2ZFCA

X-ray crystal structure of an engineered n-terminal hiv-1 gp41 trimer with enhanced stability and potency
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
44
structure length
44
Chain Sequence
VSGLVQQQNNILRALEATQHAVQALVWGVKQLQARVLALERYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of an engineered N-terminal HIV-1 gp41 trimer with enhanced stability and potency
pubmed doi rcsb
molecule tags Viral protein
molecule keywords HIV-1 GP41
total genus 19
structure length 44
sequence length 44
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-12-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2zfcA00
3TNUB 3HE4A 2P67A 3V4WA 4M3LA 4DZOA 1MFZA 1H8AA 5AW8B 3NMDA 2BASA 5AW3B 3VN0A 1CI6B 3P7KA 1CI6A 3VMXA 1S9KD 2YO3A 2H7HA 2W6AA 4XE5B 1KQLA 2XV5A 3NTNA 4AYCA 1YYCA 3HE4B 1CZQA 5APSA 4AUWA 3B8EB 2Z5HA 2XZRA 2N9BA 5APXA 3MD0A 5APWA 3OAKA 3LIDA 3M0AA 3M91A 1GZLA 1H88A 1FOSF 4KHXA 5APTA 5AVQB 1DH3A 2VRSA 1H89A 2E42A 1MUUA 3M06A 2YO2A 4C7NB 3MGNA 1GK6A 5AVTB 4HYTB 5AVWB 3M9BA 5APUA 5AVRB 1FOSE 2R32A 4AQRD 1JNMA 3TNUA 2IPPA 2R5BA 1J2JB 1HWTC 2WPSA 5AW9B 5AW2B 3TK1A 1IO4A 3HTKA 5CMZA 5APQA 5APYA 5AVYB 5APVA 3VMYA 1S9KE 2YNYA 3V5BA 3A5TA 2R3CA 5AVVB 1HJBA 1JUNA 2P7JA 2R5DA 3A2AA 4GT1A 5AW1B 2XU6A 3UIAA 2P2UA 1G2CB 4EOTA 1X8YA 3A7OA 1SP4A 3LIEA 5AW6B 4B86A 1OWAA 5AVZB 2WTYA 2W27A 3KQGA 2Q3IA 2C9NY 2E43A 1CSBA 1T2KC 5AW7B 1SLQA 2ZFCA 3VYIA 1HUCA 1GU5A 5AVXB 2JJLA 2Q5UA 3NXSA 3VMZA 3L37A 1GU4A 2KP8A 5AW4B 3I5CA 3SWFA 4I6MC 5AVSB 3P32A 2WPRA 1GK4A 2WPQA 1FAVA 3T97A 2C9LY 3L35A 1MV8A 1NAFA 3KDPB 3HE5A 1GD2E 1HBWA 3M9HA 3V4QA 4LC1A 3A3YB 3TYYA 2Q7CA 2QM8A 4I2LC 3M0DA 2ZXEB 4JYCA 3L36A 4GKGA 3O8ZA 4RESB 3HE5B 4C46A 2WT7A 3VTPC 5AW0B 2WT7B 1T2KD 4JYBA 1GTWA 5AW5B 2WWWA 3IR9A 3NFQA 4C7NA 1NWQA 2Z5IA 1A02J 1OXZA 1A02F 3P8MC 2QM7A 5AVUB
chains in the Genus database with same CATH superfamily
3L4FA 4YXWH 3Q5PA 2QJYB 2NPSB 3AECC 1JY2P 1K05A 1N7LA 2ZYGA 3IF4A 3NMDA 2ZJSE 2B9BA 2KSEA 4L76A 2FYUD 1IFMA 1CW5A 1YTZT 1OW8A 3VN0A 4JPZB 1KB9D 3VMXA 4JF7A 2H7HA 4Y99B 4BXLA 1OW6A 1L0NK 2QA4P 5DJUB 1FJKA 1IFNA 4XE5B 2B87B 5BU5A 1GL2D 1JTHA 3NTNA 2ZVOB 5TJHA 4W7ZA 1URQD 3VOPA 3WUUA 1JY3N 1OIPA 2LXCB 1SQXJ 3L71E 3KYQA 5CCGA 4IL6E 2IBZE 3I55P 2K9YA 2WSEJ 3M0AA 1Y47A 3HUSA 1J1DC 1QVGO 4L73A 1LWUA 3G4SP 1QLED 1W5CE 2AXTH 2PRRA 4HH2A 1NAYA 4B86A 3BATA 5AVQB 2ZT9D 1JMMA 1SFCB 4W80A 5CCGC 1NTKG 2VRSA 1NU1K 2QJPB 1GL2A 3FXDA 3O6QA 1LJ2A 2OYHB 4D6TE 1URQA 3AE3C 1PP9G 1SS1A 2UWJE 2CPSA 1SQQK 1L0NG 2WSCH 3AEEC 3B5NB 1SQQJ 3H1HG 2FYUE 2JWDA 1NU1G 2Y0EA 1FJPA 5AVRB 3Q3DA 1BGYD 2W6JH 1KB9H 2WSFH 4OGQB 3TGUE 4AQRD 1ZN5A 2N1TA 1FZCC 3AEDC 1K8AQ 3H6PA 2YKOA 4H44D 4BRYB 1EDJA 1QEXA 2NPSA 3E7KA 3TK1A 3GMAA 1U7JA 3HTKA 2KNCA 4QMAA 1S5LX 3L73G 1RF1C 2OTKE 3L72E 4I1LA 3L74J 5AVVB 2P7JA 5AW1B 1HJBA 3CMEP 1JUNA 1FS0E 1LT9B 3KZIE 4HJGH 3UIAA 3V2QA 3A7OA 2FY8A 5B5EE 3LIEA 4EI2A 2CK3H 3CWBE 1VF5B 5AW6B 1OWAA 5BVZA 5CBNA 1N73A 3MZWB 1HVVA 1U57A 3L75E 2Y9ZA 1URQC 5AW7B 1T2KC 2J59M 4DOJA 2N1TD 2NZ2A 3VYIA 3S4RA 1NTZG 1SQVE 3H25A 1KFNA 3AEAC 2JJLA 1KILD 2SPZA 4PJ0E 4OWFA 1L0NJ 5AW4B 1QL1A 3ITKA 3EWKA 3L73J 1FBMA 3PH0A 4BWNA 1VQPP 1RH5B 1SQQD 1Q7YQ 1Y8AA 1USDA 1ZW0A 3PTZA 4K35A 5L8RJ 4GIFA 3CL3D 2W83C 3H1HJ 4GOEA 1H0TA 1AVYA 5B66H 1EZVE 2QJKC 5TISH 5KTBA 4A7PA 1K73Q 1X9VA 3HRNA 4WY4A 2WPQA 1GK4A 2OGUA 1K9MQ 3AE8C 1ZP0C 5KAIH 2C0XA 1FAVA 3TDKA 1JCDA 2E5TA 3C1LA 3CD6P 2QG4A 1MV8A 4L75A 4N6JA 3VMAA 3HE5A 1PGJA 1HBWA 2OYHC 2LR2A 1GD2E 3U1AA 4ZKUA 2HYNA 1Q2NA 2WPVB 1N2DC 3U59A 1BSHA 2IBZI 1SFCC 3N7NA 1N73C 1PPJE 2QM8A 3CLQA 1NJIQ 1PGOA 2FXPA 4I2LC 2C0WA 2A45I 4U3FE 2IFNA 2JWAA 4U7JA 4RESB 4GOFA 3H32A 3BRTB 2WT7A 1T2KD 3H1KD 1HGZA 1T8ZA 1H0TB 2A06D 2N1TC 5AW5B 3TSIA 4JQ0D 1FZCA 2WWWA 1PL5A 3IR9A 3NFQA 1R5LA 1BCCG 2YKPA 3MIWA 3PP5A 1KILC 3RL0C 4C7NA 4C7NB 3Q2YA 1NO4A 3GHGC 3H1JJ 2HPCA 1L0NE 3VP9A 2HPCB 1VQKP 3AE2C 2H88C 2PP6A 2E75C 1JB0J 1D7MA 2M5AB 3L72J 3GF3A 5B66E 1FDMA 1QGKB 2QJPC 3HD7A 4YTPC 1FC2C 1NTKE 1RF0A 2OYIC 2P67A 3QH9A 3V4WA 1IZNB 2AEJA 1H8AA 2QVAA 3L71D 5K5GB 3OW2O 2BASA 1RHZB 5AW3B 3CC2P 1RQUA 3IFMA 2ZAEB 1USEA 3MHVA 2O01N 2M3EA 2MJZA 2E76D 1OFCX 4RKUJ 1N7SC 2E74C 3H1ID 4D6TJ 1KQLA 1AJYA 1P84E 2XV5A 5GTHE 5GTHH 1YYCA 1M8OB 2IFMA 1W2EA 3CCVP 1KZUB 2NRGA 2ZT9B 1KQSO 2WMMA 1LTSC 2A06E 2N9BA 4Y99C 2ZYDA 3LIDA 1AVOA 2JO1A 3GW6A 5KAFE 4LLHA 5M1BA 1FOSF 1YJWP 4KHXA 3AEFC 1DH3A 1IFIA 2Y9YA 3K5BA 1H89A 1N86A 1RE4C 5GTIE 1YJ9P 2E42A 1NU1D 3M06A 1BGYJ 1EZVI 3WU2E 1L0ND 1MZ9A 1J1EB 4CPGA 1DIPA 2E76B 1LT9C 2GA1A 2KZIA 2A06G 1N7SA 4HYTB 3V2RA 3II6A 1LWUB 3M9BA 5APUA 2QJKB 3AEGC 4D6TG 3L74E 1FOSE 1SQPG 1BE3E 1LGHB 2HLOA 3KZIH 3TNUA 1DEEG 1VPCA 3PRJA 1FZBA 2WPSA 5AW9B 3VP8A 1T3JA 3EQ2A 1OMIA 2XNDH 1LTJA 1GW4A 2BCCE 4L74A 1RE3A 2R3CA 3A5TA 2R5DA 3A2AA 3P8CD 2IBZG 1G2CA 1N7SB 2E74B 2P2UA 3LW5J 1X8YA 2D2CB 1ZV8A 4GODA 4WB4A 5DJTB 2PAJA 5CJ4A 1HH0A 1OVVA 1GW3A 1N7SD 2E74D 2K9JB 2KIKA 2KS1A 2KZJA 2M5AA 3GHGA 3KQGA 3L74G 3MP7B 3U1CA 1BGYE 3D6ZA 3CCQP 3IN6A 1OVUA 2FKWB 1HUCA 3PJSK 4KJMA 1L0LG 2Q1KA 1Z56A 1ZOYC 2HODA 1S2EA 2Q5UA 1BCCE 3B5NA 3TGUJ 3VMZA 1KC8Q 1ZRTE 1KQFB 2KP8A 2FFDA 1WT6A 2CPBA 2Z4EA 3WMM0 1SQQG 2K3RA 3MUDA 1L0LK 3N4XA 3A0BH 3GHGB 2WSFJ 1WMKA 1PIXA 1LTJC 2DW3A 2FYUK 2Q3EA 1JY3O 1QX8A 3E1IA 1FZCB 3BCCG 1L4AC 4PV1D 2WSSH 4HKZH 1YITP 3L75D 3SWFA 2OYHA 1EXIA 2O1JA 1VQ6P 1SQXK 4IL6H 3L70G 1SQVK 1SQBD 3FXEA 4XA4A 1NTKK 1Y9BA 3HUSB 4UB8H 3Q1MA 4UB8E 1LTIC 3T97B 3T97A 3LW5H 3SFEC 1YHQP 1P84I 4WVZA 2BCCJ 1HJ0A 1JTHB 3KDPB 1JO5A 2XDJA 1AFOA 2QRXA 3RBXA 2I8DA 3G9RA 2KLUA 2MKVA 3SSUA 3M9HA 1BDDA 3B71A 1PFIA 4LC1A 2G3AA 4DCKA 1X79B 1Q81Q 1NHLA 2M3BA 2YIUB 1ZR2A 1NOHA 5CCHC 1E79H 2FYUJ 4IFFA 4IOIH 4JBZA 2N1TB 2O1KA 4HB1A 2AEFA 3I56P 1VQ8P 4PD4D 1KQGB 3S9OA 1M90Q 3CC4P 3USSA 2AXCA 1K04A 3VTPC 2W8ZA 3HD7C 1BCCD 1HTLC 1EDKA 1PGPA 1SQVG 2PFXA 3IAOA 5KKZC 3BASA 3SFDC 1AQTA 3CCUP 1BDCA 4O9BA 2FYNB 3L72D 3P8CE 3CWBG 3H1LD 1IK7A 1NTZK 4N3YB 4WWIA 3JCUE 4KT0J 1Q82Q 4H44B 1MKMA 4U3FD 2WVRA 2ZXXA 3CWBD 3GLMA 3H1LG 1RF1A 1ZMEC 3L70D 4PV1C 3JSVC 3FGAD 2HG5D 2A45H 3BRVB 1SQPJ 3H1KE 5KLVD 1AQ5A 2Q6QA 4PJ0H 1R5SA 3AE6C 1LTAC 2V7QJ 1BE3G 1SQPE 1ZLLA 2W6AA 3CC7P 3AE9C 1KN7A 1S72P 3TGUD 4AYCA 3Q5SA 1L0LE 2P10A 1SQPD 3H1HE 2M0BA 2FYUG 4I7ZB 3D71A 3RL0g 3CMAP 3CXHD 3H1JD 3MD0A 1PP9D 2LXBA 3L73E 1PP9J 3OAKA 5APWA 3RK2C 3EFGA 3A0BE 2KK7A 2QSIA 2WT7B 2E76C 1UIXA 3H1KG 3M91A 3CXHE 3H1JE 2KSJA 3CXHH 4XFJA 1H88A 1NTMG 4UB6H 1KFMA 2K88A 2W6BA 1NKNA 1S5LH 3B5NC 1L2PA 1S5LE 1MUUA 3H1IE 1GL2B 1KTMA 3F5HA 4PV1B 5CBOA 2QM7A 2KYVA 1NTMK 3MUDC 1KMIZ 2YO2A 5KJ7D 3MGNA 1YTZI 3L71G 1FU1A 3CI9A 5AVTB 5AVWB 2KOGA 1EDLA 2FYNC 4EIJA 3L70J 1PPJD 2IYOA 2NPSD 2IPPA 2IZ0A 2KUBA 2V7QH 1KILB 3GF7A 3PHLA 4H13C 1R8EA 2O01H 3CCSP 2ZYAA 5AW2B 1YIJP 2QIWA 2ITAA 1SVFA 2W90A 2H8PD 3BCCE 5CMZA 1S4XA 1KYOI 2GUSA 5APQA 5APVA 5AVYB 3V5BA 3VMYA 1TU3F 1X22A 3V2NA 2HODB 2L91A 4GT1A 2H43A 1VF5D 4EOTA 5KJ7A 2FXMA 1Q86Q 2D2CD 1M1JB 2IDBA 1M1JA 1EDIA 1DD4A 3KXDA 2Q3IA 5AVZB 2E43A 3F89A 1S1CX 1CSBA 3L74D 4W7YA 4PD4E 1PZQA 3L73D 4PD4H 1KB9E 1LP1A 5KAIE 1S3JA 2E75B 1GU5A 1JY2N 1J1DB 1UIIA 1XTCC 2RMZA 3CCMP 1VQ9P 1GU4A 2IZ1A 3WUVA 1VL2A 1VQLP 1DEBA 3QWOC 4WBAA 5KLVK 1YQ3C 1EQ7A 3HUSC 2J58A 1E5WA 1SFCA 3RK3B 2K37A 3H1LE 3B5ND 2BCCG 4ZKPA 2WQYC 1SQPK 1SQBG 1XTGB 2FBWC 2OYOA 1SQXG 3AEBC 2LKMA 2IBZD 2YMKA 1DX7A 2BEZF 3KHUA 2O3JA 1JY3P 4H0LB 1LTJB 3ABVC 3BCCD 3R2PA 4WY4D 3RBZA 1SQBJ 3Q5RA 1KYOD 1ZR4A 1SQBK 1SQVD 3P32A 2WPRA 2KI7B 4WY4B 3SWKA 5C39A 4IFMA 5KLIB 3H1KJ 3L35A 2K1AA 3D6YA 4BRYA 2QE7H 2P1JA 5H2FE 1BGYG 2IYPA 1J1EC 1JM0A 3BCCJ 5H2FH 3RK3D 1YI2P 3JC22 1NYHA 2YMYA 1EZVG 1L4AD 1L0LD 2I1JA 2IX7C 3HTKB 3WU2H 4OH8B 3H1HD 4YXDC 1BE3J 3A3YB 2OTJP 1FZEA 3TYYA 4LGDE 2Q7CA 1EZVD 1NTME 4UB6E 1VF5C 2RN0A 3CXHI 3CPWO 1VQ5P 1JMBA 2YKQA 3M0DA 2FFDB 1VQ7P 1LTBC 1ZXGA 4GKGA 3W67A 1JY2O 3O8ZA 3WUTA 4DT0A 2OYIA 1BE3D 3H32B 5AW0B 1AV1A 1IC2A 4H13B 3C9IA 3JCUH 4JYBA 5KLVJ 1BSNA 3RK3E 2R44A 3CWBJ 4RO0A 1MFTA 4R4MA 4U3FJ 1VQNP 3KPEA 1P84H 1OVRA 3C8VA 3MTUE 5EFWB 3CCLP 1SQXD 1LNQA 3OA7A 1LT9A 1OXZA 1QL2A 5B5EH 1A02F 3E1RA 3OJAB 1X0TA 3G71P 5AVUB 1IJDB 4U3FG 4N78E 4Z1MH 1SQXE 1GL2C 1SQVJ 3TNUB 3HE4A 1HGVA 1FDOA 4M3LA 4DZOA 3HD7D 1KYOH 1MFZA 1KYOE 3L72G 5AW8B 3CCJP 2WSCJ 3CCEP 1KV4A 1CI6B 2XKMA 3P7KA 1CI6A 5KLIC 2YO3A 4EYYQ 3FWNA 1S9KD 1FZAA 1NTMJ 2KXPB 1NTMD 1ZRTD 4NPDA 4IFDK 1NU1E 5CCGD 3HE4B 2JR8A 3AE7C 1NKZB 1CZQA 3FX0A 1KB9I 4PD4I 5APSA 4YPCA 3B8EB 2Z5HA 4NPEA 4AUWA 3AE4C 3V6IA 2XZRA 1U7MA 2M8RA 3RL0D 2V4HA 1NVOA 3B4SA 5APXA 2Y0CA 2Q9IA 3RGUA 2BCCD 4OGQC 3RL0B 3M0DC 1GZLA 3H1IG 3L71J 1SQBE 2PGDA 4IL6X 5APTA 2BEQD 2FXOA 1N73B 2YXQB 2OYIB 4H44C 3CX5I 3PLNA 1RQVA 1P84D 3H1IJ 2XNXA 3L75J 4TLFA 3M9QA 1W2BO 1NTZE 2GM4A 1KORA 1M7LA 2JEEA 2QJYC 1GK6A 3RK2D 1YBKA 1VQOP 4RJTA 1OZHA 3GG2A 2QEXP 3EFFK 1M1JC 1YJNP 4H0LC 5GTIH 2E5YA 2R32A 1JNMA 3HD7B 2R5BA 1T6AA 1FE6A 1J2JB 2AEMA 1N8RQ 1HWTC 2POHA 1VDFA 2B88A 5TISE 3O6QB 1VQMP 1LTTC 1L0LJ 1EC5A 1JOCA 2JP3A 5APYA 3H1JG 2YNYA 4C7RA 5CHXA 5KJ7C 1S9KE 1M1KQ 2YIUC 2XU6A 3G6EP 3V2PA 1G2CB 1SQQE 2G8YA 3S1KA 1SP4A 1LTGC 2P58A 3W68A 2K9JA 2WTYA 2NPSC 2W27A 1KILA 4H13D 2C9NY 2OTLP 1KD1Q 3BVHA 5CCHD 1IK9A 1SLQA 1M57D 2N9YB 2HFED 2ZFCA 4K3AA 5AVXB 2OARA 3L75G 5E79E 5KLVG 1RY3A 3CX5H 1NTZD 3NXSA 1NGMB 2OQQA 3L37A 4OGQD 4Y28J 2ZVNB 2A45G 2B89A 2D2CC 4TT3H 1L4AB 1EXJA 1RE4A 4ZMDA 1FZFA 1RE3C 3I5CA 3RK2B 1FDIA 4I7ZC 4N78D 4D6TD 1OX3A 3TF5A 2O01J 1NU1J 3AE5C 4MN4C 1T3UA 5CJ0A 5CCHA 1G1IA 1LWUC 1WRGA 1SFCD 1JEKA 2KB7P 3D70A 1QVFO 1IFDA 4I6MC 1DD3A 5AVSB 1AA0A 3TGUG 2H89C 4H0LD 3AE1C 2KS1B 3FWLA 3ZDMA 4ZNCA 2C9LY 1G1JA 1YQ4C 1NAFA 1GMJA 2WZ7A 2HR3A 3R4YA 1HF9A 4EDFA 2Y0DA 2WITA 1NTKJ 3V4QA 1NH4A 1GDTA 1OW7A 1Q90D 1URQB 2J5UA 3L70E 4WY4C 2JKVA 1LT1A 2KLVA 1JCCA 4DJGA 2R3SA 2RKLA 1VQ4P 2GUVA 2L5GB 3CX5D 2ZXEB 1M56D 1NTKD 1L4AA 2E75D 2RH0A 3L36A 4JYCA 5KKZB 1PPJG 4OVNF 2ZT9C 5E79H 5BU8B 1NTZJ 3CX5E 3HE5B 4NPFX 1RF0C 4GDOA 4C46A 1GTWA 1RF1B 3RK3C 5KLVE 1IO4A 1IFPA 1PGQA 3A0HE 2AXTE 1KILE 2KNCB 3A0HH 2YXRB 1LP1B 3H1LJ 3SWYA 4ASVA 1NWQA 2WSEH 4ASWA 5KAFH 2FFDC 2Z5IA 2I1KA 2FYZA 4R4LA 1A02J 1FZGA 1PP9E 3G3ZA 3P8MC 1IFJA 1BCCJ 3CCRP 2B87A 1PV3A 2JDIH
chains in the Genus database with same CATH topology
3L4FA 2NPSB 1JY2P 1N7LA 3NMDA 1IFMA 1CW5A 1YTZT 3VN0A 3VMXA 4JF7A 2H7HA 4Y99B 1L0NK 1FJKA 1IFNA 4XE5B 5BU5A 1GL2D 1JTHA 3NTNA 4W7ZA 1URQD 3VOPA 1JY3N 3KYQA 5CCGA 3M0AA 3HUSA 1J1DC 1LWUA 4HH2A 3BATA 5AVQB 1JMMA 1SFCB 4W80A 5CCGC 2VRSA 1NU1K 1GL2A 2OYHB 1URQA 3RL0C 4C7NB 3B5NB 2CPSA 1SQQK 2WSCH 4O9BA 1FJPA 5AVRB 2WSFH 4AQRD 1ZN5A 2N1TA 1FZCC 3H6PA 2YKOA 2NPSA 3TK1A 3HTKA 1RF1C 5AVVB 4I1LA 1HJBA 1JUNA 2P7JA 5AW1B 3UIAA 1LT9B 3V2QA 3A7OA 3LIEA 5AW6B 1OWAA 1HVVA 1T2KC 1URQC 5AW7B 2J59M 4DOJA 2N1TD 3VYIA 1KFNA 2JJLA 1KILD 5AW4B 1QL1A 1FBMA 4GIFA 3CL3D 5KTBA 1X9VA 3HRNA 4WY4A 2WPQA 1GK4A 2C0XA 1FAVA 1JCDA 1MV8A 4N6JA 3HE5A 2OYHC 1GD2E 3U1AA 4ZKUA 2HYNA 1N2DC 3U59A 1SFCC 3N7NA 1N73C 2QM8A 3CLQA 4I2LC 2C0WA 2A45I 2IFNA 4RESB 3H32A 3BRTB 2WT7A 1T2KD 1HGZA 1T8ZA 2N1TC 5AW5B 3TSIA 1FZCA 2WWWA 3IR9A 3NFQA 2YKPA 3MIWA 3PP5A 4C7NA 1KILC 1NO4A 3GHGC 2HPCA 3VP9A 2HPCB 2PP6A 1FDMA 3HD7A 1RF0A 2OYIC 2P67A 3V4WA 1H8AA 2BASA 5AW3B 3IFMA 2MJZA 1N7SC 1KQLA 2XV5A 1YYCA 2IFMA 1W2EA 1KZUB 1LTSC 4Y99C 2N9BA 3LIDA 4LLHA 1FOSF 4KHXA 1DH3A 1IFIA 1H89A 1N86A 1RE4C 2E42A 3M06A 1MZ9A 1J1EB 1LT9C 1N7SA 4HYTB 3V2RA 3II6A 1LWUB 3M9BA 5APUA 1FOSE 1LGHB 2HLOA 3TNUA 1VPCA 1FZBA 2WPSA 5AW9B 3VP8A 1T3JA 3EQ2A 1LTJA 1GW4A 3A5TA 1RE3A 2R3CA 2R5DA 3A2AA 3P8CD 1G2CA 1N7SB 2P2UA 1X8YA 1ZV8A 4WB4A 2PAJA 5CJ4A 1HH0A 3P8CE 1GW3A 1N7SD 3GHGA 4B86A 3KQGA 3U1CA 2FKWB 1HUCA 1Z56A 2Q5UA 2HODA 3B5NA 3VMZA 2FFDA 2KP8A 1WT6A 2CPBA 2Z4EA 3WMM0 3N4XA 3MUDA 1L0LK 3GHGB 2FYUK 1LTJC 1JY3O 3E1IA 1FZCB 1L4AC 3SWFA 2OYHA 2O1JA 1SQXK 1SQVK 4XA4A 1NTKK 3HUSB 1LTIC 3T97A 3LW5H 1JTHB 3KDPB 1JO5A 2XDJA 1AFOA 3M9HA 1PFIA 4LC1A 1X79B 1NHLA 2M3BA 1ZR2A 1NOHA 4IFFA 2N1TB 2O1KA 3VTPC 3HD7C 1HTLC 3BASA 1NTZK 4N3YB 1RF1A 1AQ5A 2HG5D 2A45H 3BRVB 1LTAC 2W6AA 1ZLLA 4AYCA 3MD0A 5APWA 3RK2C 3OAKA 3EFGA 3M91A 1H88A 2KSJA 1KFMA 2W6BA 1NKNA 3B5NC 1MUUA 1GL2B 2KYVA 1NTMK 5KJ7D 2YO2A 3MGNA 1YTZI 1FU1A 3CI9A 5AVTB 5AVWB 2KOGA 4EIJA 2NPSD 2IPPA 1KILB 2O01H 5AW2B 1SVFA 2H8PD 5CMZA 5APQA 5AVYB 3VMYA 2GUSA 5APVA 1IO4A 3V5BA 3V2NA 2HODB 4GT1A 2H43A 4EOTA 5KJ7A 2FXMA 1M1JB 1M1JA 5AVZB 2Q3IA 2E43A 1CSBA 4W7YA 1GU5A 1JY2N 1J1DB 1XTCC 1GU4A 1DEBA 5KLVK 4WBAA 1EQ7A 3HUSC 2J58A 1E5WA 1SFCA 3RK3B 4ZKPA 5BVZA 3B5ND 1N73A 1SQPK 1XTGB 2LKMA 1DX7A 1JY3P 1LTJB 4WY4D 3R2PA 1ZR4A 1SQBK 3P32A 2WPRA 4WY4B 4IFMA 3L35A 2P1JA 1J1EC 3RK3D 3HTKB 2YMYA 1L4AD 1HBWA 2I1JA 2IX7C 4OH8B 3A3YB 1FZEA 3TYYA 4LGDE 2Q7CA 2FFDB 2YKQA 3M0DA 1LTBC 4GKGA 1JY2O 3O8ZA 2OYIA 3H32B 5AW0B 2WT7B 1IC2A 4JYBA 3C9IA 3KPEA 3MTUE 1LT9A 1OXZA 1QL2A 1A02F 3OJAB 5AVUB 1IJDB 4N78E 1GL2C 3TNUB 3HE4A 1HGVA 4M3LA 4DZOA 3HD7D 1MFZA 5AW8B 1CI6B 2XKMA 3P7KA 1CI6A 1S9KD 2YO3A 1FZAA 4IFDK 5CCGD 3HE4B 1NKZB 1CZQA 5CCHC 5APSA 4AUWA 3B8EB 2Z5HA 2XZRA 2M8RA 3RL0D 5APXA 2Q9IA 3RL0B 3M0DC 1GZLA 5APTA 1N73B 2OYIB 2XNXA 2GM4A 3M9QA 2JEEA 1M7LA 1GK6A 3RK2D 1M1JC 2R32A 1JNMA 3HD7B 2R5BA 1J2JB 1HWTC 2POHA 1VDFA 1LTTC 1JOCA 5APYA 1S9KE 4C7RA 5KJ7C 2YNYA 5CHXA 2XU6A 3V2PA 1G2CB 1SP4A 1LTGC 2WTYA 2NPSC 2W27A 1KILA 2C9NY 3BVHA 5CCHD 1IK9A 1SLQA 2ZFCA 2HFED 5AVXB 2OARA 1RY3A 3NXSA 3L37A 2A45G 1L4AB 1RE4A 1FZFA 1RE3C 3I5CA 3RK2B 4N78D 1T3UA 5CJ0A 5CCHA 1G1IA 1LWUC 1WRGA 1SFCD 2KB7P 1IFDA 4I6MC 5AVSB 2C9LY 1G1JA 1NAFA 2WZ7A 2WITA 3V4QA 1GDTA 1NH4A 1URQB 4WY4C 2KLVA 1JCCA 2GUVA 2L5GB 3OA7A 2ZXEB 4JYCA 1L4AA 3L36A 5BU8B 3HE5B 4C46A 1RF0C 1GTWA 1RF1B 3RK3C 3SWYA 1NWQA 2WSEH 2FFDC 2Z5IA 2I1KA 2FYZA 1A02J 1FZGA 3G3ZA 3P8MC 1IFJA 2QM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TNU B;  3HE4 A;  2P67 A;  3V4W A;  4M3L A;  4DZO A;  1MFZ A;  1H8A A;  5AW8 B;  3NMD A;  2BAS A;  5AW3 B;  3VN0 A;  1CI6 B;  3P7K A;  1CI6 A;  3VMX A;  1S9K D;  2YO3 A;  2H7H A;  2W6A A;  4XE5 B;  1KQL A;  2XV5 A;  3NTN A;  4AYC A;  1YYC A;  3HE4 B;  1CZQ A;  5APS A;  4AUW A;  3B8E B;  2Z5H A;  2XZR A;  2N9B A;  5APX A;  3MD0 A;  5APW A;  3OAK A;  3LID A;  3M0A A;  3M91 A;  1GZL A;  1H88 A;  1FOS F;  4KHX A;  5APT A;  5AVQ B;  1DH3 A;  2VRS A;  1H89 A;  2E42 A;  1MUU A;  3M06 A;  2YO2 A;  4C7N B;  3MGN A;  1GK6 A;  5AVT B;  4HYT B;  5AVW B;  3M9B A;  5APU A;  5AVR B;  1FOS E;  2R32 A;  4AQR D;  1JNM A;  3TNU A;  2IPP A;  2R5B A;  1J2J B;  1HWT C;  2WPS A;  5AW9 B;  5AW2 B;  3TK1 A;  1IO4 A;  3HTK A;  5CMZ A;  5APQ A;  5APY A;  5AVY B;  5APV A;  3VMY A;  1S9K E;  2YNY A;  3V5B A;  3A5T A;  2R3C A;  5AVV B;  1HJB A;  1JUN A;  2P7J A;  2R5D A;  3A2A A;  4GT1 A;  5AW1 B;  2XU6 A;  3UIA A;  2P2U A;  1G2C B;  4EOT A;  1X8Y A;  3A7O A;  1SP4 A;  3LIE A;  5AW6 B;  4B86 A;  1OWA A;  5AVZ B;  2WTY A;  2W27 A;  3KQG A;  2Q3I A;  2C9N Y;  2E43 A;  1CSB A;  1T2K C;  5AW7 B;  1SLQ A;  2ZFC A;  3VYI A;  1HUC A;  1GU5 A;  5AVX B;  2JJL A;  2Q5U A;  3NXS A;  3VMZ A;  3L37 A;  1GU4 A;  2KP8 A;  5AW4 B;  3I5C A;  3SWF A;  4I6M C;  5AVS B;  3P32 A;  2WPR A;  1GK4 A;  2WPQ A;  1FAV A;  3T97 A;  2C9L Y;  3L35 A;  1MV8 A;  1NAF A;  3KDP B;  3HE5 A;  1GD2 E;  1HBW A;  3M9H A;  3V4Q A;  4LC1 A;  3A3Y B;  3TYY A;  2Q7C A;  2QM8 A;  4I2L C;  3M0D A;  2ZXE B;  4JYC A;  3L36 A;  4GKG A;  3O8Z A;  4RES B;  3HE5 B;  4C46 A;  2WT7 A;  3VTP C;  5AW0 B;  2WT7 B;  1T2K D;  4JYB A;  1GTW A;  5AW5 B;  2WWW A;  3IR9 A;  3NFQ A;  4C7N A;  1NWQ A;  2Z5I A;  1A02 J;  1OXZ A;  1A02 F;  3P8M C;  2QM7 A;  5AVU B; 
#chains in the Genus database with same CATH topology
 3L4F A;  4YXW H;  3Q5P A;  2QJY B;  2NPS B;  3AEC C;  1JY2 P;  1K05 A;  1N7L A;  2ZYG A;  3IF4 A;  3NMD A;  2ZJS E;  2B9B A;  2KSE A;  4L76 A;  2FYU D;  1IFM A;  1CW5 A;  1YTZ T;  1OW8 A;  3VN0 A;  4JPZ B;  1KB9 D;  3VMX A;  4JF7 A;  2H7H A;  4Y99 B;  4BXL A;  1OW6 A;  1L0N K;  2QA4 P;  5DJU B;  1FJK A;  1IFN A;  4XE5 B;  2B87 B;  5BU5 A;  1GL2 D;  1JTH A;  3NTN A;  2ZVO B;  5TJH A;  4W7Z A;  1URQ D;  3VOP A;  3WUU A;  1JY3 N;  1OIP A;  2LXC B;  1SQX J;  3L71 E;  3KYQ A;  5CCG A;  4IL6 E;  2IBZ E;  3I55 P;  2K9Y A;  2WSE J;  3M0A A;  1Y47 A;  3HUS A;  1J1D C;  1QVG O;  4L73 A;  1LWU A;  3G4S P;  1QLE D;  1W5C E;  2AXT H;  2PRR A;  4HH2 A;  1NAY A;  4B86 A;  3BAT A;  5AVQ B;  2ZT9 D;  1JMM A;  1SFC B;  4W80 A;  5CCG C;  1NTK G;  2VRS A;  1NU1 K;  2QJP B;  1GL2 A;  3FXD A;  3O6Q A;  1LJ2 A;  2OYH B;  4D6T E;  1URQ A;  3AE3 C;  1PP9 G;  1SS1 A;  2UWJ E;  2CPS A;  1SQQ K;  1L0N G;  2WSC H;  3AEE C;  3B5N B;  1SQQ J;  3H1H G;  2FYU E;  2JWD A;  1NU1 G;  2Y0E A;  1FJP A;  5AVR B;  3Q3D A;  1BGY D;  2W6J H;  1KB9 H;  2WSF H;  4OGQ B;  3TGU E;  4AQR D;  1ZN5 A;  2N1T A;  1FZC C;  3AED C;  1K8A Q;  3H6P A;  2YKO A;  4H44 D;  4BRY B;  1EDJ A;  1QEX A;  2NPS A;  3E7K A;  3TK1 A;  3GMA A;  1U7J A;  3HTK A;  2KNC A;  4QMA A;  1S5L X;  3L73 G;  1RF1 C;  2OTK E;  3L72 E;  4I1L A;  3L74 J;  5AVV B;  2P7J A;  5AW1 B;  1HJB A;  3CME P;  1JUN A;  1FS0 E;  1LT9 B;  3KZI E;  4HJG H;  3UIA A;  3V2Q A;  3A7O A;  2FY8 A;  5B5E E;  3LIE A;  4EI2 A;  2CK3 H;  3CWB E;  1VF5 B;  5AW6 B;  1OWA A;  5BVZ A;  5CBN A;  1N73 A;  3MZW B;  1HVV A;  1U57 A;  3L75 E;  2Y9Z A;  1URQ C;  5AW7 B;  1T2K C;  2J59 M;  4DOJ A;  2N1T D;  2NZ2 A;  3VYI A;  3S4R A;  1NTZ G;  1SQV E;  3H25 A;  1KFN A;  3AEA C;  2JJL A;  1KIL D;  2SPZ A;  4PJ0 E;  4OWF A;  1L0N J;  5AW4 B;  1QL1 A;  3ITK A;  3EWK A;  3L73 J;  1FBM A;  3PH0 A;  4BWN A;  1VQP P;  1RH5 B;  1SQQ D;  1Q7Y Q;  1Y8A A;  1USD A;  1ZW0 A;  3PTZ A;  4K35 A;  5L8R J;  4GIF A;  3CL3 D;  2W83 C;  3H1H J;  4GOE A;  1H0T A;  1AVY A;  5B66 H;  1EZV E;  2QJK C;  5TIS H;  5KTB A;  4A7P A;  1K73 Q;  1X9V A;  3HRN A;  4WY4 A;  2WPQ A;  1GK4 A;  2OGU A;  1K9M Q;  3AE8 C;  1ZP0 C;  5KAI H;  2C0X A;  1FAV A;  3TDK A;  1JCD A;  2E5T A;  3C1L A;  3CD6 P;  2QG4 A;  1MV8 A;  4L75 A;  4N6J A;  3VMA A;  3HE5 A;  1PGJ A;  1HBW A;  2OYH C;  2LR2 A;  1GD2 E;  3U1A A;  4ZKU A;  2HYN A;  1Q2N A;  2WPV B;  1N2D C;  3U59 A;  1BSH A;  2IBZ I;  1SFC C;  3N7N A;  1N73 C;  1PPJ E;  2QM8 A;  3CLQ A;  1NJI Q;  1PGO A;  2FXP A;  4I2L C;  2C0W A;  2A45 I;  4U3F E;  2IFN A;  2JWA A;  4U7J A;  4RES B;  4GOF A;  3H32 A;  3BRT B;  2WT7 A;  1T2K D;  3H1K D;  1HGZ A;  1T8Z A;  1H0T B;  2A06 D;  2N1T C;  5AW5 B;  3TSI A;  4JQ0 D;  1FZC A;  2WWW A;  1PL5 A;  3IR9 A;  3NFQ A;  1R5L A;  1BCC G;  2YKP A;  3MIW A;  3PP5 A;  1KIL C;  3RL0 C;  4C7N A;  4C7N B;  3Q2Y A;  1NO4 A;  3GHG C;  3H1J J;  2HPC A;  1L0N E;  3VP9 A;  2HPC B;  1VQK P;  3AE2 C;  2H88 C;  2PP6 A;  2E75 C;  1JB0 J;  1D7M A;  2M5A B;  3L72 J;  3GF3 A;  5B66 E;  1FDM A;  1QGK B;  2QJP C;  3HD7 A;  4YTP C;  1FC2 C;  1NTK E;  1RF0 A;  2OYI C;  2P67 A;  3QH9 A;  3V4W A;  1IZN B;  2AEJ A;  1H8A A;  2QVA A;  3L71 D;  5K5G B;  3OW2 O;  2BAS A;  1RHZ B;  5AW3 B;  3CC2 P;  1RQU A;  3IFM A;  2ZAE B;  1USE A;  3MHV A;  2O01 N;  2M3E A;  2MJZ A;  2E76 D;  1OFC X;  4RKU J;  1N7S C;  2E74 C;  3H1I D;  4D6T J;  1KQL A;  1AJY A;  1P84 E;  2XV5 A;  5GTH E;  5GTH H;  1YYC A;  1M8O B;  2IFM A;  1W2E A;  3CCV P;  1KZU B;  2NRG A;  2ZT9 B;  1KQS O;  2WMM A;  1LTS C;  2A06 E;  2N9B A;  4Y99 C;  2ZYD A;  3LID A;  1AVO A;  2JO1 A;  3GW6 A;  5KAF E;  4LLH A;  5M1B A;  1FOS F;  1YJW P;  4KHX A;  3AEF C;  1DH3 A;  1IFI A;  2Y9Y A;  3K5B A;  1H89 A;  1N86 A;  1RE4 C;  5GTI E;  1YJ9 P;  2E42 A;  1NU1 D;  3M06 A;  1BGY J;  1EZV I;  3WU2 E;  1L0N D;  1MZ9 A;  1J1E B;  4CPG A;  1DIP A;  2E76 B;  1LT9 C;  2GA1 A;  2KZI A;  2A06 G;  1N7S A;  4HYT B;  3V2R A;  3II6 A;  1LWU B;  3M9B A;  5APU A;  2QJK B;  3AEG C;  4D6T G;  3L74 E;  1FOS E;  1SQP G;  1BE3 E;  1LGH B;  2HLO A;  3KZI H;  3TNU A;  1DEE G;  1VPC A;  3PRJ A;  1FZB A;  2WPS A;  5AW9 B;  3VP8 A;  1T3J A;  3EQ2 A;  1OMI A;  2XND H;  1LTJ A;  1GW4 A;  2BCC E;  4L74 A;  1RE3 A;  2R3C A;  3A5T A;  2R5D A;  3A2A A;  3P8C D;  2IBZ G;  1G2C A;  1N7S B;  2E74 B;  2P2U A;  3LW5 J;  1X8Y A;  2D2C B;  1ZV8 A;  4GOD A;  4WB4 A;  5DJT B;  2PAJ A;  5CJ4 A;  1HH0 A;  1OVV A;  1GW3 A;  1N7S D;  2E74 D;  2K9J B;  2KIK A;  2KS1 A;  2KZJ A;  2M5A A;  3GHG A;  3KQG A;  3L74 G;  3MP7 B;  3U1C A;  1BGY E;  3D6Z A;  3CCQ P;  3IN6 A;  1OVU A;  2FKW B;  1HUC A;  3PJS K;  4KJM A;  1L0L G;  2Q1K A;  1Z56 A;  1ZOY C;  2HOD A;  1S2E A;  2Q5U A;  1BCC E;  3B5N A;  3TGU J;  3VMZ A;  1KC8 Q;  1ZRT E;  1KQF B;  2KP8 A;  2FFD A;  1WT6 A;  2CPB A;  2Z4E A;  3WMM 0;  1SQQ G;  2K3R A;  3MUD A;  1L0L K;  3N4X A;  3A0B H;  3GHG B;  2WSF J;  1WMK A;  1PIX A;  1LTJ C;  2DW3 A;  2FYU K;  2Q3E A;  1JY3 O;  1QX8 A;  3E1I A;  1FZC B;  3BCC G;  1L4A C;  4PV1 D;  2WSS H;  4HKZ H;  1YIT P;  3L75 D;  3SWF A;  2OYH A;  1EXI A;  2O1J A;  1VQ6 P;  1SQX K;  4IL6 H;  3L70 G;  1SQV K;  1SQB D;  3FXE A;  4XA4 A;  1NTK K;  1Y9B A;  3HUS B;  4UB8 H;  3Q1M A;  4UB8 E;  1LTI C;  3T97 B;  3T97 A;  3LW5 H;  3SFE C;  1YHQ P;  1P84 I;  4WVZ A;  2BCC J;  1HJ0 A;  1JTH B;  3KDP B;  1JO5 A;  2XDJ A;  1AFO A;  2QRX A;  3RBX A;  2I8D A;  3G9R A;  2KLU A;  2MKV A;  3SSU A;  3M9H A;  1BDD A;  3B71 A;  1PFI A;  4LC1 A;  2G3A A;  4DCK A;  1X79 B;  1Q81 Q;  1NHL A;  2M3B A;  2YIU B;  1ZR2 A;  1NOH A;  5CCH C;  1E79 H;  2FYU J;  4IFF A;  4IOI H;  4JBZ A;  2N1T B;  2O1K A;  4HB1 A;  2AEF A;  3I56 P;  1VQ8 P;  4PD4 D;  1KQG B;  3S9O A;  1M90 Q;  3CC4 P;  3USS A;  2AXC A;  1K04 A;  3VTP C;  2W8Z A;  3HD7 C;  1BCC D;  1HTL C;  1EDK A;  1PGP A;  1SQV G;  2PFX A;  3IAO A;  5KKZ C;  3BAS A;  3SFD C;  1AQT A;  3CCU P;  1BDC A;  4O9B A;  2FYN B;  3L72 D;  3P8C E;  3CWB G;  3H1L D;  1IK7 A;  1NTZ K;  4N3Y B;  4WWI A;  3JCU E;  4KT0 J;  1Q82 Q;  4H44 B;  1MKM A;  4U3F D;  2WVR A;  2ZXX A;  3CWB D;  3GLM A;  3H1L G;  1RF1 A;  1ZME C;  3L70 D;  4PV1 C;  3JSV C;  3FGA D;  2HG5 D;  2A45 H;  3BRV B;  1SQP J;  3H1K E;  5KLV D;  1AQ5 A;  2Q6Q A;  4PJ0 H;  1R5S A;  3AE6 C;  1LTA C;  2V7Q J;  1BE3 G;  1SQP E;  1ZLL A;  2W6A A;  3CC7 P;  3AE9 C;  1KN7 A;  1S72 P;  3TGU D;  4AYC A;  3Q5S A;  1L0L E;  2P10 A;  1SQP D;  3H1H E;  2M0B A;  2FYU G;  4I7Z B;  3D71 A;  3RL0 g;  3CMA P;  3CXH D;  3H1J D;  3MD0 A;  1PP9 D;  2LXB A;  3L73 E;  1PP9 J;  3OAK A;  5APW A;  3RK2 C;  3EFG A;  3A0B E;  2KK7 A;  2QSI A;  2WT7 B;  2E76 C;  1UIX A;  3H1K G;  3M91 A;  3CXH E;  3H1J E;  2KSJ A;  3CXH H;  4XFJ A;  1H88 A;  1NTM G;  4UB6 H;  1KFM A;  2K88 A;  2W6B A;  1NKN A;  1S5L H;  3B5N C;  1L2P A;  1S5L E;  1MUU A;  3H1I E;  1GL2 B;  1KTM A;  3F5H A;  4PV1 B;  5CBO A;  2QM7 A;  2KYV A;  1NTM K;  3MUD C;  1KMI Z;  2YO2 A;  5KJ7 D;  3MGN A;  1YTZ I;  3L71 G;  1FU1 A;  3CI9 A;  5AVT B;  5AVW B;  2KOG A;  1EDL A;  2FYN C;  4EIJ A;  3L70 J;  1PPJ D;  2IYO A;  2NPS D;  2IPP A;  2IZ0 A;  2KUB A;  2V7Q H;  1KIL B;  3GF7 A;  3PHL A;  4H13 C;  1R8E A;  2O01 H;  3CCS P;  2ZYA A;  5AW2 B;  1YIJ P;  2QIW A;  2ITA A;  1SVF A;  2W90 A;  2H8P D;  3BCC E;  5CMZ A;  1S4X A;  1KYO I;  2GUS A;  5APQ A;  5APV A;  5AVY B;  3V5B A;  3VMY A;  1TU3 F;  1X22 A;  3V2N A;  2HOD B;  2L91 A;  4GT1 A;  2H43 A;  1VF5 D;  4EOT A;  5KJ7 A;  2FXM A;  1Q86 Q;  2D2C D;  1M1J B;  2IDB A;  1M1J A;  1EDI A;  1DD4 A;  3KXD A;  2Q3I A;  5AVZ B;  2E43 A;  3F89 A;  1S1C X;  1CSB A;  3L74 D;  4W7Y A;  4PD4 E;  1PZQ A;  3L73 D;  4PD4 H;  1KB9 E;  1LP1 A;  5KAI E;  1S3J A;  2E75 B;  1GU5 A;  1JY2 N;  1J1D B;  1UII A;  1XTC C;  2RMZ A;  3CCM P;  1VQ9 P;  1GU4 A;  2IZ1 A;  3WUV A;  1VL2 A;  1VQL P;  1DEB A;  3QWO C;  4WBA A;  5KLV K;  1YQ3 C;  1EQ7 A;  3HUS C;  2J58 A;  1E5W A;  1SFC A;  3RK3 B;  2K37 A;  3H1L E;  3B5N D;  2BCC G;  4ZKP A;  2WQY C;  1SQP K;  1SQB G;  1XTG B;  2FBW C;  2OYO A;  1SQX G;  3AEB C;  2LKM A;  2IBZ D;  2YMK A;  1DX7 A;  2BEZ F;  3KHU A;  2O3J A;  1JY3 P;  4H0L B;  1LTJ B;  3ABV C;  3BCC D;  3R2P A;  4WY4 D;  3RBZ A;  1SQB J;  3Q5R A;  1KYO D;  1ZR4 A;  1SQB K;  1SQV D;  3P32 A;  2WPR A;  2KI7 B;  4WY4 B;  3SWK A;  5C39 A;  4IFM A;  5KLI B;  3H1K J;  3L35 A;  2K1A A;  3D6Y A;  4BRY A;  2QE7 H;  2P1J A;  5H2F E;  1BGY G;  2IYP A;  1J1E C;  1JM0 A;  3BCC J;  5H2F H;  3RK3 D;  1YI2 P;  3JC2 2;  1NYH A;  2YMY A;  1EZV G;  1L4A D;  1L0L D;  2I1J A;  2IX7 C;  3HTK B;  3WU2 H;  4OH8 B;  3H1H D;  4YXD C;  1BE3 J;  3A3Y B;  2OTJ P;  1FZE A;  3TYY A;  4LGD E;  2Q7C A;  1EZV D;  1NTM E;  4UB6 E;  1VF5 C;  2RN0 A;  3CXH I;  3CPW O;  1VQ5 P;  1JMB A;  2YKQ A;  3M0D A;  2FFD B;  1VQ7 P;  1LTB C;  1ZXG A;  4GKG A;  3W67 A;  1JY2 O;  3O8Z A;  3WUT A;  4DT0 A;  2OYI A;  1BE3 D;  3H32 B;  5AW0 B;  1AV1 A;  1IC2 A;  4H13 B;  3C9I A;  3JCU H;  4JYB A;  5KLV J;  1BSN A;  3RK3 E;  2R44 A;  3CWB J;  4RO0 A;  1MFT A;  4R4M A;  4U3F J;  1VQN P;  3KPE A;  1P84 H;  1OVR A;  3C8V A;  3MTU E;  5EFW B;  3CCL P;  1SQX D;  1LNQ A;  3OA7 A;  1LT9 A;  1OXZ A;  1QL2 A;  5B5E H;  1A02 F;  3E1R A;  3OJA B;  1X0T A;  3G71 P;  5AVU B;  1IJD B;  4U3F G;  4N78 E;  4Z1M H;  1SQX E;  1GL2 C;  1SQV J;  3TNU B;  3HE4 A;  1HGV A;  1FDO A;  4M3L A;  4DZO A;  3HD7 D;  1KYO H;  1MFZ A;  1KYO E;  3L72 G;  5AW8 B;  3CCJ P;  2WSC J;  3CCE P;  1KV4 A;  1CI6 B;  2XKM A;  3P7K A;  1CI6 A;  5KLI C;  2YO3 A;  4EYY Q;  3FWN A;  1S9K D;  1FZA A;  1NTM J;  2KXP B;  1NTM D;  1ZRT D;  4NPD A;  4IFD K;  1NU1 E;  5CCG D;  3HE4 B;  2JR8 A;  3AE7 C;  1NKZ B;  1CZQ A;  3FX0 A;  1KB9 I;  4PD4 I;  5APS A;  4YPC A;  3B8E B;  2Z5H A;  4NPE A;  4AUW A;  3AE4 C;  3V6I A;  2XZR A;  1U7M A;  2M8R A;  3RL0 D;  2V4H A;  1NVO A;  3B4S A;  5APX A;  2Y0C A;  2Q9I A;  3RGU A;  2BCC D;  4OGQ C;  3RL0 B;  3M0D C;  1GZL A;  3H1I G;  3L71 J;  1SQB E;  2PGD A;  4IL6 X;  5APT A;  2BEQ D;  2FXO A;  1N73 B;  2YXQ B;  2OYI B;  4H44 C;  3CX5 I;  3PLN A;  1RQV A;  1P84 D;  3H1I J;  2XNX A;  3L75 J;  4TLF A;  3M9Q A;  1W2B O;  1NTZ E;  2GM4 A;  1KOR A;  1M7L A;  2JEE A;  2QJY C;  1GK6 A;  3RK2 D;  1YBK A;  1VQO P;  4RJT A;  1OZH A;  3GG2 A;  2QEX P;  3EFF K;  1M1J C;  1YJN P;  4H0L C;  5GTI H;  2E5Y A;  2R32 A;  1JNM A;  3HD7 B;  2R5B A;  1T6A A;  1FE6 A;  1J2J B;  2AEM A;  1N8R Q;  1HWT C;  2POH A;  1VDF A;  2B88 A;  5TIS E;  3O6Q B;  1VQM P;  1LTT C;  1L0L J;  1EC5 A;  1JOC A;  2JP3 A;  5APY A;  3H1J G;  2YNY A;  4C7R A;  5CHX A;  5KJ7 C;  1S9K E;  1M1K Q;  2YIU C;  2XU6 A;  3G6E P;  3V2P A;  1G2C B;  1SQQ E;  2G8Y A;  3S1K A;  1SP4 A;  1LTG C;  2P58 A;  3W68 A;  2K9J A;  2WTY A;  2NPS C;  2W27 A;  1KIL A;  4H13 D;  2C9N Y;  2OTL P;  1KD1 Q;  3BVH A;  5CCH D;  1IK9 A;  1SLQ A;  1M57 D;  2N9Y B;  2HFE D;  2ZFC A;  4K3A A;  5AVX B;  2OAR A;  3L75 G;  5E79 E;  5KLV G;  1RY3 A;  3CX5 H;  1NTZ D;  3NXS A;  1NGM B;  2OQQ A;  3L37 A;  4OGQ D;  4Y28 J;  2ZVN B;  2A45 G;  2B89 A;  2D2C C;  4TT3 H;  1L4A B;  1EXJ A;  1RE4 A;  4ZMD A;  1FZF A;  1RE3 C;  3I5C A;  3RK2 B;  1FDI A;  4I7Z C;  4N78 D;  4D6T D;  1OX3 A;  3TF5 A;  2O01 J;  1NU1 J;  3AE5 C;  4MN4 C;  1T3U A;  5CJ0 A;  5CCH A;  1G1I A;  1LWU C;  1WRG A;  1SFC D;  1JEK A;  2KB7 P;  3D70 A;  1QVF O;  1IFD A;  4I6M C;  1DD3 A;  5AVS B;  1AA0 A;  3TGU G;  2H89 C;  4H0L D;  3AE1 C;  2KS1 B;  3FWL A;  3ZDM A;  4ZNC A;  2C9L Y;  1G1J A;  1YQ4 C;  1NAF A;  1GMJ A;  2WZ7 A;  2HR3 A;  3R4Y A;  1HF9 A;  4EDF A;  2Y0D A;  2WIT A;  1NTK J;  3V4Q A;  1NH4 A;  1GDT A;  1OW7 A;  1Q90 D;  1URQ B;  2J5U A;  3L70 E;  4WY4 C;  2JKV A;  1LT1 A;  2KLV A;  1JCC A;  4DJG A;  2R3S A;  2RKL A;  1VQ4 P;  2GUV A;  2L5G B;  3CX5 D;  2ZXE B;  1M56 D;  1NTK D;  1L4A A;  2E75 D;  2RH0 A;  3L36 A;  4JYC A;  5KKZ B;  1PPJ G;  4OVN F;  2ZT9 C;  5E79 H;  5BU8 B;  1NTZ J;  3CX5 E;  3HE5 B;  4NPF X;  1RF0 C;  4GDO A;  4C46 A;  1GTW A;  1RF1 B;  3RK3 C;  5KLV E;  1IO4 A;  1IFP A;  1PGQ A;  3A0H E;  2AXT E;  1KIL E;  2KNC B;  3A0H H;  2YXR B;  1LP1 B;  3H1L J;  3SWY A;  4ASV A;  1NWQ A;  2WSE H;  4ASW A;  5KAF H;  2FFD C;  2Z5I A;  2I1K A;  2FYZ A;  4R4L A;  1A02 J;  1FZG A;  1PP9 E;  3G3Z A;  3P8M C;  1IFJ A;  1BCC J;  3CCR P;  2B87 A;  1PV3 A;  2JDI H; 
#chains in the Genus database with same CATH homology
 3L4F A;  2NPS B;  1JY2 P;  1N7L A;  3NMD A;  1IFM A;  1CW5 A;  1YTZ T;  3VN0 A;  3VMX A;  4JF7 A;  2H7H A;  4Y99 B;  1L0N K;  1FJK A;  1IFN A;  4XE5 B;  5BU5 A;  1GL2 D;  1JTH A;  3NTN A;  4W7Z A;  1URQ D;  3VOP A;  1JY3 N;  3KYQ A;  5CCG A;  3M0A A;  3HUS A;  1J1D C;  1LWU A;  4HH2 A;  3BAT A;  5AVQ B;  1JMM A;  1SFC B;  4W80 A;  5CCG C;  2VRS A;  1NU1 K;  1GL2 A;  2OYH B;  1URQ A;  3RL0 C;  4C7N B;  3B5N B;  2CPS A;  1SQQ K;  2WSC H;  4O9B A;  1FJP A;  5AVR B;  2WSF H;  4AQR D;  1ZN5 A;  2N1T A;  1FZC C;  3H6P A;  2YKO A;  2NPS A;  3TK1 A;  3HTK A;  1RF1 C;  5AVV B;  4I1L A;  1HJB A;  1JUN A;  2P7J A;  5AW1 B;  3UIA A;  1LT9 B;  3V2Q A;  3A7O A;  3LIE A;  5AW6 B;  1OWA A;  1HVV A;  1T2K C;  1URQ C;  5AW7 B;  2J59 M;  4DOJ A;  2N1T D;  3VYI A;  1KFN A;  2JJL A;  1KIL D;  5AW4 B;  1QL1 A;  1FBM A;  4GIF A;  3CL3 D;  5KTB A;  1X9V A;  3HRN A;  4WY4 A;  2WPQ A;  1GK4 A;  2C0X A;  1FAV A;  1JCD A;  1MV8 A;  4N6J A;  3HE5 A;  2OYH C;  1GD2 E;  3U1A A;  4ZKU A;  2HYN A;  1N2D C;  3U59 A;  1SFC C;  3N7N A;  1N73 C;  2QM8 A;  3CLQ A;  4I2L C;  2C0W A;  2A45 I;  2IFN A;  4RES B;  3H32 A;  3BRT B;  2WT7 A;  1T2K D;  1HGZ A;  1T8Z A;  2N1T C;  5AW5 B;  3TSI A;  1FZC A;  2WWW A;  3IR9 A;  3NFQ A;  2YKP A;  3MIW A;  3PP5 A;  4C7N A;  1KIL C;  1NO4 A;  3GHG C;  2HPC A;  3VP9 A;  2HPC B;  2PP6 A;  1FDM A;  3HD7 A;  1RF0 A;  2OYI C;  2P67 A;  3V4W A;  1H8A A;  2BAS A;  5AW3 B;  3IFM A;  2MJZ A;  1N7S C;  1KQL A;  2XV5 A;  1YYC A;  2IFM A;  1W2E A;  1KZU B;  1LTS C;  4Y99 C;  2N9B A;  3LID A;  4LLH A;  1FOS F;  4KHX A;  1DH3 A;  1IFI A;  1H89 A;  1N86 A;  1RE4 C;  2E42 A;  3M06 A;  1MZ9 A;  1J1E B;  1LT9 C;  1N7S A;  4HYT B;  3V2R A;  3II6 A;  1LWU B;  3M9B A;  5APU A;  1FOS E;  1LGH B;  2HLO A;  3TNU A;  1VPC A;  1FZB A;  2WPS A;  5AW9 B;  3VP8 A;  1T3J A;  3EQ2 A;  1LTJ A;  1GW4 A;  3A5T A;  1RE3 A;  2R3C A;  2R5D A;  3A2A A;  3P8C D;  1G2C A;  1N7S B;  2P2U A;  1X8Y A;  1ZV8 A;  4WB4 A;  2PAJ A;  5CJ4 A;  1HH0 A;  3P8C E;  1GW3 A;  1N7S D;  3GHG A;  4B86 A;  3KQG A;  3U1C A;  2FKW B;  1HUC A;  1Z56 A;  2Q5U A;  2HOD A;  3B5N A;  3VMZ A;  2FFD A;  2KP8 A;  1WT6 A;  2CPB A;  2Z4E A;  3WMM 0;  3N4X A;  3MUD A;  1L0L K;  3GHG B;  2FYU K;  1LTJ C;  1JY3 O;  3E1I A;  1FZC B;  1L4A C;  3SWF A;  2OYH A;  2O1J A;  1SQX K;  1SQV K;  4XA4 A;  1NTK K;  3HUS B;  1LTI C;  3T97 A;  3LW5 H;  1JTH B;  3KDP B;  1JO5 A;  2XDJ A;  1AFO A;  3M9H A;  1PFI A;  4LC1 A;  1X79 B;  1NHL A;  2M3B A;  1ZR2 A;  1NOH A;  4IFF A;  2N1T B;  2O1K A;  3VTP C;  3HD7 C;  1HTL C;  3BAS A;  1NTZ K;  4N3Y B;  1RF1 A;  1AQ5 A;  2HG5 D;  2A45 H;  3BRV B;  1LTA C;  2W6A A;  1ZLL A;  4AYC A;  3MD0 A;  5APW A;  3RK2 C;  3OAK A;  3EFG A;  3M91 A;  1H88 A;  2KSJ A;  1KFM A;  2W6B A;  1NKN A;  3B5N C;  1MUU A;  1GL2 B;  2KYV A;  1NTM K;  5KJ7 D;  2YO2 A;  3MGN A;  1YTZ I;  1FU1 A;  3CI9 A;  5AVT B;  5AVW B;  2KOG A;  4EIJ A;  2NPS D;  2IPP A;  1KIL B;  2O01 H;  5AW2 B;  1SVF A;  2H8P D;  5CMZ A;  5APQ A;  5AVY B;  3VMY A;  2GUS A;  5APV A;  1IO4 A;  3V5B A;  3V2N A;  2HOD B;  4GT1 A;  2H43 A;  4EOT A;  5KJ7 A;  2FXM A;  1M1J B;  1M1J A;  5AVZ B;  2Q3I A;  2E43 A;  1CSB A;  4W7Y A;  1GU5 A;  1JY2 N;  1J1D B;  1XTC C;  1GU4 A;  1DEB A;  5KLV K;  4WBA A;  1EQ7 A;  3HUS C;  2J58 A;  1E5W A;  1SFC A;  3RK3 B;  4ZKP A;  5BVZ A;  3B5N D;  1N73 A;  1SQP K;  1XTG B;  2LKM A;  1DX7 A;  1JY3 P;  1LTJ B;  4WY4 D;  3R2P A;  1ZR4 A;  1SQB K;  3P32 A;  2WPR A;  4WY4 B;  4IFM A;  3L35 A;  2P1J A;  1J1E C;  3RK3 D;  3HTK B;  2YMY A;  1L4A D;  1HBW A;  2I1J A;  2IX7 C;  4OH8 B;  3A3Y B;  1FZE A;  3TYY A;  4LGD E;  2Q7C A;  2FFD B;  2YKQ A;  3M0D A;  1LTB C;  4GKG A;  1JY2 O;  3O8Z A;  2OYI A;  3H32 B;  5AW0 B;  2WT7 B;  1IC2 A;  4JYB A;  3C9I A;  3KPE A;  3MTU E;  1LT9 A;  1OXZ A;  1QL2 A;  1A02 F;  3OJA B;  5AVU B;  1IJD B;  4N78 E;  1GL2 C;  3TNU B;  3HE4 A;  1HGV A;  4M3L A;  4DZO A;  3HD7 D;  1MFZ A;  5AW8 B;  1CI6 B;  2XKM A;  3P7K A;  1CI6 A;  1S9K D;  2YO3 A;  1FZA A;  4IFD K;  5CCG D;  3HE4 B;  1NKZ B;  1CZQ A;  5CCH C;  5APS A;  4AUW A;  3B8E B;  2Z5H A;  2XZR A;  2M8R A;  3RL0 D;  5APX A;  2Q9I A;  3RL0 B;  3M0D C;  1GZL A;  5APT A;  1N73 B;  2OYI B;  2XNX A;  2GM4 A;  3M9Q A;  2JEE A;  1M7L A;  1GK6 A;  3RK2 D;  1M1J C;  2R32 A;  1JNM A;  3HD7 B;  2R5B A;  1J2J B;  1HWT C;  2POH A;  1VDF A;  1LTT C;  1JOC A;  5APY A;  1S9K E;  4C7R A;  5KJ7 C;  2YNY A;  5CHX A;  2XU6 A;  3V2P A;  1G2C B;  1SP4 A;  1LTG C;  2WTY A;  2NPS C;  2W27 A;  1KIL A;  2C9N Y;  3BVH A;  5CCH D;  1IK9 A;  1SLQ A;  2ZFC A;  2HFE D;  5AVX B;  2OAR A;  1RY3 A;  3NXS A;  3L37 A;  2A45 G;  1L4A B;  1RE4 A;  1FZF A;  1RE3 C;  3I5C A;  3RK2 B;  4N78 D;  1T3U A;  5CJ0 A;  5CCH A;  1G1I A;  1LWU C;  1WRG A;  1SFC D;  2KB7 P;  1IFD A;  4I6M C;  5AVS B;  2C9L Y;  1G1J A;  1NAF A;  2WZ7 A;  2WIT A;  3V4Q A;  1GDT A;  1NH4 A;  1URQ B;  4WY4 C;  2KLV A;  1JCC A;  2GUV A;  2L5G B;  3OA7 A;  2ZXE B;  4JYC A;  1L4A A;  3L36 A;  5BU8 B;  3HE5 B;  4C46 A;  1RF0 C;  1GTW A;  1RF1 B;  3RK3 C;  3SWY A;  1NWQ A;  2WSE H;  2FFD C;  2Z5I A;  2I1K A;  2FYZ A;  1A02 J;  1FZG A;  3G3Z A;  3P8M C;  1IFJ A;  2QM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...