SPZ A;  1YBK A;  3HD7 C;  4H0L D;  4D6T G;  2H7H A;  3MIW A;  2IDB A;  3FX0 A;  4IOI H;  3GF3 A;  1PP9 E;  3L71 G;  4UB8 E;  1EZV G;  5AW1 B;  5AVX B;  3L70 E;  3V4W A;  3WU2 E;  1KB9 H;  4DZO A;  1JY2 P;  3B4S A;  1S5L E;  1J1E B;  2Z4E A;  3RL0 B;  5TJH A;  2POH A;  2LXC B;  3AE2 C;  1EQ7 A;  2OYH A;  2Z5I A;  4IFD K;  3CL3 D;  1DIP A;  1OW7 A;  1L0L G;  4GOF A;  4KHX A;  3AEC C;  1Y8A A;  1XTC C;  1P84 D;  2L5G B;  3RK2 C;  1SFC C;  3VN0 A;  1AV1 A;  1NTM E;  2KK7 A;  2YMY A;  3GMA A;  3AE3 C;  1L0N K;  5KLI B;  2WT7 A;  1HWT C;  2M8R A;  1JO5 A;  5KAI H;  2QA4 P;  4JBZ A;  2E43 A;  1JCC A;  2WIT A;  1GTW A;  2O01 J;  3D70 A;  2M5A A;  3RK2 D;  3CCE P;  2IFN A;  2HR3 A;  3H1J J;  1FJK A;  1NAY A;  4GDO A;  4GIF A;  3CX5 E;  1YJ9 P;  1VF5 D;  2ZT9 D;  3Q2Y A;  1T2K D;  1FZC A;  3CD6 P;  1RE4 A;  5AW0 B;  1ZP0 C;  1QVF O;  1Y47 A;  4LGD E;  3CCL P;  1OVR A;  4WY4 A;  1N73 C;  4U7J A;  1WT6 A;  3WUT A;  2V7Q J;  1RY3 A;  4WY4 C;  3WUU A;  5EFW B;  5CCH C;  1L0L E;  3CCR P;  1ZR2 A;  1OW8 A;  1BSN A;  1X0T A;  1H8A A;  1LWU A;  2O01 N;  1JNM A;  2IZ1 A;  2KI7 B;  3PTZ A;  4ASV A;  5CCG D;  4H13 C;  1SQB E;  3JC2 2;  5AVU B;  3CX5 D;  2V7Q H;  3NXS A;  3C8V A;  2WT7 B;  2FY8 A;  3F5H A;  1KYO I;  1FU1 A;  2FYU D;  3GHG B;  3MHV A;  3P7K A;  2ZYG A;  2PP6 A;  5KLI C;  1YQ3 C;  5AVZ B;  5KJ7 A;  1DX7 A;  2QE7 H;  4HB1 A;  1E79 H;  3AEA C;  2BAS A;  2A06 D;  1EDK A;  2FYN C;  3BCC E;  3HD7 D;  3LID A;  4I7Z B;  2A06 G;  3A0H H;  3PJS K;  1AA0 A;  2AEF A;  1BCC D;  5M1B A;  1NTM D;  2NPS D;  4W80 A;  3VP8 A;  4A7P A;  1S5L X;  1U57 A;  1CZQ A;  3M0A A;  2QJY C;  3ITK A;  2P67 A;  3IR9 A;  1ZOY C;  3KZI H;  2E75 B;  4IL6 X;  2FYN B;  2I1J A;  3KQG A;  1X8Y A;  2R5D A;  3H25 A;  1H89 A;  1NO4 A;  2I8D A;  1E5W A;  1BE3 E;  3CLQ A;  3GHG C;  3SWK A;  2BEQ D;  1SVF A;  4WB4 A;  5E79 E;  5B66 H;  3WU2 H;  1JOC A;  4H13 B;  1R5L A;  2W6A A;  3IF4 A;  4OGQ C;  1DH3 A;  3PH0 A;  1NYH A;  4BRY B;  3VYI A;  4DOJ A;  3A0B H;  2R5B A;  2IPP A;  1P84 H;  1KD1 Q;  1EDL A;  2M3E A;  3BRT B;  1M1J A;  3E7K A;  3MUD A;  4R4M A;  1RF0 A;  4U3F J;  1H88 A;  2OTJ P;  1IK7 A;  1JTH A;  1JY3 N;  1OMI A;  3M06 A;  5CCG C;  1JM0 A;  1EXJ A;  4C7R A;  2D2C B;  1JY3 O;  2HLO A;  4L75 A;  1YJW P;  1K73 Q;  3SWF A;  2E76 B;  1VQM P;  5AW7 B;  3BRV B;  1PP9 G;  3L71 E;  3L71 J;  1NTK J;  1RH5 B;  1DEE G;  3AE6 C;  5AW4 B;  5AW3 B;  2ZJS E;  3ZDM A;  4D6T E;  2KYV A;  3HE4 B;  1LGH B;  2ZYD A;  3CWB E;  3L37 A;  1KIL B;  1JMB A;  2FYZ A;  2N1T A;  5H2F E;  4WVZ A;  4K35 A;  2XV5 A;  1SP4 A;  3H1K D;  1KB9 I;  1JTH B;  2KXP B;  1NU1 E;  1GL2 C;  1IZN B;  1WRG A;  4PV1 C;  1Q86 Q;  1L4A B;  2GUS A;  2MJZ A;  3L73 G;  1VQK P;  1YYC A;  1T6A A;  4EDF A;  1YTZ I;  3P32 A;  1KTM A;  2KLU A;  5BVZ A;  4ZMD A;  3EWK A;  4EYY Q;  1NWQ A;  2BCC D;  2IBZ I;  4W7Y A;  1KQS O;  1FE6 A;  1NTK E;  2Q1K A;  4PD4 H;  1VQN P;  2N1T D;  1L0N G;  2P1J A;  3KXD A;  1YIT P;  1A02 J;  3CC7 P;  1QEX A;  1SQB G;  1LP1 B;  1OVU A;  1KIL E;  1PP9 D;  2KOG A;  2QSI A;  2WMM A;  2K37 A;  3A0H E;  2K1A A;  1N73 A;  3TSI A;  5CMZ A;  5KLV G;  3CCU P;  3L4F A;  4BRY A;  3M9B A;  5AW5 B;  3CX5 H;  1KV4 A;  3W67 A;  1IFM A;  1S1C X;  3KZI E;  3FWL A;  4H44 D;  5APV A;  2IBZ G;  2Y0D A;  2ZVO B;  1W5C E;  3H1K G;  2R32 A;  1OWA A;  2WPR A;  1BGY E;  1FBM A;  1RQU A;  1GZL A;  1SQX G;  1GMJ A;  1GK6 A;  2K9J B;  2ZT9 C;  3V2N A;  4YXW H;  5BU5 A;  4Z1M H;  1SQX D;  2B88 A;  2WSE H;  1KYO E;  3JCU E;  2IX7 C;  3L75 J;  3QWO C;  1RE3 A;  4HKZ H;  4I6M C;  4OWF A;  3M0D A;  4H0L C;  3CCQ P;  1TU3 F;  1BE3 G;  2HOD A;  4H0L B;  3V2P A;  3CWB D;  1NVO A;  1LWU B;  1SQB D;  4JPZ B;  1NTZ D;  1ZRT E;  3CC2 P;  1S5L H;  1L0L D;  2NPS C;  2V4H A;  2Y9Y A;  1JCD A;  1NTZ G;  3G3Z A;  3GHG A;  3NTN A;  4WY4 B;  2YMK A;  5CCH A;  4ZNC A;  1VQ8 P;  3FXD A;  4N78 D;  2C9L Y;  2O1K A;  4RJT A;  2KSJ A;  5CJ4 A;  1YIJ P;  2QJK C;  3QH9 A;  3HD7 A;  4NPD A;  4AYC A;  2N9B A;  4B86 A;  2CPB A;  3C1L A;  3KHU A;  1H0T A;  2N9Y B;  2XZR A;  5KJ7 D;  1NAF A;  3H1I E;  1GK4 A;  1MFZ A;  5GTH H;  1AQ5 A;  1QL1 A;  3MGN A;  3H32 A;  1HJ0 A;  2QJK B;  3EFF K;  1DEB A;  3SWY A;  5CCG A;  1BE3 D;  4C7N A;  3RGU A;  1YHQ P;  1EXI A;  3L72 J;  1LT1 A;  2QJY B;  5APY A;  3RK2 B;  4UB6 H;  1FZF A;  5KLV J;  3CC4 P;  1HGV A;  1W2B O;  1LTS C;  2E75 C;  3AE4 C;  3IAO A;  4RO0 A;  2W6J H;  2HOD B;  2BCC J;  1AJY A;  2CPS A;  4BWN A;  2OAR A;  1Q90 D;  1MKM A;  1CW5 A;  3CCS P;  1SQB K;  2W6B A;  1BCC E;  5CCH D;  1SQP K;  2YKP A;  1AVY A;  4Y99 C;  1KQF B;  3V5B A;  1NKZ B;  1NU1 J;  3IFM A;  3L70 D;  1FAV A;  3H6P A;  1SQP E;  3BVH A;  1VQ5 P;  4YXD C;  3H1L D;  3CCJ P;  4KJM A;  1N7S A;  1S4X A;  2ZYA A;  4MN4 C;  1RF0 C;  5APX A;  5APU A;  2JO1 A;  3B5N B;  1VQO P;  3HUS A;  1OFC X;  4ZKP A;  3TGU G;  2FYU K;  1EZV E;  5AW2 B;  3CMA P;  3SFD C;  1PFI A;  1VQ4 P;  5AVV B;  3TGU D;  3L70 J;  3O6Q B;  2BEZ F;  2JR8 A;  1LP1 A;  4DJG A;  1FZE A;  2RN0 A;  2KIK A;  2NPS B;  2QM8 A;  3AEG C;  3E1I A;  5AW9 B;  1L0N E;  3RK3 B;  2OGU A;  2O1J A;  3TNU B;  1BDC A;  4HYT B;  2KNC A;  2Q9I A;  2KS1 B;  1QL2 A;  2ZVN B;  4U3F D;  5GTI H;  2B87 A;  2WVR A;  2H43 A;  1VQ9 P;  3L73 D;  1GD2 E;  3GG2 A;  1HTL C;  2WSC H;  2A45 G;  4XFJ A;  1S2E A;  1URQ C;  1SQQ K;  2W27 A;  1HVV A;  4L74 A;  3U1A A;  5KLV K;  4PD4 E;  4I1L A;  2H89 C;  2W8Z A;  2KZJ A;  4H13 D;  1RF1 C;  2YKO A;  1X79 B;  1DD4 A;  3CX5 I;  3K5B A;  3AEB C;  4WWI A;  1P84 E;  1HUC A;  1FOS F;  2B9B A;  1QVG O;  1SQP J;  1ZLL A;  2WSF J;  3H1I J;  3HE4 A;  2K9J A;  1USE A;  1SQQ G;  1PPJ D;  2YKQ A;  3VMA A;  3EQ2 A;  3VMY A;  1BCC J;  3RBZ A;  3V6I A;  2JJL A;  2WSF H;  3II6 A;  2D2C D;  4R4L A;  2E76 C;  2XND H;  3BCC J;  2KLV A;  1SQQ E;  3L74 D;  1SQV J;  1EZV D;  2FYU J;  1QLE D;  2R44 A;  3RK3 C;  2Q5U A;  2PFX A;  1RE4 C;  3L72 E;  4GKG A;  2IYP A;  2M3B A;  1AQT A;  2NZ2 A;  2WSE J;  3H1H D;  2O01 H;  3I5C A;  4LC1 A;  2XDJ A;  1LTT C;  4CPG A;  4DT0 A;  3H1H J;  3D71 A;  4YPC A;  3SFE C;  1LTJ A;  4PJ0 E;  4PV1 B;  1SQV D;  3P8C E;  2K3R A;  1OZH A;  3CXH D;  3T97 A;  3L74 J;  3UIA A;  3L36 A;  3L35 A;  5CBN A;  3H1J G;  2Q3E A;  2JP3 A;  2ZFC A;  1FDI A;  2GM4 A;  1SQQ J;  1PL5 A;  3RK3 E;  3HE5 B;  4BXL A;  1NGM B;  2N1T B;  2FFD B;  1BDD A;  1KIL A;  2KSE A;  1EDJ A;  3TYY A;  2JWA A;  4WBA A;  5CBO A;  2J5U A;  3M0D C;  1N7L A;  4OH8 B;  3G71 P;  4OGQ D;  2J59 M;  1S3J A;  2WQY C;  1VQP P;  1L0N J;  1JY2 O;  3GF7 A;  1IFJ A;  1JY3 P;  2GUV A;  4AUW A;  4H44 B;  2QVA A;  2QJP B;  1N7S D;  1OW6 A;  2NPS A;  3CWB G;  1SFC D;  1S9K E;  1J1E C;  5DJU B;  1W2E A;  2CK3 H;  1Q2N A;  2FXM A;  3L73 J;  3L73 E;  2IFM A;  3BAT A;  3W68 A;  1GW3 A;  3CME P;  4EI2 A;  1PZQ A;  4IL6 E;  1R8E A;  5C39 A;  2HG5 D;  3Q5S A;  3LIE A;  4W7Z A;  1FZG A;  1IK9 A;  1R5S A;  1FZB A;  3R4Y A;  4N78 E;  1N86 A;  3M9Q A;  3TGU J;  4DCK A;  3Q5P A;  2IBZ D;  3A2A A;  1X9V A;  2YO2 A;  2KUB A;  3FXE A;  2G3A A;  5APS A;  4D6T J;  2PGD A;  3G6E P;  3OJA B;  1LJ2 A;  4IFF A;  1NTZ K;  4WY4 D;  1KFM A;  1LT9 B;  2B89 A;  1EC5 A;  1EDI A;  1KB9 D;  3CI9 A;  1GL2 B;  3H1L J;  2WPV B;  2ZXE B;  1RF1 A;  1IJD B;  1IFN A;  1KYO D;  5AVW B;  3S9O A;  1KC8 Q;  1JMM A;  1ZXG A;  1M7L A;  3LW5 J;  1YQ4 C;  3B8E B;  3U59 A;  1VQ6 P;  3C9I A;  1SLQ A;  3CXH E;  4C7N B;  1K9M Q;  3FGA D;  2OYH B;  1M56 D;  4RES B;  1VQL P;  3AE7 C;  3H32 B;  4LLH A;  1VPC A;  2FKW B;  3KYQ A;  1LTA C;  3WMM 0;  1LT9 A;  2HPC A;  1SQV K;  3L72 D;  3GW6 A;  2KB7 P;  2G8Y A;  1BE3 J;  3MTU E;  3RBX A;  1JUN A;  3PLN A;  3PP5 A;  3KPE A;  3L75 G;  1KMI Z;  1KN7 A;  3S1K A;  1ZN5 A;  3Q3D A;  1FOS E;  1NHL A;  2OYI C;  4RKU J;  2E74 B;  1FZC B;  2QJP C;  3AE8 C;  5E79 H;  2M5A B;  3BAS A;  4ZKU A;  3EFG A;  4JYB A;  1G1I A;  1NU1 D;  4H44 C;  4TLF A;  3RL0 D;  3NMD A;  1UIX A;  4U3F G;  1M1J C;  2H88 C;  2R3C A;  3B5N D;  1NTZ E;  1ZRT D;  3HE5 A;  1KIL C;  2QM7 A;  3U1C A;  2FYU G;  3V4Q A;  1RQV A;  1SQB J;  2AXT H;  1URQ B;  1MFT A;  2J58 A;  4JYC A;  5AVS B;  3TF5 A;  1ZME C;  3N7N A;  2FXP A;  2C9N Y;  1XTG B;  2ZAE B;  5B5E H;  5KAF E;  5B66 E;  3Q1M A;  2FFD C;  1NU1 K;  3RK3 D;  4YTP C;  3IN6 A;  1T3U A;  1LTJ B;  1FDM A;  3M91 A;  3USS A;  3I56 P;  1HF9 A;  1L0N D;  2O3J A;  1SQX J;  5BU8 B;  1VL2 A;  2Q7C A;  1JY2 N;  1RHZ B;  1BGY D;  2D2C C;  1KFN A;  4Y28 J;  5KLV E;  1CI6 A;  1G2C B;  4AQR D;  2QEX P;  5KKZ C;  1N73 B;  4PJ0 H;  2PAJ A;  3Q5R A;  1GW4 A;  1NU1 G;  5CHX A;  1SQQ D;  1BGY J;  2AXT E;  2JWD A;  3B5N C;  3PHL A;  2YXQ B;  3HTK A;  1NTK G;  3A3Y B;  3HTK B;  1UII A;  2FXO A;  5B5E E;  1T8Z A;  2GA1 A;  1J1D C;  1U7M A;  2IZ0 A;  2MKV A;  3CCV P;  3HRN A;  1M1K Q;  2Y9Z A;  1L0L J;  1N2D C;  2C0W A;  1OIP A;  1NTZ J;  2Y0E A;  1S9K D;  4JF7 A;  1T3J A;  2XNX A;  2BCC E;  2WWW A;  3S4R A;  3CWB J;  3CXH H;  2YXR B;  1PPJ E;  4GT1 A;  4IFM A;  1MUU A;  3G9R A;  1KQG B;  4PD4 D;  1L4A C;  4I7Z C;  3A0B E;  1BGY G;  1D7M A;  2Q3I A;  1L4A A;  3BCC D;  1AVO A;  2QIW A;  2YIU C;  1HBW A;  1GU4 A;  1PGP A;  3P8M C;  1VF5 C;  1PPJ G;  2B87 B; 
#chains in the Genus database with same CATH homology
 5TIS H;  4IL6 H;  5GTI H;  5KAF H;  2AXT H;  4PJ0 H;  3A0B H;  5B66 H;  5E79 H;  3JCU H;  4UB8 H;  3WU2 H;  5GTH H;  3KZI H;  5H2F H;  5B5E H;  3A0H H;  4UB6 H;  5KAI H;  1S5L H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...