2ZFCA

X-ray crystal structure of an engineered n-terminal hiv-1 gp41 trimer with enhanced stability and potency
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
44
structure length
44
Chain Sequence
VSGLVQQQNNILRALEATQHAVQALVWGVKQLQARVLALERYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 GP41
publication title Design of an engineered N-terminal HIV-1 gp41 trimer with enhanced stability and potency
pubmed doi rcsb
molecule tags Viral protein
total genus 19
structure length 44
sequence length 44
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-12-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2zfcA00
1IO4A 5AVQB 1SLQA 4C7NB 2P7JA 1GTWA 1T2KD 5AW1B 1GD2E 1GK6A 3M9BA 3O8ZA 3NMDA 2H7HA 2WT7A 3L37A 3L36A 3M91A 2ZFCA 4DZOA 1T2KC 4JYBA 4AQRD 3HE4A 5AVVB 1DH3A 3OAKA 5AVZB 2W27A 1JUNA 5AVXB 2WTYA 2E43A 2Q7CA 1CSBA 2P2UA 3A3YB 3M9HA 4AYCA 2JJLA 1S9KE 2QM7A 3LIDA 1FOSF 1HWTC 5AVRB 5AVYB 2WPRA 5AW5B 3A2AA 3P32A 4HYTB 1NWQA 3TNUA 2R32A 5APYA 3P8MC 1SP4A 2WT7B 1CI6A 3VTPC 2R3CA 2Z5HA 3B8EB 4KHXA 5APWA 2BASA 5APVA 2P67A 5AW7B 5AW0B 3HE4B 4XE5B 2Q3IA 3HE5A 1HUCA 5AVTB 5CMZA 3KQGA 3LIEA 1FOSE 1H89A 2IPPA 4I6MC 3VMYA 2VRSA 1CZQA 2R5BA 2YO2A 3MGNA 3M0DA 1FAVA 5AW3B 3VYIA 3M06A 4EOTA 3TNUB 1OWAA 3L35A 5APTA 2YNYA 2Z5IA 3NFQA 2XU6A 4M3LA 1CI6B 4B86A 2ZXEB 5APXA 3T97A 4LC1A 2WPQA 3A5TA 3HE5B 1OXZA 3M0AA 4I2LC 3TYYA 1JNMA 1GZLA 1J2JB 1X8YA 5AW2B 1G2CB 2XZRA 1MFZA 3I5CA 5AVWB 4AUWA 1KQLA 5APUA 3VMXA 5AW9B 3TK1A 1H8AA 5AW8B 3NXSA 2WWWA 4GKGA 1HJBA 2KP8A 2E42A 1MUUA 1YYCA 1HBWA 2YO3A 2N9BA 4GT1A 2XV5A 2QM8A 3P7KA 3HTKA 2Q5UA 5AVUB 3UIAA 1A02F 1A02J 4C7NA 1GK4A 1GU4A 2WPSA 3KDPB 1NAFA 5AVSB 2R5DA 4C46A 3SWFA 3NTNA 4RESB 5AW4B 2C9NY 1GU5A 3A7OA 2W6AA 3VN0A 3V4QA 5AW6B 1MV8A 5APQA 3V5BA 4JYCA 1S9KD 3IR9A 3VMZA 5APSA 1H88A 3V4WA 2C9LY 3MD0A
chains in the Genus database with same CATH superfamily
2OTKE 4IFFA 3WU2H 1KILA 2WMMA 3L72D 3L37A 3M91A 2A06G 4AQRD 1HF9A 2W27A 5AVXB 3CCLP 3S1KA 2P2UA 2Q1KA 3W67A 2AXTE 3Q1MA 5BU5A 2FYUE 4IL6H 3RGUA 5AW5B 4PD4I 3C8VA 4TLFA 2GA1A 2KSJA 4UB8E 1KQGB 1FZBA 2WSSH 2QJYC 2KK7A 2KB7P 2L5GB 2K9JB 1G2CA 4LLHA 3CWBD 2YO2A 3EWKA 3ITKA 2FYNB 3M0DA 3TGUG 1L4AC 1L0ND 1OMIA 2WQYC 3M0AA 1J2JB 5AW2B 1YI2P 1VF5B 1JY2N 4YXWH 2QM8A 3F5HA 3R4YA 3U1CA 1RF0A 1OIPA 4WY4B 1LTIC 3RL0g 1P84H 5CCGA 5KLVE 1KB9E 3L75D 5EFWB 3VP9A 1LTTC 2M0BA 2V4HA 1JMBA 1PGJA 1JY2O 1PPJD 2PGDA 5APQA 1J1EC 4JYCA 3B5NC 1HJ0A 5APSA 1OVVA 4C7NB 4H44D 1RF1A 3RBXA 2JKVA 2IBZE 4XA4A 3AECC 1CSBA 2DW3A 2NPSB 1SQXE 3M9HA 1OW7A 2JJLA 2RMZA 2WZ7A 3CC7P 1FDMA 1M57D 2NZ2A 4L76A 2KLUA 2OYHB 3U1AA 3FX0A 3VTPC 1IZNB 3GHGA 3L72E 1FZGA 1JY3N 2ZAEB 1FOSE 1SQQD 1GW4A 2E76B 2R5BA 4HH2A 2QJPB 1XTGB 4WBAA 1K04A 1KYOI 3NFQA 1JCDA 3BCCJ 2KNCB 4LC1A 5H2FE 2N1TC 1N73C 3PHLA 1MFZA 4WVZA 3VMXA 1JM0A 1H8AA 4TT3H 3HUSA 2C0WA 1NYHA 2WPVB 2K37A 4RJTA 2MJZA 1YIJP 1N2DC 2R5DA 4C46A 3H25A 1L0NE 3CCJP 2KSEA 3PTZA 3IFMA 2KZIA 1BDDA 4PJ0H 1FZFA 2W6AA 1T6AA 2YMKA 3AE2C 1AV1A 5B66E 5K5GB 3VMZA 2W90A 3AE9C 4EYYQ 1GTWA 2M5AA 1JY2P 1PP9J 2JO1A 3GF7A 3L75E 5L8RJ 2O01N 2HG5D 2A45G 2E74C 3QH9A 1L4AD 1M90Q 2WPRA 4HYTB 5KKZB 2KIKA 1P84I 2J58A 5KJ7A 3CX5D 3H1LD 4O9BA 4XE5B 2XDJA 1H89A 4BRYA 1GL2C 1W5CE 2FFDC 1PGQA 2HPCA 3HD7C 3RK3D 1H0TB 1K73Q 3N4XA 2ZXEB 1KFNA 1LNQA 3CCQP 3B4SA 2JEEA 4I2LC 3B5ND 1DIPA 2P1JA 3H1KJ 2M8RA 1BE3J 2KLVA 4GKGA 1SQVD 3D70A 2IYPA 1YTZI 2Q5UA 3BCCG 1KTMA 2ZT9C 1HGZA 1AQ5A 1EZVD 3KYQA 4OH8B 1E79H 2Y0DA 2PRRA 1VQ7P 2GM4A 3SWKA 4H44B 3JCUH 3GG2A 1SLQA 2E5TA 1Q90D 2H7HA 3CXHH 4H0LD 1JOCA 2D2CD 1DH3A 3AE3C 1RY3A 1FZEA 2AEJA 1N7SC 3RL0C 1S1CX 3CD6P 1HWTC 1LWUB 3WUUA 1LJ2A 3H32A 4YXDC 4ZNCA 3P8MC 3M9QA 1PP9G 4GIFA 1NTMK 5APWA 1QEXA 1W2EA 2V7QH 3GLMA 1LP1B 1NU1J 3KQGA 3WU2E 1KILD 1LTJA 2XNDH 5AW3B 2JR8A 1IFPA 1S4XA 2WSFJ 1EQ7A 4ASVA 4IL6E 1NU1K 2QJKB 1RE3C 3CX5E 3H1LE 3MUDC 3V2RA 1ZXGA 1JB0J 3TK1A 5DJUB 4JBZA 3NXSA 2ZJSE 3L70D 1X9VA 3A0HH 3RK3E 1SQPD 1AVYA 3H1HJ 1GU4A 4EDFA 1NAFA 1X22A 3H1KG 4ZKUA 1URQC 1BE3G 1SFCB 1NTZJ 1SQVE 2W8ZA 3V5BA 3A0BE 1EDKA 3TGUD 3HTKB 3MD0A 4IFMA 2B9BA 1HVVA 4PD4H 1EZVE 3O8ZA 1ZLLA 2J5UA 2XNXA 5M1BA 2ZFCA 3ZDMA 1FDIA 1NTZK 3HE4A 2K88A 1L4AA 5GTHH 5CCGD 1VQ5P 1JUNA 4R4LA 3V2PA 2O01J 5CHXA 1IC2A 1FOSF 3CCMP 1J1DB 3CI9A 3H1IJ 5KLIB 1NTKJ 2I1JA 5AW7B 1ZOYC 2WSEJ 4JPZB 3RK3B 1OVUA 2ZT9D 3MGNA 1EDLA 1FAVA 5B5EH 1NTKK 3B5NB 4BWNA 1FJKA 3N7NA 4U7JA 3G4SP 1NU1G 3TYYA 3JC22 2H8PD 5TISH 3I5CA 3L71D 1KQLA 2POHA 1KILE 4HJGH 1SQBJ 2YKQA 3IAOA 5AVUB 2E5YA 3SSUA 5KAFH 2QVAA 1KB9D 4RESB 3F89A 1U7JA 2OYOA 1SQBK 1YITP 2N9YB 3L70E 3H1HG 1IO4A 1NAYA 1VQ9P 2JDIH 4H0LB 2D2CB 5AW1B 1GK6A 3M9BA 1PL5A 1T2KC 1KMIZ 1HGVA 1R5LA 1NTZG 3CXHD 2E43A 2IBZD 5CCHA 2N1TA 1N73A 2FYUK 4DCKA 3TGUE 4MN4C 4PJ0E 2OYIC 1KYOH 1KILB 2G3AA 3H1JJ 3I56P 2PP6A 1IJDB 3AEBC 4H13C 2RH0A 2O3JA 2QSIA 1LT1A 2KUBA 3BASA 4OGQC 3H1IG 3I55P 1NTKG 3IN6A 2GUVA 2E75D 1G2CB 2WSCJ 2AXCA 4C7RA 5KJ7D 4Y99C 3E1IA 1A02F 1AVOA 2FBWC 2B87A 1YTZT 3V2NA 3L71E 1KN7A 5CJ0A 1SQBG 2M3BA 3CCUP 2KS1A 3VMAA 2V7QJ 2ZXXA 1GD2E 1GL2A 4GDOA 5KTBA 2FFDA 1U57A 2OTJP 3HD7A 3PJSK 1KFMA 2CPSA 2B89A 1KQFB 1S5LE 2WSFH 2YIUB 1SQXK 1VPCA 3AEEC 3BCCD 5AVRB 2R44A 5KAIH 1RF1B 1TU3F 3KZIH 3W68A 1L0LD 3L73J 1BCCJ 1HUCA 3CXHE 3VMYA 3CWBJ 3VYIA 3CCVP 3GHGB 3H1JG 5APXA 3MP7B 1Q86Q 3GMAA 2KYVA 3VP8A 3CC4P 3KXDA 1SS1A 2XV5A 1PP9D 3PH0A 2I8DA 1N7SA 3UIAA 2O01H 2WPSA 1AQTA 4CPGA 1JCCA 4N3YB 3NTNA 5CCHC 1FZCA 1LT9C 1JY3O 3QWOC 1VQ4P 2W83C 2NRGA 1VQOP 1MV8A 3HUSB 4PV1C 1K05A 2WSEH 1AJYA 1M1JC 2C9LY 1N8RQ 4H13D 3O6QA 3B71A 2JWDA 4GODA 4R4MA 3V6IA 2Q6QA 2ZYAA 1RE3A 2CK3H 3D6ZA 2O1KA 1VQKP 3MUDA 2Y9YA 3CX5I 1GMJA 2M5AB 3TNUA 1BDCA 1ZRTD 3Q5PA 2R3CA 1KYOD 2RN0A 3OA7A 1CZQA 3C1LA 2SPZA 3BCCE 1URQA 3K5BA 5GTHE 1SQQJ 2E75B 3KPEA 3ABVC 4EI2A 3L73G 3AE7C 1BGYJ 1L0LE 1BCCG 3Q2YA 1GZLA 1D7MA 4AUWA 2FYNC 4BRYB 5DJTB 1SQQK 2WWWA 1KV4A 4WB4A 3CWBG 2HPCB 3L4FA 2L91A 3L74J 1ZP0C 1A02J 1IK9A 1VF5C 3SWFA 4Y28J 5B5EE 2OARA 3GW6A 4WY4C 5TISE 1MKMA 1PP9E 1JY3P 3R2PA 4K3AA 2IFNA 2I1KA 4U3FD 4UB6H 5KAFE 1P84D 3CLQA 1PPJG 1LTSC 4IOIH 2WSCH 3D71A 3BVHA 2R32A 4XFJA 2H89C 5APVA 2YXRB 3TF5A 2NPSC 1N86A 1DEEG 1ZN5A 1NTMJ 1R8EA 2HODA 1LTGC 2OYHC 4RO0A 4OVNF 1VQMP 1Y9BA 3PP5A 3H32B 5APTA 5CCHD 2N1TD 3S9OA 1FZCC 1ZRTE 4I7ZB 3T97A 1QVGO 4LGDE 1WRGA 2E76C 1IFJA 1KYOE 2BCCJ 5AW9B 2QJPC 2E42A 2KP8A 1LTJB 1MUUA 1SQQG 2Y0EA 1IFMA 1DD3A 4A7PA 1BGYG 1R5SA 2OYIA 2A06D 1M7LA 1PV3A 3AE5C 1SQVK 4ASWA 3L74G 1XTCC 1K9MQ 2H88C 3BATA 1KC8Q 3FXEA 2KI7B 2E74D 5AVVB 3Q5SA 4Z1MH 2QJYB 3H6PA 2KZJA 3USSA 1UIXA 5APYA 1FBMA 1U7MA 1T3UA 1NU1E 3MZWB 3HE4B 1GL2D 4U3FE 1L4AB 1CW5A 3HD7D 1P84E 1NO4A 5KKZC 3MTUE 1VF5D 4EOTA 3L35A 4NPDA 4M3LA 4D6TJ 5KAIE 1YJWP 3Q3DA 1NTMG 3SFEC 1OFCX 3H1LG 3WUVA 4GOEA 3EFGA 1HBWA 3H1HE 1NVOA 2N9BA 1KB9I 3L70J 1J1EB 1GK4A 3OW2O 1SQPJ 2AEMA 2C9NY 1GU5A 1NTZE 1RQUA 2BCCG 1T8ZA 2LKMA 3JSVC 5C39A 1JTHA 1SQPK 1Z56A 1ZMEC 2IBZI 2WT7A 3D6YA 1VQLP 1Q82Q 1QGKB 1FC2C 1N7SD 2A06E 2LXCB 4H44C 4JYBA 3RL0D 2K3RA 2FY8A 1GDTA 2QM7A 2Y0CA 3H1IE 1NTKE 1NWQA 2QEXP 2FYUJ 1DD4A 1CI6A 3B8EB 1DX7A 3HE5A 5CMZA 3G3ZA 3LIEA 1LWUC 1Y8AA 2N1TB 1N73B 1LT9B 2ITAA 5CJ4A 1LT9A 5GTIH 2WVRA 1NKNA 3M06A 3S4RA 1G1IA 1KZUB 3FGAD 3CL3D 2XU6A 1VQPP 3PRJA 2P58A 1M1JA 4N6JA 5AVWB 5TJHA 1DEBA 1SQBE 3LW5J 3L71J 4KJMA 2QJKC 1YBKA 3KDPB 1K8AQ 1URQD 4D6TG 2IFMA 5AW4B 5KLVJ 3AE1C 5AW6B 2QA4P 1RE4C 2Q3EA 1YQ3C 3L70G 3V4WA 1EC5A 4EIJA 3CX5H 2E74B 3G9RA 3L73D 2P7JA 2B87B 2IZ1A 1BCCD 1SQPG 2BEZF 3CMEP 5KLVK 1SFCC 4L73A 2K9JA 2Q7CA 3TSIA 3CCEP 1M56D 4AYCA 1RHZB 5AVYB 2KS1B 1SQXJ 2J59M 1GL2B 3H1JE 2FFDB 4KT0J 3HD7B 1LTAC 2BASA 3A0BH 1Q7YQ 4PD4D 2Q3IA 1IK7A 2O1JA 3L72J 1ZR2A 3PLNA 1J1DC 4DJGA 4UB6E 5KLIC 1OWAA 2FYUG 1ZV8A 1VL2A 3JCUE 4WY4A 1PGPA 1Q2NA 1FS0E 1RQVA 3RK3C 3A5TA 2ZT9B 1OXZA 1S72P 1JNMA 3RK2C 1VQ6P 1YQ4C 1PZQA 1WT6A 1QLED 1EXJA 2QIWA 3FXDA 5E79H 3FWLA 4C7NA 2FXMA 5AVSB 2KOGA 3AE6C 1NHLA 1LGHB 3SFDC 4HB1A 1L0NJ 2ZYDA 1VQ8P 3L71G 3BRVB 1S5LX 2NPSA 1S9KD 1JO5A 1N7SB 5AVQB 1PIXA 3RL0B 5CBNA 1QVFO 1T2KD 2OYHA 1MZ9A 2YKOA 1FE6A 3NMDA 1L0NK 1NKZB 1FZCB 3L36A 5KLVG 2FXOA 2FKWB 3OAKA 1YJNP 3L75J 2ZVNB 2WTYA 1M1KQ 3A3YB 4H0LC 2D2CC 3CC2P 3A2AA 4WWIA 1BGYD 3L73E 1BCCE 3O6QB 2UWJE 2KNCA 2Z5HA 4KHXA 3A0HE 4ZKPA 3CCSP 1NGMB 1X0TA 1L0LJ 1OW6A 2GUSA 5AVTB 3L74D 3II6A 3CWBE 1YHQP 4OGQD 2IBZG 5CBOA 1KILC 1SQXG 2IZ0A 1PGOA 3TNUB 3MIWA 1IFIA 2WITA 1L0LK 3HRNA 2HFED 3H1KD 2HR3A 4PD4E 1BE3D 3L72G 1JMMA 2Z4EA 1HJBA 1X79B 2YO3A 1NOHA 1URQB 3WMM0 1SFCD 2FXPA 2OQQA 2PAJA 1JEKA 2AXTH 1MFTA 3M0DC 3VN0A 1PPJE 1EZVI 1FU1A 4UB8H 1S2EA 2IYOA 3G71P 3AE4C 2YKPA 3AEDC 3V2QA 1W2BO 3OJAB 1NTMD 4DZOA 1L0NG 4ZMDA 3VOPA 3EFFK 1RF0C 1EDJA 1S9KE 5CCGC 1KD1Q 3P32A 2C0XA 2ZYGA 3LW5H 2OTLP 2AEFA 3RK2D 2ZVOB 1H0TA 2YIUC 4N78D 4IFDK 1NU1D 2P67A 2BCCD 4GOFA 2G8YA 3L75G 2JP3A 4NPFX 4I6MC 1SQQE 1EDIA 2M3EA 1RF1C 4W7ZA 2LXBA 1FZAA 4QMAA 3G6EP 1KB9H 2RKLA 1BGYE 1S5LH 4YTPC 2YNYA 3CMAP 1LTBC 1Y47A 1L0LG 3KHUA 3IF4A 2OGUA 2HODB 3L74E 2PFXA 3H1LJ 5AW8B 4OWFA 1HTLC 2W6BA 3H1HD 3GHGC 1OX3A 3AEAC 3T97B 5GTIE 1NJIQ 1FJPA 3H1KE 4L74A 1BE3E 1NTZD 4PV1D 1QL1A 3V4QA 3P8CD 1G1JA 2IDBA 1Q81Q 2QE7H 1LWUA 1SQVJ 2JWAA 2OYIB 2XKMA 2FYZA 1AA0A 3HUSC 1LP1A 4NPEA 1USDA 3Q5RA 4U3FJ 3LIDA 4H13B 2K9YA 5H2FH 3H1ID 2R3SA 1NTKD 4D6TD 4W80A 2A45H 2W6JH 1SP4A 2CPBA 1UIIA 1ZW0A 1NTME 4OGQB 5AW0B 1QL2A 2VRSA 3EQ2A 3E1RA 4Y99B 5BVZA 1RE4A 2B88A 2BEQD 4N78E 1S3JA 2WPQA 2BCCE 5B66H 1BSHA 1X8YA 2QRXA 4IL6X 2XZRA 1NH4A 3GF3A 1SVFA 1SFCA 1SQBD 1WMKA 2E75C 3WUTA 3MHVA 1GW3A 2Y9ZA 4GT1A 5KJ7C 3P7KA 3HTKA 4K35A 2HLOA 4RKUJ 3A7OA 4WY4D 2YXQB 3KZIE 5BU8B 1ZR4A 2YMYA 4YPCA 4DT0A 2FYUD 2LR2A 1KORA 1IFDA 5E79E 1IFNA 5AVZB 1OZHA 1USEA 4L75A 2P10A 3P8CE 3RK2B 2QG4A 1PFIA 1JTHB 1SQVG 4I1LA 1L2PA 1AFOA 2NPSD 3B5NA 2H43A 3TGUJ 1HH0A 3H1JD 3CXHI 2WT7B 1T3JA 1EZVG 4U3FG 4BXLA 2IPPA 1OVRA 3CCRP 4JQ0D 4HKZH 3FWNA 4DOJA 1KQSO 3AEGC 4D6TE 2Z5IA 2E76D 1CI6B 4B86A 1RH5B 5KLVD 1E5WA 4W7YA 3HE5B 3RBZA 4JF7A 5APUA 3U59A 3E7KA 3AE8C 1YYCA 3AEFC 1VQNP 1YJ9P 2IX7C 4I7ZC 3BRTB 3C9IA 1SQPE 2KXPB 2A45I 1BSNA 4PV1B 2Q9IA 1M1JB 1M8OB 3TDKA 1N7LA 1QX8A 1LTJC 3CPWO 1VDFA 2HYNA 2MKVA 3SWYA 1EXIA 1SQXD 2K1AA 1OW8A 3IR9A 1FDOA 1H88A
chains in the Genus database with same CATH topology
1HVVA 5AVQB 3RL0B 4IFFA 1T2KD 3R2PA 2OYHA 1MZ9A 2YKOA 3O8ZA 3NMDA 1ZLLA 1KILA 2IFNA 1L0NK 2XNXA 1NKZB 2I1KA 1FZCB 3L37A 3L36A 3M91A 2ZFCA 1NTZK 3HE4A 2FKWB 4AQRD 3OAKA 2W27A 1L4AA 5CCGD 1JUNA 5AVXB 2WTYA 3V2PA 2P2UA 3A3YB 3CLQA 1LTSC 1IC2A 5CHXA 5BU5A 1FOSF 2WSCH 5AW5B 3A2AA 1J1DB 3BVHA 2R32A 3CI9A 2KSJA 1FZBA 2Z5HA 4KHXA 2I1JA 5APVA 5AW7B 2KB7P 2L5GB 4ZKPA 2NPSC 1N86A 2GUSA 5AVTB 1ZN5A 1G2CA 4LLHA 3RK3B 3II6A 2HODA 1LTGC 2OYHC 2YO2A 3MGNA 3M0DA 1FAVA 1KILC 3PP5A 3H32B 3TNUB 1NTKK 5APTA 3B5NB 2N1TD 5CCHD 1FJKA 3N7NA 3MIWA 1FZCC 1IFIA 2WITA 1L4AC 1L0LK 3HRNA 2HFED 3T97A 4LGDE 3M0AA 1WRGA 3TYYA 1J2JB 2H8PD 5AW2B 1IFJA 3I5CA 1JMMA 2Z4EA 1KQLA 2POHA 5AW9B 1HJBA 2E42A 1X79B 2KP8A 1JY2N 1LTJB 1MUUA 2YO3A 1NOHA 1URQB 3WMM0 2YKQA 1SFCD 2QM8A 1IFMA 3U1CA 5AVUB 1RF0A 4WY4B 1LTIC 5CCGA 2PAJA 2OYIA 4RESB 3VP9A 1LTTC 1M7LA 3M0DC 3VN0A 1SQBK 1JY2O 5APQA 1SQVK 1J1EC 4JYCA 3B5NC 1FU1A 5APSA 1XTCC 2YKPA 1IO4A 4C7NB 5AW1B 1RF1A 3V2QA 1GK6A 3M9BA 3BATA 3OJAB 4DZOA 1T2KC 5AVVB 1HGVA 4XA4A 2E43A 3H6PA 1CSBA 3VOPA 1RF0C 2NPSB 2N1TA 5CCHA 1N73A 3M9HA 2FYUK 2JJLA 1S9KE 2WZ7A 5CCGC 1JY3P 1FDMA 2OYIC 3P32A 2C0XA 3LW5H 2OYHB 5APYA 1FBMA 3U1AA 3RK2D 1KILB 1T3UA 4N78D 3VTPC 4IFDK 3GHGA 2P67A 1FZGA 3HE4B 2PP6A 1IJDB 1GL2D 1L4AB 1CW5A 1JY3N 1FOSE 3HD7D 4I6MC 1NO4A 1RF1C 1GW4A 2R5BA 3MTUE 4W7ZA 1FZAA 4HH2A 4EOTA 1XTGB 3BASA 3L35A 4WBAA 2YNYA 3NFQA 1JCDA 1LTBC 4M3LA 4LC1A 2GUVA 2N1TC 1N73C 1G2CB 1MFZA 2HODB 3VMXA 3EFGA 4C7RA 1H8AA 5AW8B 5KJ7D 4Y99C 1HBWA 3HUSA 3E1IA 1HTLC 2C0WA 2N9BA 2W6BA 3GHGC 2MJZA 1J1EB 1A02F 1N2DC 1GK4A 1YTZT 2R5DA 4C46A 1FJPA 2C9NY 3V2NA 1GU5A 3IFMA 1T8ZA 1FZFA 2LKMA 2W6AA 5CJ0A 1QL1A 3V4QA 3P8CD 1G1JA 2M3BA 3VMZA 1JTHA 1LWUA 1SQPK 1Z56A 1GTWA 1GD2E 1GL2A 1JY2P 5KTBA 2FFDA 2OYIB 2XKMA 2FYZA 3HD7A 2WT7A 1KFMA 1N7SD 2CPSA 4IFMA 3HUSC 3RL0D 4JYBA 2WSFH 2HG5D 1SQXK 2A45G 1GDTA 1VPCA 2QM7A 1L4AD 3LIDA 5AVRB 2WPRA 4HYTB 1NWQA 1RF1B 4W80A 2A45H 1SP4A 2CPBA 1CI6A 2J58A 3B8EB 5KJ7A 5AW0B 1QL2A 1DX7A 4O9BA 4XE5B 3HE5A 1HUCA 5CMZA 3G3ZA 2XDJA 3LIEA 1LWUC 1H89A 2N1TB 1N73B 1LT9B 5CJ4A 3VMYA 1GL2C 2VRSA 3EQ2A 1LT9A 2FFDC 2HPCA 3VYIA 1NKNA 3M06A 3HD7C 1G1IA 1KZUB 3RK3D 4Y99B 3CL3D 5BVZA 2XU6A 1RE4A 3N4XA 2ZXEB 3GHGB 4N78E 1KFNA 5APXA 2WPQA 1M1JA 2JEEA 4I2LC 3B5ND 1X8YA 2XZRA 4N6JA 5AVWB 2KYVA 2P1JA 3VP8A 1NH4A 2M8RA 1DEBA 1SVFA 1SFCA 2KLVA 4GKGA 1GW3A 4GT1A 2XV5A 5KJ7C 3P7KA 1YTZI 3HTKA 2Q5UA 1N7SA 3UIAA 1HGZA 2HLOA 2O01H 1AQ5A 2WPSA 3KDPB 1URQD 1JCCA 2IFMA 3KYQA 4N3YB 4OH8B 3NTNA 5CCHC 1FZCA 5AW4B 1LT9C 1JY3O 3A7OA 2GM4A 4WY4D 5BU8B 5AW6B 1MV8A 3HUSB 1ZR4A 1RE4C 2YMYA 3V4WA 2WSEH 4EIJA 1M1JC 2C9LY 1IFDA 1SLQA 2P7JA 2H7HA 5KLVK 1SFCC 1IFNA 1JOCA 1DH3A 5AVZB 1RY3A 1FZEA 2Q7CA 1RE3A 1N7SC 3TSIA 2O1KA 3P8CE 3RL0C 3RK2B 3MUDA 4AYCA 1PFIA 1JTHB 1HWTC 5AVYB 1LWUB 4I1LA 3H32A 2J59M 3TNUA 1GL2B 3P8MC 3M9QA 1AFOA 2NPSD 3B5NA 2H43A 2FFDB 1HH0A 4GIFA 1NTMK 3HD7B 2WT7B 2R3CA 5APWA 1W2EA 1T3JA 1LTAC 2BASA 2Q3IA 2O1JA 3KQGA 1KILD 1ZR2A 2IPPA 1J1DC 3OA7A 1CZQA 1LTJA 5AW3B 1URQA 1OWAA 1ZV8A 4DOJA 3KPEA 2Z5IA 1EQ7A 1CI6B 4B86A 4WY4A 1NU1K 1RE3C 3RK3C 1E5WA 3A5TA 4W7YA 3HE5B 1OXZA 3V2RA 1JNMA 1GZLA 3RK2C 4AUWA 4JF7A 5APUA 3U59A 3TK1A 3NXSA 1SQQK 2WWWA 4WB4A 1YYCA 2HPCB 3L4FA 1WT6A 2IX7C 1X9VA 3BRTB 3C9IA 1A02J 2A45I 1IK9A 4C7NA 1GU4A 2Q9IA 2FXMA 1NAFA 5AVSB 1M1JB 2KOGA 3SWFA 1NHLA 1N7LA 1LGHB 2OARA 1LTJC 4ZKUA 1VDFA 1URQC 1SFCB 2HYNA 3BRVB 3SWYA 3V5BA 2NPSA 1S9KD 1JO5A 3IR9A 4WY4C 1H88A 3HTKB 3MD0A 1N7SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IO4 A;  5AVQ B;  1SLQ A;  4C7N B;  2P7J A;  1GTW A;  1T2K D;  5AW1 B;  1GD2 E;  1GK6 A;  3M9B A;  3O8Z A;  3NMD A;  2H7H A;  2WT7 A;  3L37 A;  3L36 A;  3M91 A;  2ZFC A;  4DZO A;  1T2K C;  4JYB A;  4AQR D;  3HE4 A;  5AVV B;  1DH3 A;  3OAK A;  5AVZ B;  2W27 A;  1JUN A;  5AVX B;  2WTY A;  2E43 A;  2Q7C A;  1CSB A;  2P2U A;  3A3Y B;  3M9H A;  4AYC A;  2JJL A;  1S9K E;  2QM7 A;  3LID A;  1FOS F;  1HWT C;  5AVR B;  5AVY B;  2WPR A;  5AW5 B;  3A2A A;  3P32 A;  4HYT B;  1NWQ A;  3TNU A;  2R32 A;  5APY A;  3P8M C;  1SP4 A;  2WT7 B;  1CI6 A;  3VTP C;  2R3C A;  2Z5H A;  3B8E B;  4KHX A;  5APW A;  2BAS A;  5APV A;  2P67 A;  5AW7 B;  5AW0 B;  3HE4 B;  4XE5 B;  2Q3I A;  3HE5 A;  1HUC A;  5AVT B;  5CMZ A;  3KQG A;  3LIE A;  1FOS E;  1H89 A;  2IPP A;  4I6M C;  3VMY A;  2VRS A;  1CZQ A;  2R5B A;  2YO2 A;  3MGN A;  3M0D A;  1FAV A;  5AW3 B;  3VYI A;  3M06 A;  4EOT A;  3TNU B;  1OWA A;  3L35 A;  5APT A;  2YNY A;  2Z5I A;  3NFQ A;  2XU6 A;  4M3L A;  1CI6 B;  4B86 A;  2ZXE B;  5APX A;  3T97 A;  4LC1 A;  2WPQ A;  3A5T A;  3HE5 B;  1OXZ A;  3M0A A;  4I2L C;  3TYY A;  1JNM A;  1GZL A;  1J2J B;  1X8Y A;  5AW2 B;  1G2C B;  2XZR A;  1MFZ A;  3I5C A;  5AVW B;  4AUW A;  1KQL A;  5APU A;  3VMX A;  5AW9 B;  3TK1 A;  1H8A A;  5AW8 B;  3NXS A;  2WWW A;  4GKG A;  1HJB A;  2KP8 A;  2E42 A;  1MUU A;  1YYC A;  1HBW A;  2YO3 A;  2N9B A;  4GT1 A;  2XV5 A;  2QM8 A;  3P7K A;  3HTK A;  2Q5U A;  5AVU B;  3UIA A;  1A02 F;  1A02 J;  4C7N A;  1GK4 A;  1GU4 A;  2WPS A;  3KDP B;  1NAF A;  5AVS B;  2R5D A;  4C46 A;  3SWF A;  3NTN A;  4RES B;  5AW4 B;  2C9N Y;  1GU5 A;  3A7O A;  2W6A A;  3VN0 A;  3V4Q A;  5AW6 B;  1MV8 A;  5APQ A;  3V5B A;  4JYC A;  1S9K D;  3IR9 A;  3VMZ A;  5APS A;  1H88 A;  3V4W A;  2C9L Y;  3MD0 A; 
#chains in the Genus database with same CATH topology
 2OTK E;  4IFF A;  3WU2 H;  1KIL A;  2WMM A;  3L72 D;  3L37 A;  3M91 A;  2A06 G;  4AQR D;  1HF9 A;  2W27 A;  5AVX B;  3CCL P;  3S1K A;  2P2U A;  2Q1K A;  3W67 A;  2AXT E;  3Q1M A;  5BU5 A;  2FYU E;  4IL6 H;  3RGU A;  5AW5 B;  4PD4 I;  3C8V A;  4TLF A;  2GA1 A;  2KSJ A;  4UB8 E;  1KQG B;  1FZB A;  2WSS H;  2QJY C;  2KK7 A;  2KB7 P;  2L5G B;  2K9J B;  1G2C A;  4LLH A;  3CWB D;  2YO2 A;  3EWK A;  3ITK A;  2FYN B;  3M0D A;  3TGU G;  1L4A C;  1L0N D;  1OMI A;  2WQY C;  3M0A A;  1J2J B;  5AW2 B;  1YI2 P;  1VF5 B;  1JY2 N;  4YXW H;  2QM8 A;  3F5H A;  3R4Y A;  3U1C A;  1RF0 A;  1OIP A;  4WY4 B;  1LTI C;  3RL0 g;  1P84 H;  5CCG A;  5KLV E;  1KB9 E;  3L75 D;  5EFW B;  3VP9 A;  1LTT C;  2M0B A;  2V4H A;  1JMB A;  1PGJ A;  1JY2 O;  1PPJ D;  2PGD A;  5APQ A;  1J1E C;  4JYC A;  3B5N C;  1HJ0 A;  5APS A;  1OVV A;  4C7N B;  4H44 D;  1RF1 A;  3RBX A;  2JKV A;  2IBZ E;  4XA4 A;  3AEC C;  1CSB A;  2DW3 A;  2NPS B;  1SQX E;  3M9H A;  1OW7 A;  2JJL A;  2RMZ A;  2WZ7 A;  3CC7 P;  1FDM A;  1M57 D;  2NZ2 A;  4L76 A;  2KLU A;  2OYH B;  3U1A A;  3FX0 A;  3VTP C;  1IZN B;  3GHG A;  3L72 E;  1FZG A;  1JY3 N;  2ZAE B;  1FOS E;  1SQQ D;  1GW4 A;  2E76 B;  2R5B A;  4HH2 A;  2QJP B;  1XTG B;  4WBA A;  1K04 A;  1KYO I;  3NFQ A;  1JCD A;  3BCC J;  2KNC B;  4LC1 A;  5H2F E;  2N1T C;  1N73 C;  3PHL A;  1MFZ A;  4WVZ A;  3VMX A;  1JM0 A;  1H8A A;  4TT3 H;  3HUS A;  2C0W A;  1NYH A;  2WPV B;  2K37 A;  4RJT A;  2MJZ A;  1YIJ P;  1N2D C;  2R5D A;  4C46 A;  3H25 A;  1L0N E;  3CCJ P;  2KSE A;  3PTZ A;  3IFM A;  2KZI A;  1BDD A;  4PJ0 H;  1FZF A;  2W6A A;  1T6A A;  2YMK A;  3AE2 C;  1AV1 A;  5B66 E;  5K5G B;  3VMZ A;  2W90 A;  3AE9 C;  4EYY Q;  1GTW A;  2M5A A;  1JY2 P;  1PP9 J;  2JO1 A;  3GF7 A;  3L75 E;  5L8R J;  2O01 N;  2HG5 D;  2A45 G;  2E74 C;  3QH9 A;  1L4A D;  1M90 Q;  2WPR A;  4HYT B;  5KKZ B;  2KIK A;  1P84 I;  2J58 A;  5KJ7 A;  3CX5 D;  3H1L D;  4O9B A;  4XE5 B;  2XDJ A;  1H89 A;  4BRY A;  1GL2 C;  1W5C E;  2FFD C;  1PGQ A;  2HPC A;  3HD7 C;  3RK3 D;  1H0T B;  1K73 Q;  3N4X A;  2ZXE B;  1KFN A;  1LNQ A;  3CCQ P;  3B4S A;  2JEE A;  4I2L C;  3B5N D;  1DIP A;  2P1J A;  3H1K J;  2M8R A;  1BE3 J;  2KLV A;  4GKG A;  1SQV D;  3D70 A;  2IYP A;  1YTZ I;  2Q5U A;  3BCC G;  1KTM A;  2ZT9 C;  1HGZ A;  1AQ5 A;  1EZV D;  3KYQ A;  4OH8 B;  1E79 H;  2Y0D A;  2PRR A;  1VQ7 P;  2GM4 A;  3SWK A;  4H44 B;  3JCU H;  3GG2 A;  1SLQ A;  2E5T A;  1Q90 D;  2H7H A;  3CXH H;  4H0L D;  1JOC A;  2D2C D;  1DH3 A;  3AE3 C;  1RY3 A;  1FZE A;  2AEJ A;  1N7S C;  3RL0 C;  1S1C X;  3CD6 P;  1HWT C;  1LWU B;  3WUU A;  1LJ2 A;  3H32 A;  4YXD C;  4ZNC A;  3P8M C;  3M9Q A;  1PP9 G;  4GIF A;  1NTM K;  5APW A;  1QEX A;  1W2E A;  2V7Q H;  3GLM A;  1LP1 B;  1NU1 J;  3KQG A;  3WU2 E;  1KIL D;  1LTJ A;  2XND H;  5AW3 B;  2JR8 A;  1IFP A;  1S4X A;  2WSF J;  1EQ7 A;  4ASV A;  4IL6 E;  1NU1 K;  2QJK B;  1RE3 C;  3CX5 E;  3H1L E;  3MUD C;  3V2R A;  1ZXG A;  1JB0 J;  3TK1 A;  5DJU B;  4JBZ A;  3NXS A;  2ZJS E;  3L70 D;  1X9V A;  3A0H H;  3RK3 E;  1SQP D;  1AVY A;  3H1H J;  1GU4 A;  4EDF A;  1NAF A;  1X22 A;  3H1K G;  4ZKU A;  1URQ C;  1BE3 G;  1SFC B;  1NTZ J;  1SQV E;  2W8Z A;  3V5B A;  3A0B E;  1EDK A;  3TGU D;  3HTK B;  3MD0 A;  4IFM A;  2B9B A;  1HVV A;  4PD4 H;  1EZV E;  3O8Z A;  1ZLL A;  2J5U A;  2XNX A;  5M1B A;  2ZFC A;  3ZDM A;  1FDI A;  1NTZ K;  3HE4 A;  2K88 A;  1L4A A;  5GTH H;  5CCG D;  1VQ5 P;  1JUN A;  4R4L A;  3V2P A;  2O01 J;  5CHX A;  1IC2 A;  1FOS F;  3CCM P;  1J1D B;  3CI9 A;  3H1I J;  5KLI B;  1NTK J;  2I1J A;  5AW7 B;  1ZOY C;  2WSE J;  4JPZ B;  3RK3 B;  1OVU A;  2ZT9 D;  3MGN A;  1EDL A;  1FAV A;  5B5E H;  1NTK K;  3B5N B;  4BWN A;  1FJK A;  3N7N A;  4U7J A;  3G4S P;  1NU1 G;  3TYY A;  3JC2 2;  2H8P D;  5TIS H;  3I5C A;  3L71 D;  1KQL A;  2POH A;  1KIL E;  4HJG H;  1SQB J;  2YKQ A;  3IAO A;  5AVU B;  2E5Y A;  3SSU A;  5KAF H;  2QVA A;  1KB9 D;  4RES B;  3F89 A;  1U7J A;  2OYO A;  1SQB K;  1YIT P;  2N9Y B;  3L70 E;  3H1H G;  1IO4 A;  1NAY A;  1VQ9 P;  2JDI H;  4H0L B;  2D2C B;  5AW1 B;  1GK6 A;  3M9B A;  1PL5 A;  1T2K C;  1KMI Z;  1HGV A;  1R5L A;  1NTZ G;  3CXH D;  2E43 A;  2IBZ D;  5CCH A;  2N1T A;  1N73 A;  2FYU K;  4DCK A;  3TGU E;  4MN4 C;  4PJ0 E;  2OYI C;  1KYO H;  1KIL B;  2G3A A;  3H1J J;  3I56 P;  2PP6 A;  1IJD B;  3AEB C;  4H13 C;  2RH0 A;  2O3J A;  2QSI A;  1LT1 A;  2KUB A;  3BAS A;  4OGQ C;  3H1I G;  3I55 P;  1NTK G;  3IN6 A;  2GUV A;  2E75 D;  1G2C B;  2WSC J;  2AXC A;  4C7R A;  5KJ7 D;  4Y99 C;  3E1I A;  1A02 F;  1AVO A;  2FBW C;  2B87 A;  1YTZ T;  3V2N A;  3L71 E;  1KN7 A;  5CJ0 A;  1SQB G;  2M3B A;  3CCU P;  2KS1 A;  3VMA A;  2V7Q J;  2ZXX A;  1GD2 E;  1GL2 A;  4GDO A;  5KTB A;  2FFD A;  1U57 A;  2OTJ P;  3HD7 A;  3PJS K;  1KFM A;  2CPS A;  2B89 A;  1KQF B;  1S5L E;  2WSF H;  2YIU B;  1SQX K;  1VPC A;  3AEE C;  3BCC D;  5AVR B;  2R44 A;  5KAI H;  1RF1 B;  1TU3 F;  3KZI H;  3W68 A;  1L0L D;  3L73 J;  1BCC J;  1HUC A;  3CXH E;  3VMY A;  3CWB J;  3VYI A;  3CCV P;  3GHG B;  3H1J G;  5APX A;  3MP7 B;  1Q86 Q;  3GMA A;  2KYV A;  3VP8 A;  3CC4 P;  3KXD A;  1SS1 A;  2XV5 A;  1PP9 D;  3PH0 A;  2I8D A;  1N7S A;  3UIA A;  2O01 H;  2WPS A;  1AQT A;  4CPG A;  1JCC A;  4N3Y B;  3NTN A;  5CCH C;  1FZC A;  1LT9 C;  1JY3 O;  3QWO C;  1VQ4 P;  2W83 C;  2NRG A;  1VQO P;  1MV8 A;  3HUS B;  4PV1 C;  1K05 A;  2WSE H;  1AJY A;  1M1J C;  2C9L Y;  1N8R Q;  4H13 D;  3O6Q A;  3B71 A;  2JWD A;  4GOD A;  4R4M A;  3V6I A;  2Q6Q A;  2ZYA A;  1RE3 A;  2CK3 H;  3D6Z A;  2O1K A;  1VQK P;  3MUD A;  2Y9Y A;  3CX5 I;  1GMJ A;  2M5A B;  3TNU A;  1BDC A;  1ZRT D;  3Q5P A;  2R3C A;  1KYO D;  2RN0 A;  3OA7 A;  1CZQ A;  3C1L A;  2SPZ A;  3BCC E;  1URQ A;  3K5B A;  5GTH E;  1SQQ J;  2E75 B;  3KPE A;  3ABV C;  4EI2 A;  3L73 G;  3AE7 C;  1BGY J;  1L0L E;  1BCC G;  3Q2Y A;  1GZL A;  1D7M A;  4AUW A;  2FYN C;  4BRY B;  5DJT B;  1SQQ K;  2WWW A;  1KV4 A;  4WB4 A;  3CWB G;  2HPC B;  3L4F A;  2L91 A;  3L74 J;  1ZP0 C;  1A02 J;  1IK9 A;  1VF5 C;  3SWF A;  4Y28 J;  5B5E E;  2OAR A;  3GW6 A;  4WY4 C;  5TIS E;  1MKM A;  1PP9 E;  1JY3 P;  3R2P A;  4K3A A;  2IFN A;  2I1K A;  4U3F D;  4UB6 H;  5KAF E;  1P84 D;  3CLQ A;  1PPJ G;  1LTS C;  4IOI H;  2WSC H;  3D71 A;  3BVH A;  2R32 A;  4XFJ A;  2H89 C;  5APV A;  2YXR B;  3TF5 A;  2NPS C;  1N86 A;  1DEE G;  1ZN5 A;  1NTM J;  1R8E A;  2HOD A;  1LTG C;  2OYH C;  4RO0 A;  4OVN F;  1VQM P;  1Y9B A;  3PP5 A;  3H32 B;  5APT A;  5CCH D;  2N1T D;  3S9O A;  1FZC C;  1ZRT E;  4I7Z B;  3T97 A;  1QVG O;  4LGD E;  1WRG A;  2E76 C;  1IFJ A;  1KYO E;  2BCC J;  5AW9 B;  2QJP C;  2E42 A;  2KP8 A;  1LTJ B;  1MUU A;  1SQQ G;  2Y0E A;  1IFM A;  1DD3 A;  4A7P A;  1BGY G;  1R5S A;  2OYI A;  2A06 D;  1M7L A;  1PV3 A;  3AE5 C;  1SQV K;  4ASW A;  3L74 G;  1XTC C;  1K9M Q;  2H88 C;  3BAT A;  1KC8 Q;  3FXE A;  2KI7 B;  2E74 D;  5AVV B;  3Q5S A;  4Z1M H;  2QJY B;  3H6P A;  2KZJ A;  3USS A;  1UIX A;  5APY A;  1FBM A;  1U7M A;  1T3U A;  1NU1 E;  3MZW B;  3HE4 B;  1GL2 D;  4U3F E;  1L4A B;  1CW5 A;  3HD7 D;  1P84 E;  1NO4 A;  5KKZ C;  3MTU E;  1VF5 D;  4EOT A;  3L35 A;  4NPD A;  4M3L A;  4D6T J;  5KAI E;  1YJW P;  3Q3D A;  1NTM G;  3SFE C;  1OFC X;  3H1L G;  3WUV A;  4GOE A;  3EFG A;  1HBW A;  3H1H E;  1NVO A;  2N9B A;  1KB9 I;  3L70 J;  1J1E B;  1GK4 A;  3OW2 O;  1SQP J;  2AEM A;  2C9N Y;  1GU5 A;  1NTZ E;  1RQU A;  2BCC G;  1T8Z A;  2LKM A;  3JSV C;  5C39 A;  1JTH A;  1SQP K;  1Z56 A;  1ZME C;  2IBZ I;  2WT7 A;  3D6Y A;  1VQL P;  1Q82 Q;  1QGK B;  1FC2 C;  1N7S D;  2A06 E;  2LXC B;  4H44 C;  4JYB A;  3RL0 D;  2K3R A;  2FY8 A;  1GDT A;  2QM7 A;  2Y0C A;  3H1I E;  1NTK E;  1NWQ A;  2QEX P;  2FYU J;  1DD4 A;  1CI6 A;  3B8E B;  1DX7 A;  3HE5 A;  5CMZ A;  3G3Z A;  3LIE A;  1LWU C;  1Y8A A;  2N1T B;  1N73 B;  1LT9 B;  2ITA A;  5CJ4 A;  1LT9 A;  5GTI H;  2WVR A;  1NKN A;  3M06 A;  3S4R A;  1G1I A;  1KZU B;  3FGA D;  3CL3 D;  2XU6 A;  1VQP P;  3PRJ A;  2P58 A;  1M1J A;  4N6J A;  5AVW B;  5TJH A;  1DEB A;  1SQB E;  3LW5 J;  3L71 J;  4KJM A;  2QJK C;  1YBK A;  3KDP B;  1K8A Q;  1URQ D;  4D6T G;  2IFM A;  5AW4 B;  5KLV J;  3AE1 C;  5AW6 B;  2QA4 P;  1RE4 C;  2Q3E A;  1YQ3 C;  3L70 G;  3V4W A;  1EC5 A;  4EIJ A;  3CX5 H;  2E74 B;  3G9R A;  3L73 D;  2P7J A;  2B87 B;  2IZ1 A;  1BCC D;  1SQP G;  2BEZ F;  3CME P;  5KLV K;  1SFC C;  4L73 A;  2K9J A;  2Q7C A;  3TSI A;  3CCE P;  1M56 D;  4AYC A;  1RHZ B;  5AVY B;  2KS1 B;  1SQX J;  2J59 M;  1GL2 B;  3H1J E;  2FFD B;  4KT0 J;  3HD7 B;  1LTA C;  2BAS A;  3A0B H;  1Q7Y Q;  4PD4 D;  2Q3I A;  1IK7 A;  2O1J A;  3L72 J;  1ZR2 A;  3PLN A;  1J1D C;  4DJG A;  4UB6 E;  5KLI C;  1OWA A;  2FYU G;  1ZV8 A;  1VL2 A;  3JCU E;  4WY4 A;  1PGP A;  1Q2N A;  1FS0 E;  1RQV A;  3RK3 C;  3A5T A;  2ZT9 B;  1OXZ A;  1S72 P;  1JNM A;  3RK2 C;  1VQ6 P;  1YQ4 C;  1PZQ A;  1WT6 A;  1QLE D;  1EXJ A;  2QIW A;  3FXD A;  5E79 H;  3FWL A;  4C7N A;  2FXM A;  5AVS B;  2KOG A;  3AE6 C;  1NHL A;  1LGH B;  3SFD C;  4HB1 A;  1L0N J;  2ZYD A;  1VQ8 P;  3L71 G;  3BRV B;  1S5L X;  2NPS A;  1S9K D;  1JO5 A;  1N7S B;  5AVQ B;  1PIX A;  3RL0 B;  5CBN A;  1QVF O;  1T2K D;  2OYH A;  1MZ9 A;  2YKO A;  1FE6 A;  3NMD A;  1L0N K;  1NKZ B;  1FZC B;  3L36 A;  5KLV G;  2FXO A;  2FKW B;  3OAK A;  1YJN P;  3L75 J;  2ZVN B;  2WTY A;  1M1K Q;  3A3Y B;  4H0L C;  2D2C C;  3CC2 P;  3A2A A;  4WWI A;  1BGY D;  3L73 E;  1BCC E;  3O6Q B;  2UWJ E;  2KNC A;  2Z5H A;  4KHX A;  3A0H E;  4ZKP A;  3CCS P;  1NGM B;  1X0T A;  1L0L J;  1OW6 A;  2GUS A;  5AVT B;  3L74 D;  3II6 A;  3CWB E;  1YHQ P;  4OGQ D;  2IBZ G;  5CBO A;  1KIL C;  1SQX G;  2IZ0 A;  1PGO A;  3TNU B;  3MIW A;  1IFI A;  2WIT A;  1L0L K;  3HRN A;  2HFE D;  3H1K D;  2HR3 A;  4PD4 E;  1BE3 D;  3L72 G;  1JMM A;  2Z4E A;  1HJB A;  1X79 B;  2YO3 A;  1NOH A;  1URQ B;  3WMM 0;  1SFC D;  2FXP A;  2OQQ A;  2PAJ A;  1JEK A;  2AXT H;  1MFT A;  3M0D C;  3VN0 A;  1PPJ E;  1EZV I;  1FU1 A;  4UB8 H;  1S2E A;  2IYO A;  3G71 P;  3AE4 C;  2YKP A;  3AED C;  3V2Q A;  1W2B O;  3OJA B;  1NTM D;  4DZO A;  1L0N G;  4ZMD A;  3VOP A;  3EFF K;  1RF0 C;  1EDJ A;  1S9K E;  5CCG C;  1KD1 Q;  3P32 A;  2C0X A;  2ZYG A;  3LW5 H;  2OTL P;  2AEF A;  3RK2 D;  2ZVO B;  1H0T A;  2YIU C;  4N78 D;  4IFD K;  1NU1 D;  2P67 A;  2BCC D;  4GOF A;  2G8Y A;  3L75 G;  2JP3 A;  4NPF X;  4I6M C;  1SQQ E;  1EDI A;  2M3E A;  1RF1 C;  4W7Z A;  2LXB A;  1FZA A;  4QMA A;  3G6E P;  1KB9 H;  2RKL A;  1BGY E;  1S5L H;  4YTP C;  2YNY A;  3CMA P;  1LTB C;  1Y47 A;  1L0L G;  3KHU A;  3IF4 A;  2OGU A;  2HOD B;  3L74 E;  2PFX A;  3H1L J;  5AW8 B;  4OWF A;  1HTL C;  2W6B A;  3H1H D;  3GHG C;  1OX3 A;  3AEA C;  3T97 B;  5GTI E;  1NJI Q;  1FJP A;  3H1K E;  4L74 A;  1BE3 E;  1NTZ D;  4PV1 D;  1QL1 A;  3V4Q A;  3P8C D;  1G1J A;  2IDB A;  1Q81 Q;  2QE7 H;  1LWU A;  1SQV J;  2JWA A;  2OYI B;  2XKM A;  2FYZ A;  1AA0 A;  3HUS C;  1LP1 A;  4NPE A;  1USD A;  3Q5R A;  4U3F J;  3LID A;  4H13 B;  2K9Y A;  5H2F H;  3H1I D;  2R3S A;  1NTK D;  4D6T D;  4W80 A;  2A45 H;  2W6J H;  1SP4 A;  2CPB A;  1UII A;  1ZW0 A;  1NTM E;  4OGQ B;  5AW0 B;  1QL2 A;  2VRS A;  3EQ2 A;  3E1R A;  4Y99 B;  5BVZ A;  1RE4 A;  2B88 A;  2BEQ D;  4N78 E;  1S3J A;  2WPQ A;  2BCC E;  5B66 H;  1BSH A;  1X8Y A;  2QRX A;  4IL6 X;  2XZR A;  1NH4 A;  3GF3 A;  1SVF A;  1SFC A;  1SQB D;  1WMK A;  2E75 C;  3WUT A;  3MHV A;  1GW3 A;  2Y9Z A;  4GT1 A;  5KJ7 C;  3P7K A;  3HTK A;  4K35 A;  2HLO A;  4RKU J;  3A7O A;  4WY4 D;  2YXQ B;  3KZI E;  5BU8 B;  1ZR4 A;  2YMY A;  4YPC A;  4DT0 A;  2FYU D;  2LR2 A;  1KOR A;  1IFD A;  5E79 E;  1IFN A;  5AVZ B;  1OZH A;  1USE A;  4L75 A;  2P10 A;  3P8C E;  3RK2 B;  2QG4 A;  1PFI A;  1JTH B;  1SQV G;  4I1L A;  1L2P A;  1AFO A;  2NPS D;  3B5N A;  2H43 A;  3TGU J;  1HH0 A;  3H1J D;  3CXH I;  2WT7 B;  1T3J A;  1EZV G;  4U3F G;  4BXL A;  2IPP A;  1OVR A;  3CCR P;  4JQ0 D;  4HKZ H;  3FWN A;  4DOJ A;  1KQS O;  3AEG C;  4D6T E;  2Z5I A;  2E76 D;  1CI6 B;  4B86 A;  1RH5 B;  5KLV D;  1E5W A;  4W7Y A;  3HE5 B;  3RBZ A;  4JF7 A;  5APU A;  3U59 A;  3E7K A;  3AE8 C;  1YYC A;  3AEF C;  1VQN P;  1YJ9 P;  2IX7 C;  4I7Z C;  3BRT B;  3C9I A;  1SQP E;  2KXP B;  2A45 I;  1BSN A;  4PV1 B;  2Q9I A;  1M1J B;  1M8O B;  3TDK A;  1N7L A;  1QX8 A;  1LTJ C;  3CPW O;  1VDF A;  2HYN A;  2MKV A;  3SWY A;  1EXI A;  1SQX D;  2K1A A;  1OW8 A;  3IR9 A;  1FDO A;  1H88 A; 
#chains in the Genus database with same CATH homology
 1HVV A;  5AVQ B;  3RL0 B;  4IFF A;  1T2K D;  3R2P A;  2OYH A;  1MZ9 A;  2YKO A;  3O8Z A;  3NMD A;  1ZLL A;  1KIL A;  2IFN A;  1L0N K;  2XNX A;  1NKZ B;  2I1K A;  1FZC B;  3L37 A;  3L36 A;  3M91 A;  2ZFC A;  1NTZ K;  3HE4 A;  2FKW B;  4AQR D;  3OAK A;  2W27 A;  1L4A A;  5CCG D;  1JUN A;  5AVX B;  2WTY A;  3V2P A;  2P2U A;  3A3Y B;  3CLQ A;  1LTS C;  1IC2 A;  5CHX A;  5BU5 A;  1FOS F;  2WSC H;  5AW5 B;  3A2A A;  1J1D B;  3BVH A;  2R32 A;  3CI9 A;  2KSJ A;  1FZB A;  2Z5H A;  4KHX A;  2I1J A;  5APV A;  5AW7 B;  2KB7 P;  2L5G B;  4ZKP A;  2NPS C;  1N86 A;  2GUS A;  5AVT B;  1ZN5 A;  1G2C A;  4LLH A;  3RK3 B;  3II6 A;  2HOD A;  1LTG C;  2OYH C;  2YO2 A;  3MGN A;  3M0D A;  1FAV A;  1KIL C;  3PP5 A;  3H32 B;  3TNU B;  1NTK K;  5APT A;  3B5N B;  2N1T D;  5CCH D;  1FJK A;  3N7N A;  3MIW A;  1FZC C;  1IFI A;  2WIT A;  1L4A C;  1L0L K;  3HRN A;  2HFE D;  3T97 A;  4LGD E;  3M0A A;  1WRG A;  3TYY A;  1J2J B;  2H8P D;  5AW2 B;  1IFJ A;  3I5C A;  1JMM A;  2Z4E A;  1KQL A;  2POH A;  5AW9 B;  1HJB A;  2E42 A;  1X79 B;  2KP8 A;  1JY2 N;  1LTJ B;  1MUU A;  2YO3 A;  1NOH A;  1URQ B;  3WMM 0;  2YKQ A;  1SFC D;  2QM8 A;  1IFM A;  3U1C A;  5AVU B;  1RF0 A;  4WY4 B;  1LTI C;  5CCG A;  2PAJ A;  2OYI A;  4RES B;  3VP9 A;  1LTT C;  1M7L A;  3M0D C;  3VN0 A;  1SQB K;  1JY2 O;  5APQ A;  1SQV K;  1J1E C;  4JYC A;  3B5N C;  1FU1 A;  5APS A;  1XTC C;  2YKP A;  1IO4 A;  4C7N B;  5AW1 B;  1RF1 A;  3V2Q A;  1GK6 A;  3M9B A;  3BAT A;  3OJA B;  4DZO A;  1T2K C;  5AVV B;  1HGV A;  4XA4 A;  2E43 A;  3H6P A;  1CSB A;  3VOP A;  1RF0 C;  2NPS B;  2N1T A;  5CCH A;  1N73 A;  3M9H A;  2FYU K;  2JJL A;  1S9K E;  2WZ7 A;  5CCG C;  1JY3 P;  1FDM A;  2OYI C;  3P32 A;  2C0X A;  3LW5 H;  2OYH B;  5APY A;  1FBM A;  3U1A A;  3RK2 D;  1KIL B;  1T3U A;  4N78 D;  3VTP C;  4IFD K;  3GHG A;  2P67 A;  1FZG A;  3HE4 B;  2PP6 A;  1IJD B;  1GL2 D;  1L4A B;  1CW5 A;  1JY3 N;  1FOS E;  3HD7 D;  4I6M C;  1NO4 A;  1RF1 C;  1GW4 A;  2R5B A;  3MTU E;  4W7Z A;  1FZA A;  4HH2 A;  4EOT A;  1XTG B;  3BAS A;  3L35 A;  4WBA A;  2YNY A;  3NFQ A;  1JCD A;  1LTB C;  4M3L A;  4LC1 A;  2GUV A;  2N1T C;  1N73 C;  1G2C B;  1MFZ A;  2HOD B;  3VMX A;  3EFG A;  4C7R A;  1H8A A;  5AW8 B;  5KJ7 D;  4Y99 C;  1HBW A;  3HUS A;  3E1I A;  1HTL C;  2C0W A;  2N9B A;  2W6B A;  3GHG C;  2MJZ A;  1J1E B;  1A02 F;  1N2D C;  1GK4 A;  1YTZ T;  2R5D A;  4C46 A;  1FJP A;  2C9N Y;  3V2N A;  1GU5 A;  3IFM A;  1T8Z A;  1FZF A;  2LKM A;  2W6A A;  5CJ0 A;  1QL1 A;  3V4Q A;  3P8C D;  1G1J A;  2M3B A;  3VMZ A;  1JTH A;  1LWU A;  1SQP K;  1Z56 A;  1GTW A;  1GD2 E;  1GL2 A;  1JY2 P;  5KTB A;  2FFD A;  2OYI B;  2XKM A;  2FYZ A;  3HD7 A;  2WT7 A;  1KFM A;  1N7S D;  2CPS A;  4IFM A;  3HUS C;  3RL0 D;  4JYB A;  2WSF H;  2HG5 D;  1SQX K;  2A45 G;  1GDT A;  1VPC A;  2QM7 A;  1L4A D;  3LID A;  5AVR B;  2WPR A;  4HYT B;  1NWQ A;  1RF1 B;  4W80 A;  2A45 H;  1SP4 A;  2CPB A;  1CI6 A;  2J58 A;  3B8E B;  5KJ7 A;  5AW0 B;  1QL2 A;  1DX7 A;  4O9B A;  4XE5 B;  3HE5 A;  1HUC A;  5CMZ A;  3G3Z A;  2XDJ A;  3LIE A;  1LWU C;  1H89 A;  2N1T B;  1N73 B;  1LT9 B;  5CJ4 A;  3VMY A;  1GL2 C;  2VRS A;  3EQ2 A;  1LT9 A;  2FFD C;  2HPC A;  3VYI A;  1NKN A;  3M06 A;  3HD7 C;  1G1I A;  1KZU B;  3RK3 D;  4Y99 B;  3CL3 D;  5BVZ A;  2XU6 A;  1RE4 A;  3N4X A;  2ZXE B;  3GHG B;  4N78 E;  1KFN A;  5APX A;  2WPQ A;  1M1J A;  2JEE A;  4I2L C;  3B5N D;  1X8Y A;  2XZR A;  4N6J A;  5AVW B;  2KYV A;  2P1J A;  3VP8 A;  1NH4 A;  2M8R A;  1DEB A;  1SVF A;  1SFC A;  2KLV A;  4GKG A;  1GW3 A;  4GT1 A;  2XV5 A;  5KJ7 C;  3P7K A;  1YTZ I;  3HTK A;  2Q5U A;  1N7S A;  3UIA A;  1HGZ A;  2HLO A;  2O01 H;  1AQ5 A;  2WPS A;  3KDP B;  1URQ D;  1JCC A;  2IFM A;  3KYQ A;  4N3Y B;  4OH8 B;  3NTN A;  5CCH C;  1FZC A;  5AW4 B;  1LT9 C;  1JY3 O;  3A7O A;  2GM4 A;  4WY4 D;  5BU8 B;  5AW6 B;  1MV8 A;  3HUS B;  1ZR4 A;  1RE4 C;  2YMY A;  3V4W A;  2WSE H;  4EIJ A;  1M1J C;  2C9L Y;  1IFD A;  1SLQ A;  2P7J A;  2H7H A;  5KLV K;  1SFC C;  1IFN A;  1JOC A;  1DH3 A;  5AVZ B;  1RY3 A;  1FZE A;  2Q7C A;  1RE3 A;  1N7S C;  3TSI A;  2O1K A;  3P8C E;  3RL0 C;  3RK2 B;  3MUD A;  4AYC A;  1PFI A;  1JTH B;  1HWT C;  5AVY B;  1LWU B;  4I1L A;  3H32 A;  2J59 M;  3TNU A;  1GL2 B;  3P8M C;  3M9Q A;  1AFO A;  2NPS D;  3B5N A;  2H43 A;  2FFD B;  1HH0 A;  4GIF A;  1NTM K;  3HD7 B;  2WT7 B;  2R3C A;  5APW A;  1W2E A;  1T3J A;  1LTA C;  2BAS A;  2Q3I A;  2O1J A;  3KQG A;  1KIL D;  1ZR2 A;  2IPP A;  1J1D C;  3OA7 A;  1CZQ A;  1LTJ A;  5AW3 B;  1URQ A;  1OWA A;  1ZV8 A;  4DOJ A;  3KPE A;  2Z5I A;  1EQ7 A;  1CI6 B;  4B86 A;  4WY4 A;  1NU1 K;  1RE3 C;  3RK3 C;  1E5W A;  3A5T A;  4W7Y A;  3HE5 B;  1OXZ A;  3V2R A;  1JNM A;  1GZL A;  3RK2 C;  4AUW A;  4JF7 A;  5APU A;  3U59 A;  3TK1 A;  3NXS A;  1SQQ K;  2WWW A;  4WB4 A;  1YYC A;  2HPC B;  3L4F A;  1WT6 A;  2IX7 C;  1X9V A;  3BRT B;  3C9I A;  1A02 J;  2A45 I;  1IK9 A;  4C7N A;  1GU4 A;  2Q9I A;  2FXM A;  1NAF A;  5AVS B;  1M1J B;  2KOG A;  3SWF A;  1NHL A;  1N7L A;  1LGH B;  2OAR A;  1LTJ C;  4ZKU A;  1VDF A;  1URQ C;  1SFC B;  2HYN A;  3BRV B;  3SWY A;  3V5B A;  2NPS A;  1S9K D;  1JO5 A;  3IR9 A;  4WY4 C;  1H88 A;  3HTK B;  3MD0 A;  1N7S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...