2ZFCA

X-ray crystal structure of an engineered n-terminal hiv-1 gp41 trimer with enhanced stability and potency
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
44
structure length
44
Chain Sequence
VSGLVQQQNNILRALEATQHAVQALVWGVKQLQARVLALERYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords HIV-1 GP41
publication title Design of an engineered N-terminal HIV-1 gp41 trimer with enhanced stability and potency
pubmed doi rcsb
total genus 19
structure length 44
sequence length 44
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-12-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2zfcA00
3M9BA 2C9LY 3VMXA 1MFZA 1H8AA 1MV8A 4C46A 4AQRD 2P67A 2WTYA 2Z5HA 2W27A 4B86A 1S9KD 3TNUA 4AYCA 3I5CA 1X8YA 1HWTC 2ZXEB 3SWFA 1GK4A 3VTPC 4C7NB 2XU6A 3HTKA 2Q7CA 5AVQB 3TNUB 2QM7A 3NFQA 3VN0A 1OWAA 1KQLA 4HYTB 1IO4A 3MD0A 5AW0B 1GK6A 2YO3A 5AW4B 3LIEA 1GD2E 2Z5IA 4JYCA 1H89A 5APXA 5AW1B 4GT1A 2Q3IA 2N9BA 5APSA 4C7NA 3LIDA 1T2KD 2QM8A 1T2KC 1YYCA 5AVTB 1JUNA 2R5BA 3HE5B 3A5TA 5AW7B 1H88A 4KHXA 5CMZA 3NMDA 2H7HA 4RESB 3P7KA 3M0AA 5AVVB 3T97A 1FAVA 1NAFA 2W6AA 1J2JB 2R32A 4M3LA 3NTNA 2BASA 2IPPA 2WWWA 3OAKA 3P8MC 1HUCA 3VMZA 5APTA 2P7JA 2E42A 3HE5A 4I2LC 1HBWA 5APWA 1NWQA 3TK1A 1A02J 3M91A 1GTWA 3TYYA 1GU4A 3KDPB 1SLQA 5AVRB 5AW6B 1JNMA 3M06A 1A02F 5AVXB 3VMYA 1DH3A 3L35A 3V4WA 5AW2B 5AVWB 2XZRA 2ZFCA 3V4QA 5APVA 1S9KE 1MUUA 4I6MC 3L36A 1CZQA 2VRSA 2YO2A 4GKGA 4XE5B 5APYA 3B8EB 5APUA 5AVSB 2WT7B 3A2AA 3HE4B 2C9NY 2E43A 3A7OA 4LC1A 5AVYB 2XV5A 1GU5A 3MGNA 5APQA 3M9HA 3V5BA 4JYBA 2JJLA 3KQGA 3O8ZA 5AVZB 1HJBA 1G2CB 3UIAA 3IR9A 1CI6A 2R3CA 1OXZA 3P32A 3M0DA 5AW3B 2KP8A 2R5DA 4EOTA 3NXSA 5AVUB 2WPSA 2WPQA 3A3YB 2P2UA 1CSBA 1FOSF 2WT7A 2Q5UA 3HE4A 2WPRA 1CI6B 1SP4A 5AW5B 1GZLA 5AW9B 3VYIA 4DZOA 1FOSE 2YNYA 4AUWA 5AW8B 3L37A
chains in the Genus database with same CATH superfamily
1LNQA 1SQPJ 2C9LY 3L74G 1S5LE 1JTHB 2E76D 2WSFJ 2LR2A 3CX5D 3MUDA 4JBZA 1KQFB 4PV1D 2FXOA 2E75B 1GW4A 1LTAC 1IO4A 1HH0A 1JY3O 2IBZI 2E74D 1ZLLA 4QMAA 1YYCA 3P8CD 4I7ZC 3JCUE 1SQQE 2QRXA 3HUSA 3T97A 3L75E 5CJ4A 1JY2N 2R32A 3NTNA 1NU1K 2G8YA 1SQPD 4N78D 1G1JA 1EXJA 2KB7P 1NTKG 2NPSB 1N8RQ 4U3FE 3CD6P 1XTCC 2Y0CA 3H1IE 5APVA 3C9IA 3MUDC 3AEGC 2E43A 3L73J 2O01N 3L72J 3VMAA 1HJBA 2B87A 3IR9A 2W8ZA 1L4AA 1IK9A 3A3YB 3PH0A 3U1AA 3H1LJ 3WUUA 1G2CA 3MHVA 2N1TB 4JF7A 3H32A 3GW6A 2IDBA 2P67A 3HUSC 2WTYA 5B5EE 2A06D 2AXTE 2YXQB 1D7MA 2ZXEB 1GK4A 2XU6A 1AQTA 2M5AA 3H25A 1VQ7P 4IL6H 3I55P 3PTZA 3L73D 3BRTB 3L72D 1FU1A 4HKZH 1NTME 1S2EA 3L74D 5CMZA 3FXEA 2H7HA 1NTKJ 3H1JG 2BCCE 1GDTA 2CPBA 1JY3N 3GHGB 4NPFX 1K9MQ 1U7JA 3M91A 3CLQA 1A02F 5KKZC 1NVOA 4L74A 3KHUA 1RE4A 3EFFK 2HYNA 3CI9A 5AVSB 2WT7B 3A2AA 1EXIA 1EC5A 2HFED 1H0TB 2Y9ZA 1SQVG 3AE4C 5CJ0A 1GL2B 3CC7P 3AECC 1IFPA 1J1DB 1PFIA 1FOSF 1YTZT 3BCCE 1N2DC 1NTKD 1T3UA 4UB8E 2HPCA 2ZVNB 5TISE 4C46A 4CPGA 2W27A 4DCKA 1SQXG 1KTMA 1L4AD 1MZ9A 3IAOA 3H1KJ 1AA0A 5KLIB 1LTGC 2OYHB 1GMJA 1JTHA 2XDJA 3L70E 3LIEA 3ABVC 1IFNA 1RE4C 3AE2C 3A5TA 5AW7B 4BRYB 2RMZA 1SQPK 2FBWC 5M1BA 1AQ5A 1RF1B 2P58A 4HB1A 2J5UA 3CC4P 2LKMA 1FZFA 1DD3A 1UIIA 1SQBE 1SQVJ 1OFCX 1L0NE 3WU2E 3H1KD 2XZRA 2FFDB 1CZQA 3AE1C 2QG4A 1P84I 4PD4D 2GUSA 2FYUG 5BU5A 3NXSA 2WPQA 3CPWO 5KLVG 1SQXJ 3H1HE 5DJTB 3B5NB 2E75C 2P10A 2YNYA 4I1LA 2QSIA 5CHXA 1WRGA 1OW8A 1OZHA 1S9KD 1KILB 1M57D 3SWFA 2B9BA 4L76A 3AEEC 1RQUA 1SQVD 1BSHA 2N1TA 1QGKB 1URQB 2OYIA 5AW0B 1BCCG 1ZR4A 4GT1A 2OTJP 4PD4H 2WMMA 2KXPB 3E1IA 3CCLP 2R5BA 3SSUA 3P7KA 1SQXD 1RE3A 3PLNA 3S4RA 4IFDK 3KYQA 3CCMP 4GIFA 4KT0J 2E75D 1A02J 2IBZG 2WSSH 2FYNB 4WVZA 1J1EB 4K35A 2Q1KA 3GHGA 1JOCA 2FYUJ 2JDIH 2AXTH 3P8CE 1FDIA 2C9NY 1M56D 3A7OA 5KLVJ 3MGNA 1L0LJ 2N1TC 5AVZB 1FDMA 5KJ7A 1CI6A 1YTZI 1NTKK 2OYIC 1KB9H 1R5LA 2WT7A 2B87B 3QH9A 3AE5C 1L4AB 1PP9G 1HF9A 1N7LA 1BGYE 1GL2A 1JCCA 1H8AA 4U7JA 4B86A 1RE3C 3AE3C 3KZIE 1ZW0A 4A7PA 2LXBA 1BCCJ 2FYUD 4GDOA 5KLVD 5AW4B 1PZQA 1T8ZA 2HG5D 2JWAA 3AE8C 3AEFC 2N9BA 3GHGC 2D2CC 3S9OA 3CWBG 2HR3A 1FZBA 2OYHA 1IC2A 2N1TD 2KUBA 2A06E 1JCDA 5KJ7C 1KORA 1QL1A 2V4HA 4LLHA 4BRYA 1ZV8A 1GTWA 3SWKA 1HJ0A 1BCCD 1OVUA 1M90Q 1GL2C 3TGUG 1KYOD 3G9RA 4HJGH 5TISH 1J1DC 2XNDH 2ZYDA 1ZRTE 1RF1A 1AVOA 2YO2A 1HVVA 4TLFA 5APYA 5KAIE 1KN7A 1NKZB 2R44A 3H1LE 1PP9J 2K37A 2FFDA 2J59M 1PL5A 2FXPA 2Q5UA 4ZNCA 2I8DA 4W80A 1LT1A 2ITAA 5AW9B 3VYIA 2IBZD 1W2EA 2AEMA 2D2CD 3WMM0 3KPEA 5KLIC 2L5GB 3FWNA 3CXHE 2OYHC 1SQVK 4H13B 5KJ7D 1U57A 2WSCH 3I5CA 1ZXGA 1WT6A 3CCVP 5AVQB 1KYOH 1BE3J 2MKVA 3CWBJ 1KILA 1GL2D 1TU3F 1PGJA 2Z5IA 1PP9D 3WU2H 1T3JA 1P84E 2K9YA 1RF1C 1SQXK 2YKQA 1XTGB 4Y28J 1URQA 3IFMA 1OW7A 4WBAA 2W83C 2A45G 2QEXP 2FFDC 3TGUJ 2LXCB 1NYHA 2E42A 4Y99B 2GA1A 3WUTA 4I2LC 3RK3E 1YHQP 1QX8A 2BEZF 1NTZE 1EDJA 4BXLA 3G4SP 1UIXA 1S72P 1VQ4P 1E79H 1BE3D 3EQ2A 3CWBD 3B5NC 4NPDA 4JYBA 3A0HH 1N73A 3OA7A 3SFEC 3L71G 1KILC 2IX7C 2WITA 3GF3A 4AUWA 3TGUD 3VMYA 1URQC 2YKOA 1AV1A 1PIXA 2KIKA 3H1KE 4WY4A 1OX3A 1YJ9P 1HTLC 2H8PD 2FYUK 2PGDA 2Q6QA 5H2FE 3CX5I 3L74J 2KNCA 5KLVK 2M3EA 1L0LK 2PFXA 1OWAA 1LJ2A 2KK7A 3Q5RA 2QJPB 4H0LB 1FS0E 2OYIB 3B5ND 2GM4A 1H88A 3NMDA 2FYNC 4PJ0E 1J1EC 2W6JH 1SQQG 1ZN5A 1N73C 5KAFE 2WSEH 1KILD 1VQMP 1YIJP 1FBMA 1DX7A 3VP8A 1LTBC 4UB6H 1NJIQ 5CCGA 1X79B 1ZMEC 1URQD 1S5LX 2ZT9B 4U3FG 1AVYA 4WY4C 1KD1Q 2JP3A 2ZAEB 3FWLA 1Y9BA 1N7SB 3L71J 3KZIH 1LTIC 1L4AC 3C1LA 4LC1A 1VL2A 1Q86Q 2D2CB 1PPJE 3G6EP 2O3JA 4EOTA 2J58A 3A0BH 2KSJA 3HRNA 1EQ7A 1EZVE 2WPRA 1CI6B 1NOHA 3RGUA 5B66E 1SFCB 3HTKB 1EDLA 1OVVA 4RJTA 3O6QB 1LGHB 3G71P 3CMAP 1FE6A 2C0XA 2OTLP 1NU1E 2IYPA 3L71D 5GTIE 5CCGC 1WMKA 1GK6A 1S4XA 2I1JA 4IOIH 1LP1B 4WY4D 1SQQJ 2Q3IA 4N6JA 1DD4A 3LIDA 2YIUB 2IZ0A 2AEJA 2A45H 1FZAA 4JQ0D 2Y9YA 3PHLA 4D6TG 1MKMA 4U3FJ 3OAKA 1BSNA 1M1JB 3G3ZA 2BCCG 1HUCA 1RH5B 3H1JJ 3F89A 1L0LE 3KXDA 3D70A 3GG2A 3CXHI 3HE4B 3JSVC 2QJKB 4LGDE 1NAYA 3EWKA 4HH2A 2XV5A 3U1CA 1SQQD 3KQGA 3O8ZA 1VF5B 2PP6A 4EIJA 2R3CA 1IFIA 5CCGD 2KP8A 2B89A 5AVUB 4H13C 2P2UA 1CSBA 4YXDC 1VPCA 5AW5B 3BCCG 3RBXA 3GLMA 1S5LH 1P84H 4U3FD 1HGVA 5AW8B 2VRSA 3D6YA 4AQRD 3H1JD 5BVZA 3SFDC 1M7LA 3VTPC 3CCSP 3EFGA 1MFTA 4MN4C 1R8EA 3Q2YA 4HYTB 4ZKPA 2WPVB 1H89A 4D6TJ 3JCUH 2RKLA 2Q9IA 4Y99C 4RKUJ 2BCCJ 1ZR2A 4Z1MH 1YJNP 1KQSO 4K3AA 4H13D 3MIWA 1Q7YQ 2RN0A 3VMZA 5APTA 2V7QH 1KB9D 3HD7B 2ZXXA 2POHA 1PP9E 3L35A 1SQBG 1Q81Q 1L0NG 3L36A 1GU5A 3CX5E 4EYYQ 1G1IA 4OWFA 5H2FH 4D6TD 1NHLA 3V5BA 2JJLA 3CC2P 2QIWA 2R5DA 2BCCD 1N7SA 3BATA 1U7MA 1N73B 3C8VA 1Q2NA 3H1HG 5DJUB 3H6PA 1W2BO 5B5EH 2OYOA 1VQ8P 1FZCB 1SVFA 1BE3E 4XA4A 1M1KQ 1QVGO 2QJPC 4H0LC 4WY4B 2QVAA 3BASA 1SFCA 1SQPE 4N78E 3HTKA 2Q7CA 1FZGA 3SWYA 2FKWB 3R4YA 2XKMA 3I56P 3CCEP 1VQ6P 2KNCB 1OIPA 3O6QA 3BCCD 4IL6E 1VQNP 2KS1A 2WSCJ 5CCHA 2PAJA 1K05A 5AVTB 3TGUE 5C39A 2P1JA 3PJSK 2ZT9C 1NAFA 2W6AA 1LP1A 3RL0g 2BASA 2N9YB 3MTUE 3MZWB 1N7SC 3RK3B 1SQBJ 1L0NJ 3TDKA 2CK3H 1LWUB 5B66H 1EZVI 4L75A 2KOGA 4ZKUA 1QLED 3LW5J 1M1JA 4I6MC 1SQQK 2UWJE 4H0LD 1SFCC 5AVYB 1NH4A 2E5YA 3H1HJ 1RY3A 1IFDA 1JMMA 3L73E 5GTIH 4UB8H 3HE4A 3L72E 1SP4A 3V2RA 2QJYB 5CCHC 4KJMA 1KFMA 3L74E 1SQBD 1BGYG 1L0ND 4IFMA 3PRJA 4DOJA 2ZT9D 2KSEA 4NPEA 4WB4A 1KV4A 1N7SD 2YIUC 2KLUA 3V6IA 4N3YB 3Q5SA 4R4MA 3VN0A 1LT9B 3W67A 5KTBA 1ZOYC 1VQPP 1VQKP 2HLOA 3H1HD 5APSA 1M1JC 2BEQD 2B88A 1S1CX 3M9QA 1SFCD 1YITP 1SS1A 2QJKC 1NTKE 1PGPA 1GU4A 3KDPB 5CCHD 2K9JB 4IL6X 1VF5C 3MP7B 1VDFA 3GMAA 1RQVA 3W68A 4ZMDA 5AVWB 2QE7H 3LW5H 1K8AQ 1T2KC 4GKGA 2WSEJ 2KYVA 4OGQB 3HD7A 2YMKA 5APQA 4H44B 2HODB 5CBOA 2G3AA 1YJWP 3D71A 3H1LG 2O1JA 2Y0EA 1BGYJ 4WWIA 1HGZA 1JMBA 1QL2A 1FJKA 1OVRA 1DIPA 3K5BA 2RH0A 4YPCA 3RK2B 1IZNB 2OARA 2O1KA 3TNUA 2KI7B 3VP9A 2KZJA 3USSA 1KMIZ 1JM0A 5GTHE 2ZJSE 3JC22 1USDA 2H88C 1FZCA 2OTKE 1VF5D 2H43A 2YO3A 1T2KD 3U59A 1JUNA 3CX5H 3HE5B 2CPSA 3V2QA 1BGYD 3HD7C 4RESB 1JO5A 3M0AA 4PD4E 3H1JE 2NZ2A 4R4LA 3D6ZA 4M3LA 3E7KA 1KQGB 2P7JA 1NWQA 5TJHA 4BWNA 2PRRA 5AVRB 2JR8A 1NTZG 1LTJB 5AVXB 3CCQP 2IFNA 2ZFCA 3F5HA 1S9KE 1IK7A 3B8EB 3L75G 4GODA 1SQVE 1LWUA 5CBNA 3UIAA 3TF5A 2WSFH 3M0DA 3P32A 1FZCC 1PV3A 1Y47A 2SPZA 2C0WA 1KFNA 1SQBK 1KB9E 1L0NK 1T6AA 3AE6C 3H1IG 1CW5A 3HD7D 1SQXE 2Z5HA 3H1KG 1ZRTD 5K5GB 2JO1A 1JY2P 1E5WA 4C7NB 4D6TE 3H1LD 2QM7A 1X0TA 3VOPA 3AE7C 2O01J 4JYCA 5AW1B 3RK3C 3GF7A 1YI2P 3RL0B 1LT9A 1LWUC 2KS1B 3CXHD 1FAVA 1FJPA 3M0DC 1Z56A 1NTZJ 2IPPA 1QEXA 1FDOA 4C7RA 3V2PA 3L75J 1RF0A 1JEKA 1LTTC 1NTMG 3Q1MA 2E76B 5KAIH 1IFJA 1MUUA 2FY8A 1P84D 1VQOP 3CL3D 3RBZA 4PV1B 2QJYC 3WUVA 1EDIA 2OGUA 3TSIA 2K9JA 2M3BA 2Y0DA 3M9HA 2V7QJ 2FYUE 1KC8Q 3H1IJ 1PPJG 1OXZA 1VQ5P 2A45I 1ZP0C 2E74B 5KLVE 2I1KA 4EDFA 1KZUB 1EZVG 4DZOA 3RK3D 1FOSE 4YXWH 3CXHH 1FC2C 3S1KA 2HODA 1NTZD 1W5CE 2YXRB 1LT9C 2L91A 2M8RA 1MV8A 2WQYC 4OH8B 1X22A 3L75D 3AEDC 2WVRA 2M0BA 5E79E 1JY3P 3FXDA 4ASVA 2YKPA 3NFQA 1KQLA 1NU1G 2IZ1A 1RF0C 1BCCE 3CMEP 1KYOE 5APXA 3H1ID 2O01H 3B4SA 1YBKA 2QM8A 1NGMB 3II6A 3L4FA 2KLVA 2JKVA 3E1RA 3FX0A 4KHXA 3OJAB 4DT0A 1GW3A 1USEA 1NTMJ 2NPSA 2WWWA 3P8MC 1JB0J 3HE5A 3L70G 4OGQC 1HBWA 2IBZE 4I7ZB 3TYYA 4H44C 1Q82Q 4W7ZA 3CCRP 3AEAC 2ZYGA 3AE9C 3ZDMA 2OQQA 3V4WA 1L0LG 3ITKA 2K3RA 4XE5B 1EDKA 3N7NA 2H89C 5GTHH 1LTJA 3RK2C 3CCUP 4ASWA 3A0HE 1GZLA 1BDDA 3Q5PA 1NTMD 2JEEA 2KZIA 4O9BA 3VMXA 1MFZA 1OMIA 3BCCJ 1NU1J 4AYCA 2AXCA 1X8YA 1RHZB 4PD4I 2FYZA 2NPSC 2XNXA 1Q90D 3TNUB 4OGQD 1PPJD 4H44D 3HUSB 3MD0A 1X9VA 3T97B 1EZVD 1VQ9P 2FXMA 4GOFA 4C7NA 1LTSC 2W90A 4PJ0H 3CWBE 1AJYA 1VQLP 5KAFH 3L70J 3IF4A 5AVVB 2AEFA 1M8OB 1LTJC 5L8RJ 3RK2D 1NKNA 1J2JB 1PGOA 1DEBA 1YQ4C 2ZVOB 1L2PA 5APWA 1NU1D 5BU8B 3TK1A 1K04A 3Q3DA 1SLQA 5AW6B 3M06A 1KB9I 2MJZA 1DH3A 4UB6E 5AW2B 3V4QA 1H0TA 1IJDB 4W7YA 2NPSD 3BVHA 1G2CB 4RO0A 5AW3B 5KKZB 3H32B 2GUVA 1NTZK 3L70D 3AEBC 3A0BE 3CCJP 4DJGA 1S3JA 3B71A 3L37A 2M5AB 1L0LD 1R5SA 3M9BA 1DEEG 1QVFO 1BE3G 1HWTC 4L73A 1KILE 1N86A 2DW3A 2QA4P 1FZEA 5EFWB 2ZYAA 2IFMA 3BRVB 1SQPG 3RL0C 1BDCA 1YQ3C 1JY2O 4TT3H 2NRGA 1IFMA 3V2NA 1PGQA 1AFOA 1GD2E 3FGAD 3R2PA 2W6BA 2Z4EA 3N4XA 2R3SA 2Q3EA 2E76C 3QWOC 4EI2A 4PV1C 4IFFA 4GOEA 3PP5A 2K88A 4YTPC 1NO4A 1JNMA 3OW2O 2E74C 1OW6A 2E5TA 5APUA 2A06G 2YMYA 2K1AA 2WZ7A 5E79H 3RL0D 4OVNF 2HPCB 4XFJA 3L71E 2JWDA 2IYOA 3B5NA 2WPSA 1NTMK 3L73G 1K73Q 4JPZB 1Y8AA 3L72G 1KYOI 3IN6A
chains in the Genus database with same CATH topology
1GL2A 3HD7D 2C9LY 1JCCA 1H8AA 4AQRD 2Z5HA 1JTHB 4B86A 1RE3C 5BVZA 1N7LA 3MUDA 1JY2P 1E5WA 1M7LA 3VTPC 3EFGA 4C7NB 1GW4A 1LTAC 2QM7A 4HYTB 1IO4A 4ZKPA 1HH0A 3VOPA 1JY3O 5AW4B 1T8ZA 4JYCA 1H89A 5AW1B 2HG5D 2N9BA 3GHGC 3RK3C 1ZLLA 2Q9IA 1YYCA 4Y99C 3P8CD 3RL0B 1FZBA 1LT9A 1ZR2A 1LWUC 2OYHA 1IC2A 2N1TD 3HUSA 3T97A 1JCDA 1FAVA 5KJ7C 5CJ4A 1JY2N 1FJPA 2R32A 3NTNA 3M0DC 1QL1A 1Z56A 1NU1K 2IPPA 4N78D 3MIWA 3VMZA 5APTA 4LLHA 4C7RA 1G1JA 2KB7P 3V2PA 1ZV8A 1GTWA 2NPSB 1RF0A 3HD7B 2POHA 1LTTC 1XTCC 1GL2C 3L35A 1J1DC 1IFJA 5APVA 1MUUA 3C9IA 3L36A 1RF1A 1GU5A 2YO2A 1HVVA 5APYA 3CL3D 1G1IA 2E43A 3TSIA 1NKZB 2M3BA 1NHLA 3M9HA 3V5BA 2JJLA 1HJBA 3IR9A 1OXZA 1L4AA 1IK9A 2R5DA 2FFDA 2A45I 3A3YB 2J59M 1N7SA 2Q5UA 3BATA 4W80A 2I1KA 1N73B 1KZUB 5AW9B 3VYIA 3RK3D 4DZOA 1FOSE 3U1AA 1W2EA 2HODA 3H6PA 3WMM0 1G2CA 3KPEA 2N1TB 4JF7A 1LT9C 2L5GB 2OYHC 2M8RA 3H32A 1MV8A 1SVFA 1FZCB 2P67A 3HUSC 2WTYA 1SQVK 4OH8B 5KJ7D 4XA4A 2WSCH 3I5CA 2ZXEB 1GK4A 1WT6A 4WY4B 3BASA 1SFCA 4N78E 1JY3P 2XU6A 3HTKA 2Q7CA 5AVQB 2YKPA 1FZGA 3SWYA 2FKWB 3NFQA 1KQLA 1RF0C 2XKMA 1KILA 3BRTB 1GL2D 2Z5IA 1FU1A 5APXA 2O01H 1T3JA 1RF1C 2QM8A 1SQXK 5CCHA 3II6A 2PAJA 2YKQA 5AVTB 1XTGB 2KLVA 3L4FA 1URQA 3IFMA 2P1JA 4KHXA 5CMZA 3OJAB 2H7HA 4WBAA 1NAFA 2W6AA 1GW3A 2A45G 2BASA 1GDTA 2CPBA 2NPSA 2FFDC 2WWWA 1JY3N 3GHGB 3MTUE 1N7SC 3P8MC 3RK3B 2E42A 4Y99B 3HE5A 4I2LC 1HBWA 3M91A 3TYYA 1LWUB 4W7ZA 3CLQA 2KOGA 4ZKUA 1A02F 3V4WA 1M1JA 1RE4A 4I6MC 2HYNA 1SQQK 3CI9A 4XE5B 3EQ2A 5AVSB 2WT7B 3A2AA 2HFED 3N7NA 3B5NC 1SFCC 5AVYB 1NH4A 4JYBA 1LTJA 1RY3A 1IFDA 5CJ0A 1JMMA 1GL2B 3RK2C 1N73A 3OA7A 1J1DB 1KILC 1PFIA 1FOSF 2IX7C 2WITA 1YTZT 3HE4A 1N2DC 1SP4A 1GZLA 3V2RA 1T3UA 5CCHC 1KFMA 2HPCA 4AUWA 3VMYA 2JEEA 1URQC 2YKOA 4O9BA 3VMXA 1MFZA 4WY4A 4IFMA 4C46A 4DOJA 2W27A 1HTLC 2H8PD 4AYCA 1X8YA 1L4AD 2FYUK 4WB4A 2FYZA 2NPSC 1N7SD 2XNXA 1MZ9A 4N3YB 3TNUB 5KLVK 1L0LK 3VN0A 1OWAA 1LTGC 1LT9B 2OYHB 5KTBA 1JTHA 3HUSB 3MD0A 1X9VA 2XDJA 3LIEA 2HLOA 2FXMA 5APSA 1M1JC 2OYIB 1IFNA 1RE4C 4C7NA 1LTSC 3M9QA 3B5ND 1SFCD 5AW7B 3A5TA 1H88A 2GM4A 3NMDA 5AVVB 1SQPK 1J1EC 1LTJC 3RK2D 1NKNA 1ZN5A 1J2JB 1N73C 1AQ5A 1DEBA 2WSEH 1KILD 1RF1B 1FBMA 1DX7A 3VP8A 1LTBC 5APWA 5BU8B 3TK1A 2LKMA 1GU4A 3KDPB 5CCHD 5CCGA 1FZFA 1SLQA 5AW6B 1X79B 1URQD 1VDFA 3M06A 2MJZA 1DH3A 4WY4C 5AW2B 5AVWB 2XZRA 3V4QA 2FFDB 3LW5H 1CZQA 1T2KC 1N7SB 4GKGA 1IJDB 4W7YA 2KYVA 1LTIC 2NPSD 1L4AC 4LC1A 3HD7A 3BVHA 5APQA 2HODB 1G2CB 2GUSA 5AW3B 2O1JA 5BU5A 4EOTA 2J58A 3H32B 3NXSA 2KSJA 2WPQA 3HRNA 2GUVA 1EQ7A 1NTZK 1HGZA 2WPRA 1CI6B 1NOHA 3B5NB 1SFCB 2YNYA 1QL2A 3HTKB 4I1LA 1FJKA 3L37A 3M9BA 5CHXA 3RK2B 1WRGA 2OARA 2O1KA 1S9KD 1KILB 3TNUA 1LGHB 1HWTC 3SWFA 3VP9A 1N86A 2C0XA 1FZEA 2IFMA 3BRVB 2N1TA 3RL0C 1URQB 1JY2O 1FZCA 2OYIA 5CCGC 1IFMA 3V2NA 2H43A 5AW0B 1GK6A 1AFOA 2YO3A 1GD2E 2I1JA 4WY4D 1ZR4A 4GT1A 2Q3IA 3R2PA 4N6JA 2W6BA 3LIDA 1T2KD 3U59A 2A45H 3E1IA 1JUNA 2R5BA 3HE5B 1FZAA 2Z4EA 2CPSA 3V2QA 3N4XA 3HD7C 4RESB 3P7KA 3M0AA 1JO5A 1RE3A 4IFDK 4M3LA 3KYQA 3OAKA 1M1JB 3G3ZA 4GIFA 1HUCA 2P7JA 4IFFA 1NWQA 3PP5A 1A02J 1NO4A 5AVRB 1JNMA 1J1EB 1LTJB 5AVXB 2IFNA 3GHGA 2ZFCA 1JOCA 1S9KE 5APUA 3B8EB 3HE4B 3P8CE 2C9NY 2YMYA 4LGDE 3A7OA 1LWUA 4HH2A 2XV5A 3U1CA 2WZ7A 3MGNA 2N1TC 3KQGA 3O8ZA 5AVZB 3RL0D 2HPCB 1FDMA 2PP6A 3UIAA 4EIJA 5KJ7A 1CI6A 1IFIA 2R3CA 1YTZI 2WSFH 3M0DA 3P32A 1NTKK 5CCGD 1FZCC 2KP8A 2OYIC 3B5NA 5AVUB 2WPSA 2P2UA 1CSBA 1NTMK 2WT7A 2C0WA 1KFNA 1VPCA 5AW5B 1SQBK 1L4AB 1L0NK 1CW5A 1HGVA 5AW8B 2VRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M9B A;  2C9L Y;  3VMX A;  1MFZ A;  1H8A A;  1MV8 A;  4C46 A;  4AQR D;  2P67 A;  2WTY A;  2Z5H A;  2W27 A;  4B86 A;  1S9K D;  3TNU A;  4AYC A;  3I5C A;  1X8Y A;  1HWT C;  2ZXE B;  3SWF A;  1GK4 A;  3VTP C;  4C7N B;  2XU6 A;  3HTK A;  2Q7C A;  5AVQ B;  3TNU B;  2QM7 A;  3NFQ A;  3VN0 A;  1OWA A;  1KQL A;  4HYT B;  1IO4 A;  3MD0 A;  5AW0 B;  1GK6 A;  2YO3 A;  5AW4 B;  3LIE A;  1GD2 E;  2Z5I A;  4JYC A;  1H89 A;  5APX A;  5AW1 B;  4GT1 A;  2Q3I A;  2N9B A;  5APS A;  4C7N A;  3LID A;  1T2K D;  2QM8 A;  1T2K C;  1YYC A;  5AVT B;  1JUN A;  2R5B A;  3HE5 B;  3A5T A;  5AW7 B;  1H88 A;  4KHX A;  5CMZ A;  3NMD A;  2H7H A;  4RES B;  3P7K A;  3M0A A;  5AVV B;  3T97 A;  1FAV A;  1NAF A;  2W6A A;  1J2J B;  2R32 A;  4M3L A;  3NTN A;  2BAS A;  2IPP A;  2WWW A;  3OAK A;  3P8M C;  1HUC A;  3VMZ A;  5APT A;  2P7J A;  2E42 A;  3HE5 A;  4I2L C;  1HBW A;  5APW A;  1NWQ A;  3TK1 A;  1A02 J;  3M91 A;  1GTW A;  3TYY A;  1GU4 A;  3KDP B;  1SLQ A;  5AVR B;  5AW6 B;  1JNM A;  3M06 A;  1A02 F;  5AVX B;  3VMY A;  1DH3 A;  3L35 A;  3V4W A;  5AW2 B;  5AVW B;  2XZR A;  2ZFC A;  3V4Q A;  5APV A;  1S9K E;  1MUU A;  4I6M C;  3L36 A;  1CZQ A;  2VRS A;  2YO2 A;  4GKG A;  4XE5 B;  5APY A;  3B8E B;  5APU A;  5AVS B;  2WT7 B;  3A2A A;  3HE4 B;  2C9N Y;  2E43 A;  3A7O A;  4LC1 A;  5AVY B;  2XV5 A;  1GU5 A;  3MGN A;  5APQ A;  3M9H A;  3V5B A;  4JYB A;  2JJL A;  3KQG A;  3O8Z A;  5AVZ B;  1HJB A;  1G2C B;  3UIA A;  3IR9 A;  1CI6 A;  2R3C A;  1OXZ A;  3P32 A;  3M0D A;  5AW3 B;  2KP8 A;  2R5D A;  4EOT A;  3NXS A;  5AVU B;  2WPS A;  2WPQ A;  3A3Y B;  2P2U A;  1CSB A;  1FOS F;  2WT7 A;  2Q5U A;  3HE4 A;  2WPR A;  1CI6 B;  1SP4 A;  5AW5 B;  1GZL A;  5AW9 B;  3VYI A;  4DZO A;  1FOS E;  2YNY A;  4AUW A;  5AW8 B;  3L37 A; 
#chains in the Genus database with same CATH topology
 1LNQ A;  1SQP J;  2C9L Y;  3L74 G;  1S5L E;  1JTH B;  2E76 D;  2WSF J;  2LR2 A;  3CX5 D;  3MUD A;  4JBZ A;  1KQF B;  4PV1 D;  2FXO A;  2E75 B;  1GW4 A;  1LTA C;  1IO4 A;  1HH0 A;  1JY3 O;  2IBZ I;  2E74 D;  1ZLL A;  4QMA A;  1YYC A;  3P8C D;  4I7Z C;  3JCU E;  1SQQ E;  2QRX A;  3HUS A;  3T97 A;  3L75 E;  5CJ4 A;  1JY2 N;  2R32 A;  3NTN A;  1NU1 K;  2G8Y A;  1SQP D;  4N78 D;  1G1J A;  1EXJ A;  2KB7 P;  1NTK G;  2NPS B;  1N8R Q;  4U3F E;  3CD6 P;  1XTC C;  2Y0C A;  3H1I E;  5APV A;  3C9I A;  3MUD C;  3AEG C;  2E43 A;  3L73 J;  2O01 N;  3L72 J;  3VMA A;  1HJB A;  2B87 A;  3IR9 A;  2W8Z A;  1L4A A;  1IK9 A;  3A3Y B;  3PH0 A;  3U1A A;  3H1L J;  3WUU A;  1G2C A;  3MHV A;  2N1T B;  4JF7 A;  3H32 A;  3GW6 A;  2IDB A;  2P67 A;  3HUS C;  2WTY A;  5B5E E;  2A06 D;  2AXT E;  2YXQ B;  1D7M A;  2ZXE B;  1GK4 A;  2XU6 A;  1AQT A;  2M5A A;  3H25 A;  1VQ7 P;  4IL6 H;  3I55 P;  3PTZ A;  3L73 D;  3BRT B;  3L72 D;  1FU1 A;  4HKZ H;  1NTM E;  1S2E A;  3L74 D;  5CMZ A;  3FXE A;  2H7H A;  1NTK J;  3H1J G;  2BCC E;  1GDT A;  2CPB A;  1JY3 N;  3GHG B;  4NPF X;  1K9M Q;  1U7J A;  3M91 A;  3CLQ A;  1A02 F;  5KKZ C;  1NVO A;  4L74 A;  3KHU A;  1RE4 A;  3EFF K;  2HYN A;  3CI9 A;  5AVS B;  2WT7 B;  3A2A A;  1EXI A;  1EC5 A;  2HFE D;  1H0T B;  2Y9Z A;  1SQV G;  3AE4 C;  5CJ0 A;  1GL2 B;  3CC7 P;  3AEC C;  1IFP A;  1J1D B;  1PFI A;  1FOS F;  1YTZ T;  3BCC E;  1N2D C;  1NTK D;  1T3U A;  4UB8 E;  2HPC A;  2ZVN B;  5TIS E;  4C46 A;  4CPG A;  2W27 A;  4DCK A;  1SQX G;  1KTM A;  1L4A D;  1MZ9 A;  3IAO A;  3H1K J;  1AA0 A;  5KLI B;  1LTG C;  2OYH B;  1GMJ A;  1JTH A;  2XDJ A;  3L70 E;  3LIE A;  3ABV C;  1IFN A;  1RE4 C;  3AE2 C;  3A5T A;  5AW7 B;  4BRY B;  2RMZ A;  1SQP K;  2FBW C;  5M1B A;  1AQ5 A;  1RF1 B;  2P58 A;  4HB1 A;  2J5U A;  3CC4 P;  2LKM A;  1FZF A;  1DD3 A;  1UII A;  1SQB E;  1SQV J;  1OFC X;  1L0N E;  3WU2 E;  3H1K D;  2XZR A;  2FFD B;  1CZQ A;  3AE1 C;  2QG4 A;  1P84 I;  4PD4 D;  2GUS A;  2FYU G;  5BU5 A;  3NXS A;  2WPQ A;  3CPW O;  5KLV G;  1SQX J;  3H1H E;  5DJT B;  3B5N B;  2E75 C;  2P10 A;  2YNY A;  4I1L A;  2QSI A;  5CHX A;  1WRG A;  1OW8 A;  1OZH A;  1S9K D;  1KIL B;  1M57 D;  3SWF A;  2B9B A;  4L76 A;  3AEE C;  1RQU A;  1SQV D;  1BSH A;  2N1T A;  1QGK B;  1URQ B;  2OYI A;  5AW0 B;  1BCC G;  1ZR4 A;  4GT1 A;  2OTJ P;  4PD4 H;  2WMM A;  2KXP B;  3E1I A;  3CCL P;  2R5B A;  3SSU A;  3P7K A;  1SQX D;  1RE3 A;  3PLN A;  3S4R A;  4IFD K;  3KYQ A;  3CCM P;  4GIF A;  4KT0 J;  2E75 D;  1A02 J;  2IBZ G;  2WSS H;  2FYN B;  4WVZ A;  1J1E B;  4K35 A;  2Q1K A;  3GHG A;  1JOC A;  2FYU J;  2JDI H;  2AXT H;  3P8C E;  1FDI A;  2C9N Y;  1M56 D;  3A7O A;  5KLV J;  3MGN A;  1L0L J;  2N1T C;  5AVZ B;  1FDM A;  5KJ7 A;  1CI6 A;  1YTZ I;  1NTK K;  2OYI C;  1KB9 H;  1R5L A;  2WT7 A;  2B87 B;  3QH9 A;  3AE5 C;  1L4A B;  1PP9 G;  1HF9 A;  1N7L A;  1BGY E;  1GL2 A;  1JCC A;  1H8A A;  4U7J A;  4B86 A;  1RE3 C;  3AE3 C;  3KZI E;  1ZW0 A;  4A7P A;  2LXB A;  1BCC J;  2FYU D;  4GDO A;  5KLV D;  5AW4 B;  1PZQ A;  1T8Z A;  2HG5 D;  2JWA A;  3AE8 C;  3AEF C;  2N9B A;  3GHG C;  2D2C C;  3S9O A;  3CWB G;  2HR3 A;  1FZB A;  2OYH A;  1IC2 A;  2N1T D;  2KUB A;  2A06 E;  1JCD A;  5KJ7 C;  1KOR A;  1QL1 A;  2V4H A;  4LLH A;  4BRY A;  1ZV8 A;  1GTW A;  3SWK A;  1HJ0 A;  1BCC D;  1OVU A;  1M90 Q;  1GL2 C;  3TGU G;  1KYO D;  3G9R A;  4HJG H;  5TIS H;  1J1D C;  2XND H;  2ZYD A;  1ZRT E;  1RF1 A;  1AVO A;  2YO2 A;  1HVV A;  4TLF A;  5APY A;  5KAI E;  1KN7 A;  1NKZ B;  2R44 A;  3H1L E;  1PP9 J;  2K37 A;  2FFD A;  2J59 M;  1PL5 A;  2FXP A;  2Q5U A;  4ZNC A;  2I8D A;  4W80 A;  1LT1 A;  2ITA A;  5AW9 B;  3VYI A;  2IBZ D;  1W2E A;  2AEM A;  2D2C D;  3WMM 0;  3KPE A;  5KLI C;  2L5G B;  3FWN A;  3CXH E;  2OYH C;  1SQV K;  4H13 B;  5KJ7 D;  1U57 A;  2WSC H;  3I5C A;  1ZXG A;  1WT6 A;  3CCV P;  5AVQ B;  1KYO H;  1BE3 J;  2MKV A;  3CWB J;  1KIL A;  1GL2 D;  1TU3 F;  1PGJ A;  2Z5I A;  1PP9 D;  3WU2 H;  1T3J A;  1P84 E;  2K9Y A;  1RF1 C;  1SQX K;  2YKQ A;  1XTG B;  4Y28 J;  1URQ A;  3IFM A;  1OW7 A;  4WBA A;  2W83 C;  2A45 G;  2QEX P;  2FFD C;  3TGU J;  2LXC B;  1NYH A;  2E42 A;  4Y99 B;  2GA1 A;  3WUT A;  4I2L C;  3RK3 E;  1YHQ P;  1QX8 A;  2BEZ F;  1NTZ E;  1EDJ A;  4BXL A;  3G4S P;  1UIX A;  1S72 P;  1VQ4 P;  1E79 H;  1BE3 D;  3EQ2 A;  3CWB D;  3B5N C;  4NPD A;  4JYB A;  3A0H H;  1N73 A;  3OA7 A;  3SFE C;  3L71 G;  1KIL C;  2IX7 C;  2WIT A;  3GF3 A;  4AUW A;  3TGU D;  3VMY A;  1URQ C;  2YKO A;  1AV1 A;  1PIX A;  2KIK A;  3H1K E;  4WY4 A;  1OX3 A;  1YJ9 P;  1HTL C;  2H8P D;  2FYU K;  2PGD A;  2Q6Q A;  5H2F E;  3CX5 I;  3L74 J;  2KNC A;  5KLV K;  2M3E A;  1L0L K;  2PFX A;  1OWA A;  1LJ2 A;  2KK7 A;  3Q5R A;  2QJP B;  4H0L B;  1FS0 E;  2OYI B;  3B5N D;  2GM4 A;  1H88 A;  3NMD A;  2FYN C;  4PJ0 E;  1J1E C;  2W6J H;  1SQQ G;  1ZN5 A;  1N73 C;  5KAF E;  2WSE H;  1KIL D;  1VQM P;  1YIJ P;  1FBM A;  1DX7 A;  3VP8 A;  1LTB C;  4UB6 H;  1NJI Q;  5CCG A;  1X79 B;  1ZME C;  1URQ D;  1S5L X;  2ZT9 B;  4U3F G;  1AVY A;  4WY4 C;  1KD1 Q;  2JP3 A;  2ZAE B;  3FWL A;  1Y9B A;  1N7S B;  3L71 J;  3KZI H;  1LTI C;  1L4A C;  3C1L A;  4LC1 A;  1VL2 A;  1Q86 Q;  2D2C B;  1PPJ E;  3G6E P;  2O3J A;  4EOT A;  2J58 A;  3A0B H;  2KSJ A;  3HRN A;  1EQ7 A;  1EZV E;  2WPR A;  1CI6 B;  1NOH A;  3RGU A;  5B66 E;  1SFC B;  3HTK B;  1EDL A;  1OVV A;  4RJT A;  3O6Q B;  1LGH B;  3G71 P;  3CMA P;  1FE6 A;  2C0X A;  2OTL P;  1NU1 E;  2IYP A;  3L71 D;  5GTI E;  5CCG C;  1WMK A;  1GK6 A;  1S4X A;  2I1J A;  4IOI H;  1LP1 B;  4WY4 D;  1SQQ J;  2Q3I A;  4N6J A;  1DD4 A;  3LID A;  2YIU B;  2IZ0 A;  2AEJ A;  2A45 H;  1FZA A;  4JQ0 D;  2Y9Y A;  3PHL A;  4D6T G;  1MKM A;  4U3F J;  3OAK A;  1BSN A;  1M1J B;  3G3Z A;  2BCC G;  1HUC A;  1RH5 B;  3H1J J;  3F89 A;  1L0L E;  3KXD A;  3D70 A;  3GG2 A;  3CXH I;  3HE4 B;  3JSV C;  2QJK B;  4LGD E;  1NAY A;  3EWK A;  4HH2 A;  2XV5 A;  3U1C A;  1SQQ D;  3KQG A;  3O8Z A;  1VF5 B;  2PP6 A;  4EIJ A;  2R3C A;  1IFI A;  5CCG D;  2KP8 A;  2B89 A;  5AVU B;  4H13 C;  2P2U A;  1CSB A;  4YXD C;  1VPC A;  5AW5 B;  3BCC G;  3RBX A;  3GLM A;  1S5L H;  1P84 H;  4U3F D;  1HGV A;  5AW8 B;  2VRS A;  3D6Y A;  4AQR D;  3H1J D;  5BVZ A;  3SFD C;  1M7L A;  3VTP C;  3CCS P;  3EFG A;  1MFT A;  4MN4 C;  1R8E A;  3Q2Y A;  4HYT B;  4ZKP A;  2WPV B;  1H89 A;  4D6T J;  3JCU H;  2RKL A;  2Q9I A;  4Y99 C;  4RKU J;  2BCC J;  1ZR2 A;  4Z1M H;  1YJN P;  1KQS O;  4K3A A;  4H13 D;  3MIW A;  1Q7Y Q;  2RN0 A;  3VMZ A;  5APT A;  2V7Q H;  1KB9 D;  3HD7 B;  2ZXX A;  2POH A;  1PP9 E;  3L35 A;  1SQB G;  1Q81 Q;  1L0N G;  3L36 A;  1GU5 A;  3CX5 E;  4EYY Q;  1G1I A;  4OWF A;  5H2F H;  4D6T D;  1NHL A;  3V5B A;  2JJL A;  3CC2 P;  2QIW A;  2R5D A;  2BCC D;  1N7S A;  3BAT A;  1U7M A;  1N73 B;  3C8V A;  1Q2N A;  3H1H G;  5DJU B;  3H6P A;  1W2B O;  5B5E H;  2OYO A;  1VQ8 P;  1FZC B;  1SVF A;  1BE3 E;  4XA4 A;  1M1K Q;  1QVG O;  2QJP C;  4H0L C;  4WY4 B;  2QVA A;  3BAS A;  1SFC A;  1SQP E;  4N78 E;  3HTK A;  2Q7C A;  1FZG A;  3SWY A;  2FKW B;  3R4Y A;  2XKM A;  3I56 P;  3CCE P;  1VQ6 P;  2KNC B;  1OIP A;  3O6Q A;  3BCC D;  4IL6 E;  1VQN P;  2KS1 A;  2WSC J;  5CCH A;  2PAJ A;  1K05 A;  5AVT B;  3TGU E;  5C39 A;  2P1J A;  3PJS K;  2ZT9 C;  1NAF A;  2W6A A;  1LP1 A;  3RL0 g;  2BAS A;  2N9Y B;  3MTU E;  3MZW B;  1N7S C;  3RK3 B;  1SQB J;  1L0N J;  3TDK A;  2CK3 H;  1LWU B;  5B66 H;  1EZV I;  4L75 A;  2KOG A;  4ZKU A;  1QLE D;  3LW5 J;  1M1J A;  4I6M C;  1SQQ K;  2UWJ E;  4H0L D;  1SFC C;  5AVY B;  1NH4 A;  2E5Y A;  3H1H J;  1RY3 A;  1IFD A;  1JMM A;  3L73 E;  5GTI H;  4UB8 H;  3HE4 A;  3L72 E;  1SP4 A;  3V2R A;  2QJY B;  5CCH C;  4KJM A;  1KFM A;  3L74 E;  1SQB D;  1BGY G;  1L0N D;  4IFM A;  3PRJ A;  4DOJ A;  2ZT9 D;  2KSE A;  4NPE A;  4WB4 A;  1KV4 A;  1N7S D;  2YIU C;  2KLU A;  3V6I A;  4N3Y B;  3Q5S A;  4R4M A;  3VN0 A;  1LT9 B;  3W67 A;  5KTB A;  1ZOY C;  1VQP P;  1VQK P;  2HLO A;  3H1H D;  5APS A;  1M1J C;  2BEQ D;  2B88 A;  1S1C X;  3M9Q A;  1SFC D;  1YIT P;  1SS1 A;  2QJK C;  1NTK E;  1PGP A;  1GU4 A;  3KDP B;  5CCH D;  2K9J B;  4IL6 X;  1VF5 C;  3MP7 B;  1VDF A;  3GMA A;  1RQV A;  3W68 A;  4ZMD A;  5AVW B;  2QE7 H;  3LW5 H;  1K8A Q;  1T2K C;  4GKG A;  2WSE J;  2KYV A;  4OGQ B;  3HD7 A;  2YMK A;  5APQ A;  4H44 B;  2HOD B;  5CBO A;  2G3A A;  1YJW P;  3D71 A;  3H1L G;  2O1J A;  2Y0E A;  1BGY J;  4WWI A;  1HGZ A;  1JMB A;  1QL2 A;  1FJK A;  1OVR A;  1DIP A;  3K5B A;  2RH0 A;  4YPC A;  3RK2 B;  1IZN B;  2OAR A;  2O1K A;  3TNU A;  2KI7 B;  3VP9 A;  2KZJ A;  3USS A;  1KMI Z;  1JM0 A;  5GTH E;  2ZJS E;  3JC2 2;  1USD A;  2H88 C;  1FZC A;  2OTK E;  1VF5 D;  2H43 A;  2YO3 A;  1T2K D;  3U59 A;  1JUN A;  3CX5 H;  3HE5 B;  2CPS A;  3V2Q A;  1BGY D;  3HD7 C;  4RES B;  1JO5 A;  3M0A A;  4PD4 E;  3H1J E;  2NZ2 A;  4R4L A;  3D6Z A;  4M3L A;  3E7K A;  1KQG B;  2P7J A;  1NWQ A;  5TJH A;  4BWN A;  2PRR A;  5AVR B;  2JR8 A;  1NTZ G;  1LTJ B;  5AVX B;  3CCQ P;  2IFN A;  2ZFC A;  3F5H A;  1S9K E;  1IK7 A;  3B8E B;  3L75 G;  4GOD A;  1SQV E;  1LWU A;  5CBN A;  3UIA A;  3TF5 A;  2WSF H;  3M0D A;  3P32 A;  1FZC C;  1PV3 A;  1Y47 A;  2SPZ A;  2C0W A;  1KFN A;  1SQB K;  1KB9 E;  1L0N K;  1T6A A;  3AE6 C;  3H1I G;  1CW5 A;  3HD7 D;  1SQX E;  2Z5H A;  3H1K G;  1ZRT D;  5K5G B;  2JO1 A;  1JY2 P;  1E5W A;  4C7N B;  4D6T E;  3H1L D;  2QM7 A;  1X0T A;  3VOP A;  3AE7 C;  2O01 J;  4JYC A;  5AW1 B;  3RK3 C;  3GF7 A;  1YI2 P;  3RL0 B;  1LT9 A;  1LWU C;  2KS1 B;  3CXH D;  1FAV A;  1FJP A;  3M0D C;  1Z56 A;  1NTZ J;  2IPP A;  1QEX A;  1FDO A;  4C7R A;  3V2P A;  3L75 J;  1RF0 A;  1JEK A;  1LTT C;  1NTM G;  3Q1M A;  2E76 B;  5KAI H;  1IFJ A;  1MUU A;  2FY8 A;  1P84 D;  1VQO P;  3CL3 D;  3RBZ A;  4PV1 B;  2QJY C;  3WUV A;  1EDI A;  2OGU A;  3TSI A;  2K9J A;  2M3B A;  2Y0D A;  3M9H A;  2V7Q J;  2FYU E;  1KC8 Q;  3H1I J;  1PPJ G;  1OXZ A;  1VQ5 P;  2A45 I;  1ZP0 C;  2E74 B;  5KLV E;  2I1K A;  4EDF A;  1KZU B;  1EZV G;  4DZO A;  3RK3 D;  1FOS E;  4YXW H;  3CXH H;  1FC2 C;  3S1K A;  2HOD A;  1NTZ D;  1W5C E;  2YXR B;  1LT9 C;  2L91 A;  2M8R A;  1MV8 A;  2WQY C;  4OH8 B;  1X22 A;  3L75 D;  3AED C;  2WVR A;  2M0B A;  5E79 E;  1JY3 P;  3FXD A;  4ASV A;  2YKP A;  3NFQ A;  1KQL A;  1NU1 G;  2IZ1 A;  1RF0 C;  1BCC E;  3CME P;  1KYO E;  5APX A;  3H1I D;  2O01 H;  3B4S A;  1YBK A;  2QM8 A;  1NGM B;  3II6 A;  3L4F A;  2KLV A;  2JKV A;  3E1R A;  3FX0 A;  4KHX A;  3OJA B;  4DT0 A;  1GW3 A;  1USE A;  1NTM J;  2NPS A;  2WWW A;  3P8M C;  1JB0 J;  3HE5 A;  3L70 G;  4OGQ C;  1HBW A;  2IBZ E;  4I7Z B;  3TYY A;  4H44 C;  1Q82 Q;  4W7Z A;  3CCR P;  3AEA C;  2ZYG A;  3AE9 C;  3ZDM A;  2OQQ A;  3V4W A;  1L0L G;  3ITK A;  2K3R A;  4XE5 B;  1EDK A;  3N7N A;  2H89 C;  5GTH H;  1LTJ A;  3RK2 C;  3CCU P;  4ASW A;  3A0H E;  1GZL A;  1BDD A;  3Q5P A;  1NTM D;  2JEE A;  2KZI A;  4O9B A;  3VMX A;  1MFZ A;  1OMI A;  3BCC J;  1NU1 J;  4AYC A;  2AXC A;  1X8Y A;  1RHZ B;  4PD4 I;  2FYZ A;  2NPS C;  2XNX A;  1Q90 D;  3TNU B;  4OGQ D;  1PPJ D;  4H44 D;  3HUS B;  3MD0 A;  1X9V A;  3T97 B;  1EZV D;  1VQ9 P;  2FXM A;  4GOF A;  4C7N A;  1LTS C;  2W90 A;  4PJ0 H;  3CWB E;  1AJY A;  1VQL P;  5KAF H;  3L70 J;  3IF4 A;  5AVV B;  2AEF A;  1M8O B;  1LTJ C;  5L8R J;  3RK2 D;  1NKN A;  1J2J B;  1PGO A;  1DEB A;  1YQ4 C;  2ZVO B;  1L2P A;  5APW A;  1NU1 D;  5BU8 B;  3TK1 A;  1K04 A;  3Q3D A;  1SLQ A;  5AW6 B;  3M06 A;  1KB9 I;  2MJZ A;  1DH3 A;  4UB6 E;  5AW2 B;  3V4Q A;  1H0T A;  1IJD B;  4W7Y A;  2NPS D;  3BVH A;  1G2C B;  4RO0 A;  5AW3 B;  5KKZ B;  3H32 B;  2GUV A;  1NTZ K;  3L70 D;  3AEB C;  3A0B E;  3CCJ P;  4DJG A;  1S3J A;  3B71 A;  3L37 A;  2M5A B;  1L0L D;  1R5S A;  3M9B A;  1DEE G;  1QVF O;  1BE3 G;  1HWT C;  4L73 A;  1KIL E;  1N86 A;  2DW3 A;  2QA4 P;  1FZE A;  5EFW B;  2ZYA A;  2IFM A;  3BRV B;  1SQP G;  3RL0 C;  1BDC A;  1YQ3 C;  1JY2 O;  4TT3 H;  2NRG A;  1IFM A;  3V2N A;  1PGQ A;  1AFO A;  1GD2 E;  3FGA D;  3R2P A;  2W6B A;  2Z4E A;  3N4X A;  2R3S A;  2Q3E A;  2E76 C;  3QWO C;  4EI2 A;  4PV1 C;  4IFF A;  4GOE A;  3PP5 A;  2K88 A;  4YTP C;  1NO4 A;  1JNM A;  3OW2 O;  2E74 C;  1OW6 A;  2E5T A;  5APU A;  2A06 G;  2YMY A;  2K1A A;  2WZ7 A;  5E79 H;  3RL0 D;  4OVN F;  2HPC B;  4XFJ A;  3L71 E;  2JWD A;  2IYO A;  3B5N A;  2WPS A;  1NTM K;  3L73 G;  1K73 Q;  4JPZ B;  1Y8A A;  3L72 G;  1KYO I;  3IN6 A; 
#chains in the Genus database with same CATH homology
 1GL2 A;  3HD7 D;  2C9L Y;  1JCC A;  1H8A A;  4AQR D;  2Z5H A;  1JTH B;  4B86 A;  1RE3 C;  5BVZ A;  1N7L A;  3MUD A;  1JY2 P;  1E5W A;  1M7L A;  3VTP C;  3EFG A;  4C7N B;  1GW4 A;  1LTA C;  2QM7 A;  4HYT B;  1IO4 A;  4ZKP A;  1HH0 A;  3VOP A;  1JY3 O;  5AW4 B;  1T8Z A;  4JYC A;  1H89 A;  5AW1 B;  2HG5 D;  2N9B A;  3GHG C;  3RK3 C;  1ZLL A;  2Q9I A;  1YYC A;  4Y99 C;  3P8C D;  3RL0 B;  1FZB A;  1LT9 A;  1ZR2 A;  1LWU C;  2OYH A;  1IC2 A;  2N1T D;  3HUS A;  3T97 A;  1JCD A;  1FAV A;  5KJ7 C;  5CJ4 A;  1JY2 N;  1FJP A;  2R32 A;  3NTN A;  3M0D C;  1QL1 A;  1Z56 A;  1NU1 K;  2IPP A;  4N78 D;  3MIW A;  3VMZ A;  5APT A;  4LLH A;  4C7R A;  1G1J A;  2KB7 P;  3V2P A;  1ZV8 A;  1GTW A;  2NPS B;  1RF0 A;  3HD7 B;  2POH A;  1LTT C;  1XTC C;  1GL2 C;  3L35 A;  1J1D C;  1IFJ A;  5APV A;  1MUU A;  3C9I A;  3L36 A;  1RF1 A;  1GU5 A;  2YO2 A;  1HVV A;  5APY A;  3CL3 D;  1G1I A;  2E43 A;  3TSI A;  1NKZ B;  2M3B A;  1NHL A;  3M9H A;  3V5B A;  2JJL A;  1HJB A;  3IR9 A;  1OXZ A;  1L4A A;  1IK9 A;  2R5D A;  2FFD A;  2A45 I;  3A3Y B;  2J59 M;  1N7S A;  2Q5U A;  3BAT A;  4W80 A;  2I1K A;  1N73 B;  1KZU B;  5AW9 B;  3VYI A;  3RK3 D;  4DZO A;  1FOS E;  3U1A A;  1W2E A;  2HOD A;  3H6P A;  3WMM 0;  1G2C A;  3KPE A;  2N1T B;  4JF7 A;  1LT9 C;  2L5G B;  2OYH C;  2M8R A;  3H32 A;  1MV8 A;  1SVF A;  1FZC B;  2P67 A;  3HUS C;  2WTY A;  1SQV K;  4OH8 B;  5KJ7 D;  4XA4 A;  2WSC H;  3I5C A;  2ZXE B;  1GK4 A;  1WT6 A;  4WY4 B;  3BAS A;  1SFC A;  4N78 E;  1JY3 P;  2XU6 A;  3HTK A;  2Q7C A;  5AVQ B;  2YKP A;  1FZG A;  3SWY A;  2FKW B;  3NFQ A;  1KQL A;  1RF0 C;  2XKM A;  1KIL A;  3BRT B;  1GL2 D;  2Z5I A;  1FU1 A;  5APX A;  2O01 H;  1T3J A;  1RF1 C;  2QM8 A;  1SQX K;  5CCH A;  3II6 A;  2PAJ A;  2YKQ A;  5AVT B;  1XTG B;  2KLV A;  3L4F A;  1URQ A;  3IFM A;  2P1J A;  4KHX A;  5CMZ A;  3OJA B;  2H7H A;  4WBA A;  1NAF A;  2W6A A;  1GW3 A;  2A45 G;  2BAS A;  1GDT A;  2CPB A;  2NPS A;  2FFD C;  2WWW A;  1JY3 N;  3GHG B;  3MTU E;  1N7S C;  3P8M C;  3RK3 B;  2E42 A;  4Y99 B;  3HE5 A;  4I2L C;  1HBW A;  3M91 A;  3TYY A;  1LWU B;  4W7Z A;  3CLQ A;  2KOG A;  4ZKU A;  1A02 F;  3V4W A;  1M1J A;  1RE4 A;  4I6M C;  2HYN A;  1SQQ K;  3CI9 A;  4XE5 B;  3EQ2 A;  5AVS B;  2WT7 B;  3A2A A;  2HFE D;  3N7N A;  3B5N C;  1SFC C;  5AVY B;  1NH4 A;  4JYB A;  1LTJ A;  1RY3 A;  1IFD A;  5CJ0 A;  1JMM A;  1GL2 B;  3RK2 C;  1N73 A;  3OA7 A;  1J1D B;  1KIL C;  1PFI A;  1FOS F;  2IX7 C;  2WIT A;  1YTZ T;  3HE4 A;  1N2D C;  1SP4 A;  1GZL A;  3V2R A;  1T3U A;  5CCH C;  1KFM A;  2HPC A;  4AUW A;  3VMY A;  2JEE A;  1URQ C;  2YKO A;  4O9B A;  3VMX A;  1MFZ A;  4WY4 A;  4IFM A;  4C46 A;  4DOJ A;  2W27 A;  1HTL C;  2H8P D;  4AYC A;  1X8Y A;  1L4A D;  2FYU K;  4WB4 A;  2FYZ A;  2NPS C;  1N7S D;  2XNX A;  1MZ9 A;  4N3Y B;  3TNU B;  5KLV K;  1L0L K;  3VN0 A;  1OWA A;  1LTG C;  1LT9 B;  2OYH B;  5KTB A;  1JTH A;  3HUS B;  3MD0 A;  1X9V A;  2XDJ A;  3LIE A;  2HLO A;  2FXM A;  5APS A;  1M1J C;  2OYI B;  1IFN A;  1RE4 C;  4C7N A;  1LTS C;  3M9Q A;  3B5N D;  1SFC D;  5AW7 B;  3A5T A;  1H88 A;  2GM4 A;  3NMD A;  5AVV B;  1SQP K;  1J1E C;  1LTJ C;  3RK2 D;  1NKN A;  1ZN5 A;  1J2J B;  1N73 C;  1AQ5 A;  1DEB A;  2WSE H;  1KIL D;  1RF1 B;  1FBM A;  1DX7 A;  3VP8 A;  1LTB C;  5APW A;  5BU8 B;  3TK1 A;  2LKM A;  1GU4 A;  3KDP B;  5CCH D;  5CCG A;  1FZF A;  1SLQ A;  5AW6 B;  1X79 B;  1URQ D;  1VDF A;  3M06 A;  2MJZ A;  1DH3 A;  4WY4 C;  5AW2 B;  5AVW B;  2XZR A;  3V4Q A;  2FFD B;  3LW5 H;  1CZQ A;  1T2K C;  1N7S B;  4GKG A;  1IJD B;  4W7Y A;  2KYV A;  1LTI C;  2NPS D;  1L4A C;  4LC1 A;  3HD7 A;  3BVH A;  5APQ A;  2HOD B;  1G2C B;  2GUS A;  5AW3 B;  2O1J A;  5BU5 A;  4EOT A;  2J58 A;  3H32 B;  3NXS A;  2KSJ A;  2WPQ A;  3HRN A;  2GUV A;  1EQ7 A;  1NTZ K;  1HGZ A;  2WPR A;  1CI6 B;  1NOH A;  3B5N B;  1SFC B;  2YNY A;  1QL2 A;  3HTK B;  4I1L A;  1FJK A;  3L37 A;  3M9B A;  5CHX A;  3RK2 B;  1WRG A;  2OAR A;  2O1K A;  1S9K D;  1KIL B;  3TNU A;  1LGH B;  1HWT C;  3SWF A;  3VP9 A;  1N86 A;  2C0X A;  1FZE A;  2IFM A;  3BRV B;  2N1T A;  3RL0 C;  1URQ B;  1JY2 O;  1FZC A;  2OYI A;  5CCG C;  1IFM A;  3V2N A;  2H43 A;  5AW0 B;  1GK6 A;  1AFO A;  2YO3 A;  1GD2 E;  2I1J A;  4WY4 D;  1ZR4 A;  4GT1 A;  2Q3I A;  3R2P A;  4N6J A;  2W6B A;  3LID A;  1T2K D;  3U59 A;  2A45 H;  3E1I A;  1JUN A;  2R5B A;  3HE5 B;  1FZA A;  2Z4E A;  2CPS A;  3V2Q A;  3N4X A;  3HD7 C;  4RES B;  3P7K A;  3M0A A;  1JO5 A;  1RE3 A;  4IFD K;  4M3L A;  3KYQ A;  3OAK A;  1M1J B;  3G3Z A;  4GIF A;  1HUC A;  2P7J A;  4IFF A;  1NWQ A;  3PP5 A;  1A02 J;  1NO4 A;  5AVR B;  1JNM A;  1J1E B;  1LTJ B;  5AVX B;  2IFN A;  3GHG A;  2ZFC A;  1JOC A;  1S9K E;  5APU A;  3B8E B;  3HE4 B;  3P8C E;  2C9N Y;  2YMY A;  4LGD E;  3A7O A;  1LWU A;  4HH2 A;  2XV5 A;  3U1C A;  2WZ7 A;  3MGN A;  2N1T C;  3KQG A;  3O8Z A;  5AVZ B;  3RL0 D;  2HPC B;  1FDM A;  2PP6 A;  3UIA A;  4EIJ A;  5KJ7 A;  1CI6 A;  1IFI A;  2R3C A;  1YTZ I;  2WSF H;  3M0D A;  3P32 A;  1NTK K;  5CCG D;  1FZC C;  2KP8 A;  2OYI C;  3B5N A;  5AVU B;  2WPS A;  2P2U A;  1CSB A;  1NTM K;  2WT7 A;  2C0W A;  1KFN A;  1VPC A;  5AW5 B;  1SQB K;  1L4A B;  1L0N K;  1CW5 A;  1HGV A;  5AW8 B;  2VRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...