2ZFCA

X-ray crystal structure of an engineered n-terminal hiv-1 gp41 trimer with enhanced stability and potency
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
44
structure length
44
Chain Sequence
b'VSGLVQQQNNILRALEATQHAVQALVWGVKQLQARVLALERYIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 GP41
molecule tags Viral protein
publication title Design of an engineered N-terminal HIV-1 gp41 trimer with enhanced stability and potency
pubmed doi rcsb
total genus 19
structure length 44
sequence length 44
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-12-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2zfcA00
1GK6A 3HTKA 1KQLA 3T97A 1CI6B 3TNUA 3MD0A 2H7HA 2E42A 3O8ZA 2XV5A 3KDPB 5AW0B 2Z5HA 5AW3B 2WPRA 3M91A 2WT7B 2Q5UA 2WTYA 5AVUB 5AVVB 2C9LY 3VMXA 2WPSA 2QM8A 3M0DA 2WWWA 1GU4A 3V4QA 2WT7A 2R32A 1NAFA 5APSA 1FOSE 4XE5B 3M9BA 3VN0A 3OAKA 3KQGA 2C9NY 1JUNA 1HWTC 2N9BA 4C7NA 3NFQA 1FAVA 1HUCA 2R5DA 1HJBA 3A3YB 5AVSB 3TYYA 3NXSA 1FOSF 5APTA 1J2JB 3P32A 3V4WA 1GZLA 2JJLA 3A2AA 3NMDA 4B86A 4AUWA 2XU6A 5AVZB 3P7KA 3I5CA 4I2LC 5AW2B 1GU5A 4I6MC 1MV8A 5AW5B 3V5BA 2YO2A 2ZFCA 2IPPA 1G2CB 2Q3IA 4LC1A 5APQA 1H8AA 2YNYA 5AVQB 2ZXEB 3B8EB 5APVA 1HBWA 1GK4A 1H88A 5APUA 1NWQA 1A02J 3M06A 2Q7CA 3MGNA 5AVXB 4C46A 1T2KC 1T2KD 3VMZA 2P7JA 5AW1B 1A02F 3A5TA 4JYCA 2P2UA 3IR9A 5AW9B 3M0AA 3UIAA 3TK1A 3HE4B 1MUUA 2BASA 2YO3A 1YYCA 1DH3A 3L35A 1H89A 5CMZA 5APWA 5AW6B 2E43A 3L36A 1IO4A 3TNUB 1OWAA 4GT1A 4DZOA 3HE5A 5AW8B 1CSBA 4M3LA 5APYA 5AVWB 1S9KD 1GTWA 4RESB 1MFZA 5APXA 2Z5IA 4KHXA 1CI6A 1GD2E 3LIEA 4JYBA 3HE5B 4EOTA 2R3CA 1SLQA 2R5BA 2XZRA 4GKGA 5AVTB 2KP8A 2VRSA 3M9HA 4HYTB 3VTPC 4C7NB 1S9KE 2WPQA 2W27A 3SWFA 3NTNA 3HE4A 3LIDA 3A7OA 3VYIA 2QM7A 5AW4B 5AW7B 1SP4A 1CZQA 2P67A 4AYCA 3L37A 1X8YA 1JNMA 3VMYA 4AQRD 5AVRB 2W6AA 1OXZA 3P8MC 5AVYB
chains in the Genus database with same CATH superfamily
1GK6A 1M8OB 1UIIA 3HTKA 2JO1A 3CXHD 4PD4D 1VQ5P 1LTBC 2ZXXA 1S5LE 3GMAA 5C39A 3O6QB 3T97A 2YXQB 1RF0C 3PH0A 5K5GB 1N8RQ 3L4FA 4HJGH 1Z56A 4ASWA 2FFDA 3CCQP 2Q9IA 1M1JA 3AEBC 1PPJG 2XNXA 2XV5A 1M1KQ 5AW3B 2RH0A 4GOFA 3ZDMA 2NPSD 2M5AA 5L8RJ 2HPCB 3R4YA 3M0DC 2KYVA 4PD4E 2NPSA 1KYOH 1T3JA 1SQVG 2M8RA 2Q5UA 1KB9I 4IL6X 1KYOI 5EFWB 3FGAD 5AVUB 3TGUD 4Y99B 3RK3D 1EDKA 2E75B 1QX8A 1RE3C 3M0DA 1NO4A 1S2EA 2WWWA 2GUVA 3EFGA 1ZXGA 3G71P 1U7JA 1NAFA 1FOSE 1DEEG 3U1CA 1SQVE 1YTZT 2A06D 3BCCD 1NU1D 1S4XA 3M9BA 2KI7B 1KILA 1FZCA 3KXDA 1L0LG 1MKMA 4WY4C 4C7NA 4L75A 1T6AA 1AVYA 2D2CB 2QG4A 1EZVD 2AEMA 1RHZB 5AVSB 3MP7B 5KAFE 3WU2E 1XTCC 1IJDB 2LR2A 2CK3H 1PGOA 3Q2YA 2ZVOB 3H6PA 2WSSH 1SQPD 1NTKG 1FJKA 1GZLA 3CWBD 1XTGB 3KHUA 1BDDA 2KSJA 2W6BA 3E1IA 2JKVA 2JR8A 3L71D 2ITAA 4R4MA 4D6TD 2OYOA 5GTIE 1LGHB 3AE4C 1OZHA 1NTMK 3BVHA 5B5EE 3QH9A 1YBKA 4K3AA 2XU6A 4DCKA 1SQXK 1SS1A 1KYOD 1L0LD 3BRVB 3I5CA 1UIXA 1EZVG 1MV8A 3D6YA 5E79E 1AV1A 3V5BA 2K88A 1FZCC 1T3UA 2ZFCA 3BCCG 5APQA 2YNYA 3L75G 3KZIH 5KLIB 1M56D 1VQLP 1AJYA 2YKQA 3HD7A 1KILC 1PGQA 2N1TB 1FC2C 2O01J 1BSNA 3AE8C 1H88A 1RF1B 1ZV8A 1OX3A 2A06G 4H13B 3M06A 3ITKA 4I7ZB 4PD4I 2C0WA 3V6IA 1KILB 1PP9D 5B66H 1PV3A 3Q5PA 1FZCB 3L70E 3Q5RA 1LWUB 1FDIA 4K35A 2E5TA 3VMZA 1M57D 1NU1K 5AW1B 2XDJA 1BGYD 3H1LJ 3AE9C 2QIWA 1HVVA 2NPSC 1DX7A 3BASA 1YI2P 3HRNA 3L70J 2K1AA 4H44B 2A45G 3V2NA 2H43A 1W5CE 2PP6A 4HKZH 1MUUA 1RF0A 2KXPB 2RMZA 2N9YB 2QRXA 3L35A 1H89A 3F5HA 1MZ9A 4LGDE 4XA4A 1JY2N 5APWA 2IBZI 4OGQB 3H1JG 2OTKE 1LT9B 1VL2A 3A0HE 1L0NK 3H1KE 2LXCB 2BEZF 3FXEA 3O6QA 1VQOP 3EQ2A 4JBZA 4GT1A 4DZOA 1HGVA 1N2DC 2D2CC 3RL0B 3H1JJ 4A7PA 3CD6P 3V2RA 5AW8B 1LWUA 4WY4B 3PLNA 1MFZA 3FXDA 5APXA 2K3RA 3FWNA 3SFDC 1RF1A 4WB4A 1S1CX 4H0LD 1SLQA 1GD2E 1NTME 4JQ0D 2KP8A 1SQPK 2PAJA 3IF4A 2O3JA 4HYTB 5KKZC 3CCVP 1URQA 2WPQA 1EDLA 3CX5I 3SWFA 3NTNA 1LTAC 2WSEH 1BE3D 2E74C 3GHGB 3HE4A 4Y99C 5BU8B 3Q5SA 4RKUJ 5CHXA 3VYIA 1KQSO 1IFNA 5AW4B 1IFDA 1YITP 4UB6H 4H44C 1BCCJ 3GHGA 2YMKA 3L70D 1OFCX 3VMYA 3WU2H 1LP1A 2H8PD 2NPSB 2OARA 1JCCA 5AVRB 2W6AA 4C7RA 2SPZA 1SFCB 1OXZA 1SQVJ 4PV1D 1J1DC 4DOJA 1FJPA 1S5LH 1M1JB 3L71J 2KLVA 1KQLA 4I7ZC 3H1HG 1CI6B 3VOPA 3TNUA 3SFEC 1LTIC 3G6EP 1RH5B 2MJZA 2E42A 3V2PA 3P8CD 2Y0EA 1R5SA 2Z5HA 2KUBA 2IYPA 2QJPB 2FKWB 4U3FG 4XFJA 2FYUD 3S4RA 4U3FD 1VF5C 1NTZE 2WTYA 3PP5A 2WSCJ 1RY3A 1SQBJ 1T8ZA 2L91A 2WT7A 1S72P 3VMXA 2WPSA 1PPJE 2QM8A 5KJ7D 3RBXA 4BXLA 5B5EH 2OYIB 1GU4A 3V4QA 3RK3C 4CPGA 1NTKJ 1URQB 2AEJA 2R32A 2Y0DA 2FYUK 2YIUC 1G1IA 4XE5B 1NHLA 1PP9E 4Y28J 1KD1Q 2IZ0A 1L0NE 1JY3P 1BE3J 1NH4A 2H89C 3OAKA 4OGQC 2P58A 4YXWH 1HWTC 3CCEP 1JUNA 1YIJP 2N9BA 3RK2B 1NGMB 1GW4A 4RO0A 3BCCJ 3L70G 3SWKA 5KAFH 3A3YB 4W7ZA 1IFIA 1YTZI 1EDJA 4N78E 1SQXG 3L72G 3WUTA 1ZW0A 3NXSA 4DT0A 1DD3A 1FOSF 3H1HJ 4IOIH 5APTA 1FZEA 1K04A 3AEAC 1GL2B 2AXTE 1SQQG 3EWKA 1SQPE 2H88C 3E1RA 4L73A 4N3YB 1H0TB 3A2AA 3CX5D 1LT1A 3CCLP 3AE1C 5KJ7A 1DIPA 2V7QH 2QVAA 3MZWB 1FU1A 1K05A 3MHVA 1OMIA 1JEKA 2I8DA 1NTZK 4QMAA 1ZMEC 2O01N 2E75D 2M5AB 1YHQP 1KMIZ 4EIJA 5KLVD 4I6MC 1L0LK 4IFFA 4N6JA 4EDFA 2AXCA 3CPWO 1FDMA 2ZT9C 2YO2A 3AEFC 1ZOYC 1G2CB 2DW3A 3II6A 2B9BA 2J5UA 2R3SA 3MUDC 4OVNF 3CMAP 4H0LB 3L74J 1KC8Q 2QJKC 3EFFK 2HODA 5KTBA 1QVFO 4GIFA 5CCHA 1A02J 5H2FE 2Y9YA 3PJSK 2OGUA 3KPEA 2YMYA 2FYNB 1YJNP 1FE6A 2P7JA 3AE5C 3CLQA 3RK3E 5CCGA 1JTHB 3RBZA 1ZRTD 2P2UA 1P84D 3A5TA 1N73A 4IL6H 3H32B 4O9BA 4U3FE 1EXIA 2I1JA 2B89A 3UIAA 1USDA 1N73C 3TK1A 1OW8A 3E7KA 1PP9G 2BASA 2YO3A 3K5BA 3B5NB 1PGJA 2NRGA 4U7JA 3W68A 2IFNA 1L0LE 1G1JA 5CCHD 3L36A 2FYZA 4ZNCA 1LTGC 3CCUP 5KLVG 3L75D 2E43A 3I56P 4HB1A 1KQFB 3CCSP 3AE2C 3CWBJ 1N7SD 2J58A 5AVWB 1DD4A 1N7SB 4M3LA 1S9KD 1GTWA 2OQQA 3RK2C 1WT6A 3OA7A 3TSIA 4KHXA 4ASVA 4ZKUA 2HPCA 4EI2A 1Q82Q 3RGUA 1J1EC 3AECC 3HE5B 3SWYA 2XZRA 1Q81Q 1FZGA 3VTPC 3C1LA 5CBNA 1Q86Q 4C7NB 3IN6A 3L71G 2W27A 2HFED 1SQXD 1SQQK 3CWBG 3L72D 1VQ4P 1KZUB 1L4AB 2E76D 1W2EA 2IDBA 2POHA 3H1KD 3QWOC 2JEEA 2M0BA 4HH2A 1FZAA 2M3EA 1LTJC 5AW7B 3H32A 5KLIC 4UB8H 4AYCA 3M9QA 1JY2P 2QJKB 3HUSC 3CI9A 1OW7A 3L37A 4AQRD 1JO5A 1LTJA 3TGUJ 1AA0A 5KLVK 1AVOA 5CJ4A 3CMEP 5BU5A 3L73J 1JMMA 1NU1G 3G4SP 3CXHI 2Z4EA 1H0TA 3PHLA 4RJTA 1VF5D 1KILD 3AE3C 3N4XA 3CCRP 3H1LD 2G8YA 1BGYE 1QEXA 3L73G 3MD0A 4EYYQ 1L0NG 1SVFA 3WUVA 2WMMA 2KNCB 3TGUG 2KLUA 2BCCJ 1NVOA 5AW0B 3M91A 5CJ0A 1KILE 3G3ZA 1P84I 1ZN5A 3S9OA 4BWNA 1ZLLA 1SQXE 1EQ7A 1P84H 2PGDA 2XNDH 3C9IA 3L72E 4PV1C 5AVVB 1BGYJ 3A0BE 5CBOA 2KB7P 1SQQE 1ZP0C 1GDTA 2E76C 1L4AD 2E76B 2IFMA 5TJHA 3L75J 2FY8A 4OWFA 4PJ0E 4H44D 5APSA 2KZIA 4Z1MH 1AFOA 3H1IJ 3FX0A 3AE6C 3VN0A 1KYOE 3VP8A 3KQGA 4IL6E 4UB8E 3TGUE 2QJYB 1VDFA 1VQ7P 3LW5H 1VQ9P 2C9NY 1HF9A 1HTLC 3W67A 3CX5H 4IFMA 1DEBA 1FAVA 1HUCA 1ZRTE 1HJBA 1NU1J 3TDKA 4WY4D 4ZMDA 1NTZG 2FYUJ 2I1KA 3TYYA 1VQ6P 1X22A 2B87A 1U7MA 1NTMD 4I1LA 3RL0D 1NU1E 1ZR2A 1JY3O 1J2JB 1HH0A 3P32A 4L76A 2JJLA 3V4WA 3CL3D 3D70A 2OYHB 2V7QJ 2QJPC 2AEFA 2NZ2A 2WSFH 3WUUA 1YJWP 1JY2O 1VQKP 1EZVE 1NYHA 1PIXA 1QL2A 3B5ND 3OJAB 1HGZA 4NPEA 5KLVJ 1QGKB 1Q7YQ 1VQNP 1NTZD 2IX7C 2O1KA 2V4HA 3HUSB 2ZYGA 4TT3H 4D6TE 1CW5A 3JSVC 4GODA 1PL5A 2YKPA 3GF3A 4I2LC 3L74D 2QJYC 2Q3EA 4W7YA 2JWDA 2FXOA 5AW2B 1JY3N 5KLVE 1FBMA 1H8AA 2Q3IA 4LC1A 1L0LJ 4WY4A 2IBZG 5AVQB 5TISH 1PFIA 1GL2C 1X0TA 1NKNA 1X79B 2KK7A 3HD7D 1VQMP 1NWQA 5KAIH 3GLMA 4WVZA 3WMM0 3CCMP 2Q7CA 1GL2A 1IFMA 1JB0J 3MGNA 1VQPP 3B4SA 5TISE 3U1AA 2BCCG 1BGYG 3L73E 2LXBA 4PV1B 1A02F 5DJUB 4JYCA 3MIWA 1FZBA 2Q6QA 2ZT9D 3H1IE 1YQ3C 5AW9B 1USEA 5CCGD 2YIUB 2OTLP 1URQC 1S5LX 1QLED 2IZ1A 4L74A 2YXRB 1RQVA 1GW3A 1L0ND 1D7MA 1YQ4C 2W90A 1SQVK 2R44A 3HE4B 3H1LG 2XKMA 3L73D 2FFDC 2ZAEB 1YYCA 1LTTC 2OYHC 2CPBA 2WPVB 5CMZA 1NAYA 5AW6B 1WRGA 1LNQA 3AE7C 2HYNA 3CXHE 2KOGA 3BATA 2OTJP 4BRYB 3CC4P 2MKVA 1SQBK 1LTSC 3HE5A 5E79H 2WVRA 4D6TJ 3HTKB 4D6TG 1QVGO 1KTMA 3VMAA 4RESB 2Z5IA 2A45H 3H1KG 4OH8B 1CI6A 4DJGA 3JC22 1J1EB 4JYBA 1SFCD 2K9YA 4GKGA 2AXTH 4OGQD 5AVTB 4EOTA 1NTKD 1SQPG 2VRSA 2CPSA 3OW2O 1LWUC 3GW6A 3KYQA 4TLFA 3I55P 2GM4A 3A7OA 1P84E 1SQBG 2FYUE 2FBWC 5KJ7C 4YPCA 4NPDA 1CZQA 1N7SC 3C8VA 2P10A 2P67A 3BCCE 2GA1A 4LLHA 1BSHA 1KFMA 1AQTA 2W8ZA 1LJ2A 5DJTB 2JDIH 1BE3E 1OVUA 3CC7P 1KB9H 3BRTB 5AVZB 5BVZA 1AQ5A 3L75E 5B66E 1PGPA 2KNCA 1SQQJ 1RE4C 3CWBE 3VP9A 1SFCA 1SQVD 3F89A 1JM0A 4GOEA 1SQXJ 3ABVC 3L72J 1SQBE 3R2PA 1K9MQ 1K8AQ 2H7HA 1FDOA 4BRYA 1N7LA 3RK2D 1VQ8P 3A0BH 3O8ZA 4N78D 3KDPB 3L74E 1PPJD 1OW6A 2KZJA 2WPRA 2BCCE 1EC5A 1S3JA 1WMKA 2HODB 3A0HH 4IFDK 3CXHH 1LTJB 2P1JA 2WT7B 1LT9A 1Y9BA 3CCJP 1G2CA 1L4AC 2W83C 4KT0J 1PZQA 2C9LY 1HJ0A 4JPZB 1E5WA 2GUSA 3RK3B 1FS0E 3MUDA 2RN0A 2OYHA 1L4AA 2WSFJ 3LW5J 2ZT9B 2JWAA 2W6JH 1IK9A 1X9VA 2B87B 4H0LC 1KFNA 3T97B 5AVYB 1KV4A 1BCCE 2HR3A 2M3BA 2WZ7A 3H1ID 2R5DA 2BEQD 3NFQA 3IFMA 1EXJA 3B71A 3SSUA 2FFDB 1M90Q 2E75C 4YTPC 1Y47A 2D2CD 4W80A 1RE4A 3JCUE 4H13D 1SQBD 2A45I 1KQGB 2N1TC 5KAIE 1RF1C 1IC2A 2ZYDA 2HLOA 3PRJA 2QEXP 1EDIA 2KIKA 3NMDA 1RQUA 5M1BA 2O1JA 1KB9E 1SQQD 1J1DB 4B86A 2G3AA 3D6ZA 4AUWA 1PP9J 1U57A 2IYOA 2JP3A 1QL1A 1VPCA 2ZYAA 3CC2P 1NTKE 3B5NA 2J59M 3CX5E 4MN4C 4UB6E 2FXPA 1NOHA 1R8EA 1N86A 2WITA 3P7KA 3H1JE 1GU5A 3GG2A 1BDCA 1NTZJ 3S1KA 2OYIA 3H1KJ 1Q90D 5AW5B 2FYNC 2IPPA 2O01H 3V2QA 2QE7H 3FWLA 2ZXEB 3B8EB 5APVA 3TF5A 1SQPJ 1NJIQ 1HBWA 1GK4A 3PTZA 2K9JA 1KORA 5APUA 5H2FH 1IFPA 2E5YA 3Q1MA 2Y9ZA 1L2PA 4PJ0H 2KSEA 5APYA 1VF5B 1BCCG 2QSIA 4NPFX 4U3FJ 5AVXB 4C46A 1R5LA 3MTUE 1N7SA 2PFXA 2UWJE 1T2KC 1T2KD 4GDOA 5CCHC 2ZVNB 1ZR4A 1L0NJ 2WSCH 2FYUG 1M7LA 1BCCD 3IR9A 3H25A 3Q3DA 4WBAA 2YKOA 3H1HD 3IAOA 2IBZE 4R4LA 3AEGC 3M0AA 1MFTA 2BCCD 1M1JC 1OVRA 2WQYC 3GF7A 2LKMA 1Y8AA 2QA4P 5GTIH 1SFCC 1JOCA 2KS1A 4YXDC 1DH3A 2L5GB 3HUSA 1OVVA 3RL0g 4PD4H 5GTHH 3G9RA 1RE3A 2IBZD 3TNUB 1IO4A 1GL2D 1OWAA 1JTHA 2PRRA 1W2BO 2HG5D 2E74B 3AEEC 3AEDC 3GHGC 3L74G 3P8CE 1CSBA 1E79H 1IFJA 1TU3F 2E74D 2FXMA 2N1TA 2RKLA 3L71E 3HD7B 2Q1KA 1IK7A 1LP1B 2A06E 2K37A 2N1TD 5KKZB 1IZNB 1K73Q 2K9JB 1BE3G 3LIEA 4H13C 3USSA 2R3CA 1NKZB 2B88A 2R5BA 1YJ9P 1KN7A 2KS1B 2WSEJ 3M9HA 1S9KE 1OIPA 3KZIE 1NTKK 4WWIA 3U59A 4ZKPA 3B5NC 3H1HE 1URQD 3LIDA 2Y0CA 1KB9D 2ZJSE 1JCDA 1JMBA 5CCGC 3H1IG 1N73B 2QM7A 1Q2NA 3N7NA 1NTMG 1SP4A 3JCUH 5GTHE 3D71A 3H1JD 1X8YA 3RL0C 1JNMA 2C0XA 1GMJA 4KJMA 2OYIC 1NTMJ 4JF7A 1FZFA 3H1LE 1LT9C 1EZVI 3P8MC 3HD7C
chains in the Genus database with same CATH topology
1GK6A 3HTKA 1LTBC 3T97A 2HPCB 1RF0C 3L4FA 2FFDA 1Z56A 2Q9IA 1M1JA 2XNXA 2XV5A 5AW3B 2NPSD 3M0DC 2KYVA 2NPSA 2M8RA 1T3JA 2Q5UA 5AVUB 4Y99B 3RK3D 1RE3C 3M0DA 1NO4A 2WWWA 2GUVA 3EFGA 1NAFA 1FOSE 3U1CA 1YTZT 3M9BA 1KILA 1FZCA 4WY4C 4C7NA 5AVSB 1XTCC 1IJDB 3H6PA 1FJKA 1GZLA 1XTGB 2KSJA 2W6BA 3E1IA 1LGHB 1NTMK 3BVHA 2XU6A 1SQXK 3BRVB 3I5CA 1MV8A 3V5BA 1T3UA 2ZFCA 5APQA 2YNYA 2YKQA 3HD7A 1KILC 1H88A 2N1TB 1RF1B 1FZCC 1ZV8A 3M06A 2C0WA 1KILB 1FZCB 1LWUB 3VMZA 1NU1K 5AW1B 2XDJA 1DX7A 1HVVA 2NPSC 3BASA 3HRNA 2A45G 2PP6A 1MUUA 1RF0A 3L35A 1H89A 4LGDE 1MZ9A 4XA4A 1JY2N 5APWA 1LT9B 1L0NK 3EQ2A 4GT1A 4DZOA 1HGVA 1N2DC 3RL0B 3V2RA 5AW8B 1LWUA 4WY4B 5APXA 1MFZA 4WB4A 1SLQA 1GD2E 2KP8A 1SQPK 2PAJA 4HYTB 1URQA 2WPQA 3SWFA 3NTNA 1LTAC 2WSEH 3GHGB 3HE4A 5BU8B 4Y99C 2H43A 5CHXA 3VYIA 1IFNA 5AW4B 1IFDA 3GHGA 3VMYA 5AVRB 2H8PD 2NPSB 2OARA 1JCCA 4C7RA 2W6AA 1SFCB 1OXZA 1J1DC 4DOJA 1FJPA 1M1JB 2KLVA 1KQLA 1CI6B 3VOPA 3TNUA 1LTIC 2MJZA 2E42A 3V2PA 3P8CD 2Z5HA 2FKWB 2WTYA 3PP5A 1RY3A 1T8ZA 3VMXA 2WPSA 2QM8A 5KJ7D 2OYIB 1GU4A 3V4QA 3RK3C 2WT7A 1URQB 2R32A 2FYUK 1G1IA 4XE5B 1NHLA 1JY3P 1NH4A 3OAKA 1JUNA 1HWTC 2N9BA 3RK2B 1GW4A 3A3YB 4W7ZA 1IFIA 1YTZI 4N78E 3NXSA 1FOSF 5APTA 1FZEA 1GL2B 4N3YB 3A2AA 5KJ7A 1FU1A 1NTZK 4EIJA 4I6MC 1L0LK 4IFFA 4N6JA 1FDMA 2YO2A 1G2CB 3II6A 5KTBA 2HODA 4GIFA 5CCHA 1A02J 3KPEA 2YMYA 2P7JA 3CLQA 3A5TA 5CCGA 1JTHB 2P2UA 1N73A 3H32B 4O9BA 2I1JA 3UIAA 1N73C 3TK1A 2BASA 2YO3A 3B5NB 2IFNA 1G1JA 5CCHD 3L36A 2FYZA 2E43A 1LTGC 1N7SD 2J58A 5AVWB 1N7SB 4M3LA 1S9KD 1GTWA 4ZKUA 1WT6A 3OA7A 3TSIA 4KHXA 2HPCA 1J1EC 3HE5B 3SWYA 1FZGA 2XZRA 3VTPC 4C7NB 2W27A 2HFED 1SQQK 1KZUB 1L4AB 4HH2A 1W2EA 2POHA 2JEEA 5AW7B 1FZAA 1LTJC 3H32A 4AYCA 3M9QA 1JY2P 3HUSC 3L37A 3CI9A 4AQRD 1JO5A 1LTJA 5KLVK 5CJ4A 5BU5A 1JMMA 2Z4EA 1KILD 3N4XA 3MD0A 1SVFA 5AW0B 3M91A 5CJ0A 3G3ZA 1ZN5A 1ZLLA 1EQ7A 5AVVB 3C9IA 2KB7P 1GDTA 1L4AD 2IFMA 1AFOA 5APSA 3VN0A 3VP8A 3KQGA 2C9NY 1VDFA 3LW5H 1HTLC 4IFMA 1DEBA 1FAVA 1HUCA 1HJBA 4WY4D 2I1KA 3TYYA 4I1LA 1ZR2A 3RL0D 1JY3O 1J2JB 3P32A 1HH0A 3V4WA 2JJLA 3CL3D 2OYHB 2WSFH 1JY2O 1QL2A 3OJAB 3B5ND 1HGZA 2O1KA 2IX7C 1CW5A 3HUSB 2YKPA 4I2LC 4W7YA 5AW2B 1JY3N 1FBMA 1H8AA 2Q3IA 4LC1A 4WY4A 5AVQB 1PFIA 1GL2C 1NKNA 1X79B 3HD7D 1NWQA 3WMM0 2Q7CA 1GL2A 1IFMA 3MGNA 3U1AA 1A02F 4JYCA 3MIWA 1FZBA 5AW9B 5CCGD 1URQC 2OYIC 1GW3A 3HE4B 2FFDC 1SQVK 2XKMA 1YYCA 1LTTC 2OYHC 2CPBA 5CMZA 5AW6B 1WRGA 2HYNA 2KOGA 3BATA 3HE5A 1SQBK 1LTSC 3HTKB 4RESB 2Z5IA 2A45H 4OH8B 1CI6A 4JYBA 1J1EB 1SFCD 4EOTA 4GKGA 5AVTB 2VRSA 2CPSA 1LWUC 3KYQA 2GM4A 3A7OA 5KJ7C 1CZQA 1N7SC 2P67A 4LLHA 1KFMA 3BRTB 5AVZB 1AQ5A 5BVZA 1RE4C 3VP9A 1SFCA 3V2NA 3R2PA 2H7HA 1N7LA 3RK2D 3O8ZA 4N78D 3KDPB 2WPRA 2HODB 4IFDK 2WT7B 1LTJB 2P1JA 1LT9A 1G2CA 1L4AC 2C9LY 1E5WA 2GUSA 3RK3B 3MUDA 2OYHA 1L4AA 1IK9A 1X9VA 1KFNA 5AVYB 2M3BA 2WZ7A 3NFQA 2R5DA 3IFMA 2FFDB 4W80A 1RE4A 2A45I 2N1TC 1RF1C 1IC2A 2HLOA 3NMDA 2O1JA 4B86A 1J1DB 4AUWA 1QL1A 1VPCA 3B5NA 2J59M 1NOHA 1N86A 2WITA 3P7KA 1GU5A 2OYIA 5AW5B 2IPPA 2O01H 3V2QA 1HBWA 2ZXEB 3B8EB 5APVA 1GK4A 5APUA 5AVXB 4C46A 1T2KC 3MTUE 1N7SA 1T2KD 5CCHC 1ZR4A 2WSCH 1M7LA 3IR9A 4WBAA 2YKOA 3M0AA 1M1JC 2LKMA 1SFCC 1JOCA 1DH3A 2L5GB 3HUSA 1IO4A 3TNUB 1RE3A 1GL2D 1OWAA 1JTHA 2HG5D 3GHGC 3P8CE 1CSBA 2FXMA 1IFJA 5APYA 3RK2C 2N1TA 1RF1A 3HD7B 2N1TD 3LIEA 2R3CA 1NKZB 2R5BA 1S9KE 3M9HA 1NTKK 3U59A 4ZKPA 3B5NC 3LIDA 1URQD 1JCDA 5CCGC 1N73B 2QM7A 3N7NA 1SP4A 1X8YA 3RL0C 1JNMA 2C0XA 4JF7A 1FZFA 1LT9C 3P8MC 3HD7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GK6 A;  3HTK A;  1KQL A;  3T97 A;  1CI6 B;  3TNU A;  3MD0 A;  2H7H A;  2E42 A;  3O8Z A;  2XV5 A;  3KDP B;  5AW0 B;  2Z5H A;  5AW3 B;  2WPR A;  3M91 A;  2WT7 B;  2Q5U A;  2WTY A;  5AVU B;  5AVV B;  2C9L Y;  3VMX A;  2WPS A;  2QM8 A;  3M0D A;  2WWW A;  1GU4 A;  3V4Q A;  2WT7 A;  2R32 A;  1NAF A;  5APS A;  1FOS E;  4XE5 B;  3M9B A;  3VN0 A;  3OAK A;  3KQG A;  2C9N Y;  1JUN A;  1HWT C;  2N9B A;  4C7N A;  3NFQ A;  1FAV A;  1HUC A;  2R5D A;  1HJB A;  3A3Y B;  5AVS B;  3TYY A;  3NXS A;  1FOS F;  5APT A;  1J2J B;  3P32 A;  3V4W A;  1GZL A;  2JJL A;  3A2A A;  3NMD A;  4B86 A;  4AUW A;  2XU6 A;  5AVZ B;  3P7K A;  3I5C A;  4I2L C;  5AW2 B;  1GU5 A;  4I6M C;  1MV8 A;  5AW5 B;  3V5B A;  2YO2 A;  2ZFC A;  2IPP A;  1G2C B;  2Q3I A;  4LC1 A;  5APQ A;  1H8A A;  2YNY A;  5AVQ B;  2ZXE B;  3B8E B;  5APV A;  1HBW A;  1GK4 A;  1H88 A;  5APU A;  1NWQ A;  1A02 J;  3M06 A;  2Q7C A;  3MGN A;  5AVX B;  4C46 A;  1T2K C;  1T2K D;  3VMZ A;  2P7J A;  5AW1 B;  1A02 F;  3A5T A;  4JYC A;  2P2U A;  3IR9 A;  5AW9 B;  3M0A A;  3UIA A;  3TK1 A;  3HE4 B;  1MUU A;  2BAS A;  2YO3 A;  1YYC A;  1DH3 A;  3L35 A;  1H89 A;  5CMZ A;  5APW A;  5AW6 B;  2E43 A;  3L36 A;  1IO4 A;  3TNU B;  1OWA A;  4GT1 A;  4DZO A;  3HE5 A;  5AW8 B;  1CSB A;  4M3L A;  5APY A;  5AVW B;  1S9K D;  1GTW A;  4RES B;  1MFZ A;  5APX A;  2Z5I A;  4KHX A;  1CI6 A;  1GD2 E;  3LIE A;  4JYB A;  3HE5 B;  4EOT A;  2R3C A;  1SLQ A;  2R5B A;  2XZR A;  4GKG A;  5AVT B;  2KP8 A;  2VRS A;  3M9H A;  4HYT B;  3VTP C;  4C7N B;  1S9K E;  2WPQ A;  2W27 A;  3SWF A;  3NTN A;  3HE4 A;  3LID A;  3A7O A;  3VYI A;  2QM7 A;  5AW4 B;  5AW7 B;  1SP4 A;  1CZQ A;  2P67 A;  4AYC A;  3L37 A;  1X8Y A;  1JNM A;  3VMY A;  4AQR D;  5AVR B;  2W6A A;  1OXZ A;  3P8M C;  5AVY B; 
#chains in the Genus database with same CATH topology
 1GK6 A;  1M8O B;  1UII A;  3HTK A;  2JO1 A;  3CXH D;  4PD4 D;  1VQ5 P;  1LTB C;  2ZXX A;  1S5L E;  3GMA A;  5C39 A;  3O6Q B;  3T97 A;  2YXQ B;  1RF0 C;  3PH0 A;  5K5G B;  1N8R Q;  3L4F A;  4HJG H;  1Z56 A;  4ASW A;  2FFD A;  3CCQ P;  2Q9I A;  1M1J A;  3AEB C;  1PPJ G;  2XNX A;  2XV5 A;  1M1K Q;  5AW3 B;  2RH0 A;  4GOF A;  3ZDM A;  2NPS D;  2M5A A;  5L8R J;  2HPC B;  3R4Y A;  3M0D C;  2KYV A;  4PD4 E;  2NPS A;  1KYO H;  1T3J A;  1SQV G;  2M8R A;  2Q5U A;  1KB9 I;  4IL6 X;  1KYO I;  5EFW B;  3FGA D;  5AVU B;  3TGU D;  4Y99 B;  3RK3 D;  1EDK A;  2E75 B;  1QX8 A;  1RE3 C;  3M0D A;  1NO4 A;  1S2E A;  2WWW A;  2GUV A;  3EFG A;  1ZXG A;  3G71 P;  1U7J A;  1NAF A;  1FOS E;  1DEE G;  3U1C A;  1SQV E;  1YTZ T;  2A06 D;  3BCC D;  1NU1 D;  1S4X A;  3M9B A;  2KI7 B;  1KIL A;  1FZC A;  3KXD A;  1L0L G;  1MKM A;  4WY4 C;  4C7N A;  4L75 A;  1T6A A;  1AVY A;  2D2C B;  2QG4 A;  1EZV D;  2AEM A;  1RHZ B;  5AVS B;  3MP7 B;  5KAF E;  3WU2 E;  1XTC C;  1IJD B;  2LR2 A;  2CK3 H;  1PGO A;  3Q2Y A;  2ZVO B;  3H6P A;  2WSS H;  1SQP D;  1NTK G;  1FJK A;  1GZL A;  3CWB D;  1XTG B;  3KHU A;  1BDD A;  2KSJ A;  2W6B A;  3E1I A;  2JKV A;  2JR8 A;  3L71 D;  2ITA A;  4R4M A;  4D6T D;  2OYO A;  5GTI E;  1LGH B;  3AE4 C;  1OZH A;  1NTM K;  3BVH A;  5B5E E;  3QH9 A;  1YBK A;  4K3A A;  2XU6 A;  4DCK A;  1SQX K;  1SS1 A;  1KYO D;  1L0L D;  3BRV B;  3I5C A;  1UIX A;  1EZV G;  1MV8 A;  3D6Y A;  5E79 E;  1AV1 A;  3V5B A;  2K88 A;  1FZC C;  1T3U A;  2ZFC A;  3BCC G;  5APQ A;  2YNY A;  3L75 G;  3KZI H;  5KLI B;  1M56 D;  1VQL P;  1AJY A;  2YKQ A;  3HD7 A;  1KIL C;  1PGQ A;  2N1T B;  1FC2 C;  2O01 J;  1BSN A;  3AE8 C;  1H88 A;  1RF1 B;  1ZV8 A;  1OX3 A;  2A06 G;  4H13 B;  3M06 A;  3ITK A;  4I7Z B;  4PD4 I;  2C0W A;  3V6I A;  1KIL B;  1PP9 D;  5B66 H;  1PV3 A;  3Q5P A;  1FZC B;  3L70 E;  3Q5R A;  1LWU B;  1FDI A;  4K35 A;  2E5T A;  3VMZ A;  1M57 D;  1NU1 K;  5AW1 B;  2XDJ A;  1BGY D;  3H1L J;  3AE9 C;  2QIW A;  1HVV A;  2NPS C;  1DX7 A;  3BAS A;  1YI2 P;  3HRN A;  3L70 J;  2K1A A;  4H44 B;  2A45 G;  3V2N A;  2H43 A;  1W5C E;  2PP6 A;  4HKZ H;  1MUU A;  1RF0 A;  2KXP B;  2RMZ A;  2N9Y B;  2QRX A;  3L35 A;  1H89 A;  3F5H A;  1MZ9 A;  4LGD E;  4XA4 A;  1JY2 N;  5APW A;  2IBZ I;  4OGQ B;  3H1J G;  2OTK E;  1LT9 B;  1VL2 A;  3A0H E;  1L0N K;  3H1K E;  2LXC B;  2BEZ F;  3FXE A;  3O6Q A;  1VQO P;  3EQ2 A;  4JBZ A;  4GT1 A;  4DZO A;  1HGV A;  1N2D C;  2D2C C;  3RL0 B;  3H1J J;  4A7P A;  3CD6 P;  3V2R A;  5AW8 B;  1LWU A;  4WY4 B;  3PLN A;  1MFZ A;  3FXD A;  5APX A;  2K3R A;  3FWN A;  3SFD C;  1RF1 A;  4WB4 A;  1S1C X;  4H0L D;  1SLQ A;  1GD2 E;  1NTM E;  4JQ0 D;  2KP8 A;  1SQP K;  2PAJ A;  3IF4 A;  2O3J A;  4HYT B;  5KKZ C;  3CCV P;  1URQ A;  2WPQ A;  1EDL A;  3CX5 I;  3SWF A;  3NTN A;  1LTA C;  2WSE H;  1BE3 D;  2E74 C;  3GHG B;  3HE4 A;  4Y99 C;  5BU8 B;  3Q5S A;  4RKU J;  5CHX A;  3VYI A;  1KQS O;  1IFN A;  5AW4 B;  1IFD A;  1YIT P;  4UB6 H;  4H44 C;  1BCC J;  3GHG A;  2YMK A;  3L70 D;  1OFC X;  3VMY A;  3WU2 H;  1LP1 A;  2H8P D;  2NPS B;  2OAR A;  1JCC A;  5AVR B;  2W6A A;  4C7R A;  2SPZ A;  1SFC B;  1OXZ A;  1SQV J;  4PV1 D;  1J1D C;  4DOJ A;  1FJP A;  1S5L H;  1M1J B;  3L71 J;  2KLV A;  1KQL A;  4I7Z C;  3H1H G;  1CI6 B;  3VOP A;  3TNU A;  3SFE C;  1LTI C;  3G6E P;  1RH5 B;  2MJZ A;  2E42 A;  3V2P A;  3P8C D;  2Y0E A;  1R5S A;  2Z5H A;  2KUB A;  2IYP A;  2QJP B;  2FKW B;  4U3F G;  4XFJ A;  2FYU D;  3S4R A;  4U3F D;  1VF5 C;  1NTZ E;  2WTY A;  3PP5 A;  2WSC J;  1RY3 A;  1SQB J;  1T8Z A;  2L91 A;  2WT7 A;  1S72 P;  3VMX A;  2WPS A;  1PPJ E;  2QM8 A;  5KJ7 D;  3RBX A;  4BXL A;  5B5E H;  2OYI B;  1GU4 A;  3V4Q A;  3RK3 C;  4CPG A;  1NTK J;  1URQ B;  2AEJ A;  2R32 A;  2Y0D A;  2FYU K;  2YIU C;  1G1I A;  4XE5 B;  1NHL A;  1PP9 E;  4Y28 J;  1KD1 Q;  2IZ0 A;  1L0N E;  1JY3 P;  1BE3 J;  1NH4 A;  2H89 C;  3OAK A;  4OGQ C;  2P58 A;  4YXW H;  1HWT C;  3CCE P;  1JUN A;  1YIJ P;  2N9B A;  3RK2 B;  1NGM B;  1GW4 A;  4RO0 A;  3BCC J;  3L70 G;  3SWK A;  5KAF H;  3A3Y B;  4W7Z A;  1IFI A;  1YTZ I;  1EDJ A;  4N78 E;  1SQX G;  3L72 G;  3WUT A;  1ZW0 A;  3NXS A;  4DT0 A;  1DD3 A;  1FOS F;  3H1H J;  4IOI H;  5APT A;  1FZE A;  1K04 A;  3AEA C;  1GL2 B;  2AXT E;  1SQQ G;  3EWK A;  1SQP E;  2H88 C;  3E1R A;  4L73 A;  4N3Y B;  1H0T B;  3A2A A;  3CX5 D;  1LT1 A;  3CCL P;  3AE1 C;  5KJ7 A;  1DIP A;  2V7Q H;  2QVA A;  3MZW B;  1FU1 A;  1K05 A;  3MHV A;  1OMI A;  1JEK A;  2I8D A;  1NTZ K;  4QMA A;  1ZME C;  2O01 N;  2E75 D;  2M5A B;  1YHQ P;  1KMI Z;  4EIJ A;  5KLV D;  4I6M C;  1L0L K;  4IFF A;  4N6J A;  4EDF A;  2AXC A;  3CPW O;  1FDM A;  2ZT9 C;  2YO2 A;  3AEF C;  1ZOY C;  1G2C B;  2DW3 A;  3II6 A;  2B9B A;  2J5U A;  2R3S A;  3MUD C;  4OVN F;  3CMA P;  4H0L B;  3L74 J;  1KC8 Q;  2QJK C;  3EFF K;  2HOD A;  5KTB A;  1QVF O;  4GIF A;  5CCH A;  1A02 J;  5H2F E;  2Y9Y A;  3PJS K;  2OGU A;  3KPE A;  2YMY A;  2FYN B;  1YJN P;  1FE6 A;  2P7J A;  3AE5 C;  3CLQ A;  3RK3 E;  5CCG A;  1JTH B;  3RBZ A;  1ZRT D;  2P2U A;  1P84 D;  3A5T A;  1N73 A;  4IL6 H;  3H32 B;  4O9B A;  4U3F E;  1EXI A;  2I1J A;  2B89 A;  3UIA A;  1USD A;  1N73 C;  3TK1 A;  1OW8 A;  3E7K A;  1PP9 G;  2BAS A;  2YO3 A;  3K5B A;  3B5N B;  1PGJ A;  2NRG A;  4U7J A;  3W68 A;  2IFN A;  1L0L E;  1G1J A;  5CCH D;  3L36 A;  2FYZ A;  4ZNC A;  1LTG C;  3CCU P;  5KLV G;  3L75 D;  2E43 A;  3I56 P;  4HB1 A;  1KQF B;  3CCS P;  3AE2 C;  3CWB J;  1N7S D;  2J58 A;  5AVW B;  1DD4 A;  1N7S B;  4M3L A;  1S9K D;  1GTW A;  2OQQ A;  3RK2 C;  1WT6 A;  3OA7 A;  3TSI A;  4KHX A;  4ASV A;  4ZKU A;  2HPC A;  4EI2 A;  1Q82 Q;  3RGU A;  1J1E C;  3AEC C;  3HE5 B;  3SWY A;  2XZR A;  1Q81 Q;  1FZG A;  3VTP C;  3C1L A;  5CBN A;  1Q86 Q;  4C7N B;  3IN6 A;  3L71 G;  2W27 A;  2HFE D;  1SQX D;  1SQQ K;  3CWB G;  3L72 D;  1VQ4 P;  1KZU B;  1L4A B;  2E76 D;  1W2E A;  2IDB A;  2POH A;  3H1K D;  3QWO C;  2JEE A;  2M0B A;  4HH2 A;  1FZA A;  2M3E A;  1LTJ C;  5AW7 B;  3H32 A;  5KLI C;  4UB8 H;  4AYC A;  3M9Q A;  1JY2 P;  2QJK B;  3HUS C;  3CI9 A;  1OW7 A;  3L37 A;  4AQR D;  1JO5 A;  1LTJ A;  3TGU J;  1AA0 A;  5KLV K;  1AVO A;  5CJ4 A;  3CME P;  5BU5 A;  3L73 J;  1JMM A;  1NU1 G;  3G4S P;  3CXH I;  2Z4E A;  1H0T A;  3PHL A;  4RJT A;  1VF5 D;  1KIL D;  3AE3 C;  3N4X A;  3CCR P;  3H1L D;  2G8Y A;  1BGY E;  1QEX A;  3L73 G;  3MD0 A;  4EYY Q;  1L0N G;  1SVF A;  3WUV A;  2WMM A;  2KNC B;  3TGU G;  2KLU A;  2BCC J;  1NVO A;  5AW0 B;  3M91 A;  5CJ0 A;  1KIL E;  3G3Z A;  1P84 I;  1ZN5 A;  3S9O A;  4BWN A;  1ZLL A;  1SQX E;  1EQ7 A;  1P84 H;  2PGD A;  2XND H;  3C9I A;  3L72 E;  4PV1 C;  5AVV B;  1BGY J;  3A0B E;  5CBO A;  2KB7 P;  1SQQ E;  1ZP0 C;  1GDT A;  2E76 C;  1L4A D;  2E76 B;  2IFM A;  5TJH A;  3L75 J;  2FY8 A;  4OWF A;  4PJ0 E;  4H44 D;  5APS A;  2KZI A;  4Z1M H;  1AFO A;  3H1I J;  3FX0 A;  3AE6 C;  3VN0 A;  1KYO E;  3VP8 A;  3KQG A;  4IL6 E;  4UB8 E;  3TGU E;  2QJY B;  1VDF A;  1VQ7 P;  3LW5 H;  1VQ9 P;  2C9N Y;  1HF9 A;  1HTL C;  3W67 A;  3CX5 H;  4IFM A;  1DEB A;  1FAV A;  1HUC A;  1ZRT E;  1HJB A;  1NU1 J;  3TDK A;  4WY4 D;  4ZMD A;  1NTZ G;  2FYU J;  2I1K A;  3TYY A;  1VQ6 P;  1X22 A;  2B87 A;  1U7M A;  1NTM D;  4I1L A;  3RL0 D;  1NU1 E;  1ZR2 A;  1JY3 O;  1J2J B;  1HH0 A;  3P32 A;  4L76 A;  2JJL A;  3V4W A;  3CL3 D;  3D70 A;  2OYH B;  2V7Q J;  2QJP C;  2AEF A;  2NZ2 A;  2WSF H;  3WUU A;  1YJW P;  1JY2 O;  1VQK P;  1EZV E;  1NYH A;  1PIX A;  1QL2 A;  3B5N D;  3OJA B;  1HGZ A;  4NPE A;  5KLV J;  1QGK B;  1Q7Y Q;  1VQN P;  1NTZ D;  2IX7 C;  2O1K A;  2V4H A;  3HUS B;  2ZYG A;  4TT3 H;  4D6T E;  1CW5 A;  3JSV C;  4GOD A;  1PL5 A;  2YKP A;  3GF3 A;  4I2L C;  3L74 D;  2QJY C;  2Q3E A;  4W7Y A;  2JWD A;  2FXO A;  5AW2 B;  1JY3 N;  5KLV E;  1FBM A;  1H8A A;  2Q3I A;  4LC1 A;  1L0L J;  4WY4 A;  2IBZ G;  5AVQ B;  5TIS H;  1PFI A;  1GL2 C;  1X0T A;  1NKN A;  1X79 B;  2KK7 A;  3HD7 D;  1VQM P;  1NWQ A;  5KAI H;  3GLM A;  4WVZ A;  3WMM 0;  3CCM P;  2Q7C A;  1GL2 A;  1IFM A;  1JB0 J;  3MGN A;  1VQP P;  3B4S A;  5TIS E;  3U1A A;  2BCC G;  1BGY G;  3L73 E;  2LXB A;  4PV1 B;  1A02 F;  5DJU B;  4JYC A;  3MIW A;  1FZB A;  2Q6Q A;  2ZT9 D;  3H1I E;  1YQ3 C;  5AW9 B;  1USE A;  5CCG D;  2YIU B;  2OTL P;  1URQ C;  1S5L X;  1QLE D;  2IZ1 A;  4L74 A;  2YXR B;  1RQV A;  1GW3 A;  1L0N D;  1D7M A;  1YQ4 C;  2W90 A;  1SQV K;  2R44 A;  3HE4 B;  3H1L G;  2XKM A;  3L73 D;  2FFD C;  2ZAE B;  1YYC A;  1LTT C;  2OYH C;  2CPB A;  2WPV B;  5CMZ A;  1NAY A;  5AW6 B;  1WRG A;  1LNQ A;  3AE7 C;  2HYN A;  3CXH E;  2KOG A;  3BAT A;  2OTJ P;  4BRY B;  3CC4 P;  2MKV A;  1SQB K;  1LTS C;  3HE5 A;  5E79 H;  2WVR A;  4D6T J;  3HTK B;  4D6T G;  1QVG O;  1KTM A;  3VMA A;  4RES B;  2Z5I A;  2A45 H;  3H1K G;  4OH8 B;  1CI6 A;  4DJG A;  3JC2 2;  1J1E B;  4JYB A;  1SFC D;  2K9Y A;  4GKG A;  2AXT H;  4OGQ D;  5AVT B;  4EOT A;  1NTK D;  1SQP G;  2VRS A;  2CPS A;  3OW2 O;  1LWU C;  3GW6 A;  3KYQ A;  4TLF A;  3I55 P;  2GM4 A;  3A7O A;  1P84 E;  1SQB G;  2FYU E;  2FBW C;  5KJ7 C;  4YPC A;  4NPD A;  1CZQ A;  1N7S C;  3C8V A;  2P10 A;  2P67 A;  3BCC E;  2GA1 A;  4LLH A;  1BSH A;  1KFM A;  1AQT A;  2W8Z A;  1LJ2 A;  5DJT B;  2JDI H;  1BE3 E;  1OVU A;  3CC7 P;  1KB9 H;  3BRT B;  5AVZ B;  5BVZ A;  1AQ5 A;  3L75 E;  5B66 E;  1PGP A;  2KNC A;  1SQQ J;  1RE4 C;  3CWB E;  3VP9 A;  1SFC A;  1SQV D;  3F89 A;  1JM0 A;  4GOE A;  1SQX J;  3ABV C;  3L72 J;  1SQB E;  3R2P A;  1K9M Q;  1K8A Q;  2H7H A;  1FDO A;  4BRY A;  1N7L A;  3RK2 D;  1VQ8 P;  3A0B H;  3O8Z A;  4N78 D;  3KDP B;  3L74 E;  1PPJ D;  1OW6 A;  2KZJ A;  2WPR A;  2BCC E;  1EC5 A;  1S3J A;  1WMK A;  2HOD B;  3A0H H;  4IFD K;  3CXH H;  1LTJ B;  2P1J A;  2WT7 B;  1LT9 A;  1Y9B A;  3CCJ P;  1G2C A;  1L4A C;  2W83 C;  4KT0 J;  1PZQ A;  2C9L Y;  1HJ0 A;  4JPZ B;  1E5W A;  2GUS A;  3RK3 B;  1FS0 E;  3MUD A;  2RN0 A;  2OYH A;  1L4A A;  2WSF J;  3LW5 J;  2ZT9 B;  2JWA A;  2W6J H;  1IK9 A;  1X9V A;  2B87 B;  4H0L C;  1KFN A;  3T97 B;  5AVY B;  1KV4 A;  1BCC E;  2HR3 A;  2M3B A;  2WZ7 A;  3H1I D;  2R5D A;  2BEQ D;  3NFQ A;  3IFM A;  1EXJ A;  3B71 A;  3SSU A;  2FFD B;  1M90 Q;  2E75 C;  4YTP C;  1Y47 A;  2D2C D;  4W80 A;  1RE4 A;  3JCU E;  4H13 D;  1SQB D;  2A45 I;  1KQG B;  2N1T C;  5KAI E;  1RF1 C;  1IC2 A;  2ZYD A;  2HLO A;  3PRJ A;  2QEX P;  1EDI A;  2KIK A;  3NMD A;  1RQU A;  5M1B A;  2O1J A;  1KB9 E;  1SQQ D;  1J1D B;  4B86 A;  2G3A A;  3D6Z A;  4AUW A;  1PP9 J;  1U57 A;  2IYO A;  2JP3 A;  1QL1 A;  1VPC A;  2ZYA A;  3CC2 P;  1NTK E;  3B5N A;  2J59 M;  3CX5 E;  4MN4 C;  4UB6 E;  2FXP A;  1NOH A;  1R8E A;  1N86 A;  2WIT A;  3P7K A;  3H1J E;  1GU5 A;  3GG2 A;  1BDC A;  1NTZ J;  3S1K A;  2OYI A;  3H1K J;  1Q90 D;  5AW5 B;  2FYN C;  2IPP A;  2O01 H;  3V2Q A;  2QE7 H;  3FWL A;  2ZXE B;  3B8E B;  5APV A;  3TF5 A;  1SQP J;  1NJI Q;  1HBW A;  1GK4 A;  3PTZ A;  2K9J A;  1KOR A;  5APU A;  5H2F H;  1IFP A;  2E5Y A;  3Q1M A;  2Y9Z A;  1L2P A;  4PJ0 H;  2KSE A;  5APY A;  1VF5 B;  1BCC G;  2QSI A;  4NPF X;  4U3F J;  5AVX B;  4C46 A;  1R5L A;  3MTU E;  1N7S A;  2PFX A;  2UWJ E;  1T2K C;  1T2K D;  4GDO A;  5CCH C;  2ZVN B;  1ZR4 A;  1L0N J;  2WSC H;  2FYU G;  1M7L A;  1BCC D;  3IR9 A;  3H25 A;  3Q3D A;  4WBA A;  2YKO A;  3H1H D;  3IAO A;  2IBZ E;  4R4L A;  3AEG C;  3M0A A;  1MFT A;  2BCC D;  1M1J C;  1OVR A;  2WQY C;  3GF7 A;  2LKM A;  1Y8A A;  2QA4 P;  5GTI H;  1SFC C;  1JOC A;  2KS1 A;  4YXD C;  1DH3 A;  2L5G B;  3HUS A;  1OVV A;  3RL0 g;  4PD4 H;  5GTH H;  3G9R A;  1RE3 A;  2IBZ D;  3TNU B;  1IO4 A;  1GL2 D;  1OWA A;  1JTH A;  2PRR A;  1W2B O;  2HG5 D;  2E74 B;  3AEE C;  3AED C;  3GHG C;  3L74 G;  3P8C E;  1CSB A;  1E79 H;  1IFJ A;  1TU3 F;  2E74 D;  2FXM A;  2N1T A;  2RKL A;  3L71 E;  3HD7 B;  2Q1K A;  1IK7 A;  1LP1 B;  2A06 E;  2K37 A;  2N1T D;  5KKZ B;  1IZN B;  1K73 Q;  2K9J B;  1BE3 G;  3LIE A;  4H13 C;  3USS A;  2R3C A;  1NKZ B;  2B88 A;  2R5B A;  1YJ9 P;  1KN7 A;  2KS1 B;  2WSE J;  3M9H A;  1S9K E;  1OIP A;  3KZI E;  1NTK K;  4WWI A;  3U59 A;  4ZKP A;  3B5N C;  3H1H E;  1URQ D;  3LID A;  2Y0C A;  1KB9 D;  2ZJS E;  1JCD A;  1JMB A;  5CCG C;  3H1I G;  1N73 B;  2QM7 A;  1Q2N A;  3N7N A;  1NTM G;  1SP4 A;  3JCU H;  5GTH E;  3D71 A;  3H1J D;  1X8Y A;  3RL0 C;  1JNM A;  2C0X A;  1GMJ A;  4KJM A;  2OYI C;  1NTM J;  4JF7 A;  1FZF A;  3H1L E;  1LT9 C;  1EZV I;  3P8M C;  3HD7 C; 
#chains in the Genus database with same CATH homology
 1GK6 A;  3HTK A;  1LTB C;  3T97 A;  2HPC B;  1RF0 C;  3L4F A;  2FFD A;  1Z56 A;  2Q9I A;  1M1J A;  2XNX A;  2XV5 A;  5AW3 B;  2NPS D;  3M0D C;  2KYV A;  2NPS A;  2M8R A;  1T3J A;  2Q5U A;  5AVU B;  4Y99 B;  3RK3 D;  1RE3 C;  3M0D A;  1NO4 A;  2WWW A;  2GUV A;  3EFG A;  1NAF A;  1FOS E;  3U1C A;  1YTZ T;  3M9B A;  1KIL A;  1FZC A;  4WY4 C;  4C7N A;  5AVS B;  1XTC C;  1IJD B;  3H6P A;  1FJK A;  1GZL A;  1XTG B;  2KSJ A;  2W6B A;  3E1I A;  1LGH B;  1NTM K;  3BVH A;  2XU6 A;  1SQX K;  3BRV B;  3I5C A;  1MV8 A;  3V5B A;  1T3U A;  2ZFC A;  5APQ A;  2YNY A;  2YKQ A;  3HD7 A;  1KIL C;  1H88 A;  2N1T B;  1RF1 B;  1FZC C;  1ZV8 A;  3M06 A;  2C0W A;  1KIL B;  1FZC B;  1LWU B;  3VMZ A;  1NU1 K;  5AW1 B;  2XDJ A;  1DX7 A;  1HVV A;  2NPS C;  3BAS A;  3HRN A;  2A45 G;  2PP6 A;  1MUU A;  1RF0 A;  3L35 A;  1H89 A;  4LGD E;  1MZ9 A;  4XA4 A;  1JY2 N;  5APW A;  1LT9 B;  1L0N K;  3EQ2 A;  4GT1 A;  4DZO A;  1HGV A;  1N2D C;  3RL0 B;  3V2R A;  5AW8 B;  1LWU A;  4WY4 B;  5APX A;  1MFZ A;  4WB4 A;  1SLQ A;  1GD2 E;  2KP8 A;  1SQP K;  2PAJ A;  4HYT B;  1URQ A;  2WPQ A;  3SWF A;  3NTN A;  1LTA C;  2WSE H;  3GHG B;  3HE4 A;  5BU8 B;  4Y99 C;  2H43 A;  5CHX A;  3VYI A;  1IFN A;  5AW4 B;  1IFD A;  3GHG A;  3VMY A;  5AVR B;  2H8P D;  2NPS B;  2OAR A;  1JCC A;  4C7R A;  2W6A A;  1SFC B;  1OXZ A;  1J1D C;  4DOJ A;  1FJP A;  1M1J B;  2KLV A;  1KQL A;  1CI6 B;  3VOP A;  3TNU A;  1LTI C;  2MJZ A;  2E42 A;  3V2P A;  3P8C D;  2Z5H A;  2FKW B;  2WTY A;  3PP5 A;  1RY3 A;  1T8Z A;  3VMX A;  2WPS A;  2QM8 A;  5KJ7 D;  2OYI B;  1GU4 A;  3V4Q A;  3RK3 C;  2WT7 A;  1URQ B;  2R32 A;  2FYU K;  1G1I A;  4XE5 B;  1NHL A;  1JY3 P;  1NH4 A;  3OAK A;  1JUN A;  1HWT C;  2N9B A;  3RK2 B;  1GW4 A;  3A3Y B;  4W7Z A;  1IFI A;  1YTZ I;  4N78 E;  3NXS A;  1FOS F;  5APT A;  1FZE A;  1GL2 B;  4N3Y B;  3A2A A;  5KJ7 A;  1FU1 A;  1NTZ K;  4EIJ A;  4I6M C;  1L0L K;  4IFF A;  4N6J A;  1FDM A;  2YO2 A;  1G2C B;  3II6 A;  5KTB A;  2HOD A;  4GIF A;  5CCH A;  1A02 J;  3KPE A;  2YMY A;  2P7J A;  3CLQ A;  3A5T A;  5CCG A;  1JTH B;  2P2U A;  1N73 A;  3H32 B;  4O9B A;  2I1J A;  3UIA A;  1N73 C;  3TK1 A;  2BAS A;  2YO3 A;  3B5N B;  2IFN A;  1G1J A;  5CCH D;  3L36 A;  2FYZ A;  2E43 A;  1LTG C;  1N7S D;  2J58 A;  5AVW B;  1N7S B;  4M3L A;  1S9K D;  1GTW A;  4ZKU A;  1WT6 A;  3OA7 A;  3TSI A;  4KHX A;  2HPC A;  1J1E C;  3HE5 B;  3SWY A;  1FZG A;  2XZR A;  3VTP C;  4C7N B;  2W27 A;  2HFE D;  1SQQ K;  1KZU B;  1L4A B;  4HH2 A;  1W2E A;  2POH A;  2JEE A;  5AW7 B;  1FZA A;  1LTJ C;  3H32 A;  4AYC A;  3M9Q A;  1JY2 P;  3HUS C;  3L37 A;  3CI9 A;  4AQR D;  1JO5 A;  1LTJ A;  5KLV K;  5CJ4 A;  5BU5 A;  1JMM A;  2Z4E A;  1KIL D;  3N4X A;  3MD0 A;  1SVF A;  5AW0 B;  3M91 A;  5CJ0 A;  3G3Z A;  1ZN5 A;  1ZLL A;  1EQ7 A;  5AVV B;  3C9I A;  2KB7 P;  1GDT A;  1L4A D;  2IFM A;  1AFO A;  5APS A;  3VN0 A;  3VP8 A;  3KQG A;  2C9N Y;  1VDF A;  3LW5 H;  1HTL C;  4IFM A;  1DEB A;  1FAV A;  1HUC A;  1HJB A;  4WY4 D;  2I1K A;  3TYY A;  4I1L A;  1ZR2 A;  3RL0 D;  1JY3 O;  1J2J B;  3P32 A;  1HH0 A;  3V4W A;  2JJL A;  3CL3 D;  2OYH B;  2WSF H;  1JY2 O;  1QL2 A;  3OJA B;  3B5N D;  1HGZ A;  2O1K A;  2IX7 C;  1CW5 A;  3HUS B;  2YKP A;  4I2L C;  4W7Y A;  5AW2 B;  1JY3 N;  1FBM A;  1H8A A;  2Q3I A;  4LC1 A;  4WY4 A;  5AVQ B;  1PFI A;  1GL2 C;  1NKN A;  1X79 B;  3HD7 D;  1NWQ A;  3WMM 0;  2Q7C A;  1GL2 A;  1IFM A;  3MGN A;  3U1A A;  1A02 F;  4JYC A;  3MIW A;  1FZB A;  5AW9 B;  5CCG D;  1URQ C;  2OYI C;  1GW3 A;  3HE4 B;  2FFD C;  1SQV K;  2XKM A;  1YYC A;  1LTT C;  2OYH C;  2CPB A;  5CMZ A;  5AW6 B;  1WRG A;  2HYN A;  2KOG A;  3BAT A;  3HE5 A;  1SQB K;  1LTS C;  3HTK B;  4RES B;  2Z5I A;  2A45 H;  4OH8 B;  1CI6 A;  4JYB A;  1J1E B;  1SFC D;  4EOT A;  4GKG A;  5AVT B;  2VRS A;  2CPS A;  1LWU C;  3KYQ A;  2GM4 A;  3A7O A;  5KJ7 C;  1CZQ A;  1N7S C;  2P67 A;  4LLH A;  1KFM A;  3BRT B;  5AVZ B;  1AQ5 A;  5BVZ A;  1RE4 C;  3VP9 A;  1SFC A;  3V2N A;  3R2P A;  2H7H A;  1N7L A;  3RK2 D;  3O8Z A;  4N78 D;  3KDP B;  2WPR A;  2HOD B;  4IFD K;  2WT7 B;  1LTJ B;  2P1J A;  1LT9 A;  1G2C A;  1L4A C;  2C9L Y;  1E5W A;  2GUS A;  3RK3 B;  3MUD A;  2OYH A;  1L4A A;  1IK9 A;  1X9V A;  1KFN A;  5AVY B;  2M3B A;  2WZ7 A;  3NFQ A;  2R5D A;  3IFM A;  2FFD B;  4W80 A;  1RE4 A;  2A45 I;  2N1T C;  1RF1 C;  1IC2 A;  2HLO A;  3NMD A;  2O1J A;  4B86 A;  1J1D B;  4AUW A;  1QL1 A;  1VPC A;  3B5N A;  2J59 M;  1NOH A;  1N86 A;  2WIT A;  3P7K A;  1GU5 A;  2OYI A;  5AW5 B;  2IPP A;  2O01 H;  3V2Q A;  1HBW A;  2ZXE B;  3B8E B;  5APV A;  1GK4 A;  5APU A;  5AVX B;  4C46 A;  1T2K C;  3MTU E;  1N7S A;  1T2K D;  5CCH C;  1ZR4 A;  2WSC H;  1M7L A;  3IR9 A;  4WBA A;  2YKO A;  3M0A A;  1M1J C;  2LKM A;  1SFC C;  1JOC A;  1DH3 A;  2L5G B;  3HUS A;  1IO4 A;  3TNU B;  1RE3 A;  1GL2 D;  1OWA A;  1JTH A;  2HG5 D;  3GHG C;  3P8C E;  1CSB A;  2FXM A;  1IFJ A;  5APY A;  3RK2 C;  2N1T A;  1RF1 A;  3HD7 B;  2N1T D;  3LIE A;  2R3C A;  1NKZ B;  2R5B A;  1S9K E;  3M9H A;  1NTK K;  3U59 A;  4ZKP A;  3B5N C;  3LID A;  1URQ D;  1JCD A;  5CCG C;  1N73 B;  2QM7 A;  3N7N A;  1SP4 A;  1X8Y A;  3RL0 C;  1JNM A;  2C0X A;  4JF7 A;  1FZF A;  1LT9 C;  3P8M C;  3HD7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...