5GTHH

Native xfel structure of photosystem ii (dark dataset)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
b'ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 14
structure length 64
sequence length 64
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5gthH01
3A0HH 5TISH 5B5EH 5KAFH 3JCUH 3A0BH 1S5LH 5E79H 5GTHH 3KZIH 4UB8H 5B66H 5KAIH 4UB6H 4IL6H 2AXTH 5GTIH 3WU2H 5H2FH 4PJ0H
chains in the Genus database with same CATH superfamily
2QSIA 1TU3F 1NOHA 1HVVA 2Q9IA 2E42A 2E74C 2HG5D 5BU8B 4DZOA 3D70A 3RK2B 1NWQA 1NVOA 3AE7C 1ZR4A 4PJ0H 4PD4I 2POHA 1K05A 2ZXXA 1JTHB 1X79B 2Q6QA 1BSHA 1JCCA 1FZBA 4I6MC 3HRNA 1L0LD 1RH5B 2E74D 4CPGA 3L71J 4N6JA 4GT1A 4RKUJ 1G2CB 1WMKA 1GZLA 2SPZA 4AUWA 1QL2A 4LC1A 5AVYB 1VQ4P 1SQVJ 1RQVA 1N2DC 4GOFA 2UWJE 4OWFA 3AE8C 1OVUA 1RY3A 3F89A 5TISH 1T2KC 5AW3B 1IFNA 3TYYA 1VQMP 1YQ4C 3CWBE 2BEZF 2C0XA 1Y47A 1NAYA 3QWOC 2K9YA 1BE3D 3AE2C 4YXWH 4EOTA 4YPCA 1LGHB 2KS1A 2OYHC 1HJ0A 4OVNF 1LTBC 3HD7C 1X22A 3RBZA 2IYPA 2JP3A 3L74J 4DT0A 3FWNA 1PP9E 5H2FH 3SWYA 1HGZA 1RE3C 1JNMA 2LR2A 4ZKUA 1BGYG 2QRXA 1N86A 1NU1D 1GD2E 2M5AA 2KLVA 2CPBA 2WSCJ 3PH0A 3H6PA 1IFMA 2OTLP 4Y99C 2FYZA 2WSSH 1G1JA 1MZ9A 1VQPP 1S5LH 3HE5B 1SQXK 1IFJA 1MFTA 3H1HG 3TGUD 1IFIA 4I1LA 1DH3A 1DEEG 1NU1E 2GUVA 1N73B 4H44B 1VF5C 1KILD 1VQLP 3V2RA 3L75J 3S9OA 3ITKA 1KZUB 3G6EP 1PZQA 3GHGB 1Q82Q 2QJPB 3PP5A 3RK2C 4D6TE 5KLVK 1KYOI 1EDLA 3V5BA 2H7HA 2A45G 1VF5D 3TGUE 1L0ND 5APXA 2AXTH 1PGJA 5CCHA 1HH0A 1RF1C 3LIEA 4K35A 1M1JB 1KILE 1Z56A 4I7ZB 2Q3EA 2E43A 2KP8A 4GOEA 4C7RA 2A06G 1YIJP 1H0TA 3H1IJ 1SFCB 2XKMA 3RGUA 1J1DB 2JWAA 4R4MA 2Q5UA 5CBNA 3WUTA 1FDMA 3H1LE 1L0NE 1SQPD 4C7NA 3MD0A 3L37A 2Y0EA 2KSJA 5AVRB 3L71G 2IPPA 1G1IA 2QJYB 3A0BE 1CW5A 1NTME 4WBAA 2J58A 1PGPA 2PAJA 3B5NB 3CC2P 2ZYGA 3T97B 1SQVG 2Y9ZA 2OARA 5DJUB 1P84H 1SQPE 3CCUP 5APWA 2Z5IA 3F5HA 4DCKA 1FZFA 3CWBJ 2FXMA 3VMZA 2P1JA 1USEA 4C7NB 2LXCB 1D7MA 1L4AB 3A7OA 2HPCA 2GUSA 4L76A 1M1KQ 2OTJP 3AEDC 1PP9J 3U1CA 3LW5H 1S5LX 2BCCD 1SQBD 5CJ4A 1SQXD 1KC8Q 3L74G 1DD3A 3G9RA 3R2PA 3CX5D 3MUDA 1Q2NA 3NMDA 1FJKA 2N1TA 4UB8H 2OGUA 1VQ7P 1RHZB 2G8YA 1N73C 1IC2A 4H44C 2DW3A 2PRRA 1ZLLA 3M0AA 2OYHA 3BATA 4EYYQ 3L72D 1DX7A 2QE7H 2YMYA 2WSFH 3HD7A 3SFDC 5KAFH 2HYNA 1A02F 2KYVA 2ZXEB 3L73G 3CXHD 3PTZA 4UB6E 1WRGA 3GHGC 3Q3DA 1ZP0C 2QJPC 1RE3A 5GTIH 2BCCE 1SQBE 5KLVD 1IZNB 2CPSA 2KB7P 3CC4P 2HPCB 1EC5A 4K3AA 2C9LY 2JDIH 1OMIA 2M3EA 1KTMA 1JY3P 3FXEA 1OW7A 4GIFA 1BGYJ 1M1JC 4N78D 1AVYA 4I7ZC 2OQQA 2KI7B 3L75G 1KFNA 2E75C 3NXSA 1SFCC 5CJ0A 4D6TJ 4ZMDA 1LP1A 1J1DC 2B88A 1W5CE 3AEFC 3H1KE 2ZYAA 5AW8B 5KJ7A 1PPJD 2AEJA 3M9HA 3GLMA 1AV1A 2YKPA 3ZDMA 5AVQB 1MKMA 5CCGC 2E75D 1N7SA 3CCQP 3USSA 3H1HJ 1SFCD 4JF7A 3TDKA 2H88C 3IAOA 1RF0A 2QJYC 4LGDE 1ZMEC 4IFMA 1A02J 4RESB 5CCHC 3NTNA 3H1LJ 5CCGD 1DD4A 1E79H 3B5NC 5GTHH 3U1AA 1FZCB 2IYOA 1M56D 1EZVE 1PPJE 1JTHA 1BDCA 1BCCE 1GK4A 2RMZA 1NO4A 2H43A 4H0LB 4IFFA 3TF5A 3KDPB 5TISE 1U57A 4KT0J 1YYCA 3V4QA 5CCHD 5AW6B 1JB0J 1G2CA 2NPSB 3BCCD 1EDJA 3L70D 1NTMJ 5AVVB 3M9BA 3H1JE 1L4AC 1NGMB 4L73A 1H89A 4RO0A 4N3YB 2ZT9B 1GL2B 5AW2B 5B5EH 3G4SP 2D2CB 2G3AA 3S1KA 3CXHH 2FY8A 5KAIH 5EFWB 1GW3A 1NTKD 1YTZT 5H2FE 2Y0CA 2QM7A 1JY2P 1VQ5P 1L4AD 3CWBG 1YQ3C 2YXRB 3C1LA 2IFMA 1AJYA 2FYUD 5APYA 3P8CD 4H13C 3P8MC 2R32A 2QA4P 2O01J 3M0DC 1CSBA 2Q3IA 2Q7CA 1CZQA 2WSCH 2A45I 3AE6C 1KYOH 1OX3A 2KSEA 2KZJA 1GMJA 2WQYC 1GDTA 1S5LE 2N9BA 3JC22 2HODA 3SSUA 1PP9G 3E1IA 4JYBA 3VP8A 4H13D 1LTIC 1GU4A 1NTZD 2P10A 2Y0DA 4U3FD 1PGQA 1MUUA 1JMBA 2FYUE 3P8CE 1LTAC 4OGQB 1L0LE 2YXQB 3MUDC 4Z1MH 2N1TC 3HTKB 1FJPA 3HE5A 3AE1C 1ZV8A 3HE4A 1W2EA 2ZJSE 2XV5A 3K5BA 1SS1A 2WTYA 3FXDA 1UIIA 1T2KD 3L36A 2XZRA 1NTZE 4U3FE 1N73A 1NU1G 5KLIB 2AXTE 1ZOYC 4IL6E 3SFEC 2WITA 2N1TD 3QH9A 2HODB 4QMAA 1HTLC 2WPQA 1DIPA 3CCSP 3D6YA 3GHGA 1NAFA 1RE4C 4GKGA 3W67A 3I56P 5DJTB 3H1KJ 2HLOA 3HD7D 4D6TG 3O6QA 1BE3E 2ZVNB 1SQQD 1SQVK 1ZRTD 1FZCC 3L73J 3TGUG 3AE4C 1P84D 2HR3A 5AW9B 3CD6P 4H0LC 2W6JH 2XDJA 3KXDA 3RK3C 3S4RA 1KB9D 1M1JA 2QIWA 1KQLA 3HE4B 1HGVA 4HYTB 3WU2H 2KK7A 5KJ7C 2E76B 1SFCA 1FS0E 3AE5C 3RL0B 3CCVP 4ZNCA 2KZIA 1DEBA 2KXPB 5KKZB 1N7SC 3Q1MA 1EDKA 3CL3D 1BCCJ 1URQB 3RK3D 3V2PA 3VMAA 1SQQE 3H1LG 1EQ7A 1YHQP 1GL2C 1S72P 1HWTC 1L0NG 1RF0C 5CCGA 1P84E 3V2NA 5KJ7D 4ASWA 1FOSE 3KZIE 1UIXA 3V2QA 3VP9A 2PP6A 3O6QB 1N7SD 3NFQA 1W2BO 3EFGA 2M0BA 3H1JJ 4WVZA 1NTMG 3A0HH 1H8AA 3W68A 3GMAA 1PGOA 3B5NA 2I1KA 4BWNA 3T97A 3RK2D 4PD4D 4B86A 3RK3E 1HJBA 1KFMA 1SQPG 4WWIA 2JO1A 1KORA 1JY3N 3IF4A 4WY4B 2CK3H 2BASA 1EZVI 1OXZA 2YIUB 3WMM0 1BDDA 4UB8E 2PFXA 1NH4A 2XNDH 3V4WA 1L4AA 5AVSB 1R5SA 1PL5A 3MTUE 4OGQC 3B8EB 1VDFA 2R5DA 2A06D 1MFZA 5KAFE 1LNQA 2Z4EA 2Q1KA 5AW0B 3I5CA 1LTGC 2FXPA 3P7KA 3II6A 1Q7YQ 1NKZB 1FU1A 1M90Q 1HUCA 1S9KD 3CI9A 5KLIC 3AEGC 3AE9C 3M0DA 4EI2A 2K1AA 1L0LJ 3FWLA 1KB9H 2R3CA 3L71D 3IR9A 1X8YA 3O8ZA 1VQ9P 4ASVA 3VTPC 2P58A 1IO4A 3B4SA 1YJWP 1QL1A 2BCCG 4JQ0D 2FFDA 2R5BA 1SQBG 3GG2A 1VPCA 2V7QJ 1T3JA 3AEBC 1SQVD 3CC7P 1LT9B 3EWKA 1Q90D 3A3YB 2FXOA 1S4XA 2FYNB 3CCLP 1KV4A 1K04A 2WPVB 1N7LA 4YTPC 1IFDA 5AVZB 2E76C 3OA7A 4NPFX 2KOGA 1M7LA 2O3JA 3RL0C 2E74B 2E5YA 1BE3J 4GODA 3FX0A 5KKZC 3G71P 1AA0A 3H1KG 1XTCC 1URQC 5GTHE 5KTBA 3JCUH 4PD4H 1JY2N 1KN7A 2K9JA 1Q86Q 1OZHA 1OFCX 3L74D 3RL0D 1SQXE 2FFDB 2O1JA 4H44D 2A45H 3CX5E 3PJSK 2OYIB 1NU1J 2C9NY 1EXJA 1RE4A 5AVXB 1URQD 2B87B 2J5UA 4IFDK 3EFFK 3N7NA 3GF7A 1GW4A 4GDOA 1K8AQ 1LT1A 2WT7B 4NPDA 2MJZA 2PGDA 1FZCA 1KYOD 2XNXA 2RKLA 2YO3A 1EZVG 1PPJG 3L72E 2W6AA 5B5EE 1BCCG 2E5TA 2OTKE 2P2UA 3WUUA 1FBMA 2WPRA 1S1CX 4XA4A 3CXHE 5KAIE 1T6AA 4LLHA 1H88A 1AQTA 2LXBA 3TGUJ 2YKOA 1QEXA 4Y28J 2NPSA 2JJLA 5KLVE 4PJ0E 2YIUC 1L2PA 2Z5HA 2K9JB 4I2LC 3H25A 3BVHA 1JMMA 4HKZH 1FAVA 5E79H 3H1JG 3VN0A 2O01H 1VQOP 4XE5B 2LKMA 3L75D 4N78E 2ZFCA 1KYOE 1GL2A 3AEEC 3KPEA 1IJDB 3LW5J 2GA1A 2AEFA 2KIKA 2O1KA 3TK1A 1EXIA 4JYCA 3OW2O 1L0NJ 3A2AA 1KQGB 2JEEA 5TJHA 1JOCA 1VQ6P 1JCDA 1NU1K 1S3JA 1S2EA 3KHUA 2IFNA 1USDA 2AEMA 3MP7B 3IN6A 5B66H 4DJGA 5CBOA 3B5ND 1KILB 1T3UA 3H1ID 2OYOA 2IX7C 2IBZD 1SQPJ 2ITAA 1LT9C 2O01N 3BRTB 1FZGA 1SVFA 3P32A 4M3LA 3CCRP 5APUA 4HH2A 3Q5RA 2FYUG 1LWUA 1KMIZ 1LTJB 1YBKA 2B89A 2MKVA 2W83C 1L0LG 1J1EB 1X9VA 3HTKA 3L4FA 3BCCE 3L70E 2KLUA 2WMMA 3SWKA 3H1IE 3EQ2A 2WSEJ 3G3ZA 2IBZE 2K88A 1L0NK 1NTZG 1CI6B 4U3FG 4PV1B 1RF1B 3U59A 2C0WA 3OJAB 3HUSA 1NTKE 2FFDC 5APSA 3WU2E 1QVGO 1LTTC 2OYIC 3CWBD 3M9QA 5C39A 3VMYA 1NTMK 3M91A 2RN0A 2GM4A 3MGNA 1LWUB 2IZ1A 4W7YA 1BE3G 2P67A 5AW1B 1FDIA 1T8ZA 4W7ZA 1JUNA 1SQPK 5APQA 3Q2YA 3SWFA 2BCCJ 1SQBJ 1SQXJ 1PP9D 1K73Q 2XU6A 1YI2P 1JEKA 1OIPA 2QM8A 1QVFO 3N4XA 2NRGA 4IOIH 4JPZB 2QJKB 3AE3C 1Q81Q 3AEAC 4AYCA 3LIDA 4W80A 1RQUA 3A0HE 1R8EA 3PHLA 2FBWC 3L72J 1URQA 3HUSB 3B71A 4YXDC 3MIWA 1WT6A 1SQQG 3D71A 3D6ZA 2KUBA 3E1RA 4HB1A 3KYQA 3VMXA 5BU5A 5KLVJ 1HBWA 2IZ0A 3IFMA 2P7JA 5APTA 3TSIA 2IDBA 1QX8A 1E5WA 2FKWB 1QGKB 1BGYD 3CX5I 4ZKPA 2NPSC 2M8RA 3PLNA 4KHXA 1KILC 3CLQA 1JY3O 4D6TD 1SQBK 5M1BA 4WY4A 1AQ5A 1Y9BA 4H0LD 4AQRD 1IK9A 2KS1B 1ZRTE 3A5TA 2ZT9C 1KD1Q 2D2CC 3CXHI 2NPSD 2M3BA 1LTJC 1KB9E 1PV3A 3H1HD 3E7KA 1IFPA 1J1EC 1BGYE 1YJ9P 1SP4A 2M5AB 5BVZA 2ZT9D 1GL2D 2WZ7A 2D2CD 1VQNP 1IK7A 3H1LD 1KQFB 3I55P 2V7QH 5AW5B 1OVRA 4PV1C 4IL6H 2V4HA 1Y8AA 1QLED 3BCCJ 3H1HE 3L70J 1NKNA 2JKVA 1NYHA 2E75B 2ZVOB 3CPWO 1NTMD 2W8ZA 2ZAEB 1YITP 2KNCA 1LWUC 4PV1D 4A7PA 1PFIA 3OAKA 1MV8A 1LT9A 3JCUE 4PD4E 1NJIQ 1NTKJ 2QG4A 4MN4C 5GTIE 1VQKP 3C9IA 4OGQD 2FYUJ 2ZYDA 1EDIA 2QJKC 1U7JA 4U7JA 2BEQD 1NHLA 2W90A 4TLFA 3HUSC 1FZEA 1OW8A 1JY2O 1U7MA 3AECC 2YNYA 2A06E 2W6BA 2YMKA 1H0TB 2JR8A 1ZR2A 3CMEP 1GTWA 3KZIH 1SQXG 2IBZI 2KNCB 2HFED 2OYIA 3R4YA 1FOSF 4L74A 1NTZJ 4U3FJ 2I1JA 4WB4A 3TNUA 1ZN5A 2B87A 2J59M 1S9KE 3GW6A 3RBXA 3BASA 1JO5A 2WT7A 5E79E 2RH0A 2W27A 2N9YB 3L72G 2NZ2A 1LJ2A 3L71E 3C8VA 1VL2A 4C46A 4R4LA 2K37A 4TT3H 5APVA 1NTKK 3CCEP 2Y9YA 5AW4B 5KLVG 3ABVC 1X0TA 4HJGH 1SQVE 1SLQA 3UIAA 1GU5A 4BXLA 2FYUK 2R44A 4H13B 2E76D 2WVRA 1FZAA 2JWDA 2VRSA 1L0LK 2H8PD 2YO2A 3FGAD 1ZXGA 3H32A 3A0BH 4EIJA 5B66E 4L75A 3TNUB 1K9MQ 1YJNP 3KQGA 3L35A 1HF9A 3H1KD 1SQQJ 3WUVA 2L5GB 4NPEA 1NTZK 3L73D 4BRYA 2B9BA 4IL6X 1GK6A 5L8RJ 5CHXA 2WWWA 3L74E 4WY4C 5AVUB 1FE6A 5AW7B 2QVAA 3GF3A 2I8DA 2N1TB 1KILA 1ZW0A 1XTGB 1FDOA 5K5GB 5AVTB 4KJMA 3CMAP 4XFJA 3M06A 2WSEH 1EZVD 5AVWB 1VQ8P 2WPSA 4RJTA 2OYHB 1BCCD 2H89C 3MHVA 3HD7B 4WY4D 1OWAA 3CCJP 3L73E 3H32B 1KQSO 4OH8B 1LTJA 3VOPA 1N8RQ 3BCCG 1P84I 3L70G 1YTZI 4BRYB 2L91A 3Q5PA 1AVOA 3MZWB 3H1IG 1J2JB 3H1JD 1KB9I 2R3SA 2QEXP 1AFOA 2WSFJ 3PRJA 1OVVA 1SQQK 2IBZG 4Y99B 1R5LA 3L75E 1CI6A 4UB6H 1RF1A 4DOJA 4JBZA 3RK3B 1LP1B 2AXCA 5CMZA 1NTKG 3Q5SA 3RL0g 1BSNA 1OW6A 3VYIA 3JSVC 3CX5H 1M8OB 1LTSC 1JM0A 1M57D 2K3RA 1PIXA 3V6IA 3BRVB 1FC2C 4EDFA 3CCMP 1VF5B 2FYNC 1N7SB 2YKQA 4O9BA
chains in the Genus database with same CATH topology
3A0HH 5TISH 5B5EH 5KAFH 3JCUH 3A0BH 1S5LH 5E79H 5GTHH 3KZIH 4UB8H 5B66H 5KAIH 4UB6H 4IL6H 2AXTH 5GTIH 3WU2H 5H2FH 4PJ0H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H H;  5TIS H;  5B5E H;  5KAF H;  3JCU H;  3A0B H;  1S5L H;  5E79 H;  5GTH H;  3KZI H;  4UB8 H;  5B66 H;  5KAI H;  4UB6 H;  4IL6 H;  2AXT H;  5GTI H;  3WU2 H;  5H2F H;  4PJ0 H; 
#chains in the Genus database with same CATH topology
 2QSI A;  1TU3 F;  1NOH A;  1HVV A;  2Q9I A;  2E42 A;  2E74 C;  2HG5 D;  5BU8 B;  4DZO A;  3D70 A;  3RK2 B;  1NWQ A;  1NVO A;  3AE7 C;  1ZR4 A;  4PJ0 H;  4PD4 I;  2POH A;  1K05 A;  2ZXX A;  1JTH B;  1X79 B;  2Q6Q A;  1BSH A;  1JCC A;  1FZB A;  4I6M C;  3HRN A;  1L0L D;  1RH5 B;  2E74 D;  4CPG A;  3L71 J;  4N6J A;  4GT1 A;  4RKU J;  1G2C B;  1WMK A;  1GZL A;  2SPZ A;  4AUW A;  1QL2 A;  4LC1 A;  5AVY B;  1VQ4 P;  1SQV J;  1RQV A;  1N2D C;  4GOF A;  2UWJ E;  4OWF A;  3AE8 C;  1OVU A;  1RY3 A;  3F89 A;  5TIS H;  1T2K C;  5AW3 B;  1IFN A;  3TYY A;  1VQM P;  1YQ4 C;  3CWB E;  2BEZ F;  2C0X A;  1Y47 A;  1NAY A;  3QWO C;  2K9Y A;  1BE3 D;  3AE2 C;  4YXW H;  4EOT A;  4YPC A;  1LGH B;  2KS1 A;  2OYH C;  1HJ0 A;  4OVN F;  1LTB C;  3HD7 C;  1X22 A;  3RBZ A;  2IYP A;  2JP3 A;  3L74 J;  4DT0 A;  3FWN A;  1PP9 E;  5H2F H;  3SWY A;  1HGZ A;  1RE3 C;  1JNM A;  2LR2 A;  4ZKU A;  1BGY G;  2QRX A;  1N86 A;  1NU1 D;  1GD2 E;  2M5A A;  2KLV A;  2CPB A;  2WSC J;  3PH0 A;  3H6P A;  1IFM A;  2OTL P;  4Y99 C;  2FYZ A;  2WSS H;  1G1J A;  1MZ9 A;  1VQP P;  1S5L H;  3HE5 B;  1SQX K;  1IFJ A;  1MFT A;  3H1H G;  3TGU D;  1IFI A;  4I1L A;  1DH3 A;  1DEE G;  1NU1 E;  2GUV A;  1N73 B;  4H44 B;  1VF5 C;  1KIL D;  1VQL P;  3V2R A;  3L75 J;  3S9O A;  3ITK A;  1KZU B;  3G6E P;  1PZQ A;  3GHG B;  1Q82 Q;  2QJP B;  3PP5 A;  3RK2 C;  4D6T E;  5KLV K;  1KYO I;  1EDL A;  3V5B A;  2H7H A;  2A45 G;  1VF5 D;  3TGU E;  1L0N D;  5APX A;  2AXT H;  1PGJ A;  5CCH A;  1HH0 A;  1RF1 C;  3LIE A;  4K35 A;  1M1J B;  1KIL E;  1Z56 A;  4I7Z B;  2Q3E A;  2E43 A;  2KP8 A;  4GOE A;  4C7R A;  2A06 G;  1YIJ P;  1H0T A;  3H1I J;  1SFC B;  2XKM A;  3RGU A;  1J1D B;  2JWA A;  4R4M A;  2Q5U A;  5CBN A;  3WUT A;  1FDM A;  3H1L E;  1L0N E;  1SQP D;  4C7N A;  3MD0 A;  3L37 A;  2Y0E A;  2KSJ A;  5AVR B;  3L71 G;  2IPP A;  1G1I A;  2QJY B;  3A0B E;  1CW5 A;  1NTM E;  4WBA A;  2J58 A;  1PGP A;  2PAJ A;  3B5N B;  3CC2 P;  2ZYG A;  3T97 B;  1SQV G;  2Y9Z A;  2OAR A;  5DJU B;  1P84 H;  1SQP E;  3CCU P;  5APW A;  2Z5I A;  3F5H A;  4DCK A;  1FZF A;  3CWB J;  2FXM A;  3VMZ A;  2P1J A;  1USE A;  4C7N B;  2LXC B;  1D7M A;  1L4A B;  3A7O A;  2HPC A;  2GUS A;  4L76 A;  1M1K Q;  2OTJ P;  3AED C;  1PP9 J;  3U1C A;  3LW5 H;  1S5L X;  2BCC D;  1SQB D;  5CJ4 A;  1SQX D;  1KC8 Q;  3L74 G;  1DD3 A;  3G9R A;  3R2P A;  3CX5 D;  3MUD A;  1Q2N A;  3NMD A;  1FJK A;  2N1T A;  4UB8 H;  2OGU A;  1VQ7 P;  1RHZ B;  2G8Y A;  1N73 C;  1IC2 A;  4H44 C;  2DW3 A;  2PRR A;  1ZLL A;  3M0A A;  2OYH A;  3BAT A;  4EYY Q;  3L72 D;  1DX7 A;  2QE7 H;  2YMY A;  2WSF H;  3HD7 A;  3SFD C;  5KAF H;  2HYN A;  1A02 F;  2KYV A;  2ZXE B;  3L73 G;  3CXH D;  3PTZ A;  4UB6 E;  1WRG A;  3GHG C;  3Q3D A;  1ZP0 C;  2QJP C;  1RE3 A;  5GTI H;  2BCC E;  1SQB E;  5KLV D;  1IZN B;  2CPS A;  2KB7 P;  3CC4 P;  2HPC B;  1EC5 A;  4K3A A;  2C9L Y;  2JDI H;  1OMI A;  2M3E A;  1KTM A;  1JY3 P;  3FXE A;  1OW7 A;  4GIF A;  1BGY J;  1M1J C;  4N78 D;  1AVY A;  4I7Z C;  2OQQ A;  2KI7 B;  3L75 G;  1KFN A;  2E75 C;  3NXS A;  1SFC C;  5CJ0 A;  4D6T J;  4ZMD A;  1LP1 A;  1J1D C;  2B88 A;  1W5C E;  3AEF C;  3H1K E;  2ZYA A;  5AW8 B;  5KJ7 A;  1PPJ D;  2AEJ A;  3M9H A;  3GLM A;  1AV1 A;  2YKP A;  3ZDM A;  5AVQ B;  1MKM A;  5CCG C;  2E75 D;  1N7S A;  3CCQ P;  3USS A;  3H1H J;  1SFC D;  4JF7 A;  3TDK A;  2H88 C;  3IAO A;  1RF0 A;  2QJY C;  4LGD E;  1ZME C;  4IFM A;  1A02 J;  4RES B;  5CCH C;  3NTN A;  3H1L J;  5CCG D;  1DD4 A;  1E79 H;  3B5N C;  5GTH H;  3U1A A;  1FZC B;  2IYO A;  1M56 D;  1EZV E;  1PPJ E;  1JTH A;  1BDC A;  1BCC E;  1GK4 A;  2RMZ A;  1NO4 A;  2H43 A;  4H0L B;  4IFF A;  3TF5 A;  3KDP B;  5TIS E;  1U57 A;  4KT0 J;  1YYC A;  3V4Q A;  5CCH D;  5AW6 B;  1JB0 J;  1G2C A;  2NPS B;  3BCC D;  1EDJ A;  3L70 D;  1NTM J;  5AVV B;  3M9B A;  3H1J E;  1L4A C;  1NGM B;  4L73 A;  1H89 A;  4RO0 A;  4N3Y B;  2ZT9 B;  1GL2 B;  5AW2 B;  5B5E H;  3G4S P;  2D2C B;  2G3A A;  3S1K A;  3CXH H;  2FY8 A;  5KAI H;  5EFW B;  1GW3 A;  1NTK D;  1YTZ T;  5H2F E;  2Y0C A;  2QM7 A;  1JY2 P;  1VQ5 P;  1L4A D;  3CWB G;  1YQ3 C;  2YXR B;  3C1L A;  2IFM A;  1AJY A;  2FYU D;  5APY A;  3P8C D;  4H13 C;  3P8M C;  2R32 A;  2QA4 P;  2O01 J;  3M0D C;  1CSB A;  2Q3I A;  2Q7C A;  1CZQ A;  2WSC H;  2A45 I;  3AE6 C;  1KYO H;  1OX3 A;  2KSE A;  2KZJ A;  1GMJ A;  2WQY C;  1GDT A;  1S5L E;  2N9B A;  3JC2 2;  2HOD A;  3SSU A;  1PP9 G;  3E1I A;  4JYB A;  3VP8 A;  4H13 D;  1LTI C;  1GU4 A;  1NTZ D;  2P10 A;  2Y0D A;  4U3F D;  1PGQ A;  1MUU A;  1JMB A;  2FYU E;  3P8C E;  1LTA C;  4OGQ B;  1L0L E;  2YXQ B;  3MUD C;  4Z1M H;  2N1T C;  3HTK B;  1FJP A;  3HE5 A;  3AE1 C;  1ZV8 A;  3HE4 A;  1W2E A;  2ZJS E;  2XV5 A;  3K5B A;  1SS1 A;  2WTY A;  3FXD A;  1UII A;  1T2K D;  3L36 A;  2XZR A;  1NTZ E;  4U3F E;  1N73 A;  1NU1 G;  5KLI B;  2AXT E;  1ZOY C;  4IL6 E;  3SFE C;  2WIT A;  2N1T D;  3QH9 A;  2HOD B;  4QMA A;  1HTL C;  2WPQ A;  1DIP A;  3CCS P;  3D6Y A;  3GHG A;  1NAF A;  1RE4 C;  4GKG A;  3W67 A;  3I56 P;  5DJT B;  3H1K J;  2HLO A;  3HD7 D;  4D6T G;  3O6Q A;  1BE3 E;  2ZVN B;  1SQQ D;  1SQV K;  1ZRT D;  1FZC C;  3L73 J;  3TGU G;  3AE4 C;  1P84 D;  2HR3 A;  5AW9 B;  3CD6 P;  4H0L C;  2W6J H;  2XDJ A;  3KXD A;  3RK3 C;  3S4R A;  1KB9 D;  1M1J A;  2QIW A;  1KQL A;  3HE4 B;  1HGV A;  4HYT B;  3WU2 H;  2KK7 A;  5KJ7 C;  2E76 B;  1SFC A;  1FS0 E;  3AE5 C;  3RL0 B;  3CCV P;  4ZNC A;  2KZI A;  1DEB A;  2KXP B;  5KKZ B;  1N7S C;  3Q1M A;  1EDK A;  3CL3 D;  1BCC J;  1URQ B;  3RK3 D;  3V2P A;  3VMA A;  1SQQ E;  3H1L G;  1EQ7 A;  1YHQ P;  1GL2 C;  1S72 P;  1HWT C;  1L0N G;  1RF0 C;  5CCG A;  1P84 E;  3V2N A;  5KJ7 D;  4ASW A;  1FOS E;  3KZI E;  1UIX A;  3V2Q A;  3VP9 A;  2PP6 A;  3O6Q B;  1N7S D;  3NFQ A;  1W2B O;  3EFG A;  2M0B A;  3H1J J;  4WVZ A;  1NTM G;  3A0H H;  1H8A A;  3W68 A;  3GMA A;  1PGO A;  3B5N A;  2I1K A;  4BWN A;  3T97 A;  3RK2 D;  4PD4 D;  4B86 A;  3RK3 E;  1HJB A;  1KFM A;  1SQP G;  4WWI A;  2JO1 A;  1KOR A;  1JY3 N;  3IF4 A;  4WY4 B;  2CK3 H;  2BAS A;  1EZV I;  1OXZ A;  2YIU B;  3WMM 0;  1BDD A;  4UB8 E;  2PFX A;  1NH4 A;  2XND H;  3V4W A;  1L4A A;  5AVS B;  1R5S A;  1PL5 A;  3MTU E;  4OGQ C;  3B8E B;  1VDF A;  2R5D A;  2A06 D;  1MFZ A;  5KAF E;  1LNQ A;  2Z4E A;  2Q1K A;  5AW0 B;  3I5C A;  1LTG C;  2FXP A;  3P7K A;  3II6 A;  1Q7Y Q;  1NKZ B;  1FU1 A;  1M90 Q;  1HUC A;  1S9K D;  3CI9 A;  5KLI C;  3AEG C;  3AE9 C;  3M0D A;  4EI2 A;  2K1A A;  1L0L J;  3FWL A;  1KB9 H;  2R3C A;  3L71 D;  3IR9 A;  1X8Y A;  3O8Z A;  1VQ9 P;  4ASV A;  3VTP C;  2P58 A;  1IO4 A;  3B4S A;  1YJW P;  1QL1 A;  2BCC G;  4JQ0 D;  2FFD A;  2R5B A;  1SQB G;  3GG2 A;  1VPC A;  2V7Q J;  1T3J A;  3AEB C;  1SQV D;  3CC7 P;  1LT9 B;  3EWK A;  1Q90 D;  3A3Y B;  2FXO A;  1S4X A;  2FYN B;  3CCL P;  1KV4 A;  1K04 A;  2WPV B;  1N7L A;  4YTP C;  1IFD A;  5AVZ B;  2E76 C;  3OA7 A;  4NPF X;  2KOG A;  1M7L A;  2O3J A;  3RL0 C;  2E74 B;  2E5Y A;  1BE3 J;  4GOD A;  3FX0 A;  5KKZ C;  3G71 P;  1AA0 A;  3H1K G;  1XTC C;  1URQ C;  5GTH E;  5KTB A;  3JCU H;  4PD4 H;  1JY2 N;  1KN7 A;  2K9J A;  1Q86 Q;  1OZH A;  1OFC X;  3L74 D;  3RL0 D;  1SQX E;  2FFD B;  2O1J A;  4H44 D;  2A45 H;  3CX5 E;  3PJS K;  2OYI B;  1NU1 J;  2C9N Y;  1EXJ A;  1RE4 A;  5AVX B;  1URQ D;  2B87 B;  2J5U A;  4IFD K;  3EFF K;  3N7N A;  3GF7 A;  1GW4 A;  4GDO A;  1K8A Q;  1LT1 A;  2WT7 B;  4NPD A;  2MJZ A;  2PGD A;  1FZC A;  1KYO D;  2XNX A;  2RKL A;  2YO3 A;  1EZV G;  1PPJ G;  3L72 E;  2W6A A;  5B5E E;  1BCC G;  2E5T A;  2OTK E;  2P2U A;  3WUU A;  1FBM A;  2WPR A;  1S1C X;  4XA4 A;  3CXH E;  5KAI E;  1T6A A;  4LLH A;  1H88 A;  1AQT A;  2LXB A;  3TGU J;  2YKO A;  1QEX A;  4Y28 J;  2NPS A;  2JJL A;  5KLV E;  4PJ0 E;  2YIU C;  1L2P A;  2Z5H A;  2K9J B;  4I2L C;  3H25 A;  3BVH A;  1JMM A;  4HKZ H;  1FAV A;  5E79 H;  3H1J G;  3VN0 A;  2O01 H;  1VQO P;  4XE5 B;  2LKM A;  3L75 D;  4N78 E;  2ZFC A;  1KYO E;  1GL2 A;  3AEE C;  3KPE A;  1IJD B;  3LW5 J;  2GA1 A;  2AEF A;  2KIK A;  2O1K A;  3TK1 A;  1EXI A;  4JYC A;  3OW2 O;  1L0N J;  3A2A A;  1KQG B;  2JEE A;  5TJH A;  1JOC A;  1VQ6 P;  1JCD A;  1NU1 K;  1S3J A;  1S2E A;  3KHU A;  2IFN A;  1USD A;  2AEM A;  3MP7 B;  3IN6 A;  5B66 H;  4DJG A;  5CBO A;  3B5N D;  1KIL B;  1T3U A;  3H1I D;  2OYO A;  2IX7 C;  2IBZ D;  1SQP J;  2ITA A;  1LT9 C;  2O01 N;  3BRT B;  1FZG A;  1SVF A;  3P32 A;  4M3L A;  3CCR P;  5APU A;  4HH2 A;  3Q5R A;  2FYU G;  1LWU A;  1KMI Z;  1LTJ B;  1YBK A;  2B89 A;  2MKV A;  2W83 C;  1L0L G;  1J1E B;  1X9V A;  3HTK A;  3L4F A;  3BCC E;  3L70 E;  2KLU A;  2WMM A;  3SWK A;  3H1I E;  3EQ2 A;  2WSE J;  3G3Z A;  2IBZ E;  2K88 A;  1L0N K;  1NTZ G;  1CI6 B;  4U3F G;  4PV1 B;  1RF1 B;  3U59 A;  2C0W A;  3OJA B;  3HUS A;  1NTK E;  2FFD C;  5APS A;  3WU2 E;  1QVG O;  1LTT C;  2OYI C;  3CWB D;  3M9Q A;  5C39 A;  3VMY A;  1NTM K;  3M91 A;  2RN0 A;  2GM4 A;  3MGN A;  1LWU B;  2IZ1 A;  4W7Y A;  1BE3 G;  2P67 A;  5AW1 B;  1FDI A;  1T8Z A;  4W7Z A;  1JUN A;  1SQP K;  5APQ A;  3Q2Y A;  3SWF A;  2BCC J;  1SQB J;  1SQX J;  1PP9 D;  1K73 Q;  2XU6 A;  1YI2 P;  1JEK A;  1OIP A;  2QM8 A;  1QVF O;  3N4X A;  2NRG A;  4IOI H;  4JPZ B;  2QJK B;  3AE3 C;  1Q81 Q;  3AEA C;  4AYC A;  3LID A;  4W80 A;  1RQU A;  3A0H E;  1R8E A;  3PHL A;  2FBW C;  3L72 J;  1URQ A;  3HUS B;  3B71 A;  4YXD C;  3MIW A;  1WT6 A;  1SQQ G;  3D71 A;  3D6Z A;  2KUB A;  3E1R A;  4HB1 A;  3KYQ A;  3VMX A;  5BU5 A;  5KLV J;  1HBW A;  2IZ0 A;  3IFM A;  2P7J A;  5APT A;  3TSI A;  2IDB A;  1QX8 A;  1E5W A;  2FKW B;  1QGK B;  1BGY D;  3CX5 I;  4ZKP A;  2NPS C;  2M8R A;  3PLN A;  4KHX A;  1KIL C;  3CLQ A;  1JY3 O;  4D6T D;  1SQB K;  5M1B A;  4WY4 A;  1AQ5 A;  1Y9B A;  4H0L D;  4AQR D;  1IK9 A;  2KS1 B;  1ZRT E;  3A5T A;  2ZT9 C;  1KD1 Q;  2D2C C;  3CXH I;  2NPS D;  2M3B A;  1LTJ C;  1KB9 E;  1PV3 A;  3H1H D;  3E7K A;  1IFP A;  1J1E C;  1BGY E;  1YJ9 P;  1SP4 A;  2M5A B;  5BVZ A;  2ZT9 D;  1GL2 D;  2WZ7 A;  2D2C D;  1VQN P;  1IK7 A;  3H1L D;  1KQF B;  3I55 P;  2V7Q H;  5AW5 B;  1OVR A;  4PV1 C;  4IL6 H;  2V4H A;  1Y8A A;  1QLE D;  3BCC J;  3H1H E;  3L70 J;  1NKN A;  2JKV A;  1NYH A;  2E75 B;  2ZVO B;  3CPW O;  1NTM D;  2W8Z A;  2ZAE B;  1YIT P;  2KNC A;  1LWU C;  4PV1 D;  4A7P A;  1PFI A;  3OAK A;  1MV8 A;  1LT9 A;  3JCU E;  4PD4 E;  1NJI Q;  1NTK J;  2QG4 A;  4MN4 C;  5GTI E;  1VQK P;  3C9I A;  4OGQ D;  2FYU J;  2ZYD A;  1EDI A;  2QJK C;  1U7J A;  4U7J A;  2BEQ D;  1NHL A;  2W90 A;  4TLF A;  3HUS C;  1FZE A;  1OW8 A;  1JY2 O;  1U7M A;  3AEC C;  2YNY A;  2A06 E;  2W6B A;  2YMK A;  1H0T B;  2JR8 A;  1ZR2 A;  3CME P;  1GTW A;  3KZI H;  1SQX G;  2IBZ I;  2KNC B;  2HFE D;  2OYI A;  3R4Y A;  1FOS F;  4L74 A;  1NTZ J;  4U3F J;  2I1J A;  4WB4 A;  3TNU A;  1ZN5 A;  2B87 A;  2J59 M;  1S9K E;  3GW6 A;  3RBX A;  3BAS A;  1JO5 A;  2WT7 A;  5E79 E;  2RH0 A;  2W27 A;  2N9Y B;  3L72 G;  2NZ2 A;  1LJ2 A;  3L71 E;  3C8V A;  1VL2 A;  4C46 A;  4R4L A;  2K37 A;  4TT3 H;  5APV A;  1NTK K;  3CCE P;  2Y9Y A;  5AW4 B;  5KLV G;  3ABV C;  1X0T A;  4HJG H;  1SQV E;  1SLQ A;  3UIA A;  1GU5 A;  4BXL A;  2FYU K;  2R44 A;  4H13 B;  2E76 D;  2WVR A;  1FZA A;  2JWD A;  2VRS A;  1L0L K;  2H8P D;  2YO2 A;  3FGA D;  1ZXG A;  3H32 A;  3A0B H;  4EIJ A;  5B66 E;  4L75 A;  3TNU B;  1K9M Q;  1YJN P;  3KQG A;  3L35 A;  1HF9 A;  3H1K D;  1SQQ J;  3WUV A;  2L5G B;  4NPE A;  1NTZ K;  3L73 D;  4BRY A;  2B9B A;  4IL6 X;  1GK6 A;  5L8R J;  5CHX A;  2WWW A;  3L74 E;  4WY4 C;  5AVU B;  1FE6 A;  5AW7 B;  2QVA A;  3GF3 A;  2I8D A;  2N1T B;  1KIL A;  1ZW0 A;  1XTG B;  1FDO A;  5K5G B;  5AVT B;  4KJM A;  3CMA P;  4XFJ A;  3M06 A;  2WSE H;  1EZV D;  5AVW B;  1VQ8 P;  2WPS A;  4RJT A;  2OYH B;  1BCC D;  2H89 C;  3MHV A;  3HD7 B;  4WY4 D;  1OWA A;  3CCJ P;  3L73 E;  3H32 B;  1KQS O;  4OH8 B;  1LTJ A;  3VOP A;  1N8R Q;  3BCC G;  1P84 I;  3L70 G;  1YTZ I;  4BRY B;  2L91 A;  3Q5P A;  1AVO A;  3MZW B;  3H1I G;  1J2J B;  3H1J D;  1KB9 I;  2R3S A;  2QEX P;  1AFO A;  2WSF J;  3PRJ A;  1OVV A;  1SQQ K;  2IBZ G;  4Y99 B;  1R5L A;  3L75 E;  1CI6 A;  4UB6 H;  1RF1 A;  4DOJ A;  4JBZ A;  3RK3 B;  1LP1 B;  2AXC A;  5CMZ A;  1NTK G;  3Q5S A;  3RL0 g;  1BSN A;  1OW6 A;  3VYI A;  3JSV C;  3CX5 H;  1M8O B;  1LTS C;  1JM0 A;  1M57 D;  2K3R A;  1PIX A;  3V6I A;  3BRV B;  1FC2 C;  4EDF A;  3CCM P;  1VF5 B;  2FYN C;  1N7S B;  2YKQ A;  4O9B A; 
#chains in the Genus database with same CATH homology
 3A0H H;  5TIS H;  5B5E H;  5KAF H;  3JCU H;  3A0B H;  1S5L H;  5E79 H;  5GTH H;  3KZI H;  4UB8 H;  5B66 H;  5KAI H;  4UB6 H;  4IL6 H;  2AXT H;  5GTI H;  3WU2 H;  5H2F H;  4PJ0 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...