5GTHH

Native xfel structure of photosystem ii (dark dataset)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
total genus 14
structure length 64
sequence length 64
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5gthH01
3KZIH 5H2FH 4UB6H 4PJ0H 1S5LH 5GTHH 4IL6H 5B5EH 3A0BH 3JCUH 5KAIH 5TISH 2AXTH 3WU2H 5KAFH 3A0HH 5GTIH 4UB8H 5E79H 5B66H
chains in the Genus database with same CATH superfamily
3EFFK 1VQOP 2G8YA 2H88C 2K88A 3TGUD 2DW3A 1VQPP 2E74B 1NTZJ 2Y9ZA 1L0LE 1FOSE 2ZT9C 4H13D 3L37A 1NU1G 3Q2YA 3FWNA 2OYHB 1OW7A 3B5NA 3CL3D 1HVVA 5AVUB 3U59A 2W6JH 3QH9A 2PFXA 1PPJE 3S9OA 2KSEA 1YQ3C 3OJAB 2R5BA 1PGQA 4BXLA 1AV1A 3USSA 3RK3E 1XTCC 3M9QA 4N6JA 1PP9E 5AVTB 2E74D 2WT7A 4U3FG 2AEFA 3B4SA 1OFCX 1OVVA 5B66H 2ZXXA 2FYNB 2RN0A 4JBZA 3RGUA 1SFCC 1URQC 3MD0A 1YI2P 2P7JA 5DJUB 1SQBK 5AVWB 1NTMD 4Z1MH 1L0ND 2L5GB 3TF5A 3WUVA 5KAIH 1LJ2A 3K5BA 1SQBG 1FZAA 5KLIC 1R5LA 3CX5I 1VQ4P 1S5LE 3L35A 2HYNA 3HE4A 3D71A 4D6TJ 3L70G 4UB6H 1M1KQ 1FZGA 5KJ7D 3I5CA 3S1KA 2XNXA 3L71E 3TDKA 1G1IA 1NTKJ 3U1CA 1K8AQ 1GU4A 1G2CB 1CI6B 2J5UA 1KQSO 3AE2C 4RO0A 1FZCC 4YTPC 1QVFO 3CC7P 2LXBA 1PPJG 2K9JB 5TISE 1N73C 5GTIE 1KV4A 2B9BA 2ZT9B 2Z4EA 3E1IA 3ITKA 5GTHE 3CCUP 2UWJE 1KQLA 2QVAA 2YKOA 3B5NC 3O6QA 3PRJA 3E7KA 3MUDC 2XV5A 1OW8A 1YTZI 1PZQA 1H89A 2Q3EA 1NHLA 5AVSB 3PTZA 3H1IJ 1QVGO 1TU3F 3N7NA 1MZ9A 1EDLA 2E76C 4EYYQ 2KK7A 4HH2A 3IFMA 5APWA 5APSA 3AE8C 1HJ0A 4JPZB 1NKZB 2QA4P 3GMAA 3L75E 2ZT9D 4L75A 3M9BA 1N7SA 1MFTA 1KD1Q 1URQB 1NTZD 1M1JA 3Q1MA 2VRSA 3AE7C 4DT0A 3H1HJ 1PFIA 1FJKA 2KZJA 3HE5B 2FXOA 2BCCJ 1K04A 3WUUA 3L71G 2W8ZA 1W2BO 4IFMA 2ZXEB 1NVOA 3V2QA 3AE4C 5KLIB 5CCGA 1ZR4A 1NOHA 1RQVA 4OGQC 4WB4A 3VP8A 2JP3A 1IFMA 1M8OB 1S5LH 2Y0EA 1S9KD 3H1LJ 3EQ2A 1URQD 2FYZA 3L36A 2L91A 2IFMA 2FYUJ 5KLVE 4XFJA 2IYOA 1QL2A 4U7JA 3N4XA 2XDJA 2SPZA 3F5HA 5H2FE 2Y0DA 5KAFH 1FZCB 1SQPJ 1JY3O 2OYIA 4D6TG 4BWNA 4BRYA 1N73B 3AEFC 1IJDB 3CMAP 3H1JE 3TNUB 3SFEC 5CMZA 2WZ7A 2Q6QA 3BCCE 4TLFA 4K3AA 3CX5E 3TGUJ 1IZNB 3VMAA 3C8VA 5AW6B 5TISH 1JOCA 5CBNA 1M56D 4H44C 5GTIH 2H7HA 3H1KD 3II6A 3NMDA 3AEGC 5GTHH 3L75G 1KILA 1YITP 2Z5IA 1IFNA 4AYCA 1BGYE 3MTUE 1GZLA 3CCRP 1VQLP 1G1JA 1P84I 1ZV8A 3CCEP 1GK6A 1NTKD 1MFZA 2P10A 1A02F 1FS0E 3PH0A 3H1IG 1SS1A 2N1TA 3CWBE 1GW3A 2QM8A 3M0AA 1X0TA 2QG4A 1JCCA 1RF1B 1E79H 2XZRA 2A45G 1KYOI 4KT0J 1OXZA 2WVRA 3GW6A 1KORA 1L2PA 2W90A 3CXHD 2W83C 2N9YB 1NAYA 1JMBA 4C7NB 1K05A 2HFED 1ZRTE 2KYVA 1LP1B 4JYCA 1EDJA 3H1HG 1NTMJ 4LLHA 1L0NJ 3D70A 2A06D 4WY4A 1L4AC 1FDMA 2NPSA 2BCCG 2R3SA 3H25A 3H1ID 1LTIC 1T2KC 1LTBC 2AXTH 2Q7CA 1S3JA 2WPQA 2QEXP 2C9NY 2FYUK 3SFDC 3VMXA 2V4HA 5AW1B 1EZVD 2WWWA 4RKUJ 1Q2NA 1JCDA 2QJKB 3T97B 4GOFA 3CC2P 3KPEA 4JYBA 2OYIC 2O3JA 2POHA 3L73D 3A0BE 2O1JA 3H1LG 3HTKA 2OTJP 4AQRD 2FYUG 5H2FH 1BE3J 1ZOYC 3GHGA 1KQFB 5AW5B 4H44B 2Q1KA 3FGAD 3OAKA 4OGQD 3Q3DA 3CX5H 5APVA 3JCUE 5KAIE 2HPCA 1E5WA 2ZYGA 4U3FE 2ZAEB 1QL1A 3TGUG 5APYA 4EI2A 1LTGC 5BU5A 1LWUB 3QWOC 1HJBA 1OX3A 4I1LA 1KILE 4UB6E 1FJPA 2KOGA 1K73Q 3AEBC 4PV1C 5C39A 5KKZB 1USDA 1GTWA 3LW5H 2N1TC 2QE7H 3P8MC 3NTNA 2O01H 3R2PA 2QSIA 1SQPD 2XKMA 1RY3A 4H44D 3WMM0 3M0DA 2KS1B 1J1DC 1SQBE 5AW0B 4ZKPA 4GKGA 4HKZH 1KQGB 5AVQB 3L70E 1T3JA 2D2CC 1T8ZA 3C9IA 2FXPA 3L74J 1NTMK 1OMIA 1L0NK 1P84E 3CXHI 4OWFA 3HD7A 3H32A 4JQ0D 1NGMB 1PP9J 4WY4C 2NPSC 2WSCH 4NPDA 3RK3C 1SP4A 1U57A 2WSEH 4MN4C 2HLOA 1NTMG 1KYOE 1UIIA 1PV3A 3A3YB 1L0NG 1VQ6P 1OIPA 1Y47A 2K3RA 1BCCD 3OW2O 4M3LA 2RKLA 3WU2E 1OVUA 1GL2C 1VPCA 2YIUB 3PJSK 2IBZD 1PGOA 4N78D 2KZIA 1NTZE 2A45I 2YO2A 1EZVI 2MKVA 4H0LC 3AECC 1JY3N 1OVRA 1SQVJ 3HUSC 5AW7B 3TSIA 4KHXA 3F89A 1IK9A 4ZMDA 3A0BH 1L4AD 1ZXGA 1H8AA 1LT1A 2R32A 3CLQA 4R4MA 3S4RA 5CCHC 5K5GB 3Q5RA 2FFDC 2KP8A 2QIWA 1LTTC 1HWTC 3H1KJ 2JR8A 1U7MA 3IR9A 4IFFA 1DD4A 3JCUH 3IF4A 4WVZA 1S9KE 1IC2A 2R44A 1LT9C 2OARA 2LR2A 1OW6A 2I1KA 1KFNA 2JWDA 3V5BA 1MKMA 4Y99C 1SQXJ 1RE4A 5KAFE 3BRTB 2W6AA 1LTJB 1IFDA 3FWLA 1BDDA 1R5SA 5AVRB 1IFIA 3M0DC 1MV8A 4HJGH 1J1DB 3GF3A 1A02J 5TJHA 1BE3D 3VP9A 1NTZK 2MJZA 4I7ZC 2QJYC 4ASWA 1JTHA 1EQ7A 2M5AA 1NO4A 1OZHA 3FXEA 3T97A 1J1EC 2OGUA 3HD7C 2KLUA 1JY2O 1AA0A 1ZW0A 2YXRB 3MGNA 1GW4A 3L72J 1OWAA 3E1RA 1NTZG 4PV1D 4D6TE 3M9HA 1P84H 3RK3B 4YXWH 2KXPB 1NTKE 2C0WA 3RL0C 1KB9D 2M3EA 2ZVOB 4GIFA 1FOSF 3G9RA 2N9BA 1RE3A 1WMKA 1GL2B 1KYOH 2HODA 2ZVNB 4KJMA 2V7QH 1FBMA 4ZNCA 5AW3B 2E75C 2YMKA 4H0LB 3WU2H 2WPRA 4DJGA 2Y9YA 3B71A 3CXHE 3HUSB 3CD6P 1WRGA 3L73J 1FAVA 1YQ4C 2JEEA 1SFCB 1GMJA 2C0XA 1PL5A 4IL6X 5APUA 3RK3D 3L74D 2A06E 5AVZB 1SQVG 1S72P 2FFDB 3H1IE 1CZQA 3CCJP 2KNCA 1PP9D 4PD4D 1KFMA 2LXCB 2AXTE 1GL2D 1FC2C 3AEDC 1LT9B 1EZVE 2WSFJ 3SSUA 4L74A 4H0LD 1SQXK 2IZ0A 4LC1A 3H1KG 3M06A 3Q5SA 1NTKK 3H1JJ 1VL2A 1LTSC 3BCCJ 1SFCD 2OYHA 1SQQJ 2Q3IA 3D6YA 3IAOA 3H1HE 1FE6A 1SQVD 2IFNA 5CCHD 1YBKA 2BCCE 1Y9BA 4TT3H 1SQXG 4I7ZB 3AE5C 2ZFCA 3CCQP 1NTKG 3G3ZA 1YYCA 4DCKA 1J1EB 2HR3A 1KMIZ 3B5NB 3CPWO 1UIXA 1AFOA 5KJ7A 3H1LE 3RK2C 5CJ4A 1YJ9P 2FYUE 3WUTA 1PGJA 4W80A 1GDTA 2R5DA 2E76B 1EDKA 2JJLA 1SQPE 1RE3C 3CI9A 5L8RJ 1SQXD 1KB9I 1VQ7P 2GUSA 4C7RA 2A06G 5CJ0A 2WT7B 1BCCJ 2E75B 1X22A 5KTBA 3TGUE 1SVFA 1Q90D 1HH0A 1N7SC 1DEBA 2E5TA 3RBZA 1SLQA 2ZYAA 1FZEA 1YHQP 1EZVG 3B5ND 3CXHH 1M1JC 4ZKUA 3KQGA 5APQA 4O9BA 1N2DC 2JKVA 3TYYA 3BASA 3VN0A 1G2CA 3L73G 1CI6A 4IOIH 3L72D 2E76D 3G6EP 1T6AA 1USEA 1NU1J 2Q9IA 2K9JA 2O01N 1AQTA 2E74C 4PD4I 5CCGC 1AQ5A 1FU1A 2E75D 3JSVC 4NPFX 3HE4B 4N78E 2A45H 4OGQB 1NWQA 1JY3P 1KC8Q 3SWYA 2OYHC 2YNYA 1MUUA 2H8PD 3A0HE 1SQPK 2B88A 3I55P 3CCMP 3P32A 1Q86Q 3KDPB 4IFDK 3BATA 3I56P 1KTMA 3UIAA 1Q81Q 1NTME 1L0NE 3RL0g 3AEEC 1QGKB 2W6BA 1SQPG 1S4XA 2LKMA 3KZIE 4GODA 5AW8B 2M0BA 1JUNA 1NKNA 3ZDMA 5KLVD 3O6QB 1JY2N 2FYNC 3AE9C 1EDIA 3RK2B 3CMEP 1URQA 2E5YA 1KILC 1FZFA 3A2AA 1DIPA 4OH8B 4YXDC 2KLVA 2ZYDA 3VTPC 3HE5A 4XA4A 3H1JD 2WSSH 3BCCD 1SQQD 3CX5D 3G71P 2B89A 1BE3E 2J59M 4N3YB 1FDIA 1YTZT 1L0LJ 3PP5A 1N7SB 3EWKA 2IZ1A 1NJIQ 2P2UA 1NH4A 1RF0A 1JNMA 1VQNP 1M1JB 1BCCG 1R8EA 1YJWP 3RK2D 2IBZG 1IFJA 3LIDA 1BDCA 1BGYD 1FDOA 5AW4B 2NRGA 1GK4A 1KB9E 1FZCA 3CWBD 2Q5UA 1N73A 1L4AB 4AUWA 3TNUA 2BEZF 1S2EA 2G3AA 1N7SD 3CCSP 2IYPA 2CPSA 4Y28J 1Z56A 4K35A 3MP7B 2AEJA 1NYHA 3MUDA 4DOJA 3NXSA 1ZRTD 5AVYB 1VQ9P 1KN7A 2OYIB 3A0HH 3AEAC 4BRYB 3L74E 1WT6A 2Y0CA 5B5EE 3ABVC 1JEKA 3A7OA 4GDOA 3GHGC 1S5LX 1RHZB 4PD4E 4L73A 4L76A 1J2JB 1NAFA 5CCGD 3SWKA 1T2KD 2WTYA 1Q7YQ 5AVVB 1JMMA 1BE3G 3MHVA 1NU1D 1RF1A 5CHXA 3V4WA 3KZIH 1D7MA 2AXCA 4QMAA 2RH0A 3L71J 1IFPA 1KILB 1KZUB 2K9YA 2OQQA 1BSHA 3V6IA 2M3BA 1X9VA 4W7ZA 4C7NA 2PAJA 1SQVE 1L0LK 1LP1A 2PGDA 4NPEA 4PV1B 4EIJA 1HGZA 3PLNA 4RESB 2N1TB 2KUBA 2ITAA 1H0TB 1JB0J 4U3FD 1RF0C 2W27A 2XNDH 3KHUA 2FY8A 2ZJSE 3M91A 3GLMA 5AVXB 1L0LG 3H1KE 2OTKE 1KILD 4WBAA 2D2CB 4UB8E 4DZOA 4RJTA 3V2NA 1GD2E 5BVZA 1Y8AA 4WY4B 2NPSB 1KB9H 1SQXE 2N1TD 2B87B 3L74G 3L75J 4GT1A 1SQBD 3RBXA 3P8CD 2JWAA 3Q5PA 3A5TA 1PP9G 3H6PA 2QJPC 3L70D 1VQKP 1DH3A 1T3UA 1L0LD 2Z5HA 4GOEA 3V4QA 1SQVK 1P84D 1CSBA 1LWUA 2D2CD 5M1BA 1K9MQ 3HTKB 2P1JA 2IBZI 3BRVB 3GHGB 2XU6A 2WQYC 1PPJD 3L72E 5CBOA 1EC5A 4WY4D 1X79B 5B5EH 2NPSD 3GF7A 5APXA 5E79E 1BSNA 1KYOD 1N86A 2FKWB 2WPSA 4PD4H 2HPCB 1RF1C 3GG2A 1M57D 2KS1A 2K1AA 1LTAC 3VYIA 5KLVJ 1EXJA 4HYTB 2HG5D 2P67A 1LNQA 2OTLP 3FX0A 1ZMEC 2M8RA 2KI7B 4I2LC 1ZP0C 1H88A 2CPBA 2KB7P 4Y99B 3L73E 1RE4C 1L4AA 4HB1A 1QX8A 2IX7C 2NZ2A 4PJ0E 2C9LY 4C46A 1HBWA 4IL6E 2H43A 2K37A 2YXQB 1JY2P 3BVHA 2JO1A 2QJYB 2KSJA 3B8EB 3CCVP 1M90Q 3U1AA 2E42A 1ZLLA 1JO5A 1HGVA 1W2EA 2OYOA 2QJKC 1X8YA 1BGYJ 3CC4P 3HD7B 3H32B 3LW5J 2R3CA 4UB8H 5AW9B 2O01J 2RMZA 1N7LA 3L71D 1DX7A 2YMYA 2GM4A 2FBWC 3CWBJ 1SQQE 1VF5C 1ZN5A 3RL0B 2O1KA 3W68A 2P58A 3KXDA 4W7YA 3CCLP 3L72G 2CK3H 2QJPB 1JM0A 3OA7A 1HUCA 1VDFA 2KIKA 1AVYA 3V2RA 3FXDA 1HF9A 5APTA 1Q82Q 1LWUC 2IDBA 2GA1A 4H13C 1ZR2A 3P7KA 2WSCJ 4A7PA 4D6TD 3HD7D 5AW2B 2I8DA 2WSEJ 3MIWA 2YKPA 1PIXA 2BASA 3W67A 3VMYA 3L4FA 1IO4A 5KKZC 1LTJA 4EOTA 3RL0D 1H0TA 1YIJP 5KLVK 3NFQA 5E79H 3AE3C 2E43A 1GU5A 2FXMA 5BU8B 1QEXA 3L75D 3KYQA 1BCCE 3AE1C 1VQ8P 1AVOA 1YJNP 3TK1A 2IBZE 1IK7A 5KLVG 1SQQK 4JF7A 2YO3A 2PRRA 2WPVB 4YPCA 2I1JA 3LIEA 2B87A 3C1LA 1DEEG 2YKQA 3H1JG 2H89C 3BCCG 1JTHB 4U3FJ 1SQQG 2M5AB 5DJTB 3IN6A 4PJ0H 1VQMP 1RH5B 1NU1E 4IL6H 4EDFA 3O8ZA 1GL2A 2YIUC 3VOPA 5B66E 2IPPA 4XE5B 3G4SP 2J58A 1M7LA 3HUSA 2JDIH 1FZBA 2WSFH 4CPGA 3D6ZA 1RQUA 3PHLA 3H1HD 5KJ7C 4I6MC 2PP6A 1SFCA 1VF5B 2BEQD 1HTLC 2WMMA 1VQ5P 1BGYG 2BCCD 4ASVA 3V2PA 4WWIA 1CW5A 2AEMA 3VMZA 5CCHA 1SQBJ 2QRXA 2FFDA 1W5CE 1PGPA 3CWBG 2HODB 3HRNA 2GUVA 3L70J 1QLED 1S1CX 4H13B 1LT9A 2WITA 3SWFA 3H1LD 3EFGA 2FYUD 1AJYA 1DD3A 3R4YA 1LGHB 1LTJC 1VF5D 1U7JA 4B86A 5EFWB 2QM7A 3AE6C 3MZWB 4R4LA 4OVNF 1NU1K 1XTGB 2KNCB 2V7QJ 3JC22 1EXIA 4LGDE 3P8CE 1N8RQ
chains in the Genus database with same CATH topology
3KZIH 5H2FH 4UB6H 4PJ0H 1S5LH 5GTHH 4IL6H 5B5EH 3A0BH 3JCUH 5KAIH 5TISH 2AXTH 3WU2H 5KAFH 3A0HH 5GTIH 4UB8H 5E79H 5B66H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI H;  5H2F H;  4UB6 H;  4PJ0 H;  1S5L H;  5GTH H;  4IL6 H;  5B5E H;  3A0B H;  3JCU H;  5KAI H;  5TIS H;  2AXT H;  3WU2 H;  5KAF H;  3A0H H;  5GTI H;  4UB8 H;  5E79 H;  5B66 H; 
#chains in the Genus database with same CATH topology
 3EFF K;  1VQO P;  2G8Y A;  2H88 C;  2K88 A;  3TGU D;  2DW3 A;  1VQP P;  2E74 B;  1NTZ J;  2Y9Z A;  1L0L E;  1FOS E;  2ZT9 C;  4H13 D;  3L37 A;  1NU1 G;  3Q2Y A;  3FWN A;  2OYH B;  1OW7 A;  3B5N A;  3CL3 D;  1HVV A;  5AVU B;  3U59 A;  2W6J H;  3QH9 A;  2PFX A;  1PPJ E;  3S9O A;  2KSE A;  1YQ3 C;  3OJA B;  2R5B A;  1PGQ A;  4BXL A;  1AV1 A;  3USS A;  3RK3 E;  1XTC C;  3M9Q A;  4N6J A;  1PP9 E;  5AVT B;  2E74 D;  2WT7 A;  4U3F G;  2AEF A;  3B4S A;  1OFC X;  1OVV A;  5B66 H;  2ZXX A;  2FYN B;  2RN0 A;  4JBZ A;  3RGU A;  1SFC C;  1URQ C;  3MD0 A;  1YI2 P;  2P7J A;  5DJU B;  1SQB K;  5AVW B;  1NTM D;  4Z1M H;  1L0N D;  2L5G B;  3TF5 A;  3WUV A;  5KAI H;  1LJ2 A;  3K5B A;  1SQB G;  1FZA A;  5KLI C;  1R5L A;  3CX5 I;  1VQ4 P;  1S5L E;  3L35 A;  2HYN A;  3HE4 A;  3D71 A;  4D6T J;  3L70 G;  4UB6 H;  1M1K Q;  1FZG A;  5KJ7 D;  3I5C A;  3S1K A;  2XNX A;  3L71 E;  3TDK A;  1G1I A;  1NTK J;  3U1C A;  1K8A Q;  1GU4 A;  1G2C B;  1CI6 B;  2J5U A;  1KQS O;  3AE2 C;  4RO0 A;  1FZC C;  4YTP C;  1QVF O;  3CC7 P;  2LXB A;  1PPJ G;  2K9J B;  5TIS E;  1N73 C;  5GTI E;  1KV4 A;  2B9B A;  2ZT9 B;  2Z4E A;  3E1I A;  3ITK A;  5GTH E;  3CCU P;  2UWJ E;  1KQL A;  2QVA A;  2YKO A;  3B5N C;  3O6Q A;  3PRJ A;  3E7K A;  3MUD C;  2XV5 A;  1OW8 A;  1YTZ I;  1PZQ A;  1H89 A;  2Q3E A;  1NHL A;  5AVS B;  3PTZ A;  3H1I J;  1QVG O;  1TU3 F;  3N7N A;  1MZ9 A;  1EDL A;  2E76 C;  4EYY Q;  2KK7 A;  4HH2 A;  3IFM A;  5APW A;  5APS A;  3AE8 C;  1HJ0 A;  4JPZ B;  1NKZ B;  2QA4 P;  3GMA A;  3L75 E;  2ZT9 D;  4L75 A;  3M9B A;  1N7S A;  1MFT A;  1KD1 Q;  1URQ B;  1NTZ D;  1M1J A;  3Q1M A;  2VRS A;  3AE7 C;  4DT0 A;  3H1H J;  1PFI A;  1FJK A;  2KZJ A;  3HE5 B;  2FXO A;  2BCC J;  1K04 A;  3WUU A;  3L71 G;  2W8Z A;  1W2B O;  4IFM A;  2ZXE B;  1NVO A;  3V2Q A;  3AE4 C;  5KLI B;  5CCG A;  1ZR4 A;  1NOH A;  1RQV A;  4OGQ C;  4WB4 A;  3VP8 A;  2JP3 A;  1IFM A;  1M8O B;  1S5L H;  2Y0E A;  1S9K D;  3H1L J;  3EQ2 A;  1URQ D;  2FYZ A;  3L36 A;  2L91 A;  2IFM A;  2FYU J;  5KLV E;  4XFJ A;  2IYO A;  1QL2 A;  4U7J A;  3N4X A;  2XDJ A;  2SPZ A;  3F5H A;  5H2F E;  2Y0D A;  5KAF H;  1FZC B;  1SQP J;  1JY3 O;  2OYI A;  4D6T G;  4BWN A;  4BRY A;  1N73 B;  3AEF C;  1IJD B;  3CMA P;  3H1J E;  3TNU B;  3SFE C;  5CMZ A;  2WZ7 A;  2Q6Q A;  3BCC E;  4TLF A;  4K3A A;  3CX5 E;  3TGU J;  1IZN B;  3VMA A;  3C8V A;  5AW6 B;  5TIS H;  1JOC A;  5CBN A;  1M56 D;  4H44 C;  5GTI H;  2H7H A;  3H1K D;  3II6 A;  3NMD A;  3AEG C;  5GTH H;  3L75 G;  1KIL A;  1YIT P;  2Z5I A;  1IFN A;  4AYC A;  1BGY E;  3MTU E;  1GZL A;  3CCR P;  1VQL P;  1G1J A;  1P84 I;  1ZV8 A;  3CCE P;  1GK6 A;  1NTK D;  1MFZ A;  2P10 A;  1A02 F;  1FS0 E;  3PH0 A;  3H1I G;  1SS1 A;  2N1T A;  3CWB E;  1GW3 A;  2QM8 A;  3M0A A;  1X0T A;  2QG4 A;  1JCC A;  1RF1 B;  1E79 H;  2XZR A;  2A45 G;  1KYO I;  4KT0 J;  1OXZ A;  2WVR A;  3GW6 A;  1KOR A;  1L2P A;  2W90 A;  3CXH D;  2W83 C;  2N9Y B;  1NAY A;  1JMB A;  4C7N B;  1K05 A;  2HFE D;  1ZRT E;  2KYV A;  1LP1 B;  4JYC A;  1EDJ A;  3H1H G;  1NTM J;  4LLH A;  1L0N J;  3D70 A;  2A06 D;  4WY4 A;  1L4A C;  1FDM A;  2NPS A;  2BCC G;  2R3S A;  3H25 A;  3H1I D;  1LTI C;  1T2K C;  1LTB C;  2AXT H;  2Q7C A;  1S3J A;  2WPQ A;  2QEX P;  2C9N Y;  2FYU K;  3SFD C;  3VMX A;  2V4H A;  5AW1 B;  1EZV D;  2WWW A;  4RKU J;  1Q2N A;  1JCD A;  2QJK B;  3T97 B;  4GOF A;  3CC2 P;  3KPE A;  4JYB A;  2OYI C;  2O3J A;  2POH A;  3L73 D;  3A0B E;  2O1J A;  3H1L G;  3HTK A;  2OTJ P;  4AQR D;  2FYU G;  5H2F H;  1BE3 J;  1ZOY C;  3GHG A;  1KQF B;  5AW5 B;  4H44 B;  2Q1K A;  3FGA D;  3OAK A;  4OGQ D;  3Q3D A;  3CX5 H;  5APV A;  3JCU E;  5KAI E;  2HPC A;  1E5W A;  2ZYG A;  4U3F E;  2ZAE B;  1QL1 A;  3TGU G;  5APY A;  4EI2 A;  1LTG C;  5BU5 A;  1LWU B;  3QWO C;  1HJB A;  1OX3 A;  4I1L A;  1KIL E;  4UB6 E;  1FJP A;  2KOG A;  1K73 Q;  3AEB C;  4PV1 C;  5C39 A;  5KKZ B;  1USD A;  1GTW A;  3LW5 H;  2N1T C;  2QE7 H;  3P8M C;  3NTN A;  2O01 H;  3R2P A;  2QSI A;  1SQP D;  2XKM A;  1RY3 A;  4H44 D;  3WMM 0;  3M0D A;  2KS1 B;  1J1D C;  1SQB E;  5AW0 B;  4ZKP A;  4GKG A;  4HKZ H;  1KQG B;  5AVQ B;  3L70 E;  1T3J A;  2D2C C;  1T8Z A;  3C9I A;  2FXP A;  3L74 J;  1NTM K;  1OMI A;  1L0N K;  1P84 E;  3CXH I;  4OWF A;  3HD7 A;  3H32 A;  4JQ0 D;  1NGM B;  1PP9 J;  4WY4 C;  2NPS C;  2WSC H;  4NPD A;  3RK3 C;  1SP4 A;  1U57 A;  2WSE H;  4MN4 C;  2HLO A;  1NTM G;  1KYO E;  1UII A;  1PV3 A;  3A3Y B;  1L0N G;  1VQ6 P;  1OIP A;  1Y47 A;  2K3R A;  1BCC D;  3OW2 O;  4M3L A;  2RKL A;  3WU2 E;  1OVU A;  1GL2 C;  1VPC A;  2YIU B;  3PJS K;  2IBZ D;  1PGO A;  4N78 D;  2KZI A;  1NTZ E;  2A45 I;  2YO2 A;  1EZV I;  2MKV A;  4H0L C;  3AEC C;  1JY3 N;  1OVR A;  1SQV J;  3HUS C;  5AW7 B;  3TSI A;  4KHX A;  3F89 A;  1IK9 A;  4ZMD A;  3A0B H;  1L4A D;  1ZXG A;  1H8A A;  1LT1 A;  2R32 A;  3CLQ A;  4R4M A;  3S4R A;  5CCH C;  5K5G B;  3Q5R A;  2FFD C;  2KP8 A;  2QIW A;  1LTT C;  1HWT C;  3H1K J;  2JR8 A;  1U7M A;  3IR9 A;  4IFF A;  1DD4 A;  3JCU H;  3IF4 A;  4WVZ A;  1S9K E;  1IC2 A;  2R44 A;  1LT9 C;  2OAR A;  2LR2 A;  1OW6 A;  2I1K A;  1KFN A;  2JWD A;  3V5B A;  1MKM A;  4Y99 C;  1SQX J;  1RE4 A;  5KAF E;  3BRT B;  2W6A A;  1LTJ B;  1IFD A;  3FWL A;  1BDD A;  1R5S A;  5AVR B;  1IFI A;  3M0D C;  1MV8 A;  4HJG H;  1J1D B;  3GF3 A;  1A02 J;  5TJH A;  1BE3 D;  3VP9 A;  1NTZ K;  2MJZ A;  4I7Z C;  2QJY C;  4ASW A;  1JTH A;  1EQ7 A;  2M5A A;  1NO4 A;  1OZH A;  3FXE A;  3T97 A;  1J1E C;  2OGU A;  3HD7 C;  2KLU A;  1JY2 O;  1AA0 A;  1ZW0 A;  2YXR B;  3MGN A;  1GW4 A;  3L72 J;  1OWA A;  3E1R A;  1NTZ G;  4PV1 D;  4D6T E;  3M9H A;  1P84 H;  3RK3 B;  4YXW H;  2KXP B;  1NTK E;  2C0W A;  3RL0 C;  1KB9 D;  2M3E A;  2ZVO B;  4GIF A;  1FOS F;  3G9R A;  2N9B A;  1RE3 A;  1WMK A;  1GL2 B;  1KYO H;  2HOD A;  2ZVN B;  4KJM A;  2V7Q H;  1FBM A;  4ZNC A;  5AW3 B;  2E75 C;  2YMK A;  4H0L B;  3WU2 H;  2WPR A;  4DJG A;  2Y9Y A;  3B71 A;  3CXH E;  3HUS B;  3CD6 P;  1WRG A;  3L73 J;  1FAV A;  1YQ4 C;  2JEE A;  1SFC B;  1GMJ A;  2C0X A;  1PL5 A;  4IL6 X;  5APU A;  3RK3 D;  3L74 D;  2A06 E;  5AVZ B;  1SQV G;  1S72 P;  2FFD B;  3H1I E;  1CZQ A;  3CCJ P;  2KNC A;  1PP9 D;  4PD4 D;  1KFM A;  2LXC B;  2AXT E;  1GL2 D;  1FC2 C;  3AED C;  1LT9 B;  1EZV E;  2WSF J;  3SSU A;  4L74 A;  4H0L D;  1SQX K;  2IZ0 A;  4LC1 A;  3H1K G;  3M06 A;  3Q5S A;  1NTK K;  3H1J J;  1VL2 A;  1LTS C;  3BCC J;  1SFC D;  2OYH A;  1SQQ J;  2Q3I A;  3D6Y A;  3IAO A;  3H1H E;  1FE6 A;  1SQV D;  2IFN A;  5CCH D;  1YBK A;  2BCC E;  1Y9B A;  4TT3 H;  1SQX G;  4I7Z B;  3AE5 C;  2ZFC A;  3CCQ P;  1NTK G;  3G3Z A;  1YYC A;  4DCK A;  1J1E B;  2HR3 A;  1KMI Z;  3B5N B;  3CPW O;  1UIX A;  1AFO A;  5KJ7 A;  3H1L E;  3RK2 C;  5CJ4 A;  1YJ9 P;  2FYU E;  3WUT A;  1PGJ A;  4W80 A;  1GDT A;  2R5D A;  2E76 B;  1EDK A;  2JJL A;  1SQP E;  1RE3 C;  3CI9 A;  5L8R J;  1SQX D;  1KB9 I;  1VQ7 P;  2GUS A;  4C7R A;  2A06 G;  5CJ0 A;  2WT7 B;  1BCC J;  2E75 B;  1X22 A;  5KTB A;  3TGU E;  1SVF A;  1Q90 D;  1HH0 A;  1N7S C;  1DEB A;  2E5T A;  3RBZ A;  1SLQ A;  2ZYA A;  1FZE A;  1YHQ P;  1EZV G;  3B5N D;  3CXH H;  1M1J C;  4ZKU A;  3KQG A;  5APQ A;  4O9B A;  1N2D C;  2JKV A;  3TYY A;  3BAS A;  3VN0 A;  1G2C A;  3L73 G;  1CI6 A;  4IOI H;  3L72 D;  2E76 D;  3G6E P;  1T6A A;  1USE A;  1NU1 J;  2Q9I A;  2K9J A;  2O01 N;  1AQT A;  2E74 C;  4PD4 I;  5CCG C;  1AQ5 A;  1FU1 A;  2E75 D;  3JSV C;  4NPF X;  3HE4 B;  4N78 E;  2A45 H;  4OGQ B;  1NWQ A;  1JY3 P;  1KC8 Q;  3SWY A;  2OYH C;  2YNY A;  1MUU A;  2H8P D;  3A0H E;  1SQP K;  2B88 A;  3I55 P;  3CCM P;  3P32 A;  1Q86 Q;  3KDP B;  4IFD K;  3BAT A;  3I56 P;  1KTM A;  3UIA A;  1Q81 Q;  1NTM E;  1L0N E;  3RL0 g;  3AEE C;  1QGK B;  2W6B A;  1SQP G;  1S4X A;  2LKM A;  3KZI E;  4GOD A;  5AW8 B;  2M0B A;  1JUN A;  1NKN A;  3ZDM A;  5KLV D;  3O6Q B;  1JY2 N;  2FYN C;  3AE9 C;  1EDI A;  3RK2 B;  3CME P;  1URQ A;  2E5Y A;  1KIL C;  1FZF A;  3A2A A;  1DIP A;  4OH8 B;  4YXD C;  2KLV A;  2ZYD A;  3VTP C;  3HE5 A;  4XA4 A;  3H1J D;  2WSS H;  3BCC D;  1SQQ D;  3CX5 D;  3G71 P;  2B89 A;  1BE3 E;  2J59 M;  4N3Y B;  1FDI A;  1YTZ T;  1L0L J;  3PP5 A;  1N7S B;  3EWK A;  2IZ1 A;  1NJI Q;  2P2U A;  1NH4 A;  1RF0 A;  1JNM A;  1VQN P;  1M1J B;  1BCC G;  1R8E A;  1YJW P;  3RK2 D;  2IBZ G;  1IFJ A;  3LID A;  1BDC A;  1BGY D;  1FDO A;  5AW4 B;  2NRG A;  1GK4 A;  1KB9 E;  1FZC A;  3CWB D;  2Q5U A;  1N73 A;  1L4A B;  4AUW A;  3TNU A;  2BEZ F;  1S2E A;  2G3A A;  1N7S D;  3CCS P;  2IYP A;  2CPS A;  4Y28 J;  1Z56 A;  4K35 A;  3MP7 B;  2AEJ A;  1NYH A;  3MUD A;  4DOJ A;  3NXS A;  1ZRT D;  5AVY B;  1VQ9 P;  1KN7 A;  2OYI B;  3A0H H;  3AEA C;  4BRY B;  3L74 E;  1WT6 A;  2Y0C A;  5B5E E;  3ABV C;  1JEK A;  3A7O A;  4GDO A;  3GHG C;  1S5L X;  1RHZ B;  4PD4 E;  4L73 A;  4L76 A;  1J2J B;  1NAF A;  5CCG D;  3SWK A;  1T2K D;  2WTY A;  1Q7Y Q;  5AVV B;  1JMM A;  1BE3 G;  3MHV A;  1NU1 D;  1RF1 A;  5CHX A;  3V4W A;  3KZI H;  1D7M A;  2AXC A;  4QMA A;  2RH0 A;  3L71 J;  1IFP A;  1KIL B;  1KZU B;  2K9Y A;  2OQQ A;  1BSH A;  3V6I A;  2M3B A;  1X9V A;  4W7Z A;  4C7N A;  2PAJ A;  1SQV E;  1L0L K;  1LP1 A;  2PGD A;  4NPE A;  4PV1 B;  4EIJ A;  1HGZ A;  3PLN A;  4RES B;  2N1T B;  2KUB A;  2ITA A;  1H0T B;  1JB0 J;  4U3F D;  1RF0 C;  2W27 A;  2XND H;  3KHU A;  2FY8 A;  2ZJS E;  3M91 A;  3GLM A;  5AVX B;  1L0L G;  3H1K E;  2OTK E;  1KIL D;  4WBA A;  2D2C B;  4UB8 E;  4DZO A;  4RJT A;  3V2N A;  1GD2 E;  5BVZ A;  1Y8A A;  4WY4 B;  2NPS B;  1KB9 H;  1SQX E;  2N1T D;  2B87 B;  3L74 G;  3L75 J;  4GT1 A;  1SQB D;  3RBX A;  3P8C D;  2JWA A;  3Q5P A;  3A5T A;  1PP9 G;  3H6P A;  2QJP C;  3L70 D;  1VQK P;  1DH3 A;  1T3U A;  1L0L D;  2Z5H A;  4GOE A;  3V4Q A;  1SQV K;  1P84 D;  1CSB A;  1LWU A;  2D2C D;  5M1B A;  1K9M Q;  3HTK B;  2P1J A;  2IBZ I;  3BRV B;  3GHG B;  2XU6 A;  2WQY C;  1PPJ D;  3L72 E;  5CBO A;  1EC5 A;  4WY4 D;  1X79 B;  5B5E H;  2NPS D;  3GF7 A;  5APX A;  5E79 E;  1BSN A;  1KYO D;  1N86 A;  2FKW B;  2WPS A;  4PD4 H;  2HPC B;  1RF1 C;  3GG2 A;  1M57 D;  2KS1 A;  2K1A A;  1LTA C;  3VYI A;  5KLV J;  1EXJ A;  4HYT B;  2HG5 D;  2P67 A;  1LNQ A;  2OTL P;  3FX0 A;  1ZME C;  2M8R A;  2KI7 B;  4I2L C;  1ZP0 C;  1H88 A;  2CPB A;  2KB7 P;  4Y99 B;  3L73 E;  1RE4 C;  1L4A A;  4HB1 A;  1QX8 A;  2IX7 C;  2NZ2 A;  4PJ0 E;  2C9L Y;  4C46 A;  1HBW A;  4IL6 E;  2H43 A;  2K37 A;  2YXQ B;  1JY2 P;  3BVH A;  2JO1 A;  2QJY B;  2KSJ A;  3B8E B;  3CCV P;  1M90 Q;  3U1A A;  2E42 A;  1ZLL A;  1JO5 A;  1HGV A;  1W2E A;  2OYO A;  2QJK C;  1X8Y A;  1BGY J;  3CC4 P;  3HD7 B;  3H32 B;  3LW5 J;  2R3C A;  4UB8 H;  5AW9 B;  2O01 J;  2RMZ A;  1N7L A;  3L71 D;  1DX7 A;  2YMY A;  2GM4 A;  2FBW C;  3CWB J;  1SQQ E;  1VF5 C;  1ZN5 A;  3RL0 B;  2O1K A;  3W68 A;  2P58 A;  3KXD A;  4W7Y A;  3CCL P;  3L72 G;  2CK3 H;  2QJP B;  1JM0 A;  3OA7 A;  1HUC A;  1VDF A;  2KIK A;  1AVY A;  3V2R A;  3FXD A;  1HF9 A;  5APT A;  1Q82 Q;  1LWU C;  2IDB A;  2GA1 A;  4H13 C;  1ZR2 A;  3P7K A;  2WSC J;  4A7P A;  4D6T D;  3HD7 D;  5AW2 B;  2I8D A;  2WSE J;  3MIW A;  2YKP A;  1PIX A;  2BAS A;  3W67 A;  3VMY A;  3L4F A;  1IO4 A;  5KKZ C;  1LTJ A;  4EOT A;  3RL0 D;  1H0T A;  1YIJ P;  5KLV K;  3NFQ A;  5E79 H;  3AE3 C;  2E43 A;  1GU5 A;  2FXM A;  5BU8 B;  1QEX A;  3L75 D;  3KYQ A;  1BCC E;  3AE1 C;  1VQ8 P;  1AVO A;  1YJN P;  3TK1 A;  2IBZ E;  1IK7 A;  5KLV G;  1SQQ K;  4JF7 A;  2YO3 A;  2PRR A;  2WPV B;  4YPC A;  2I1J A;  3LIE A;  2B87 A;  3C1L A;  1DEE G;  2YKQ A;  3H1J G;  2H89 C;  3BCC G;  1JTH B;  4U3F J;  1SQQ G;  2M5A B;  5DJT B;  3IN6 A;  4PJ0 H;  1VQM P;  1RH5 B;  1NU1 E;  4IL6 H;  4EDF A;  3O8Z A;  1GL2 A;  2YIU C;  3VOP A;  5B66 E;  2IPP A;  4XE5 B;  3G4S P;  2J58 A;  1M7L A;  3HUS A;  2JDI H;  1FZB A;  2WSF H;  4CPG A;  3D6Z A;  1RQU A;  3PHL A;  3H1H D;  5KJ7 C;  4I6M C;  2PP6 A;  1SFC A;  1VF5 B;  2BEQ D;  1HTL C;  2WMM A;  1VQ5 P;  1BGY G;  2BCC D;  4ASV A;  3V2P A;  4WWI A;  1CW5 A;  2AEM A;  3VMZ A;  5CCH A;  1SQB J;  2QRX A;  2FFD A;  1W5C E;  1PGP A;  3CWB G;  2HOD B;  3HRN A;  2GUV A;  3L70 J;  1QLE D;  1S1C X;  4H13 B;  1LT9 A;  2WIT A;  3SWF A;  3H1L D;  3EFG A;  2FYU D;  1AJY A;  1DD3 A;  3R4Y A;  1LGH B;  1LTJ C;  1VF5 D;  1U7J A;  4B86 A;  5EFW B;  2QM7 A;  3AE6 C;  3MZW B;  4R4L A;  4OVN F;  1NU1 K;  1XTG B;  2KNC B;  2V7Q J;  3JC2 2;  1EXI A;  4LGD E;  3P8C E;  1N8R Q; 
#chains in the Genus database with same CATH homology
 3KZI H;  5H2F H;  4UB6 H;  4PJ0 H;  1S5L H;  5GTH H;  4IL6 H;  5B5E H;  3A0B H;  3JCU H;  5KAI H;  5TIS H;  2AXT H;  3WU2 H;  5KAF H;  3A0H H;  5GTI H;  4UB8 H;  5E79 H;  5B66 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...