5GTHH

Native xfel structure of photosystem ii (dark dataset)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 14
structure length 64
sequence length 64
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5gthH01
5KAIH 5GTHH 5GTIH 5B66H 5B5EH 5TISH 5E79H 4IL6H 4UB8H 3A0HH 1S5LH 3A0BH 3KZIH 5H2FH 4PJ0H 2AXTH 3WU2H 3JCUH 5KAFH 4UB6H
chains in the Genus database with same CATH superfamily
1WT6A 3AEFC 3TGUD 1KB9D 3D6ZA 3L37A 2WPRA 1IK7A 1GMJA 1KQSO 3R2PA 2KUBA 5APWA 2E43A 3L75J 2C0WA 3RL0D 2CPSA 3V4WA 1RE4C 2Z4EA 5AW7B 3TGUJ 1SQXG 3A0BE 4WBAA 1TU3F 3JSVC 1JMBA 3CWBD 5L8RJ 1CI6B 4C7RA 3H1JE 1CI6A 3CCQP 1HTLC 4JPZB 1QVGO 2P2UA 3BATA 1VQKP 3CWBJ 3P8CD 5AW5B 2WT7B 3GF3A 2LKMA 2WT7A 1LTGC 5AVVB 3A0BH 2YKQA 1MFTA 1E79H 1JOCA 2H88C 3OA7A 2PFXA 1IC2A 4EDFA 1NAFA 2O1KA 1JNMA 1BE3D 3GG2A 2A45I 2IPPA 1USDA 1M8OB 5C39A 1BCCJ 3F5HA 4PV1D 2BCCD 1SFCC 1BE3J 5KKZC 1PIXA 2YKPA 2BEZF 1S1CX 2PP6A 2K9YA 1SQVE 3M9HA 1GK6A 2KIKA 1NU1K 3UIAA 2IX7C 1U57A 3OJAB 1T8ZA 2QA4P 5AVRB 3M91A 2QJYB 4C46A 3S4RA 1J1DC 3MUDA 3VP9A 1T2KC 2NRGA 4H0LB 1HUCA 2E76D 1ZN5A 3G4SP 1N7SB 3L73G 2Y9YA 1N7SA 2ITAA 2WPVB 3M9BA 3H32A 3D70A 2Y0DA 1T6AA 2E42A 1WRGA 5APVA 4LGDE 1S5LE 2QJKC 2P58A 2KK7A 4PD4E 5H2FE 4HYTB 3H1JD 4EYYQ 3PTZA 3AE7C 4Y28J 1PGQA 4A7PA 1EQ7A 3F89A 2FFDA 1KMIZ 3H1JJ 1FOSF 2FYUG 1YI2P 3RK3B 5CCGC 1VQLP 2K1AA 3H1KE 4EIJA 1URQD 2Z5IA 1EZVG 1SQPE 1S5LH 2QIWA 3USSA 4PD4H 1T3UA 4CPGA 2WPQA 1ZXGA 4HB1A 3P32A 1IFDA 1PP9J 1KILE 3H1HE 4EOTA 1JTHB 3NXSA 1RQUA 1JTHA 5CBOA 3RK2D 2KZJA 1AA0A 4WY4D 2L5GB 1RH5B 2D2CC 2GUVA 1ZOYC 2KZIA 2QSIA 3B5NB 2E74C 3PH0A 1GZLA 3B5NA 4B86A 5KJ7C 2M0BA 1JY3N 2FFDC 1SQVD 1SQXJ 4OGQD 5M1BA 3IAOA 1SQXK 2D2CD 1L0NG 4W7ZA 3VMXA 1N86A 2OYHA 1JY3P 3TNUB 2AEFA 1L4AB 3BCCE 3TNUA 1ZLLA 5AW8B 1L4AA 2K3RA 2V4HA 1OVRA 1EZVE 1X22A 3A0HE 3AE3C 3H1LG 3S1KA 1VF5B 4H44C 2IYPA 1M56D 3HD7D 5BU5A 3RL0g 2XU6A 3CI9A 1Y47A 2OQQA 3O8ZA 2ZXEB 3CLQA 2HG5D 3Q2YA 2A45G 2H43A 5APUA 2KS1B 4PD4D 2WMMA 3U1CA 3N4XA 2KS1A 5AVYB 2QJPC 3W68A 3RGUA 3M0DA 3Q5RA 2OGUA 1N73B 2H8PD 2LXCB 2WZ7A 2WTYA 1A02J 1N73A 5AVSB 2ZFCA 4KJMA 1K05A 3A0HH 1Q82Q 1W2EA 2WSFH 2FBWC 2OYHC 5CCHA 1YIJP 1GL2B 2P10A 1J1EB 1GL2A 3CCUP 1OW6A 3H1KD 1S5LX 2NPSB 1X8YA 1SQPD 1M57D 1GU4A 2NPSA 2H89C 3CCRP 2WVRA 2ZT9D 2QVAA 2C9LY 3HE4B 3C8VA 2POHA 1IFMA 1IFNA 1KILD 3HE4A 3H1HD 1NWQA 4H13B 2XZRA 2ZYAA 2E75C 2H7HA 2W27A 1FS0E 4I7ZB 3CCVP 4JF7A 1LTJC 1LT1A 1FZEA 3H1HJ 3L73J 2BCCG 3H6PA 1GK4A 2Q3EA 3K5BA 3WUUA 1ZMEC 1AQTA 2E75D 4NPDA 3L72E 2IZ1A 4I1LA 2K9JB 2IFMA 4JBZA 3L71E 5AVUB 3VN0A 1Y9BA 4W7YA 2Q9IA 4D6TG 3BCCD 1RF1C 1FZCC 4LLHA 3CMEP 2A45H 1EZVD 2KLUA 2CPBA 1X9VA 2YXQB 2JP3A 3AEDC 2KNCB 3A3YB 1M1JB 2FYUJ 1NHLA 1DD4A 1RF0A 2XV5A 1PZQA 2KNCA 2N1TB 1GD2E 1M1JA 1KYOI 2FYUK 4GOEA 4NPEA 2N1TA 4ZKPA 2OTLP 3II6A 3RL0B 1FZFA 1LWUB 1VQOP 1QEXA 2L91A 2WSFJ 4RKUJ 4KT0J 1YTZI 2OYIA 5AW4B 1IZNB 2AEMA 1N8RQ 4HKZH 1LTAC 2J5UA 1Y8AA 2J59M 3PRJA 1LTSC 1X79B 3H1JG 2N9BA 2DW3A 1KN7A 1S4XA 1EXJA 1QX8A 4IL6E 2FYNC 1KFNA 1KORA 1G2CB 4RESB 2YO2A 3VMZA 2W6AA 1G2CA 2ZVNB 3E7KA 3L36A 4YXDC 4D6TE 3FGAD 1SP4A 1OW8A 2YIUC 3AEEC 3M0AA 5B5EE 3HUSB 2WSSH 3IFMA 2O1JA 3HUSA 3ZDMA 2W83C 2M8RA 3AE4C 4JYCA 3AE8C 2IZ0A 1L0NK 1VQNP 3LW5H 3I55P 4IL6H 1AQ5A 5CJ0A 1QL1A 3AECC 2OYIC 1OW7A 4PV1B 1VPCA 3H1LJ 4RJTA 1N2DC 1H89A 2JO1A 4AQRD 1G1IA 1KQGB 5B5EH 3BRVB 3L72D 2LR2A 3TYYA 3G6EP 3FXDA 3BASA 2I1KA 3B8EB 1SQQE 3L71D 3GHGC 2KI7B 1NGMB 1VL2A 1SQVG 1PPJG 1M7LA 3HTKB 4GOFA 3EFFK 3L72J 4IFFA 3V6IA 3HTKA 2FY8A 5KAIE 2ZJSE 1XTCC 1NTME 1M90Q 4IFMA 3SWYA 2R3CA 2W8ZA 2E76B 4YXWH 1E5WA 1S9KE 3AEAC 3Q1MA 3CC7P 1FOSE 1YQ3C 2FYZA 1W5CE 3KHUA 3PLNA 2IBZI 3L70G 1NKNA 2AEJA 1ZW0A 1FJPA 5KAIH 5APSA 1LP1B 1RHZB 3QWOC 4K35A 3GMAA 1G1JA 4AYCA 1LP1A 2VRSA 3A2AA 3IF4A 2BCCJ 4R4LA 1AVYA 4YTPC 4U3FE 4D6TD 3SWFA 2XNXA 4OH8B 1HF9A 3VYIA 1PPJE 3LW5J 2WITA 1SFCD 3H1KG 1OXZA 4HJGH 2IDBA 1URQB 4GODA 1SQPG 1CW5A 2FKWB 1URQA 3AE6C 3GLMA 1PGOA 4D6TJ 3TF5A 4IL6X 2P7JA 2ZXXA 1RE3A 3H1HG 2E5YA 1YJWP 2KB7P 4OWFA 2GM4A 1EC5A 1L0LG 2ZVOB 3RK2B 3V5BA 2ZYGA 4WY4B 1VQPP 2OTJP 3MHVA 1T2KD 3L74E 1KQFB 3L70E 4WY4A 2M3EA 3L35A 1Q2NA 1SQQD 5DJUB 3VP8A 4WB4A 2Y0CA 2C9NY 3G9RA 2M5AB 2M5AA 2Q3IA 4OGQB 1JO5A 4RO0A 1JY2N 2Q6QA 3P7KA 3BCCG 1NTMD 3MUDC 1BGYE 1USEA 2I8DA 3TSIA 2QJYC 3BRTB 3NMDA 4U7JA 4H0LC 1S9KD 4DCKA 1JCCA 1JY2P 3EFGA 2ZYDA 2KSJA 3AE1C 1N7SC 2BASA 2K37A 1DEBA 1NTMJ 3Q3DA 3HD7B 3HD7A 5CCGD 2OYOA 1KYOE 1PL5A 3V2PA 5AW6B 1L0LE 2QE7H 1JY3O 3H25A 5CMZA 1SQBE 1YITP 3WMM0 1HGZA 1R8EA 1AV1A 2A06E 1KTMA 4U3FD 2HYNA 2CK3H 3H1IG 1NTKD 1YBKA 3V2NA 1CZQA 1PPJD 3FWNA 3IN6A 1EDIA 3RK3C 2RN0A 1K8AQ 2SPZA 1KYOH 4I2LC 2MJZA 2E74D 4U3FJ 1SQVJ 5KJ7D 1QL2A 2ZT9B 4JQ0D 3C1LA 1SQVK 1KILB 1UIIA 2GA1A 1NJIQ 1KILA 2QEXP 1Q81Q 1JEKA 3RK3D 3VMAA 4LC1A 3AE9C 3L74D 1MKMA 3L70D 3U1AA 1A02F 4N6JA 2IBZG 4MN4C 2B87B 1FDIA 3B5NC 2B87A 1JMMA 2IYOA 1AVOA 5AW0B 3BVHA 1VDFA 3VTPC 1SLQA 4H44D 1PFIA 4DJGA 2Y0EA 1IFIA 3L74J 3L72G 3L70J 1LGHB 3L71G 1VQ8P 2HODB 3H1IE 2HODA 2IFNA 1BGYD 2Z5HA 4BWNA 1BDCA 1FZGA 1L4AC 3WU2E 2RKLA 4Y99B 5B66E 1QLED 5KLVE 5E79E 1VF5C 1YTZT 4QMAA 3H1KJ 2HR3A 4KHXA 2W90A 1SQPJ 1L4AD 2YMKA 2KP8A 2KOGA 1KYOD 1FZAA 5GTIE 1L0LD 3LIDA 1SQPK 3CCLP 4JYBA 1SQBD 1LT9B 3WU2H 3M0DC 2JEEA 3L75E 4DT0A 1LNQA 5AW9B 1VQ6P 2IBZE 1PGPA 1VF5D 1LT9A 3LIEA 1MV8A 1N73C 5B66H 2A06D 3CX5I 3EWKA 4Z1MH 5E79H 2K88A 3KPEA 1L0LJ 1U7JA 1OMIA 3M06A 5CCHC 1HH0A 3AEGC 1GL2C 3O6QB 1OVVA 4XFJA 2K9JA 1J1EC 1NO4A 1NU1G 3O6QA 5GTIH 3GF7A 1Z56A 2NPSC 2Q5UA 4GIFA 2OARA 5KAFE 4UB6E 2O3JA 1FC2C 4ZMDA 1K9MQ 2KSEA 3KXDA 4L76A 1PV3A 4XE5B 1DEEG 3B4SA 4H13C 3BCCJ 1ZV8A 2ZAEB 1KC8Q 2G8YA 4I7ZC 1M1KQ 2YXRB 5KLIB 1LWUA 5KAFH 1RQVA 1HJBA 4UB6H 1DD3A 1BCCE 3MZWB 1ZR4A 1T3JA 1P84I 1H0TB 1SQQG 1H0TA 3H1ID 2WPSA 1EDLA 1RE4A 1NU1E 3CCJP 2JR8A 4DZOA 1MUUA 2JKVA 4M3LA 3G3ZA 1NTMG 5KLVD 3H1IJ 3CC2P 1HGVA 3KDPB 1VQ4P 3AEBC 1RF0C 1KV4A 1M1JC 2PGDA 1JM0A 5AVXB 2AXTE 2N1TC 4ZNCA 3NTNA 3Q5SA 1L2PA 3ITKA 2WSCH 2W6JH 3GW6A 3WUVA 3RL0C 1UIXA 3L75D 2IBZD 3MGNA 3MP7B 3A5TA 2WSEH 2HLOA 3TDKA 3HE5B 2QRXA 1KFMA 1AFOA 3HE5A 1GTWA 2XKMA 1NH4A 2N1TD 2AXCA 3PP5A 2P67A 1K04A 3CCEP 3CXHI 4L74A 1HJ0A 3ABVC 3CC4P 3SWKA 2AXTH 4U3FG 1KZUB 1X0TA 1YJNP 1QGKB 1NTKG 1Q90D 1SFCB 5CHXA 3CPWO 5KKZB 1SFCA 3HUSC 3L71J 3I5CA 4L73A 1J2JB 4WVZA 3A7OA 4GT1A 4DOJA 1LTTC 2PRRA 5CJ4A 2FXOA 2KYVA 3MIWA 1KQLA 1S72P 3M9QA 1NKZB 3V2QA 2V7QH 1PP9E 4PV1C 4C7NB 1J1DB 3L74G 1BCCD 1IO4A 4C7NA 2BEQD 1KB9I 3OW2O 3E1RA 4GDOA 4N3YB 3S9OA 3PHLA 1DIPA 4N78E 5AVTB 1NU1D 1CSBA 1SQXE 2QJKB 1NTKE 4ASWA 1BGYG 2RMZA 3MD0A 2WSCJ 1EXIA 1FAVA 3FWLA 1GDTA 1R5SA 5APTA 3HRNA 2E76C 3Q5PA 5APXA 1NU1J 1R5LA 2WSEJ 5BU8B 2GUSA 3N7NA 3SFEC 1NTZG 1K73Q 2Q7CA 1GW3A 2YNYA 4WWIA 4BRYB 1ZRTE 3RK3E 5CCGA 4BRYA 1VQ7P 1SQBG 5EFWB 4IFDK 1AJYA 3I56P 3PJSK 1NVOA 4YPCA 2B9BA 3H32B 2A06G 2YMYA 1JY2O 3V4QA 2YKOA 3RBZA 3D6YA 3CX5E 2HFED 1FDOA 2MKVA 1SS1A 2R3SA 3R4YA 1DX7A 1PGJA 1YYCA 2D2CB 2J58A 1KD1Q 2XDJA 1IFJA 1SQQJ 1URQC 5APQA 2E74B 3SSUA 2KXPB 1QVFO 2V7QJ 1SQQK 2FFDB 2JWDA 2FXPA 5KJ7A 2Y9ZA 1RE3C 4BXLA 1RY3A 5AVWB 3NFQA 1OIPA 2HPCB 1IK9A 2QM7A 1Q86Q 1NTZE 2HPCA 3JCUE 3E1IA 3CX5H 1PP9D 1FJKA 1NTMK 2WWWA 2C0XA 2O01H 3RK2C 2JWAA 4WY4C 5AW1B 5H2FH 4H0LD 1ZP0C 4UB8E 1YJ9P 1N7SD 4H44B 2PAJA 3L73E 3FX0A 4N78D 3QH9A 1P84E 2XNDH 1SQXD 1ZR2A 4OGQC 3JCUH 1S2EA 3KYQA 2FXMA 3CMAP 1S3JA 1VQ9P 2QJPB 3CCSP 5GTHE 4UB8H 5KLVG 3OAKA 3JC22 2LXBA 3CL3D 1NTKJ 3V2RA 2R5DA 1W2BO 1VQMP 2OYHB 1HWTC 1NTKK 3HD7C 4ZKUA 2JDIH 3W67A 1ZRTD 1P84H 2FYUE 2W6BA 1EDKA 5TJHA 5AW2B 3L75G 5K5GB 3RBXA 2UWJE 2I1JA 1LTIC 5GTHH 1FZBA 3TGUG 3WUTA 4R4MA 2OTKE 2E75B 3CX5D 4TT3H 1OZHA 1LTJB 3CXHE 4K3AA 1LTJA 1FDMA 3G71P 3B5ND 5AVQB 1BDDA 3CWBG 2O01J 2R5BA 2ZT9C 5APYA 1IFPA 1KILC 4ASVA 3P8MC 1OWAA 4XA4A 1NTZD 1JUNA 1BGYJ 1EDJA 4O9BA 1L0NE 1RF1B 2B89A 1FZCB 5AVZB 3IR9A 1RF1A 1HBWA 1FZCA 3CXHH 1FU1A 2QM8A 1MZ9A 1YHQP 3AE5C 1NTZJ 2Q1KA 1BCCG 1U7MA 3L73D 1FBMA 2WQYC 3KZIE 1NTZK 1WMKA 3L4FA 3TK1A 3H1LE 4AUWA 2O01N 1NAYA 3TGUE 1KB9E 1H8AA 2E5TA 1P84D 1OVUA 1BE3G 1YQ4C 1SQBJ 4PD4I 1L0LK 2B88A 4GKGA 1JB0J 3MTUE 4EI2A 1SQBK 3VOPA 3FXEA 1JCDA 4IOIH 1MFZA 4OVNF 1NOHA 4Y99C 3EQ2A 3D71A 2R32A 1DH3A 3CWBE 5TISE 5CCHD 3KZIH 3VMYA 1VQ5P 1D7MA 3AE2C 2FYNB 2N9YB 1GL2D 5CBNA 1KB9H 2FYUD 1FE6A 2NPSD 2P1JA 2NZ2A 5BVZA 3P8CE 2YIUB 1BSNA 3CD6P 2RH0A 1LT9C 1SVFA 2YO3A 3U59A 4H13D 1OFCX 5DJTB 2JJLA 4NPFX 5TISH 1OX3A 1XTGB 2G3AA 1N7LA 3SFDC 3B71A 2OYIB 3CXHD 1BE3E 1IJDB 3KQGA 2BCCE 4PJ0E 2M3BA 3CCMP 1GW4A 1LJ2A 1Q7YQ 4TLFA 1NYHA 3GHGB 1HVVA 1L0ND 5AW3B 1BSHA 4W80A 3GHGA 5KTBA 1LTBC 4L75A 2QG4A 5KLVJ 1EZVI 1PP9G 2KLVA 1LWUC 5KLVK 4HH2A 4I6MC 5KLIC 1H88A 1GU5A 4PJ0H 1L0NJ 3T97B 2R44A 3C9IA 3H1LD 3T97A
chains in the Genus database with same CATH topology
5KAIH 5GTHH 5GTIH 5B66H 5B5EH 5TISH 5E79H 4IL6H 4UB8H 3A0HH 1S5LH 3A0BH 3KZIH 5H2FH 4PJ0H 2AXTH 3WU2H 3JCUH 5KAFH 4UB6H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAI H;  5GTH H;  5GTI H;  5B66 H;  5B5E H;  5TIS H;  5E79 H;  4IL6 H;  4UB8 H;  3A0H H;  1S5L H;  3A0B H;  3KZI H;  5H2F H;  4PJ0 H;  2AXT H;  3WU2 H;  3JCU H;  5KAF H;  4UB6 H; 
#chains in the Genus database with same CATH topology
 1WT6 A;  3AEF C;  3TGU D;  1KB9 D;  3D6Z A;  3L37 A;  2WPR A;  1IK7 A;  1GMJ A;  1KQS O;  3R2P A;  2KUB A;  5APW A;  2E43 A;  3L75 J;  2C0W A;  3RL0 D;  2CPS A;  3V4W A;  1RE4 C;  2Z4E A;  5AW7 B;  3TGU J;  1SQX G;  3A0B E;  4WBA A;  1TU3 F;  3JSV C;  1JMB A;  3CWB D;  5L8R J;  1CI6 B;  4C7R A;  3H1J E;  1CI6 A;  3CCQ P;  1HTL C;  4JPZ B;  1QVG O;  2P2U A;  3BAT A;  1VQK P;  3CWB J;  3P8C D;  5AW5 B;  2WT7 B;  3GF3 A;  2LKM A;  2WT7 A;  1LTG C;  5AVV B;  3A0B H;  2YKQ A;  1MFT A;  1E79 H;  1JOC A;  2H88 C;  3OA7 A;  2PFX A;  1IC2 A;  4EDF A;  1NAF A;  2O1K A;  1JNM A;  1BE3 D;  3GG2 A;  2A45 I;  2IPP A;  1USD A;  1M8O B;  5C39 A;  1BCC J;  3F5H A;  4PV1 D;  2BCC D;  1SFC C;  1BE3 J;  5KKZ C;  1PIX A;  2YKP A;  2BEZ F;  1S1C X;  2PP6 A;  2K9Y A;  1SQV E;  3M9H A;  1GK6 A;  2KIK A;  1NU1 K;  3UIA A;  2IX7 C;  1U57 A;  3OJA B;  1T8Z A;  2QA4 P;  5AVR B;  3M91 A;  2QJY B;  4C46 A;  3S4R A;  1J1D C;  3MUD A;  3VP9 A;  1T2K C;  2NRG A;  4H0L B;  1HUC A;  2E76 D;  1ZN5 A;  3G4S P;  1N7S B;  3L73 G;  2Y9Y A;  1N7S A;  2ITA A;  2WPV B;  3M9B A;  3H32 A;  3D70 A;  2Y0D A;  1T6A A;  2E42 A;  1WRG A;  5APV A;  4LGD E;  1S5L E;  2QJK C;  2P58 A;  2KK7 A;  4PD4 E;  5H2F E;  4HYT B;  3H1J D;  4EYY Q;  3PTZ A;  3AE7 C;  4Y28 J;  1PGQ A;  4A7P A;  1EQ7 A;  3F89 A;  2FFD A;  1KMI Z;  3H1J J;  1FOS F;  2FYU G;  1YI2 P;  3RK3 B;  5CCG C;  1VQL P;  2K1A A;  3H1K E;  4EIJ A;  1URQ D;  2Z5I A;  1EZV G;  1SQP E;  1S5L H;  2QIW A;  3USS A;  4PD4 H;  1T3U A;  4CPG A;  2WPQ A;  1ZXG A;  4HB1 A;  3P32 A;  1IFD A;  1PP9 J;  1KIL E;  3H1H E;  4EOT A;  1JTH B;  3NXS A;  1RQU A;  1JTH A;  5CBO A;  3RK2 D;  2KZJ A;  1AA0 A;  4WY4 D;  2L5G B;  1RH5 B;  2D2C C;  2GUV A;  1ZOY C;  2KZI A;  2QSI A;  3B5N B;  2E74 C;  3PH0 A;  1GZL A;  3B5N A;  4B86 A;  5KJ7 C;  2M0B A;  1JY3 N;  2FFD C;  1SQV D;  1SQX J;  4OGQ D;  5M1B A;  3IAO A;  1SQX K;  2D2C D;  1L0N G;  4W7Z A;  3VMX A;  1N86 A;  2OYH A;  1JY3 P;  3TNU B;  2AEF A;  1L4A B;  3BCC E;  3TNU A;  1ZLL A;  5AW8 B;  1L4A A;  2K3R A;  2V4H A;  1OVR A;  1EZV E;  1X22 A;  3A0H E;  3AE3 C;  3H1L G;  3S1K A;  1VF5 B;  4H44 C;  2IYP A;  1M56 D;  3HD7 D;  5BU5 A;  3RL0 g;  2XU6 A;  3CI9 A;  1Y47 A;  2OQQ A;  3O8Z A;  2ZXE B;  3CLQ A;  2HG5 D;  3Q2Y A;  2A45 G;  2H43 A;  5APU A;  2KS1 B;  4PD4 D;  2WMM A;  3U1C A;  3N4X A;  2KS1 A;  5AVY B;  2QJP C;  3W68 A;  3RGU A;  3M0D A;  3Q5R A;  2OGU A;  1N73 B;  2H8P D;  2LXC B;  2WZ7 A;  2WTY A;  1A02 J;  1N73 A;  5AVS B;  2ZFC A;  4KJM A;  1K05 A;  3A0H H;  1Q82 Q;  1W2E A;  2WSF H;  2FBW C;  2OYH C;  5CCH A;  1YIJ P;  1GL2 B;  2P10 A;  1J1E B;  1GL2 A;  3CCU P;  1OW6 A;  3H1K D;  1S5L X;  2NPS B;  1X8Y A;  1SQP D;  1M57 D;  1GU4 A;  2NPS A;  2H89 C;  3CCR P;  2WVR A;  2ZT9 D;  2QVA A;  2C9L Y;  3HE4 B;  3C8V A;  2POH A;  1IFM A;  1IFN A;  1KIL D;  3HE4 A;  3H1H D;  1NWQ A;  4H13 B;  2XZR A;  2ZYA A;  2E75 C;  2H7H A;  2W27 A;  1FS0 E;  4I7Z B;  3CCV P;  4JF7 A;  1LTJ C;  1LT1 A;  1FZE A;  3H1H J;  3L73 J;  2BCC G;  3H6P A;  1GK4 A;  2Q3E A;  3K5B A;  3WUU A;  1ZME C;  1AQT A;  2E75 D;  4NPD A;  3L72 E;  2IZ1 A;  4I1L A;  2K9J B;  2IFM A;  4JBZ A;  3L71 E;  5AVU B;  3VN0 A;  1Y9B A;  4W7Y A;  2Q9I A;  4D6T G;  3BCC D;  1RF1 C;  1FZC C;  4LLH A;  3CME P;  2A45 H;  1EZV D;  2KLU A;  2CPB A;  1X9V A;  2YXQ B;  2JP3 A;  3AED C;  2KNC B;  3A3Y B;  1M1J B;  2FYU J;  1NHL A;  1DD4 A;  1RF0 A;  2XV5 A;  1PZQ A;  2KNC A;  2N1T B;  1GD2 E;  1M1J A;  1KYO I;  2FYU K;  4GOE A;  4NPE A;  2N1T A;  4ZKP A;  2OTL P;  3II6 A;  3RL0 B;  1FZF A;  1LWU B;  1VQO P;  1QEX A;  2L91 A;  2WSF J;  4RKU J;  4KT0 J;  1YTZ I;  2OYI A;  5AW4 B;  1IZN B;  2AEM A;  1N8R Q;  4HKZ H;  1LTA C;  2J5U A;  1Y8A A;  2J59 M;  3PRJ A;  1LTS C;  1X79 B;  3H1J G;  2N9B A;  2DW3 A;  1KN7 A;  1S4X A;  1EXJ A;  1QX8 A;  4IL6 E;  2FYN C;  1KFN A;  1KOR A;  1G2C B;  4RES B;  2YO2 A;  3VMZ A;  2W6A A;  1G2C A;  2ZVN B;  3E7K A;  3L36 A;  4YXD C;  4D6T E;  3FGA D;  1SP4 A;  1OW8 A;  2YIU C;  3AEE C;  3M0A A;  5B5E E;  3HUS B;  2WSS H;  3IFM A;  2O1J A;  3HUS A;  3ZDM A;  2W83 C;  2M8R A;  3AE4 C;  4JYC A;  3AE8 C;  2IZ0 A;  1L0N K;  1VQN P;  3LW5 H;  3I55 P;  4IL6 H;  1AQ5 A;  5CJ0 A;  1QL1 A;  3AEC C;  2OYI C;  1OW7 A;  4PV1 B;  1VPC A;  3H1L J;  4RJT A;  1N2D C;  1H89 A;  2JO1 A;  4AQR D;  1G1I A;  1KQG B;  5B5E H;  3BRV B;  3L72 D;  2LR2 A;  3TYY A;  3G6E P;  3FXD A;  3BAS A;  2I1K A;  3B8E B;  1SQQ E;  3L71 D;  3GHG C;  2KI7 B;  1NGM B;  1VL2 A;  1SQV G;  1PPJ G;  1M7L A;  3HTK B;  4GOF A;  3EFF K;  3L72 J;  4IFF A;  3V6I A;  3HTK A;  2FY8 A;  5KAI E;  2ZJS E;  1XTC C;  1NTM E;  1M90 Q;  4IFM A;  3SWY A;  2R3C A;  2W8Z A;  2E76 B;  4YXW H;  1E5W A;  1S9K E;  3AEA C;  3Q1M A;  3CC7 P;  1FOS E;  1YQ3 C;  2FYZ A;  1W5C E;  3KHU A;  3PLN A;  2IBZ I;  3L70 G;  1NKN A;  2AEJ A;  1ZW0 A;  1FJP A;  5KAI H;  5APS A;  1LP1 B;  1RHZ B;  3QWO C;  4K35 A;  3GMA A;  1G1J A;  4AYC A;  1LP1 A;  2VRS A;  3A2A A;  3IF4 A;  2BCC J;  4R4L A;  1AVY A;  4YTP C;  4U3F E;  4D6T D;  3SWF A;  2XNX A;  4OH8 B;  1HF9 A;  3VYI A;  1PPJ E;  3LW5 J;  2WIT A;  1SFC D;  3H1K G;  1OXZ A;  4HJG H;  2IDB A;  1URQ B;  4GOD A;  1SQP G;  1CW5 A;  2FKW B;  1URQ A;  3AE6 C;  3GLM A;  1PGO A;  4D6T J;  3TF5 A;  4IL6 X;  2P7J A;  2ZXX A;  1RE3 A;  3H1H G;  2E5Y A;  1YJW P;  2KB7 P;  4OWF A;  2GM4 A;  1EC5 A;  1L0L G;  2ZVO B;  3RK2 B;  3V5B A;  2ZYG A;  4WY4 B;  1VQP P;  2OTJ P;  3MHV A;  1T2K D;  3L74 E;  1KQF B;  3L70 E;  4WY4 A;  2M3E A;  3L35 A;  1Q2N A;  1SQQ D;  5DJU B;  3VP8 A;  4WB4 A;  2Y0C A;  2C9N Y;  3G9R A;  2M5A B;  2M5A A;  2Q3I A;  4OGQ B;  1JO5 A;  4RO0 A;  1JY2 N;  2Q6Q A;  3P7K A;  3BCC G;  1NTM D;  3MUD C;  1BGY E;  1USE A;  2I8D A;  3TSI A;  2QJY C;  3BRT B;  3NMD A;  4U7J A;  4H0L C;  1S9K D;  4DCK A;  1JCC A;  1JY2 P;  3EFG A;  2ZYD A;  2KSJ A;  3AE1 C;  1N7S C;  2BAS A;  2K37 A;  1DEB A;  1NTM J;  3Q3D A;  3HD7 B;  3HD7 A;  5CCG D;  2OYO A;  1KYO E;  1PL5 A;  3V2P A;  5AW6 B;  1L0L E;  2QE7 H;  1JY3 O;  3H25 A;  5CMZ A;  1SQB E;  1YIT P;  3WMM 0;  1HGZ A;  1R8E A;  1AV1 A;  2A06 E;  1KTM A;  4U3F D;  2HYN A;  2CK3 H;  3H1I G;  1NTK D;  1YBK A;  3V2N A;  1CZQ A;  1PPJ D;  3FWN A;  3IN6 A;  1EDI A;  3RK3 C;  2RN0 A;  1K8A Q;  2SPZ A;  1KYO H;  4I2L C;  2MJZ A;  2E74 D;  4U3F J;  1SQV J;  5KJ7 D;  1QL2 A;  2ZT9 B;  4JQ0 D;  3C1L A;  1SQV K;  1KIL B;  1UII A;  2GA1 A;  1NJI Q;  1KIL A;  2QEX P;  1Q81 Q;  1JEK A;  3RK3 D;  3VMA A;  4LC1 A;  3AE9 C;  3L74 D;  1MKM A;  3L70 D;  3U1A A;  1A02 F;  4N6J A;  2IBZ G;  4MN4 C;  2B87 B;  1FDI A;  3B5N C;  2B87 A;  1JMM A;  2IYO A;  1AVO A;  5AW0 B;  3BVH A;  1VDF A;  3VTP C;  1SLQ A;  4H44 D;  1PFI A;  4DJG A;  2Y0E A;  1IFI A;  3L74 J;  3L72 G;  3L70 J;  1LGH B;  3L71 G;  1VQ8 P;  2HOD B;  3H1I E;  2HOD A;  2IFN A;  1BGY D;  2Z5H A;  4BWN A;  1BDC A;  1FZG A;  1L4A C;  3WU2 E;  2RKL A;  4Y99 B;  5B66 E;  1QLE D;  5KLV E;  5E79 E;  1VF5 C;  1YTZ T;  4QMA A;  3H1K J;  2HR3 A;  4KHX A;  2W90 A;  1SQP J;  1L4A D;  2YMK A;  2KP8 A;  2KOG A;  1KYO D;  1FZA A;  5GTI E;  1L0L D;  3LID A;  1SQP K;  3CCL P;  4JYB A;  1SQB D;  1LT9 B;  3WU2 H;  3M0D C;  2JEE A;  3L75 E;  4DT0 A;  1LNQ A;  5AW9 B;  1VQ6 P;  2IBZ E;  1PGP A;  1VF5 D;  1LT9 A;  3LIE A;  1MV8 A;  1N73 C;  5B66 H;  2A06 D;  3CX5 I;  3EWK A;  4Z1M H;  5E79 H;  2K88 A;  3KPE A;  1L0L J;  1U7J A;  1OMI A;  3M06 A;  5CCH C;  1HH0 A;  3AEG C;  1GL2 C;  3O6Q B;  1OVV A;  4XFJ A;  2K9J A;  1J1E C;  1NO4 A;  1NU1 G;  3O6Q A;  5GTI H;  3GF7 A;  1Z56 A;  2NPS C;  2Q5U A;  4GIF A;  2OAR A;  5KAF E;  4UB6 E;  2O3J A;  1FC2 C;  4ZMD A;  1K9M Q;  2KSE A;  3KXD A;  4L76 A;  1PV3 A;  4XE5 B;  1DEE G;  3B4S A;  4H13 C;  3BCC J;  1ZV8 A;  2ZAE B;  1KC8 Q;  2G8Y A;  4I7Z C;  1M1K Q;  2YXR B;  5KLI B;  1LWU A;  5KAF H;  1RQV A;  1HJB A;  4UB6 H;  1DD3 A;  1BCC E;  3MZW B;  1ZR4 A;  1T3J A;  1P84 I;  1H0T B;  1SQQ G;  1H0T A;  3H1I D;  2WPS A;  1EDL A;  1RE4 A;  1NU1 E;  3CCJ P;  2JR8 A;  4DZO A;  1MUU A;  2JKV A;  4M3L A;  3G3Z A;  1NTM G;  5KLV D;  3H1I J;  3CC2 P;  1HGV A;  3KDP B;  1VQ4 P;  3AEB C;  1RF0 C;  1KV4 A;  1M1J C;  2PGD A;  1JM0 A;  5AVX B;  2AXT E;  2N1T C;  4ZNC A;  3NTN A;  3Q5S A;  1L2P A;  3ITK A;  2WSC H;  2W6J H;  3GW6 A;  3WUV A;  3RL0 C;  1UIX A;  3L75 D;  2IBZ D;  3MGN A;  3MP7 B;  3A5T A;  2WSE H;  2HLO A;  3TDK A;  3HE5 B;  2QRX A;  1KFM A;  1AFO A;  3HE5 A;  1GTW A;  2XKM A;  1NH4 A;  2N1T D;  2AXC A;  3PP5 A;  2P67 A;  1K04 A;  3CCE P;  3CXH I;  4L74 A;  1HJ0 A;  3ABV C;  3CC4 P;  3SWK A;  2AXT H;  4U3F G;  1KZU B;  1X0T A;  1YJN P;  1QGK B;  1NTK G;  1Q90 D;  1SFC B;  5CHX A;  3CPW O;  5KKZ B;  1SFC A;  3HUS C;  3L71 J;  3I5C A;  4L73 A;  1J2J B;  4WVZ A;  3A7O A;  4GT1 A;  4DOJ A;  1LTT C;  2PRR A;  5CJ4 A;  2FXO A;  2KYV A;  3MIW A;  1KQL A;  1S72 P;  3M9Q A;  1NKZ B;  3V2Q A;  2V7Q H;  1PP9 E;  4PV1 C;  4C7N B;  1J1D B;  3L74 G;  1BCC D;  1IO4 A;  4C7N A;  2BEQ D;  1KB9 I;  3OW2 O;  3E1R A;  4GDO A;  4N3Y B;  3S9O A;  3PHL A;  1DIP A;  4N78 E;  5AVT B;  1NU1 D;  1CSB A;  1SQX E;  2QJK B;  1NTK E;  4ASW A;  1BGY G;  2RMZ A;  3MD0 A;  2WSC J;  1EXI A;  1FAV A;  3FWL A;  1GDT A;  1R5S A;  5APT A;  3HRN A;  2E76 C;  3Q5P A;  5APX A;  1NU1 J;  1R5L A;  2WSE J;  5BU8 B;  2GUS A;  3N7N A;  3SFE C;  1NTZ G;  1K73 Q;  2Q7C A;  1GW3 A;  2YNY A;  4WWI A;  4BRY B;  1ZRT E;  3RK3 E;  5CCG A;  4BRY A;  1VQ7 P;  1SQB G;  5EFW B;  4IFD K;  1AJY A;  3I56 P;  3PJS K;  1NVO A;  4YPC A;  2B9B A;  3H32 B;  2A06 G;  2YMY A;  1JY2 O;  3V4Q A;  2YKO A;  3RBZ A;  3D6Y A;  3CX5 E;  2HFE D;  1FDO A;  2MKV A;  1SS1 A;  2R3S A;  3R4Y A;  1DX7 A;  1PGJ A;  1YYC A;  2D2C B;  2J58 A;  1KD1 Q;  2XDJ A;  1IFJ A;  1SQQ J;  1URQ C;  5APQ A;  2E74 B;  3SSU A;  2KXP B;  1QVF O;  2V7Q J;  1SQQ K;  2FFD B;  2JWD A;  2FXP A;  5KJ7 A;  2Y9Z A;  1RE3 C;  4BXL A;  1RY3 A;  5AVW B;  3NFQ A;  1OIP A;  2HPC B;  1IK9 A;  2QM7 A;  1Q86 Q;  1NTZ E;  2HPC A;  3JCU E;  3E1I A;  3CX5 H;  1PP9 D;  1FJK A;  1NTM K;  2WWW A;  2C0X A;  2O01 H;  3RK2 C;  2JWA A;  4WY4 C;  5AW1 B;  5H2F H;  4H0L D;  1ZP0 C;  4UB8 E;  1YJ9 P;  1N7S D;  4H44 B;  2PAJ A;  3L73 E;  3FX0 A;  4N78 D;  3QH9 A;  1P84 E;  2XND H;  1SQX D;  1ZR2 A;  4OGQ C;  3JCU H;  1S2E A;  3KYQ A;  2FXM A;  3CMA P;  1S3J A;  1VQ9 P;  2QJP B;  3CCS P;  5GTH E;  4UB8 H;  5KLV G;  3OAK A;  3JC2 2;  2LXB A;  3CL3 D;  1NTK J;  3V2R A;  2R5D A;  1W2B O;  1VQM P;  2OYH B;  1HWT C;  1NTK K;  3HD7 C;  4ZKU A;  2JDI H;  3W67 A;  1ZRT D;  1P84 H;  2FYU E;  2W6B A;  1EDK A;  5TJH A;  5AW2 B;  3L75 G;  5K5G B;  3RBX A;  2UWJ E;  2I1J A;  1LTI C;  5GTH H;  1FZB A;  3TGU G;  3WUT A;  4R4M A;  2OTK E;  2E75 B;  3CX5 D;  4TT3 H;  1OZH A;  1LTJ B;  3CXH E;  4K3A A;  1LTJ A;  1FDM A;  3G71 P;  3B5N D;  5AVQ B;  1BDD A;  3CWB G;  2O01 J;  2R5B A;  2ZT9 C;  5APY A;  1IFP A;  1KIL C;  4ASV A;  3P8M C;  1OWA A;  4XA4 A;  1NTZ D;  1JUN A;  1BGY J;  1EDJ A;  4O9B A;  1L0N E;  1RF1 B;  2B89 A;  1FZC B;  5AVZ B;  3IR9 A;  1RF1 A;  1HBW A;  1FZC A;  3CXH H;  1FU1 A;  2QM8 A;  1MZ9 A;  1YHQ P;  3AE5 C;  1NTZ J;  2Q1K A;  1BCC G;  1U7M A;  3L73 D;  1FBM A;  2WQY C;  3KZI E;  1NTZ K;  1WMK A;  3L4F A;  3TK1 A;  3H1L E;  4AUW A;  2O01 N;  1NAY A;  3TGU E;  1KB9 E;  1H8A A;  2E5T A;  1P84 D;  1OVU A;  1BE3 G;  1YQ4 C;  1SQB J;  4PD4 I;  1L0L K;  2B88 A;  4GKG A;  1JB0 J;  3MTU E;  4EI2 A;  1SQB K;  3VOP A;  3FXE A;  1JCD A;  4IOI H;  1MFZ A;  4OVN F;  1NOH A;  4Y99 C;  3EQ2 A;  3D71 A;  2R32 A;  1DH3 A;  3CWB E;  5TIS E;  5CCH D;  3KZI H;  3VMY A;  1VQ5 P;  1D7M A;  3AE2 C;  2FYN B;  2N9Y B;  1GL2 D;  5CBN A;  1KB9 H;  2FYU D;  1FE6 A;  2NPS D;  2P1J A;  2NZ2 A;  5BVZ A;  3P8C E;  2YIU B;  1BSN A;  3CD6 P;  2RH0 A;  1LT9 C;  1SVF A;  2YO3 A;  3U59 A;  4H13 D;  1OFC X;  5DJT B;  2JJL A;  4NPF X;  5TIS H;  1OX3 A;  1XTG B;  2G3A A;  1N7L A;  3SFD C;  3B71 A;  2OYI B;  3CXH D;  1BE3 E;  1IJD B;  3KQG A;  2BCC E;  4PJ0 E;  2M3B A;  3CCM P;  1GW4 A;  1LJ2 A;  1Q7Y Q;  4TLF A;  1NYH A;  3GHG B;  1HVV A;  1L0N D;  5AW3 B;  1BSH A;  4W80 A;  3GHG A;  5KTB A;  1LTB C;  4L75 A;  2QG4 A;  5KLV J;  1EZV I;  1PP9 G;  2KLV A;  1LWU C;  5KLV K;  4HH2 A;  4I6M C;  5KLI C;  1H88 A;  1GU5 A;  4PJ0 H;  1L0N J;  3T97 B;  2R44 A;  3C9I A;  3H1L D;  3T97 A; 
#chains in the Genus database with same CATH homology
 5KAI H;  5GTH H;  5GTI H;  5B66 H;  5B5E H;  5TIS H;  5E79 H;  4IL6 H;  4UB8 H;  3A0H H;  1S5L H;  3A0B H;  3KZI H;  5H2F H;  4PJ0 H;  2AXT H;  3WU2 H;  3JCU H;  5KAF H;  4UB6 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...