2HODA

Crystal structure of fragment d from human fibrinogen complexed with gly-hydroxypro-arg-pro-amide
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
74
structure length
74
Chain Sequence
IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting/peptide
molecule keywords Fibrinogen alpha chain
total genus 19
structure length 74
sequence length 74
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2006-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hodA00
2XNXA 1M1JB 1FZEA 1W2EA 3H32A 1FZCA 2A45G 1LWUB 1RE4C 1FZBA 2HLOA 1RE3A 3H32B 3BVHA 2HODA 2OYIC 1LWUA 1N86A 3HUSA 1FZCC 2OYIB 1FZCB 2OYHA 1N73A 3GHGB 1FZAA 1RE3C 2OYIA 2HODB 2OYHB 2H43A 1JY3O 1JY2O 1M1JA 1JY3P 1LT9C 1FZFA 1T3UA 1RF1C 2HPCB 1LTJA 1RF0C 1LT9B 3GHGC 1LTJB 3HUSB 1JY3N 1JY2N 1LTJC 2HPCA 1N73B 1RF1A 2FFDB 1LT9A 1RF1B 1FZGA 1M1JC 1RF0A 3GHGA 3HUSC 2FFDC 1RE4A 1JY2P 2Q9IA 2Z4EA 1N73C 2A45H 2FFDA 3E1IA 2A45I 1LWUC 2OYHC
chains in the Genus database with same CATH superfamily
2KXPB 1IJDB 1JMMA 2KNCB 3Q5PA 3CC4P 3D70A 4N78D 1SQBE 1LWUB 2QM7A 4H13C 1FZCC 5B5EE 2XV5A 1PP9G 1PZQA 1BGYG 3H1KJ 1N8RQ 3T97A 2E76D 2JP3A 1NWQA 1GZLA 2KI7B 2Y9ZA 4DZOA 1DD3A 3F5HA 1VQ8P 3KHUA 2K88A 3IR9A 1BDDA 3CCJP 3L74G 1KILE 2B87B 2L91A 3LIDA 1SQVD 1IFIA 2KS1A 4WY4B 3K5BA 3VMZA 1OMIA 5GTIE 1DD4A 1LT9A 1NTZK 5CCHA 1FOSE 1SVFA 2ZVOB 1KTMA 2D2CC 1VL2A 5APTA 1K04A 4PV1B 3B5ND 1AQTA 3CXHE 2Y9YA 1XTCC 2JWDA 1FOSF 3L73E 1NH4A 2YNYA 3HUSC 1SQXD 2H88C 1Q2NA 1HJ0A 2J5UA 4D6TJ 1MUUA 2FKWB 1W2EA 3G71P 3CCUP 2A45G 1T2KD 1M1KQ 1L0LD 1YQ4C 1FZBA 4GOEA 2N1TC 1NVOA 2YIUC 2XZRA 4XFJA 3PJSK 1YI2P 2P7JA 1NAFA 4DOJA 1LTIC 3OW2O 3M0AA 3PLNA 3V2NA 1N73B 4WY4C 1W5CE 1E79H 2W6JH 3HE5B 1VF5C 1FE6A 3L4FA 1RF1C 3MUDC 1PFIA 1KMIZ 1LNQA 4UB8H 2R3CA 1KILB 1RH5B 3AE5C 1VF5B 3O6QA 1AA0A 4IL6H 4PJ0H 1JY3N 1S5LX 1LTJC 4YTPC 2K1AA 2WPVB 2GUSA 4HH2A 1PIXA 3CWBG 2OYHC 3EFFK 5APQA 1VQOP 1T6AA 1J2JB 2JR8A 5AVVB 2W8ZA 1KQFB 1RF0A 2OQQA 2MKVA 1PP9D 3B5NA 1URQD 2Z4EA 3AEBC 1VQKP 2UWJE 3W68A 1SQXK 3CMEP 1S3JA 1G1JA 2FYUJ 3ABVC 3BVHA 3I5CA 3RK3B 1FZCB 1IO4A 5AW4B 2QJKC 1WT6A 4UB6H 2YXRB 1VQ4P 2AEFA 3GHGB 2K9JA 2NZ2A 1NU1J 3RBXA 1VQ9P 1HTLC 4IL6X 3RK2B 1SQQD 2IZ1A 2KZIA 2XU6A 1D7MA 5B66H 3CCQP 2Z5IA 1Q86Q 2JEEA 2H7HA 1VQ7P 2I8DA 2GA1A 3PRJA 3Q5RA 3AEAC 3W67A 4GOFA 5AVYB 4JF7A 1SQVJ 3ZDMA 2FYNC 2Y0DA 3Q3DA 4NPFX 1KYOI 2IBZE 1GDTA 1SQXG 1QEXA 2B89A 1JY2N 2WVRA 3B4SA 3A2AA 3C9IA 3JC22 1UIIA 4PD4D 1KFNA 3BCCE 3FXEA 4JQ0D 3ITKA 1HWTC 3KXDA 1GK6A 3SFDC 2ZFCA 1H0TB 2KB7P 1RF1A 3VOPA 4L76A 2B87A 2A45I 3N4XA 2KOGA 3GLMA 4PD4I 1NU1D 2J58A 2O01H 3L72J 3L74E 4C7RA 1OW8A 1BDCA 1CI6B 1IFJA 1MFZA 1RE4C 2NPSA 4WBAA 3L75E 2FXMA 1DEBA 1QVGO 2BASA 3H1KE 1UIXA 1S5LE 1YTZT 1URQA 2G8YA 1KYOE 2IBZI 2QRXA 3CX5H 3H1HD 3H1JD 3QH9A 1LTGC 3TK1A 1KB9H 2G3AA 2WT7B 2K9YA 2M3EA 1T3UA 5TJHA 2C9NY 1NTKE 1SFCA 3FGAD 1Z56A 3L70G 4I2LC 4LC1A 1RQVA 2QVAA 3L73G 1RF0C 4XA4A 2Q7CA 3VTPC 5CCGD 1Q90D 5KLVD 1NKNA 2E43A 1KORA 3O8ZA 5KJ7D 1AV1A 2KS1B 1SFCC 1CI6A 1NTZG 3FX0A 2L5GB 4YPCA 3H1IJ 5APUA 2D2CB 2CPBA 1NO4A 2R5DA 3MUDA 1PPJD 3C8VA 1A02J 2R32A 2ZVNB 1PV3A 2YKOA 3L71E 4C7NB 4AUWA 5KLVG 1GMJA 3AE2C 3CD6P 1EZVI 1HGZA 2IYPA 2ZXEB 3H32B 3V2RA 2W6AA 1JCDA 1KB9D 2BCCJ 2WMMA 1P84I 2KP8A 2LR2A 2AXTH 1L0LJ 1SQBG 2RKLA 2IFNA 3GW6A 3SWKA 2QJYB 1EC5A 1EDIA 2HODB 4O9BA 1KN7A 3M9HA 1FJKA 5AVTB 1L0NJ 2H43A 4EOTA 3OA7A 4H44B 3H1HJ 4OWFA 1FS0E 1NTME 3QWOC 5DJUB 3JCUH 1LTSC 2FYNB 3GMAA 1S1CX 1NHLA 5AW5B 3C1LA 4IFMA 4A7PA 4KJMA 1X8YA 1NOHA 4H44D 1URQC 2AXCA 2HFED 5AVRB 1BCCG 1SQBK 1EZVE 1SQVE 3G6EP 3MTUE 4Y28J 1ZMEC 1VPCA 2WPQA 5APWA 2ZYGA 4EIJA 1P84E 1IFNA 2KNCA 3L75J 1RHZB 3M0DC 3MGNA 2GUVA 1HUCA 1NYHA 2BEQD 2XNDH 3B5NB 2N1TA 3JCUE 4PD4H 3RGUA 5KLIB 3CCEP 4EDFA 3H32A 4KHXA 2KSJA 4JPZB 1EXJA 2YMKA 1FC2C 4R4LA 3FWLA 1L4AA 2CPSA 3HE4B 5GTIH 1M90Q 2N9BA 3HUSA 1SQXE 3RK2D 3U1AA 1EQ7A 5KJ7A 1J1DB 1N7SD 1GL2A 1ZRTE 3FWNA 2QEXP 3RK3D 1JY3P 4BRYB 4GT1A 1X79B 3CCVP 1OWAA 2E74D 1YJNP 1DH3A 1IK9A 2A06E 1LTJA 2IX7C 1YIJP 3SFEC 1AVYA 4U7JA 4I7ZC 5APXA 1OX3A 3UIAA 2M3BA 1SQPJ 4ASWA 4BXLA 1T8ZA 3GF3A 4JYCA 1GU4A 1OVVA 1SQBD 3IF4A 5BU5A 3H1LG 2N1TB 3S9OA 1BE3D 2YKQA 2D2CD 4HYTB 4OH8B 3CCSP 1M1JB 3B5NC 3WMM0 1W2BO 2KSEA 1N7SB 1YHQP 1L4AD 1BGYJ 3L70D 1T2KC 1BSNA 3LIEA 5APSA 5DJTB 5APYA 1LT1A 1IFMA 2N1TD 2JDIH 3H6PA 1KFMA 1JOCA 2CK3H 1SFCD 5CCHC 5AW8B 2SPZA 1G1IA 3HD7D 3CC2P 3CXHD 1IC2A 2JJLA 1G2CB 5CJ0A 2FFDB 1GTWA 2M0BA 2NRGA 1BCCD 2O01J 1J1EB 2PGDA 1JCCA 2B88A 2C0XA 1L0LE 2IBZD 3G4SP 3CPWO 1JY2P 1S4XA 4D6TE 1ZR2A 1N73C 4H13B 3HTKA 4OGQD 2WTYA 1LWUC 3AE8C 3BCCD 1NTZD 5KLVK 4I6MC 1FZCA 1KQLA 2YKPA 2OYIC 1BE3G 3II6A 3L71G 4QMAA 4ZMDA 3B71A 3A5TA 3FXDA 5KAIH 1HF9A 1LWUA 1N86A 1RY3A 3AE4C 3AE6C 3P7KA 3AE9C 1HVVA 1N73A 2MJZA 3L72E 1Q82Q 1S9KE 2R5BA 3H1JG 1USDA 4K35A 1AJYA 1BGYD 2QSIA 3WUVA 2YIUB 3VP8A 2POHA 4H44C 4HJGH 3E7KA 1OW7A 2E75B 3H1KD 2K37A 1KYOD 1IFPA 3MZWB 3TGUD 3HUSB 3I55P 3RBZA 1AQ5A 2AXTE 1DIPA 3U1CA 3TNUA 2E42A 5KLVE 3H1LD 4ZKUA 2WITA 1HGVA 1JTHA 1K05A 1CZQA 5AVXB 5CJ4A 3SWFA 1GL2C 2QJPB 3CWBD 2Q3EA 2RN0A 4DCKA 3BCCJ 1Q7YQ 1H88A 4Y99C 2O1JA 3M9BA 3RK3C 3L71D 3V4WA 1NU1G 2OYHB 2Q1KA 5AW6B 3KYQA 1SQPE 1NTKG 2FY8A 2XDJA 1GK4A 1P84H 1JY3O 5AW0B 3VMYA 4PD4E 1GU5A 2QJYC 2QM8A 2FXOA 2ZT9D 3A0BH 2P67A 2H8PD 2H89C 1M8OB 3TNUB 4I7ZB 1EZVG 1JB0J 1NTMD 4PV1C 1GL2B 2QJPC 3KQGA 2FYUE 1VQMP 1NU1E 3F89A 1FZGA 4W7ZA 1MFTA 2PRRA 4L73A 1AFOA 2QJKB 5KJ7C 3T97B 2Y0EA 3MP7B 3V4QA 1L0NE 3RL0g 3NMDA 2XNXA 3P8CE 1L4AC 1KD1Q 2W27A 3L72G 1EZVD 1X22A 2C0WA 2O3JA 4LLHA 4WVZA 4YXWH 1CW5A 1E5WA 1G2CA 5L8RJ 2FFDA 2HODA 4WY4A 2P58A 2OYIA 2FYZA 3IAOA 1H0TA 2Q5UA 1A02F 4RESB 3S4RA 4WB4A 2ZYAA 2OYOA 1SQQK 2I1JA 3MHVA 1JY2O 4GIFA 4IFFA 4RJTA 1KILC 1SQVK 4C7NA 1N2DC 1USEA 4U3FG 3L73J 3I56P 1YJWP 3GHGC 2HG5D 1NTMJ 3OJAB 4L74A 1X0TA 1R5LA 2PFXA 5CMZA 5K5GB 2AEJA 3WUUA 1NKZB 4B86A 1M1JC 2WPRA 3H1ID 2HYNA 1QLED 1KQSO 5TISE 2BCCE 3BRTB 3A3YB 4WWIA 3TGUJ 1SQQG 1TU3F 3VP9A 5KLVJ 2E5TA 1S2EA 3RL0B 2AEMA 1JEKA 1MZ9A 2FXPA 1U7MA 3AECC 4UB8E 4PJ0E 1L2PA 5AVSB 4W80A 2BCCG 2OYIB 1OZHA 1L0LG 1SQBJ 4AQRD 1BE3E 1PP9J 3H1KG 3NFQA 3RL0D 3M0DA 5BVZA 3AEGC 1EDLA 5TISH 5CBNA 3H1HG 2OTJP 3L74J 1EDKA 3RK2C 1FJPA 1R5SA 3KDPB 1K73Q 3WU2H 2YMYA 1M56D 3L35A 3L70E 2W6BA 1N7SC 1YYCA 1SFCB 3O6QB 1S72P 1GW3A 3A0HE 1OIPA 1PGJA 2R44A 2HPCA 1EXIA 4N6JA 2E74C 3HE4A 1Y8AA 3H25A 2V4HA 2LXCB 1S5LH 1BCCJ 1OW6A 3EFGA 3CC7P 1GL2D 1ZW0A 1N7SA 2E74B 2LXBA 4GDOA 5C39A 5B66E 3L75G 4GKGA 5KTBA 1VQLP 3NXSA 4C46A 3E1IA 1YJ9P 3D6YA 4D6TG 3WU2E 1FU1A 4BRYA 4DT0A 5KAFE 3CCLP 1LTTC 1M57D 5AW2B 3D71A 1LP1B 1BSHA 3A0HH 4TLFA 1ZRTD 1ZOYC 2M5AB 3TDKA 3RK3E 3Q1MA 2I1KA 2K9JB 1NAYA 1Y9BA 3AEEC 3L73D 1EDJA 1K8AQ 2DW3A 3BATA 2ZT9C 2E5YA 2ZJSE 3L37A 1L0NK 1NU1K 4K3AA 4U3FE 4XE5B 3R2PA 3GG2A 3TYYA 1IK7A 2OTKE 3P8MC 1NTKK 2WSCJ 3CXHI 3LW5J 1QGKB 3PP5A 3L36A 4R4MA 3CCMP 4PV1D 1FZFA 1QVFO 4L75A 1IFDA 2HPCB 1S9KD 3CX5D 1BGYE 1KQGB 2PAJA 1OFCX 1HBWA 1SQPG 3CWBJ 1GW4A 2IZ0A 3GF7A 5CCHD 2WQYC 2A06G 4HKZH 2GM4A 4HB1A 1U57A 3GHGA 3HD7C 4N78E 5KLIC 4KT0J 2KYVA 3H1LJ 3E1RA 3AE7C 1LJ2A 1LP1A 1ZLLA 3CLQA 3V5BA 4UB6E 3A0BE 3V6IA 1K9MQ 1FZEA 5KKZC 1FDMA 3WUTA 2FYUG 2KIKA 3HD7A 1LGHB 2WSCH 3H1LE 3LW5H 4OGQC 1IZNB 1KILD 2OGUA 1OVRA 3AE1C 2ZYDA 3CWBE 4U3FD 3AE3C 2XKMA 2N9YB 4LGDE 1SS1A 2WT7A 3KPEA 3BASA 3R4YA 1YTZI 4MN4C 2WSEJ 3V2QA 1R8EA 1GD2E 1BCCE 1SQVG 3EWKA 5CBOA 5E79H 1VQNP 1SQPD 2OTLP 1LTJB 1SQXJ 5APVA 4D6TD 2K3RA 1H8AA 1KILA 1OXZA 2JWAA 4M3LA 3VN0A 1DX7A 1NTZE 1RF1B 4ZNCA 1WMKA 2WSFH 3M91A 1VQ6P 1PGQA 3MD0A 2E75D 5BU8B 1RE4A 2NPSC 5AVQB 1H89A 3M06A 4RO0A 2A45H 4H0LC 2FYUD 3L72D 3RL0C 5E79E 1BE3J 1SLQA 3L71J 2HLOA 2ITAA 2KK7A 1ZXGA 2P1JA 2QA4P 2HR3A 2OYHA 1L0LK 3P8CD 2J59M 1JNMA 3NTNA 3H1JJ 1XTGB 5CCGA 3N7NA 3TGUE 3AEFC 3HTKB 3IN6A 3CXHH 4H13D 1HH0A 4OGQB 1M1JA 5AW1B 5AW9B 2Y0CA 1LT9C 1T3JA 1PL5A 2KUBA 2E76C 4GODA 2RMZA 2QIWA 3L70J 3H1JE 1U7JA 3KZIE 3CCRP 1LT9B 2WZ7A 1PP9E 1MKMA 4JBZA 2VRSA 3BRVB 3USSA 3PH0A 4NPEA 4EYYQ 2JKVA 3HD7B 3JSVC 2IFMA 2IBZG 3U59A 1NTZJ 2YXQB 3Q2YA 4RKUJ 1JUNA 3H1IG 1ZP0C 1PGPA 1FBMA 2B9BA 2LKMA 2YO2A 3VMAA 1PPJG 4AYCA 3CMAP 1KV4A 2ZXXA 1YBKA 2Q6QA 4W7YA 1YITP 2IPPA 2R3SA 2V7QH 4TT3H 1Q81Q 4IFDK 1KZUB 2PP6A 3KZIH 1L4AB 3H1IE 1SQQE 2BEZF 3TSIA 3V2PA 3BCCG 4H0LB 4IL6E 1FDIA 2BCCD 3G3ZA 2IDBA 2NPSB 1FAVA 1QX8A 3D6ZA 1RE3C 3OAKA 1NGMB 2Z5HA 5CCGC 1QL1A 1LTBC 1L0NG 1NTKJ 4ASVA 3HE5A 5H2FH 2WPSA 3AEDC 3M9QA 1M7LA 3HRNA 1QL2A 3A7OA 4OVNF 3MIWA 5AW7B 3EQ2A 2RH0A 3VMXA 5KAFH 3P32A 1SP4A 4NPDA 3Q5SA 2YO3A 5KAIE 2KZJA 3CL3D 1VF5D 1L0ND 1J1EC 1SQPK 1Y47A 1FDOA 2KLVA 2WSSH 3PHLA 1KYOH 3L74D 4YXDC 1X9VA 4DJGA 5GTHE 2FFDC 3TF5A 5H2FE 4Y99B 3L75D 5EFWB 4EI2A 3G9RA 2O01N 4H0LD 4BWNA 1HJBA 1RQUA 5KKZB 1NTMK 4IOIH 2WSFJ 3S1KA 4Z1MH 2ZT9B 5CHXA 1ZN5A 1ZV8A 2IYOA 2W90A 3H1HE 3CX5I 3IFMA 5M1BA 1P84D 1RE3A 2FYUK 1KB9I 4ZKPA 4CPGA 2P10A 3CI9A 5AW3B 1JO5A 3PTZA 1NTKD 1FZAA 1J1DC 2E76B 2QE7H 2WWWA 1JTHB 5GTHH 2WSEH 2QG4A 3VYIA 1VQPP 2O1KA 5AVUB 5AVWB 1N7LA 4JYBA 2C9LY 1KC8Q 1CSBA 1YQ3C 3SSUA 1PGOA 2Q3IA 2FBWC 4U3FJ 2W83C 1DEEG 1VDFA 2V7QJ 1NTMG 2ZAEB 2E75C 2KLUA 2NPSD 1PPJE 2P2UA 4N3YB 3B8EB 1ZR4A 5B5EH 1NJIQ 2JO1A 1WRGA 4WY4D 1AVOA 1JM0A 2OARA 1OVUA 3SWYA 2M5AA 1JMBA 2A06D 3CX5E 5AVZB 1KB9E 1LTAC 1URQB 2M8RA 4I1LA 1VQ5P 2Q9IA 3TGUG 1SQQJ 1MV8A
chains in the Genus database with same CATH topology
1IJDB 1JMMA 4N78D 1LWUB 2QM7A 1FZCC 2XV5A 1NWQA 3T97A 1GZLA 4DZOA 3IR9A 3LIDA 1IFIA 4WY4B 3VMZA 1LT9A 1NTZK 5CCHA 1FOSE 1SVFA 5APTA 3B5ND 1XTCC 1FOSF 1NH4A 2YNYA 3HUSC 1MUUA 2FKWB 1W2EA 1T2KD 2A45G 1FZBA 2N1TC 2XZRA 2P7JA 1NAFA 4DOJA 1LTIC 3M0AA 3V2NA 3HE5B 3L4FA 1RF1C 2R3CA 1KILB 5AW8B 3SWYA 1JY3N 5CCGA 1LTJC 4HH2A 2GUSA 5APQA 1J2JB 5AVVB 1RF0A 3B5NA 1URQD 2Z4EA 1SQXK 1G1JA 1IO4A 3BVHA 1FZCB 3I5CA 3RK3B 5AW4B 1WT6A 3GHGB 1HTLC 3RK2B 2XU6A 2Z5IA 2JEEA 2H7HA 5AVYB 4JF7A 1GDTA 1JY2N 3C9IA 3A2AA 1KFNA 1HWTC 1GK6A 2ZFCA 2KB7P 3VOPA 2A45I 3N4XA 2KOGA 2J58A 2O01H 4C7RA 1CI6B 1IFJA 1MFZA 1RE4C 2NPSA 4WBAA 2FXMA 1DEBA 2BASA 1YTZT 1URQA 3TK1A 1LTGC 2WT7B 1T3UA 1SFCA 1Z56A 4I2LC 4LC1A 3VTPC 5CCGD 4XA4A 1RF0C 2Q7CA 2E43A 1NKNA 5KJ7D 3O8ZA 1SFCC 1CI6A 2L5GB 2CPBA 1NO4A 2R5DA 3MUDA 1A02J 2R32A 4AUWA 4C7NB 2YKOA 1HGZA 2ZXEB 3H32B 3V2RA 2W6AA 1JCDA 1JNMA 4GT1A 2OYIC 2KP8A 2IFNA 2HODB 4O9BA 3M9HA 1FJKA 5AVTB 2H43A 4EOTA 3OA7A 1LTSC 1NHLA 5AW5B 4IFMA 1X8YA 1NOHA 1URQC 2HFED 5AVRB 1SQBK 3MTUE 1VPCA 2WPQA 5APWA 4EIJA 4IFDK 1IFNA 3M0DC 3MGNA 4WY4C 2GUVA 1HUCA 3B5NB 1DX7A 2N1TA 3H32A 4KHXA 2KSJA 3HE4B 1L4AA 2CPSA 2N9BA 3HUSA 3RK2D 3U1AA 1EQ7A 5KJ7A 1J1DB 1N7SD 1GL2A 3RK3D 1JY3P 1X79B 1OWAA 1DH3A 1IK9A 1LTJA 2IX7C 5APXA 3UIAA 2M3BA 1T8ZA 1GU4A 4JYCA 5BU5A 2N1TB 2YKQA 4HYTB 4OH8B 1M1JB 3B5NC 3WMM0 1N7SB 1L4AD 1T2KC 3LIEA 5APSA 5APYA 2N1TD 1IFMA 3H6PA 1KFMA 1JOCA 1SFCD 5CCHC 1G1IA 3HD7D 1IC2A 2JJLA 1G2CB 5CJ0A 2FFDB 1GTWA 1J1EB 1JCCA 2C0XA 1ZR2A 1JY2P 1N73C 3HTKA 2WTYA 1LWUC 5KLVK 4I6MC 1FZCA 1KQLA 2YKPA 3II6A 3A5TA 1LWUA 1N86A 1RY3A 3P7KA 1HVVA 1N73A 2MJZA 1S9KE 2R5BA 3VP8A 2POHA 3HUSB 1AQ5A 3U1CA 3TNUA 2E42A 4ZKUA 2WITA 1HGVA 1JTHA 1CZQA 5AVXB 5CJ4A 3SWFA 1GL2C 1H88A 4Y99C 2O1JA 3M9BA 3RK3C 3V4WA 2OYHB 5AW6B 3KYQA 5AW0B 2XDJA 1GK4A 3VMYA 1JY3O 1GU5A 2QM8A 2P67A 2H8PD 3TNUB 1GL2B 3KQGA 1FZGA 4W7ZA 1AFOA 5KJ7C 3V4QA 3NMDA 2XNXA 3P8CE 1L4AC 2W27A 4LLHA 2C0WA 1CW5A 1E5WA 1G2CA 2FFDA 2HODA 4WY4A 2OYIA 2FYZA 2Q5UA 1A02F 4RESB 4WB4A 1SQQK 2I1JA 4GIFA 1JY2O 4IFFA 1KILC 1SQVK 4C7NA 1N2DC 1PFIA 3GHGC 2HG5D 3OJAB 5CMZA 1NKZB 4B86A 1M1JC 2WPRA 2HYNA 3BRTB 3A3YB 3VP9A 2OYHC 3RL0B 1MZ9A 5AVSB 4W80A 2OYIB 4AQRD 3NFQA 3RL0D 3M0DA 5BVZA 1FJPA 3RK2C 3KDPB 2YMYA 3L35A 2C9NY 2W6BA 1N7SC 1YYCA 1SFCB 1GW3A 2HPCA 4N6JA 3HE4A 3EFGA 1GL2D 1N7SA 5KTBA 4GKGA 3NXSA 4C46A 3E1IA 1FU1A 1LTTC 5AW2B 2I1KA 3BATA 3L37A 1L0NK 1NU1K 4XE5B 3R2PA 3TYYA 3P8MC 5APUA 1NTKK 3PP5A 3L36A 1FZFA 1IFDA 2HPCB 1S9KD 2PAJA 1HBWA 1GW4A 5CCHD 2GM4A 3GHGA 3HD7C 4N78E 2KYVA 1ZLLA 3CLQA 3V5BA 1FZEA 1FDMA 3HD7A 1LGHB 2WSCH 3LW5H 1KILD 4LGDE 2WT7A 3KPEA 3BASA 1YTZI 3V2QA 1GD2E 1LTJB 5APVA 1H8AA 1KILA 1OXZA 4M3LA 3VN0A 1RF1B 2WSFH 3M91A 3MD0A 5BU8B 1RE4A 2NPSC 5AVQB 1H89A 3M06A 2A45H 3RL0C 1SLQA 2HLOA 2P1JA 2OYHA 1L0LK 3P8CD 2J59M 3NTNA 1XTGB 3N7NA 3HTKB 5AW9B 1HH0A 5AW1B 1M1JA 1LT9C 1T3JA 1LT9B 2WZ7A 2VRSA 3BRVB 1N73B 1RF1A 3HD7B 2IFMA 3U59A 1JUNA 2LKMA 1FBMA 2YO2A 4AYCA 4W7YA 2IPPA 1KZUB 2PP6A 3V2PA 1L4AB 3TSIA 3G3ZA 2NPSB 1FAVA 1RE3C 3OAKA 2Z5HA 5CCGC 1QL1A 1LTBC 3HE5A 2WPSA 5AW7B 3M9QA 1M7LA 3HRNA 1QL2A 3A7OA 3MIWA 3EQ2A 3VMXA 3P32A 1SP4A 2YO3A 3CL3D 1J1EC 1SQPK 2KLVA 1X9VA 2FFDC 4Y99B 1HJBA 1NTMK 5CHXA 1ZN5A 1ZV8A 3IFMA 1RE3A 2FYUK 4ZKPA 3CI9A 5AW3B 1JO5A 1FZAA 1J1DC 2WWWA 1JTHB 3VYIA 2WSEH 2O1KA 5AVUB 5AVWB 1N7LA 4JYBA 2C9LY 1CSBA 2Q3IA 1VDFA 4N3YB 2NPSD 2P2UA 1ZR4A 3B8EB 1WRGA 4WY4D 2OARA 5AVZB 2Q9IA 1LTAC 1URQB 2M8RA 4I1LA 2XKMA 1MV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XNX A;  1M1J B;  1FZE A;  1W2E A;  3H32 A;  1FZC A;  2A45 G;  1LWU B;  1RE4 C;  1FZB A;  2HLO A;  1RE3 A;  3H32 B;  3BVH A;  2HOD A;  2OYI C;  1LWU A;  1N86 A;  3HUS A;  1FZC C;  2OYI B;  1FZC B;  2OYH A;  1N73 A;  3GHG B;  1FZA A;  1RE3 C;  2OYI A;  2HOD B;  2OYH B;  2H43 A;  1JY3 O;  1JY2 O;  1M1J A;  1JY3 P;  1LT9 C;  1FZF A;  1T3U A;  1RF1 C;  2HPC B;  1LTJ A;  1RF0 C;  1LT9 B;  3GHG C;  1LTJ B;  3HUS B;  1JY3 N;  1JY2 N;  1LTJ C;  2HPC A;  1N73 B;  1RF1 A;  2FFD B;  1LT9 A;  1RF1 B;  1FZG A;  1M1J C;  1RF0 A;  3GHG A;  3HUS C;  2FFD C;  1RE4 A;  1JY2 P;  2Q9I A;  2Z4E A;  1N73 C;  2A45 H;  2FFD A;  3E1I A;  2A45 I;  1LWU C;  2OYH C; 
#chains in the Genus database with same CATH topology
 2KXP B;  1IJD B;  1JMM A;  2KNC B;  3Q5P A;  3CC4 P;  3D70 A;  4N78 D;  1SQB E;  1LWU B;  2QM7 A;  4H13 C;  1FZC C;  5B5E E;  2XV5 A;  1PP9 G;  1PZQ A;  1BGY G;  3H1K J;  1N8R Q;  3T97 A;  2E76 D;  2JP3 A;  1NWQ A;  1GZL A;  2KI7 B;  2Y9Z A;  4DZO A;  1DD3 A;  3F5H A;  1VQ8 P;  3KHU A;  2K88 A;  3IR9 A;  1BDD A;  3CCJ P;  3L74 G;  1KIL E;  2B87 B;  2L91 A;  3LID A;  1SQV D;  1IFI A;  2KS1 A;  4WY4 B;  3K5B A;  3VMZ A;  1OMI A;  5GTI E;  1DD4 A;  1LT9 A;  1NTZ K;  5CCH A;  1FOS E;  1SVF A;  2ZVO B;  1KTM A;  2D2C C;  1VL2 A;  5APT A;  1K04 A;  4PV1 B;  3B5N D;  1AQT A;  3CXH E;  2Y9Y A;  1XTC C;  2JWD A;  1FOS F;  3L73 E;  1NH4 A;  2YNY A;  3HUS C;  1SQX D;  2H88 C;  1Q2N A;  1HJ0 A;  2J5U A;  4D6T J;  1MUU A;  2FKW B;  1W2E A;  3G71 P;  3CCU P;  2A45 G;  1T2K D;  1M1K Q;  1L0L D;  1YQ4 C;  1FZB A;  4GOE A;  2N1T C;  1NVO A;  2YIU C;  2XZR A;  4XFJ A;  3PJS K;  1YI2 P;  2P7J A;  1NAF A;  4DOJ A;  1LTI C;  3OW2 O;  3M0A A;  3PLN A;  3V2N A;  1N73 B;  4WY4 C;  1W5C E;  1E79 H;  2W6J H;  3HE5 B;  1VF5 C;  1FE6 A;  3L4F A;  1RF1 C;  3MUD C;  1PFI A;  1KMI Z;  1LNQ A;  4UB8 H;  2R3C A;  1KIL B;  1RH5 B;  3AE5 C;  1VF5 B;  3O6Q A;  1AA0 A;  4IL6 H;  4PJ0 H;  1JY3 N;  1S5L X;  1LTJ C;  4YTP C;  2K1A A;  2WPV B;  2GUS A;  4HH2 A;  1PIX A;  3CWB G;  2OYH C;  3EFF K;  5APQ A;  1VQO P;  1T6A A;  1J2J B;  2JR8 A;  5AVV B;  2W8Z A;  1KQF B;  1RF0 A;  2OQQ A;  2MKV A;  1PP9 D;  3B5N A;  1URQ D;  2Z4E A;  3AEB C;  1VQK P;  2UWJ E;  3W68 A;  1SQX K;  3CME P;  1S3J A;  1G1J A;  2FYU J;  3ABV C;  3BVH A;  3I5C A;  3RK3 B;  1FZC B;  1IO4 A;  5AW4 B;  2QJK C;  1WT6 A;  4UB6 H;  2YXR B;  1VQ4 P;  2AEF A;  3GHG B;  2K9J A;  2NZ2 A;  1NU1 J;  3RBX A;  1VQ9 P;  1HTL C;  4IL6 X;  3RK2 B;  1SQQ D;  2IZ1 A;  2KZI A;  2XU6 A;  1D7M A;  5B66 H;  3CCQ P;  2Z5I A;  1Q86 Q;  2JEE A;  2H7H A;  1VQ7 P;  2I8D A;  2GA1 A;  3PRJ A;  3Q5R A;  3AEA C;  3W67 A;  4GOF A;  5AVY B;  4JF7 A;  1SQV J;  3ZDM A;  2FYN C;  2Y0D A;  3Q3D A;  4NPF X;  1KYO I;  2IBZ E;  1GDT A;  1SQX G;  1QEX A;  2B89 A;  1JY2 N;  2WVR A;  3B4S A;  3A2A A;  3C9I A;  3JC2 2;  1UII A;  4PD4 D;  1KFN A;  3BCC E;  3FXE A;  4JQ0 D;  3ITK A;  1HWT C;  3KXD A;  1GK6 A;  3SFD C;  2ZFC A;  1H0T B;  2KB7 P;  1RF1 A;  3VOP A;  4L76 A;  2B87 A;  2A45 I;  3N4X A;  2KOG A;  3GLM A;  4PD4 I;  1NU1 D;  2J58 A;  2O01 H;  3L72 J;  3L74 E;  4C7R A;  1OW8 A;  1BDC A;  1CI6 B;  1IFJ A;  1MFZ A;  1RE4 C;  2NPS A;  4WBA A;  3L75 E;  2FXM A;  1DEB A;  1QVG O;  2BAS A;  3H1K E;  1UIX A;  1S5L E;  1YTZ T;  1URQ A;  2G8Y A;  1KYO E;  2IBZ I;  2QRX A;  3CX5 H;  3H1H D;  3H1J D;  3QH9 A;  1LTG C;  3TK1 A;  1KB9 H;  2G3A A;  2WT7 B;  2K9Y A;  2M3E A;  1T3U A;  5TJH A;  2C9N Y;  1NTK E;  1SFC A;  3FGA D;  1Z56 A;  3L70 G;  4I2L C;  4LC1 A;  1RQV A;  2QVA A;  3L73 G;  1RF0 C;  4XA4 A;  2Q7C A;  3VTP C;  5CCG D;  1Q90 D;  5KLV D;  1NKN A;  2E43 A;  1KOR A;  3O8Z A;  5KJ7 D;  1AV1 A;  2KS1 B;  1SFC C;  1CI6 A;  1NTZ G;  3FX0 A;  2L5G B;  4YPC A;  3H1I J;  5APU A;  2D2C B;  2CPB A;  1NO4 A;  2R5D A;  3MUD A;  1PPJ D;  3C8V A;  1A02 J;  2R32 A;  2ZVN B;  1PV3 A;  2YKO A;  3L71 E;  4C7N B;  4AUW A;  5KLV G;  1GMJ A;  3AE2 C;  3CD6 P;  1EZV I;  1HGZ A;  2IYP A;  2ZXE B;  3H32 B;  3V2R A;  2W6A A;  1JCD A;  1KB9 D;  2BCC J;  2WMM A;  1P84 I;  2KP8 A;  2LR2 A;  2AXT H;  1L0L J;  1SQB G;  2RKL A;  2IFN A;  3GW6 A;  3SWK A;  2QJY B;  1EC5 A;  1EDI A;  2HOD B;  4O9B A;  1KN7 A;  3M9H A;  1FJK A;  5AVT B;  1L0N J;  2H43 A;  4EOT A;  3OA7 A;  4H44 B;  3H1H J;  4OWF A;  1FS0 E;  1NTM E;  3QWO C;  5DJU B;  3JCU H;  1LTS C;  2FYN B;  3GMA A;  1S1C X;  1NHL A;  5AW5 B;  3C1L A;  4IFM A;  4A7P A;  4KJM A;  1X8Y A;  1NOH A;  4H44 D;  1URQ C;  2AXC A;  2HFE D;  5AVR B;  1BCC G;  1SQB K;  1EZV E;  1SQV E;  3G6E P;  3MTU E;  4Y28 J;  1ZME C;  1VPC A;  2WPQ A;  5APW A;  2ZYG A;  4EIJ A;  1P84 E;  1IFN A;  2KNC A;  3L75 J;  1RHZ B;  3M0D C;  3MGN A;  2GUV A;  1HUC A;  1NYH A;  2BEQ D;  2XND H;  3B5N B;  2N1T A;  3JCU E;  4PD4 H;  3RGU A;  5KLI B;  3CCE P;  4EDF A;  3H32 A;  4KHX A;  2KSJ A;  4JPZ B;  1EXJ A;  2YMK A;  1FC2 C;  4R4L A;  3FWL A;  1L4A A;  2CPS A;  3HE4 B;  5GTI H;  1M90 Q;  2N9B A;  3HUS A;  1SQX E;  3RK2 D;  3U1A A;  1EQ7 A;  5KJ7 A;  1J1D B;  1N7S D;  1GL2 A;  1ZRT E;  3FWN A;  2QEX P;  3RK3 D;  1JY3 P;  4BRY B;  4GT1 A;  1X79 B;  3CCV P;  1OWA A;  2E74 D;  1YJN P;  1DH3 A;  1IK9 A;  2A06 E;  1LTJ A;  2IX7 C;  1YIJ P;  3SFE C;  1AVY A;  4U7J A;  4I7Z C;  5APX A;  1OX3 A;  3UIA A;  2M3B A;  1SQP J;  4ASW A;  4BXL A;  1T8Z A;  3GF3 A;  4JYC A;  1GU4 A;  1OVV A;  1SQB D;  3IF4 A;  5BU5 A;  3H1L G;  2N1T B;  3S9O A;  1BE3 D;  2YKQ A;  2D2C D;  4HYT B;  4OH8 B;  3CCS P;  1M1J B;  3B5N C;  3WMM 0;  1W2B O;  2KSE A;  1N7S B;  1YHQ P;  1L4A D;  1BGY J;  3L70 D;  1T2K C;  1BSN A;  3LIE A;  5APS A;  5DJT B;  5APY A;  1LT1 A;  1IFM A;  2N1T D;  2JDI H;  3H6P A;  1KFM A;  1JOC A;  2CK3 H;  1SFC D;  5CCH C;  5AW8 B;  2SPZ A;  1G1I A;  3HD7 D;  3CC2 P;  3CXH D;  1IC2 A;  2JJL A;  1G2C B;  5CJ0 A;  2FFD B;  1GTW A;  2M0B A;  2NRG A;  1BCC D;  2O01 J;  1J1E B;  2PGD A;  1JCC A;  2B88 A;  2C0X A;  1L0L E;  2IBZ D;  3G4S P;  3CPW O;  1JY2 P;  1S4X A;  4D6T E;  1ZR2 A;  1N73 C;  4H13 B;  3HTK A;  4OGQ D;  2WTY A;  1LWU C;  3AE8 C;  3BCC D;  1NTZ D;  5KLV K;  4I6M C;  1FZC A;  1KQL A;  2YKP A;  2OYI C;  1BE3 G;  3II6 A;  3L71 G;  4QMA A;  4ZMD A;  3B71 A;  3A5T A;  3FXD A;  5KAI H;  1HF9 A;  1LWU A;  1N86 A;  1RY3 A;  3AE4 C;  3AE6 C;  3P7K A;  3AE9 C;  1HVV A;  1N73 A;  2MJZ A;  3L72 E;  1Q82 Q;  1S9K E;  2R5B A;  3H1J G;  1USD A;  4K35 A;  1AJY A;  1BGY D;  2QSI A;  3WUV A;  2YIU B;  3VP8 A;  2POH A;  4H44 C;  4HJG H;  3E7K A;  1OW7 A;  2E75 B;  3H1K D;  2K37 A;  1KYO D;  1IFP A;  3MZW B;  3TGU D;  3HUS B;  3I55 P;  3RBZ A;  1AQ5 A;  2AXT E;  1DIP A;  3U1C A;  3TNU A;  2E42 A;  5KLV E;  3H1L D;  4ZKU A;  2WIT A;  1HGV A;  1JTH A;  1K05 A;  1CZQ A;  5AVX B;  5CJ4 A;  3SWF A;  1GL2 C;  2QJP B;  3CWB D;  2Q3E A;  2RN0 A;  4DCK A;  3BCC J;  1Q7Y Q;  1H88 A;  4Y99 C;  2O1J A;  3M9B A;  3RK3 C;  3L71 D;  3V4W A;  1NU1 G;  2OYH B;  2Q1K A;  5AW6 B;  3KYQ A;  1SQP E;  1NTK G;  2FY8 A;  2XDJ A;  1GK4 A;  1P84 H;  1JY3 O;  5AW0 B;  3VMY A;  4PD4 E;  1GU5 A;  2QJY C;  2QM8 A;  2FXO A;  2ZT9 D;  3A0B H;  2P67 A;  2H8P D;  2H89 C;  1M8O B;  3TNU B;  4I7Z B;  1EZV G;  1JB0 J;  1NTM D;  4PV1 C;  1GL2 B;  2QJP C;  3KQG A;  2FYU E;  1VQM P;  1NU1 E;  3F89 A;  1FZG A;  4W7Z A;  1MFT A;  2PRR A;  4L73 A;  1AFO A;  2QJK B;  5KJ7 C;  3T97 B;  2Y0E A;  3MP7 B;  3V4Q A;  1L0N E;  3RL0 g;  3NMD A;  2XNX A;  3P8C E;  1L4A C;  1KD1 Q;  2W27 A;  3L72 G;  1EZV D;  1X22 A;  2C0W A;  2O3J A;  4LLH A;  4WVZ A;  4YXW H;  1CW5 A;  1E5W A;  1G2C A;  5L8R J;  2FFD A;  2HOD A;  4WY4 A;  2P58 A;  2OYI A;  2FYZ A;  3IAO A;  1H0T A;  2Q5U A;  1A02 F;  4RES B;  3S4R A;  4WB4 A;  2ZYA A;  2OYO A;  1SQQ K;  2I1J A;  3MHV A;  1JY2 O;  4GIF A;  4IFF A;  4RJT A;  1KIL C;  1SQV K;  4C7N A;  1N2D C;  1USE A;  4U3F G;  3L73 J;  3I56 P;  1YJW P;  3GHG C;  2HG5 D;  1NTM J;  3OJA B;  4L74 A;  1X0T A;  1R5L A;  2PFX A;  5CMZ A;  5K5G B;  2AEJ A;  3WUU A;  1NKZ B;  4B86 A;  1M1J C;  2WPR A;  3H1I D;  2HYN A;  1QLE D;  1KQS O;  5TIS E;  2BCC E;  3BRT B;  3A3Y B;  4WWI A;  3TGU J;  1SQQ G;  1TU3 F;  3VP9 A;  5KLV J;  2E5T A;  1S2E A;  3RL0 B;  2AEM A;  1JEK A;  1MZ9 A;  2FXP A;  1U7M A;  3AEC C;  4UB8 E;  4PJ0 E;  1L2P A;  5AVS B;  4W80 A;  2BCC G;  2OYI B;  1OZH A;  1L0L G;  1SQB J;  4AQR D;  1BE3 E;  1PP9 J;  3H1K G;  3NFQ A;  3RL0 D;  3M0D A;  5BVZ A;  3AEG C;  1EDL A;  5TIS H;  5CBN A;  3H1H G;  2OTJ P;  3L74 J;  1EDK A;  3RK2 C;  1FJP A;  1R5S A;  3KDP B;  1K73 Q;  3WU2 H;  2YMY A;  1M56 D;  3L35 A;  3L70 E;  2W6B A;  1N7S C;  1YYC A;  1SFC B;  3O6Q B;  1S72 P;  1GW3 A;  3A0H E;  1OIP A;  1PGJ A;  2R44 A;  2HPC A;  1EXI A;  4N6J A;  2E74 C;  3HE4 A;  1Y8A A;  3H25 A;  2V4H A;  2LXC B;  1S5L H;  1BCC J;  1OW6 A;  3EFG A;  3CC7 P;  1GL2 D;  1ZW0 A;  1N7S A;  2E74 B;  2LXB A;  4GDO A;  5C39 A;  5B66 E;  3L75 G;  4GKG A;  5KTB A;  1VQL P;  3NXS A;  4C46 A;  3E1I A;  1YJ9 P;  3D6Y A;  4D6T G;  3WU2 E;  1FU1 A;  4BRY A;  4DT0 A;  5KAF E;  3CCL P;  1LTT C;  1M57 D;  5AW2 B;  3D71 A;  1LP1 B;  1BSH A;  3A0H H;  4TLF A;  1ZRT D;  1ZOY C;  2M5A B;  3TDK A;  3RK3 E;  3Q1M A;  2I1K A;  2K9J B;  1NAY A;  1Y9B A;  3AEE C;  3L73 D;  1EDJ A;  1K8A Q;  2DW3 A;  3BAT A;  2ZT9 C;  2E5Y A;  2ZJS E;  3L37 A;  1L0N K;  1NU1 K;  4K3A A;  4U3F E;  4XE5 B;  3R2P A;  3GG2 A;  3TYY A;  1IK7 A;  2OTK E;  3P8M C;  1NTK K;  2WSC J;  3CXH I;  3LW5 J;  1QGK B;  3PP5 A;  3L36 A;  4R4M A;  3CCM P;  4PV1 D;  1FZF A;  1QVF O;  4L75 A;  1IFD A;  2HPC B;  1S9K D;  3CX5 D;  1BGY E;  1KQG B;  2PAJ A;  1OFC X;  1HBW A;  1SQP G;  3CWB J;  1GW4 A;  2IZ0 A;  3GF7 A;  5CCH D;  2WQY C;  2A06 G;  4HKZ H;  2GM4 A;  4HB1 A;  1U57 A;  3GHG A;  3HD7 C;  4N78 E;  5KLI C;  4KT0 J;  2KYV A;  3H1L J;  3E1R A;  3AE7 C;  1LJ2 A;  1LP1 A;  1ZLL A;  3CLQ A;  3V5B A;  4UB6 E;  3A0B E;  3V6I A;  1K9M Q;  1FZE A;  5KKZ C;  1FDM A;  3WUT A;  2FYU G;  2KIK A;  3HD7 A;  1LGH B;  2WSC H;  3H1L E;  3LW5 H;  4OGQ C;  1IZN B;  1KIL D;  2OGU A;  1OVR A;  3AE1 C;  2ZYD A;  3CWB E;  4U3F D;  3AE3 C;  2XKM A;  2N9Y B;  4LGD E;  1SS1 A;  2WT7 A;  3KPE A;  3BAS A;  3R4Y A;  1YTZ I;  4MN4 C;  2WSE J;  3V2Q A;  1R8E A;  1GD2 E;  1BCC E;  1SQV G;  3EWK A;  5CBO A;  5E79 H;  1VQN P;  1SQP D;  2OTL P;  1LTJ B;  1SQX J;  5APV A;  4D6T D;  2K3R A;  1H8A A;  1KIL A;  1OXZ A;  2JWA A;  4M3L A;  3VN0 A;  1DX7 A;  1NTZ E;  1RF1 B;  4ZNC A;  1WMK A;  2WSF H;  3M91 A;  1VQ6 P;  1PGQ A;  3MD0 A;  2E75 D;  5BU8 B;  1RE4 A;  2NPS C;  5AVQ B;  1H89 A;  3M06 A;  4RO0 A;  2A45 H;  4H0L C;  2FYU D;  3L72 D;  3RL0 C;  5E79 E;  1BE3 J;  1SLQ A;  3L71 J;  2HLO A;  2ITA A;  2KK7 A;  1ZXG A;  2P1J A;  2QA4 P;  2HR3 A;  2OYH A;  1L0L K;  3P8C D;  2J59 M;  1JNM A;  3NTN A;  3H1J J;  1XTG B;  5CCG A;  3N7N A;  3TGU E;  3AEF C;  3HTK B;  3IN6 A;  3CXH H;  4H13 D;  1HH0 A;  4OGQ B;  1M1J A;  5AW1 B;  5AW9 B;  2Y0C A;  1LT9 C;  1T3J A;  1PL5 A;  2KUB A;  2E76 C;  4GOD A;  2RMZ A;  2QIW A;  3L70 J;  3H1J E;  1U7J A;  3KZI E;  3CCR P;  1LT9 B;  2WZ7 A;  1PP9 E;  1MKM A;  4JBZ A;  2VRS A;  3BRV B;  3USS A;  3PH0 A;  4NPE A;  4EYY Q;  2JKV A;  3HD7 B;  3JSV C;  2IFM A;  2IBZ G;  3U59 A;  1NTZ J;  2YXQ B;  3Q2Y A;  4RKU J;  1JUN A;  3H1I G;  1ZP0 C;  1PGP A;  1FBM A;  2B9B A;  2LKM A;  2YO2 A;  3VMA A;  1PPJ G;  4AYC A;  3CMA P;  1KV4 A;  2ZXX A;  1YBK A;  2Q6Q A;  4W7Y A;  1YIT P;  2IPP A;  2R3S A;  2V7Q H;  4TT3 H;  1Q81 Q;  4IFD K;  1KZU B;  2PP6 A;  3KZI H;  1L4A B;  3H1I E;  1SQQ E;  2BEZ F;  3TSI A;  3V2P A;  3BCC G;  4H0L B;  4IL6 E;  1FDI A;  2BCC D;  3G3Z A;  2IDB A;  2NPS B;  1FAV A;  1QX8 A;  3D6Z A;  1RE3 C;  3OAK A;  1NGM B;  2Z5H A;  5CCG C;  1QL1 A;  1LTB C;  1L0N G;  1NTK J;  4ASV A;  3HE5 A;  5H2F H;  2WPS A;  3AED C;  3M9Q A;  1M7L A;  3HRN A;  1QL2 A;  3A7O A;  4OVN F;  3MIW A;  5AW7 B;  3EQ2 A;  2RH0 A;  3VMX A;  5KAF H;  3P32 A;  1SP4 A;  4NPD A;  3Q5S A;  2YO3 A;  5KAI E;  2KZJ A;  3CL3 D;  1VF5 D;  1L0N D;  1J1E C;  1SQP K;  1Y47 A;  1FDO A;  2KLV A;  2WSS H;  3PHL A;  1KYO H;  3L74 D;  4YXD C;  1X9V A;  4DJG A;  5GTH E;  2FFD C;  3TF5 A;  5H2F E;  4Y99 B;  3L75 D;  5EFW B;  4EI2 A;  3G9R A;  2O01 N;  4H0L D;  4BWN A;  1HJB A;  1RQU A;  5KKZ B;  1NTM K;  4IOI H;  2WSF J;  3S1K A;  4Z1M H;  2ZT9 B;  5CHX A;  1ZN5 A;  1ZV8 A;  2IYO A;  2W90 A;  3H1H E;  3CX5 I;  3IFM A;  5M1B A;  1P84 D;  1RE3 A;  2FYU K;  1KB9 I;  4ZKP A;  4CPG A;  2P10 A;  3CI9 A;  5AW3 B;  1JO5 A;  3PTZ A;  1NTK D;  1FZA A;  1J1D C;  2E76 B;  2QE7 H;  2WWW A;  1JTH B;  5GTH H;  2WSE H;  2QG4 A;  3VYI A;  1VQP P;  2O1K A;  5AVU B;  5AVW B;  1N7L A;  4JYB A;  2C9L Y;  1KC8 Q;  1CSB A;  1YQ3 C;  3SSU A;  1PGO A;  2Q3I A;  2FBW C;  4U3F J;  2W83 C;  1DEE G;  1VDF A;  2V7Q J;  1NTM G;  2ZAE B;  2E75 C;  2KLU A;  2NPS D;  1PPJ E;  2P2U A;  4N3Y B;  3B8E B;  1ZR4 A;  5B5E H;  1NJI Q;  2JO1 A;  1WRG A;  4WY4 D;  1AVO A;  1JM0 A;  2OAR A;  1OVU A;  3SWY A;  2M5A A;  1JMB A;  2A06 D;  3CX5 E;  5AVZ B;  1KB9 E;  1LTA C;  1URQ B;  2M8R A;  4I1L A;  1VQ5 P;  2Q9I A;  3TGU G;  1SQQ J;  1MV8 A; 
#chains in the Genus database with same CATH homology
 1IJD B;  1JMM A;  4N78 D;  1LWU B;  2QM7 A;  1FZC C;  2XV5 A;  1NWQ A;  3T97 A;  1GZL A;  4DZO A;  3IR9 A;  3LID A;  1IFI A;  4WY4 B;  3VMZ A;  1LT9 A;  1NTZ K;  5CCH A;  1FOS E;  1SVF A;  5APT A;  3B5N D;  1XTC C;  1FOS F;  1NH4 A;  2YNY A;  3HUS C;  1MUU A;  2FKW B;  1W2E A;  1T2K D;  2A45 G;  1FZB A;  2N1T C;  2XZR A;  2P7J A;  1NAF A;  4DOJ A;  1LTI C;  3M0A A;  3V2N A;  3HE5 B;  3L4F A;  1RF1 C;  2R3C A;  1KIL B;  5AW8 B;  3SWY A;  1JY3 N;  5CCG A;  1LTJ C;  4HH2 A;  2GUS A;  5APQ A;  1J2J B;  5AVV B;  1RF0 A;  3B5N A;  1URQ D;  2Z4E A;  1SQX K;  1G1J A;  1IO4 A;  3BVH A;  1FZC B;  3I5C A;  3RK3 B;  5AW4 B;  1WT6 A;  3GHG B;  1HTL C;  3RK2 B;  2XU6 A;  2Z5I A;  2JEE A;  2H7H A;  5AVY B;  4JF7 A;  1GDT A;  1JY2 N;  3C9I A;  3A2A A;  1KFN A;  1HWT C;  1GK6 A;  2ZFC A;  2KB7 P;  3VOP A;  2A45 I;  3N4X A;  2KOG A;  2J58 A;  2O01 H;  4C7R A;  1CI6 B;  1IFJ A;  1MFZ A;  1RE4 C;  2NPS A;  4WBA A;  2FXM A;  1DEB A;  2BAS A;  1YTZ T;  1URQ A;  3TK1 A;  1LTG C;  2WT7 B;  1T3U A;  1SFC A;  1Z56 A;  4I2L C;  4LC1 A;  3VTP C;  5CCG D;  4XA4 A;  1RF0 C;  2Q7C A;  2E43 A;  1NKN A;  5KJ7 D;  3O8Z A;  1SFC C;  1CI6 A;  2L5G B;  2CPB A;  1NO4 A;  2R5D A;  3MUD A;  1A02 J;  2R32 A;  4AUW A;  4C7N B;  2YKO A;  1HGZ A;  2ZXE B;  3H32 B;  3V2R A;  2W6A A;  1JCD A;  1JNM A;  4GT1 A;  2OYI C;  2KP8 A;  2IFN A;  2HOD B;  4O9B A;  3M9H A;  1FJK A;  5AVT B;  2H43 A;  4EOT A;  3OA7 A;  1LTS C;  1NHL A;  5AW5 B;  4IFM A;  1X8Y A;  1NOH A;  1URQ C;  2HFE D;  5AVR B;  1SQB K;  3MTU E;  1VPC A;  2WPQ A;  5APW A;  4EIJ A;  4IFD K;  1IFN A;  3M0D C;  3MGN A;  4WY4 C;  2GUV A;  1HUC A;  3B5N B;  1DX7 A;  2N1T A;  3H32 A;  4KHX A;  2KSJ A;  3HE4 B;  1L4A A;  2CPS A;  2N9B A;  3HUS A;  3RK2 D;  3U1A A;  1EQ7 A;  5KJ7 A;  1J1D B;  1N7S D;  1GL2 A;  3RK3 D;  1JY3 P;  1X79 B;  1OWA A;  1DH3 A;  1IK9 A;  1LTJ A;  2IX7 C;  5APX A;  3UIA A;  2M3B A;  1T8Z A;  1GU4 A;  4JYC A;  5BU5 A;  2N1T B;  2YKQ A;  4HYT B;  4OH8 B;  1M1J B;  3B5N C;  3WMM 0;  1N7S B;  1L4A D;  1T2K C;  3LIE A;  5APS A;  5APY A;  2N1T D;  1IFM A;  3H6P A;  1KFM A;  1JOC A;  1SFC D;  5CCH C;  1G1I A;  3HD7 D;  1IC2 A;  2JJL A;  1G2C B;  5CJ0 A;  2FFD B;  1GTW A;  1J1E B;  1JCC A;  2C0X A;  1ZR2 A;  1JY2 P;  1N73 C;  3HTK A;  2WTY A;  1LWU C;  5KLV K;  4I6M C;  1FZC A;  1KQL A;  2YKP A;  3II6 A;  3A5T A;  1LWU A;  1N86 A;  1RY3 A;  3P7K A;  1HVV A;  1N73 A;  2MJZ A;  1S9K E;  2R5B A;  3VP8 A;  2POH A;  3HUS B;  1AQ5 A;  3U1C A;  3TNU A;  2E42 A;  4ZKU A;  2WIT A;  1HGV A;  1JTH A;  1CZQ A;  5AVX B;  5CJ4 A;  3SWF A;  1GL2 C;  1H88 A;  4Y99 C;  2O1J A;  3M9B A;  3RK3 C;  3V4W A;  2OYH B;  5AW6 B;  3KYQ A;  5AW0 B;  2XDJ A;  1GK4 A;  3VMY A;  1JY3 O;  1GU5 A;  2QM8 A;  2P67 A;  2H8P D;  3TNU B;  1GL2 B;  3KQG A;  1FZG A;  4W7Z A;  1AFO A;  5KJ7 C;  3V4Q A;  3NMD A;  2XNX A;  3P8C E;  1L4A C;  2W27 A;  4LLH A;  2C0W A;  1CW5 A;  1E5W A;  1G2C A;  2FFD A;  2HOD A;  4WY4 A;  2OYI A;  2FYZ A;  2Q5U A;  1A02 F;  4RES B;  4WB4 A;  1SQQ K;  2I1J A;  4GIF A;  1JY2 O;  4IFF A;  1KIL C;  1SQV K;  4C7N A;  1N2D C;  1PFI A;  3GHG C;  2HG5 D;  3OJA B;  5CMZ A;  1NKZ B;  4B86 A;  1M1J C;  2WPR A;  2HYN A;  3BRT B;  3A3Y B;  3VP9 A;  2OYH C;  3RL0 B;  1MZ9 A;  5AVS B;  4W80 A;  2OYI B;  4AQR D;  3NFQ A;  3RL0 D;  3M0D A;  5BVZ A;  1FJP A;  3RK2 C;  3KDP B;  2YMY A;  3L35 A;  2C9N Y;  2W6B A;  1N7S C;  1YYC A;  1SFC B;  1GW3 A;  2HPC A;  4N6J A;  3HE4 A;  3EFG A;  1GL2 D;  1N7S A;  5KTB A;  4GKG A;  3NXS A;  4C46 A;  3E1I A;  1FU1 A;  1LTT C;  5AW2 B;  2I1K A;  3BAT A;  3L37 A;  1L0N K;  1NU1 K;  4XE5 B;  3R2P A;  3TYY A;  3P8M C;  5APU A;  1NTK K;  3PP5 A;  3L36 A;  1FZF A;  1IFD A;  2HPC B;  1S9K D;  2PAJ A;  1HBW A;  1GW4 A;  5CCH D;  2GM4 A;  3GHG A;  3HD7 C;  4N78 E;  2KYV A;  1ZLL A;  3CLQ A;  3V5B A;  1FZE A;  1FDM A;  3HD7 A;  1LGH B;  2WSC H;  3LW5 H;  1KIL D;  4LGD E;  2WT7 A;  3KPE A;  3BAS A;  1YTZ I;  3V2Q A;  1GD2 E;  1LTJ B;  5APV A;  1H8A A;  1KIL A;  1OXZ A;  4M3L A;  3VN0 A;  1RF1 B;  2WSF H;  3M91 A;  3MD0 A;  5BU8 B;  1RE4 A;  2NPS C;  5AVQ B;  1H89 A;  3M06 A;  2A45 H;  3RL0 C;  1SLQ A;  2HLO A;  2P1J A;  2OYH A;  1L0L K;  3P8C D;  2J59 M;  3NTN A;  1XTG B;  3N7N A;  3HTK B;  5AW9 B;  1HH0 A;  5AW1 B;  1M1J A;  1LT9 C;  1T3J A;  1LT9 B;  2WZ7 A;  2VRS A;  3BRV B;  1N73 B;  1RF1 A;  3HD7 B;  2IFM A;  3U59 A;  1JUN A;  2LKM A;  1FBM A;  2YO2 A;  4AYC A;  4W7Y A;  2IPP A;  1KZU B;  2PP6 A;  3V2P A;  1L4A B;  3TSI A;  3G3Z A;  2NPS B;  1FAV A;  1RE3 C;  3OAK A;  2Z5H A;  5CCG C;  1QL1 A;  1LTB C;  3HE5 A;  2WPS A;  5AW7 B;  3M9Q A;  1M7L A;  3HRN A;  1QL2 A;  3A7O A;  3MIW A;  3EQ2 A;  3VMX A;  3P32 A;  1SP4 A;  2YO3 A;  3CL3 D;  1J1E C;  1SQP K;  2KLV A;  1X9V A;  2FFD C;  4Y99 B;  1HJB A;  1NTM K;  5CHX A;  1ZN5 A;  1ZV8 A;  3IFM A;  1RE3 A;  2FYU K;  4ZKP A;  3CI9 A;  5AW3 B;  1JO5 A;  1FZA A;  1J1D C;  2WWW A;  1JTH B;  3VYI A;  2WSE H;  2O1K A;  5AVU B;  5AVW B;  1N7L A;  4JYB A;  2C9L Y;  1CSB A;  2Q3I A;  1VDF A;  4N3Y B;  2NPS D;  2P2U A;  1ZR4 A;  3B8E B;  1WRG A;  4WY4 D;  2OAR A;  5AVZ B;  2Q9I A;  1LTA C;  1URQ B;  2M8R A;  4I1L A;  2XKM A;  1MV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...