2HODA

Crystal structure of fragment d from human fibrinogen complexed with gly-hydroxypro-arg-pro-amide
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
74
structure length
74
Chain Sequence
IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting/peptide
molecule keywords Fibrinogen alpha chain
total genus 19
structure length 74
sequence length 74
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2006-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hodA00
1M1JB 3GHGC 2OYIC 3GHGA 1FZCC 1W2EA 2OYIA 1LWUC 1FZCA 1LWUA 1RE3C 2HPCB 1LTJB 1RF1C 1RE3A 1RF1A 1JY2P 1FZAA 2OYHB 2HODB 1LT9B 3E1IA 3H32A 1FZFA 2FFDC 1M1JC 2Z4EA 1M1JA 2FFDA 1JY3N 1N73B 1JY2O 1LTJC 2HPCA 3BVHA 1LTJA 3HUSB 2A45G 2A45H 2HLOA 2OYHC 2HODA 1FZGA 2FFDB 2OYHA 1LT9C 3GHGB 1FZEA 1JY3P 1LT9A 1FZCB 2OYIB 1RF1B 1FZBA 1LWUB 2XNXA 2Q9IA 2H43A 1T3UA 1RF0C 3HUSC 1N86A 1N73C 1JY2N 1RF0A 3HUSA 3H32B 1N73A 1RE4C 1JY3O 1RE4A 2A45I
chains in the Genus database with same CATH superfamily
4GDOA 5DJUB 2MKVA 3OJAB 4WB4A 2KK7A 1M1JC 5AVZB 4HB1A 2K3RA 2ZYGA 5APSA 3F5HA 5APQA 1EZVG 2XU6A 1EXJA 2B87B 1NTMG 3RL0B 2QE7H 2D2CB 3AE4C 3H1HE 3AE6C 3VMXA 1YJ9P 2AXCA 2KB7P 1P84I 4PJ0H 2I1KA 1JTHA 1LTTC 3SWKA 1SFCD 2IFMA 3H32B 3GHGA 3H6PA 3RBXA 5CCHD 4I7ZC 1SQXJ 3TGUD 3L74E 1PGQA 2WSEJ 3T97B 2DW3A 3CCJP 1N73A 1NTZD 1RE4A 1JMMA 3CX5E 1KILD 3VP9A 1X9VA 1YQ3C 1LTGC 1SQPK 2KZIA 1URQB 5K5GB 3TF5A 2OTJP 3CXHH 1SQBK 3BCCJ 1BE3D 3H1HG 3JC22 2YMYA 3H1HJ 1ZRTE 4PD4E 4A7PA 3AE2C 1RQVA 1LT9B 3BASA 2N1TB 1CSBA 2KS1B 2W27A 3B5NA 3VMAA 4GKGA 2PGDA 3L35A 2E74D 3GHGC 2HR3A 3KDPB 3LIDA 3L74G 3O6QA 3L71E 4K35A 1Q86Q 2KIKA 1SQVE 3WMM0 2R3SA 3JCUE 4HKZH 1J1DB 2FYNB 1Q7YQ 1SQXD 1QGKB 3Q5SA 3RL0g 4W80A 1BDDA 1N73C 1RE4C 1K05A 3H1KD 1SFCA 2JP3A 5KLVK 1YI2P 3GF3A 4KJMA 5CCHA 4ASWA 1R5SA 2ZXXA 3CWBJ 4H44C 2IYOA 2QA4P 1ZV8A 5KTBA 2WMMA 3GG2A 5GTIH 5M1BA 1KV4A 3SWFA 2K9JA 1S1CX 1SQQG 1FJKA 4UB6H 2YIUC 5AVXB 1SQQJ 3H1LJ 2L91A 3AEAC 1XTGB 1KYOI 3B5NC 2KSEA 4AQRD 3A0HH 3L71G 1MV8A 4I7ZB 2WT7B 3FWLA 1SQVG 1T6AA 2AXTE 2I8DA 4I2LC 3V2QA 2MJZA 1PGOA 1HTLC 1PPJD 1L0LD 1EC5A 3MD0A 3UIAA 2NPSD 1BDCA 1JOCA 1SFCC 2H8PD 3HD7D 3U1CA 3RL0D 1QEXA 5CCHC 1AFOA 1AQTA 4C46A 2KP8A 2WSEH 1Q2NA 2NZ2A 3CWBD 4NPDA 1NU1G 1T2KD 3WUTA 1T8ZA 2QJYC 5CMZA 4L73A 1NU1J 1PP9E 4NPEA 2OYIA 1OX3A 2J58A 4N3YB 2YKOA 1ZXGA 3S4RA 3A0BE 3Q2YA 2OGUA 1E79H 3GHGB 3H1LD 4PV1B 1QLED 2R3CA 4N78D 1BGYD 3KZIE 2AEJA 1ZP0C 2FYUD 1ZW0A 2O3JA 2JEEA 1N73B 2IZ0A 3V4QA 2W90A 4JYCA 1X22A 1URQD 3WU2H 3L70E 3NXSA 3G3ZA 3CC2P 4H44B 3BATA 1ZN5A 1NTMK 2HODB 5B66H 2R44A 1JY3N 3L75E 1KB9E 5KAFE 3CPWO 4LLHA 1PP9G 2BASA 2K1AA 3CX5H 1HH0A 4EIJA 5AW7B 2NPSA 3KHUA 2YIUB 2OYIC 1GL2D 3M9QA 2BCCD 3HD7A 3AE1C 1LTIC 3HE5B 3H1JE 1SQXK 2KZJA 3A7OA 4OGQC 4PD4H 3O6QB 4JPZB 1MKMA 1YTZT 3H1IE 1T3UA 3L72E 2Y0DA 3AEDC 4DJGA 3TNUA 2A06E 3U1AA 1NOHA 1CZQA 3L73E 3B4SA 3L70G 1NH4A 1SFCB 3L70J 2KNCB 4GOFA 3KPEA 1ZMEC 1QL2A 1DEEG 4D6TG 3L75G 1NHLA 3AE3C 1M1KQ 3KQGA 2ZT9D 4D6TJ 1G2CB 5APXA 2XV5A 2QJYB 2O1JA 1H0TA 5AVSB 1EXIA 1KQSO 3CCLP 2YXRB 1RF0A 2NPSC 1KILB 5AVQB 1JM0A 3CCRP 1BSHA 4U7JA 3HD7C 4YTPC 3C1LA 1GU4A 3H1IG 3L72G 3M0DA 1GZLA 2IYPA 3H1IJ 2A06G 3G9RA 3LW5J 2FFDA 4JQ0D 1T2KC 1W2EA 1FZAA 1K73Q 5APWA 5GTHE 1FU1A 2YO3A 2AXTH 2E74B 4WWIA 4WY4A 1GDTA 4H0LC 4OH8B 3RK3E 4Y99C 3AE8C 1EDJA 2NRGA 3WUVA 3TGUE 1R8EA 5KKZC 3L37A 4I6MC 2QG4A 4Z1MH 2IBZD 3IFMA 3H25A 1SQQK 2M5AB 2Z5IA 1NTZE 3NFQA 1NTKJ 1RF0C 1KILE 1S9KE 1Z56A 1X8YA 5KLVD 2IZ1A 1AA0A 1LP1B 2WZ7A 3PJSK 1OW6A 1Q82Q 3PRJA 3M0DC 1BE3E 2B9BA 2XNDH 3V2NA 2M0BA 4JF7A 3AE5C 2FFDC 2A45I 3A0BH 5APTA 1LWUA 3EQ2A 2N9YB 3FGAD 2Y9YA 3CL3D 2UWJE 3A2AA 4IFFA 1UIXA 3KZIH 4L75A 4DT0A 4WY4C 4U3FJ 4H13C 3TGUG 4DZOA 2P67A 3CXHD 1EQ7A 1NU1K 1GTWA 3L36A 5CBOA 1NTZG 4L76A 2NPSB 3B5ND 1L0NE 1VQLP 3W67A 2HYNA 1FS0E 2ZFCA 2LR2A 3H1KE 3HD7B 3AEFC 2WWWA 3Q1MA 1NTMJ 1YYCA 1KB9H 2M8RA 1DX7A 1BE3G 3AEGC 1DIPA 2LXBA 2WPSA 2K9YA 3D71A 2ZT9C 2P2UA 1Y9BA 1LTAC 1AVOA 1E5WA 4AYCA 3TNUB 1ZLLA 2BEQD 1L2PA 1N8RQ 2YNYA 1KN7A 1N7SD 1LWUC 1FZCA 4KHXA 3Q5PA 4HH2A 4H0LB 3CMAP 5AW5B 2FY8A 1KQGB 4Y99B 1G1IA 3LW5H 3G6EP 5KKZB 3M06A 3CCVP 3G71P 3FX0A 3V4WA 1L0NG 3M91A 3PH0A 1L0LE 3MUDA 2I1JA 3MGNA 3H1KG 2KYVA 1LTJA 3P8MC 3TSIA 2CK3H 2GM4A 1QL1A 2PAJA 4GODA 1EZVD 1NTMD 3FXEA 5BU5A 1S5LE 4XE5B 1CI6B 1KTMA 2IPPA 1X79B 1WRGA 2OYHA 1DD3A 5AW1B 4Y28J 2Q9IA 3HTKB 3HE4A 1VQKP 1GL2B 1FZCC 3HRNA 1J1EB 1PFIA 2ITAA 4CPGA 2P1JA 2WSCH 3L74J 1P84E 2CPBA 5AVRB 2WTYA 2C9NY 2PFXA 2SPZA 1BGYE 1SVFA 2W6BA 3OW2O 1L0LG 2XDJA 5BU8B 1M1JB 1PV3A 5GTHH 2FYUE 1RQUA 1R5LA 1N7SA 1TU3F 4XFJA 3MUDC 4OGQD 1LTJC 4ZKUA 3NMDA 3BCCD 3GW6A 2ZT9B 4BRYB 2H88C 2O01H 5KLIC 3H1HD 4WBAA 2YKPA 3M9BA 2OYHC 4YXDC 3QWOC 4L74A 2HG5D 3SFEC 2E75D 1KD1Q 3PHLA 3L71J 2BCCE 1SQVJ 3P32A 5APVA 4K3AA 1GW4A 1BGYG 4IL6E 2KLVA 5DJTB 3RK2C 5BVZA 1YTZI 4BWNA 2FYUG 1M8OB 1A02F 1HUCA 1Q81Q 1NTKK 2PRRA 3D6ZA 5B5EE 1N7SC 2LKMA 3CX5D 1FE6A 1IFMA 1IO4A 2RKLA 1LNQA 1MUUA 2IBZI 3EFGA 1T3JA 4W7ZA 1QVGO 3HUSA 1K9MQ 2V7QJ 4PD4D 4RKUJ 4KT0J 1JCDA 2WVRA 3I56P 4IFDK 1N7LA 4UB8E 2B88A 1JTHB 2GUSA 1BSNA 1M7LA 1LT1A 3C8VA 1YHQP 1FZCB 3VP8A 1SQQD 1OVRA 4H0LD 2XNXA 3V5BA 3EWKA 3CMEP 5C39A 2W8ZA 4R4LA 1RE3A 1H89A 3L71D 1SQPE 1LGHB 2P58A 2ZXEB 4W7YA 1SQBE 1VQ4P 1IFJA 1KYOE 4C7NA 3V2PA 1H88A 1OIPA 3CXHI 1RH5B 1LTJB 1DH3A 3M9HA 3G4SP 2JWAA 1JB0J 5KJ7D 1JY2O 2W6JH 5CCGD 1SLQA 2WPRA 5KLIB 3HUSC 1PP9J 4I1LA 4ZNCA 2RN0A 1IFNA 2GA1A 2OYHB 3VOPA 1NU1D 3B5NB 1U7JA 2E5YA 2IBZE 4IFMA 1GW3A 1ZR2A 1QX8A 2GUVA 4WY4D 4H13D 4PJ0E 2HFED 5AW0B 2WSSH 1SQPG 2V4HA 5KLVE 1FDMA 4YPCA 2AEMA 3CCSP 1BCCE 2B87A 1RE3C 1SQBG 1VQ8P 1FJPA 1OVVA 1M56D 2R32A 5AW8B 3NTNA 5AVTB 1L4AD 1SP4A 1NJIQ 4IOIH 3MHVA 1N7SB 1YJWP 1D7MA 2G3AA 2L5GB 1JO5A 1P84H 2E75C 3JCUH 2QVAA 3H32A 4WVZA 5H2FE 3SWYA 1NGMB 3L75J 2HPCA 5AW4B 4RJTA 1IJDB 3II6A 4NPFX 2E5TA 2K9JB 1EDLA 3CXHE 4AUWA 2IBZG 2P10A 1EZVI 2OTKE 4TLFA 4B86A 1PP9D 3VMYA 3H1JG 1VQPP 1U57A 3Q5RA 3H1JJ 3CI9A 2N9BA 5KLVG 1VQNP 2O01N 2OQQA 3D6YA 3AEBC 4O9BA 5KJ7A 1BCCG 3L72J 2Q3EA 2V7QH 5CCGA 3L73G 3L73J 4JBZA 1RHZB 1U7MA 2D2CC 2Q6QA 1ZR4A 1NKNA 2YXQB 2N1TA 3BRTB 2ZJSE 1PGJA 2FKWB 1ZOYC 3L70D 3MTUE 2KS1A 4XA4A 3CCEP 4IL6H 2Y0CA 3MP7B 1S2EA 2WPVB 4GT1A 4D6TD 3L75D 1KB9D 2WSFJ 2OYIB 1MFTA 1L4AA 5B5EH 2Q7CA 1YBKA 1VQ5P 4DOJA 1KFMA 4OGQB 1MZ9A 1S72P 1SQVK 1NYHA 3A5TA 2Q1KA 3S9OA 4YXWH 3ITKA 2WSCJ 2W83C 1WT6A 4UB6E 5KJ7C 2JDIH 3CC4P 3I5CA 5CCGC 4UB8H 3H1ID 1IFPA 3N4XA 1KFNA 1HVVA 2JR8A 2JO1A 4C7NB 2A06D 2WPQA 1JCCA 1VL2A 3CLQA 1JEKA 2VRSA 1EDIA 2M3EA 2N1TC 2E76D 2E75B 2H89C 2IDBA 3TK1A 1OW7A 1NWQA 2J5UA 5AW9B 1WMKA 3TGUJ 3CX5I 2WT7A 4GOEA 1KYOH 3CCUP 2O01J 1SQXE 5AVVB 3D70A 3USSA 1NTZJ 1Q90D 1J1DC 1FZBA 1L4AC 1KQFB 1RY3A 1JY3O 2P7JA 4PD4I 1NVOA 3P8CD 1NTKD 1FDOA 1VDFA 5KAFH 4RO0A 2C9LY 4ZKPA 2QIWA 3RK2D 3VYIA 1BE3J 3IAOA 1OVUA 3SSUA 1FZEA 3BCCE 4HYTB 2AEFA 2C0XA 1MFZA 3CCMP 2RH0A 4DCKA 3ZDMA 3F89A 3JSVC 1FOSF 1VPCA 1KMIZ 1LTBC 2JJLA 3RK3D 3WU2E 1SQXG 4U3FD 2HPCB 1RF1A 3U59A 1PPJE 2KSJA 1H0TB 1L0NJ 1VF5C 2FXMA 1AJYA 2OTLP 3V6IA 5B66E 2YKQA 3H1KJ 2ZYDA 1N86A 1JY2N 1HGVA 5H2FH 1S9KD 1FAVA 4R4MA 2E42A 2WSFH 3BCCG 3GLMA 2QJPC 3CWBE 2HODA 2FFDB 1HJ0A 3K5BA 3O8ZA 3RGUA 4OWFA 3PP5A 5APUA 5APYA 3E7KA 1FBMA 5E79E 5EFWB 3OA7A 3PTZA 5CBNA 4WY4B 4H13B 2A45G 1SQQE 3H1LE 4EYYQ 3HE5A 1K04A 4N78E 1PPJG 2QEXP 4QMAA 4PV1C 1RF1C 1L0LJ 1IFDA 1JY2P 3LIEA 4EDFA 1L4AB 1USEA 2QJKC 2OYOA 3MIWA 2CPSA 1L0ND 2KUBA 3CD6P 5AW3B 2E76C 3CC7P 5TJHA 1KZUB 4ZMDA 1HJBA 3CWBG 2KNCA 1JMBA 3KXDA 3BVHA 1X0TA 2K37A 1G2CA 1LWUB 2H43A 4EOTA 1LTSC 1HGZA 3E1RA 1S4XA 2Y0EA 1DD4A 1OWAA 1SS1A 1FC2C 4EI2A 2ZVNB 1NU1E 3CCQP 3H1LG 1KILA 1K8AQ 4C7RA 4BXLA 3L74D 1FOSE 1W5CE 1BGYJ 1NAFA 3BRVB 2FYUJ 3WUUA 1VF5B 3VMZA 5AVUB 1M57D 5AVWB 1IC2A 1KB9I 1YIJP 1USDA 3ABVC 1GK6A 1OZHA 3V2RA 2IFNA 3S1KA 3MZWB 4HJGH 4ASVA 1DEBA 3IN6A 2XKMA 2QJPB 1ZRTD 3AECC 3RK3C 2D2CD 2LXCB 2ZYAA 3AE7C 4TT3H 3W68A 2IX7C 2QM8A 2BCCG 5TISE 1YQ4C 2BCCJ 1QVFO 2M5AA 1AVYA 1IFIA 4LC1A 2Z5HA 1KILC 2QM7A 1SQVD 1KORA 3R4YA 1VQMP 1P84D 3TYYA 1LP1A 1RF1B 1NTZK 5AW2B 5L8RJ 1Y47A 2QJKB 4RESB 3TDKA 2WITA 2ZVOB 5KAIE 5AW6B 2E76B 3QH9A 1GK4A 2A45H 1NO4A 2E43A 4LGDE 2KI7B 2H7HA 2E74C 3N7NA 3Q3DA 3PLNA 3IR9A 1FZFA 4D6TE 1GMJA 2C0WA 2N1TD 3HE4B 2FBWC 1J2JB 5CHXA 3A3YB 3AE9C 3B71A 3GMAA 1JUNA 1IK9A 1S5LH 1SQPJ 1VQ6P 2J59M 3RK2B 3E1IA 3L4FA 1SQBJ 1HBWA 5AVYB 2M3BA 1PIXA 1XTCC 1FZGA 1PZQA 2BEZF 1L0NK 4JYBA 5E79H 3I55P 1YJNP 1EDKA 3AEEC 3FWNA 2R5BA 2Z4EA 1AV1A 1M90Q 2W6AA 4GIFA 3M0AA 1JY3P 1S5LX 2KLUA 2POHA 3RK3B 1OXZA 3T97A 3IF4A 1S3JA 1W2BO 2YO2A 1AQ5A 1KC8Q 2Q5UA 2YMKA 3VTPC 5KLVJ 2JWDA 3P8CE 1URQA 2QSIA 1NTKE 1OMIA 4OVNF 1BCCJ 1KQLA 2B89A 1VQOP 3RL0C 1VQ7P 1L0LK 2OARA 1SQPD 1VF5D 2KXPB 1VQ9P 5CJ0A 1YITP 1SQBD 1A02J 1LT9A 1KYOD 1IK7A 2ZAEB 1CI6A 3P7KA 3GF7A 2PP6A 2FYZA 1PL5A 1Y8AA 3HTKA 1GD2E 3OAKA 1GL2A 1IZNB 1HF9A 4MN4C 3HUSB 2KOGA 2HLOA 1OW8A 1G1JA 1GU5A 1UIIA 2Q3IA 1NKZB 4U3FE 3EFFK 5CJ4A 2QRXA 4M3LA 3R2PA 1LJ2A 5GTIE 3KYQA 3B8EB 1H8AA 1M1JA 2Y9ZA 2O1KA 2FXPA 1NTKG 2K88A 3H1JD 4IL6X 1URQC 4PV1D 1EZVE 3L72D 3A0HE 1NTME 3VN0A 1BCCD 2FYUK 3SFDC 4BRYA 1JNMA 1N2DC 3L73D 1CW5A 5TISH 1LT9C 3RBZA 2FXOA 3FXDA 3C9IA 1OFCX 1PGPA 4N6JA 2JKVA 2R5DA 1GL2C 4H44D 2WQYC 1J1EC 4U3FG 1NAYA 1HWTC 2RMZA 1FDIA 2FYNC 2XZRA 2G8YA 5KAIH
chains in the Genus database with same CATH topology
1RF1C 1RE3A 3OJAB 1IFDA 4WB4A 1H89A 1JY2P 3HD7C 1LGHB 3LIEA 1M1JC 5AVZB 2ZXEB 1L4AB 4W7YA 1GU4A 3MIWA 1IFJA 2CPSA 5APSA 3M0DA 4C7NA 1GZLA 5APQA 2XU6A 5AW3B 3V2PA 1H88A 3RL0B 2FFDA 1T2KC 1W2EA 1LTJB 1DH3A 1KZUB 3VMXA 1HJBA 1FZAA 3M9HA 5APWA 2KB7P 5KJ7D 1FU1A 2YO3A 1JY2O 3BVHA 1G2CA 2I1KA 5CCGD 1JTHA 1SLQA 2WPRA 1LTTC 1LWUB 4WY4A 1GDTA 1SFCD 2IFMA 2H43A 3HUSC 4EOTA 1LTSC 3H32B 1HGZA 4OH8B 4I1LA 4Y99C 1OWAA 3GHGA 3H6PA 5CCHD 1IFNA 2OYHB 3VOPA 1KILA 3L37A 3B5NB 4I6MC 4IFMA 1GW3A 4C7RA 1ZR2A 2GUVA 4WY4D 1FOSE 3IFMA 1SQQK 1NAFA 2Z5IA 3NFQA 2HFED 3BRVB 1RF0C 5AW0B 1N73A 1RE4A 1FDMA 1S9KE 1JMMA 1Z56A 1X8YA 1RE3C 1KILD 3VP9A 3VMZA 5AVUB 1X9VA 2WZ7A 1FJPA 5AVWB 1LTGC 2R32A 1SQPK 5AW8B 1IC2A 3NTNA 1URQB 5AVTB 3M0DC 1L4AD 1SQBK 1SP4A 3V2NA 1GK6A 3V2RA 4JF7A 1N7SB 2IFNA 2YMYA 2FFDC 2L5GB 2A45I 1DEBA 5APTA 1JO5A 2XKMA 1LWUA 3EQ2A 3RK3C 1LT9B 3BASA 3H32A 2N1TB 3SWYA 3CL3D 2HPCA 1CSBA 3A2AA 5AW4B 4IFFA 2IX7C 1IJDB 2W27A 3B5NA 3II6A 4GKGA 4WY4C 2QM8A 3L35A 4AUWA 4DZOA 2P67A 3GHGC 3KDPB 3LIDA 1EQ7A 4B86A 1IFIA 3VMYA 4LC1A 2Z5HA 1KILC 1NU1K 3WMM0 2QM7A 1GTWA 3L36A 1J1DB 3CI9A 2N9BA 2NPSB 3TYYA 3B5ND 2HYNA 4O9BA 4W80A 5KJ7A 1RF1B 2ZFCA 1NTZK 3HD7B 1N73C 5CCGA 5AW2B 1RE4C 2WWWA 1SFCA 5KLVK 1YYCA 4RESB 2WITA 2M8RA 1DX7A 5AW6B 5CCHA 2WPSA 2P2UA 1LTAC 1E5WA 1ZR4A 4AYCA 1NKNA 1GK4A 2A45H 3TNUB 2N1TA 3BRTB 1ZLLA 2FKWB 1ZV8A 5KTBA 1NO4A 2E43A 4LGDE 2YNYA 1N7SD 3MTUE 3SWFA 4XA4A 2H7HA 1LWUC 1FZCA 3N7NA 4KHXA 3IR9A 1FJKA 1FZFA 5AVXB 4HH2A 5AW5B 2C0WA 2N1TD 4GT1A 3HE4B 1XTGB 4Y99B 3B5NC 4AQRD 1G1IA 2OYIB 3LW5H 1MV8A 1L4AA 2WT7B 1J2JB 5CHXA 3A3YB 2Q7CA 3M06A 1JUNA 3V4WA 1KFMA 1IK9A 4DOJA 4I2LC 3V2QA 2J59M 2MJZA 3M91A 3RK2B 1MZ9A 3E1IA 3L4FA 1SQVK 1HTLC 3A5TA 3MUDA 2I1JA 3MGNA 1HBWA 2KYVA 3MD0A 1LTJA 2M3BA 5AVYB 3P8MC 3UIAA 1XTCC 1FZGA 1WT6A 5KJ7C 1L0NK 2NPSD 3TSIA 4JYBA 1JOCA 3I5CA 5CCGC 2GM4A 1SFCC 2H8PD 1QL1A 3N4XA 2PAJA 3HD7D 3U1CA 1KFNA 1HVVA 3RL0D 4C7NB 5CCHC 2WPQA 2R5BA 1AFOA 1JCCA 4C46A 2KP8A 2Z4EA 2WSEH 5BU5A 3CLQA 4XE5B 2VRSA 1CI6B 2IPPA 2W6AA 4GIFA 1X79B 1WRGA 2N1TC 2OYHA 3M0AA 1JY3P 5AW1B 2Q9IA 2POHA 3RK3B 1OXZA 3TK1A 1NWQA 3HTKB 1T2KD 1T8ZA 3HE4A 5CMZA 5AW9B 3T97A 1GL2B 1FZCC 2OYIA 2WT7A 3HRNA 2J58A 1J1EB 2YKOA 4N3YB 1PFIA 2P1JA 2WSCH 2CPBA 2YO2A 1AQ5A 5AVRB 5AVVB 2WTYA 3GHGB 2C9NY 2Q5UA 1J1DC 1FZBA 1L4AC 3VTPC 1SVFA 2W6BA 3P8CE 1URQA 1RY3A 2R3CA 4N78D 2XDJA 1JY3O 2P7JA 5BU8B 1M1JB 3P8CD 1VDFA 1KQLA 1N7SA 2C9LY 3RL0C 4ZKPA 1L0LK 2OARA 3RK2D 3VYIA 2JEEA 1N73B 1LTJC 5CJ0A 1A02J 1FZEA 1LT9A 3V4QA 4JYCA 1URQD 4ZKUA 3NXSA 4HYTB 1CI6A 3NMDA 2C0XA 3G3ZA 3P7KA 1MFZA 2PP6A 2FYZA 2O01H 1ZN5A 3BATA 1NTMK 3HTKA 2HODB 1GD2E 3OAKA 1GL2A 4WBAA 1JY3N 2YKPA 3HUSB 4LLHA 3M9BA 2KOGA 2HLOA 2OYHC 1G1JA 1GU5A 2BASA 1HH0A 2HG5D 1FOSF 2Q3IA 1NKZB 4EIJA 1VPCA 5AW7B 1LTBC 2JJLA 2NPSA 2OYIC 3RK3D 5CJ4A 2HPCB 3P32A 1RF1A 3U59A 1GL2D 3M9QA 4M3LA 3R2PA 5APVA 3HD7A 1LTIC 3KYQA 3B8EB 1H8AA 1M1JA 2KSJA 3HE5B 1GW4A 2O1KA 2FXMA 1SQXK 2KLVA 3A7OA 3RK2C 5BVZA 1YTZI 2YKQA 1YTZT 1T3UA 1URQC 1N86A 1JY2N 1A02F 1HGVA 1HUCA 3TNUA 1NTKK 1S9KD 3VN0A 1N7SC 2LKMA 2FYUK 1FAVA 3U1AA 1NOHA 1CZQA 2E42A 1IFMA 1IO4A 2WSFH 1JNMA 1MUUA 1N2DC 1CW5A 1NH4A 1SFCB 2HODA 3EFGA 2FFDB 1LT9C 1T3JA 4W7ZA 3O8ZA 3HUSA 3PP5A 3KPEA 5APUA 3C9IA 1QL2A 5APYA 4N6JA 1NHLA 1JCDA 4IFDK 3KQGA 1FBMA 1N7LA 3OA7A 1G2CB 2R5DA 1GL2C 1JTHB 2GUSA 4WY4B 5APXA 2XV5A 1J1EC 1M7LA 2A45G 1HWTC 2O1JA 1FZCB 3VP8A 3HE5A 5AVSB 3V5BA 2XNXA 2XZRA 4N78E 1RF0A 2NPSC 1KILB 5AVQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1J B;  3GHG C;  2OYI C;  3GHG A;  1FZC C;  1W2E A;  2OYI A;  1LWU C;  1FZC A;  1LWU A;  1RE3 C;  2HPC B;  1LTJ B;  1RF1 C;  1RE3 A;  1RF1 A;  1JY2 P;  1FZA A;  2OYH B;  2HOD B;  1LT9 B;  3E1I A;  3H32 A;  1FZF A;  2FFD C;  1M1J C;  2Z4E A;  1M1J A;  2FFD A;  1JY3 N;  1N73 B;  1JY2 O;  1LTJ C;  2HPC A;  3BVH A;  1LTJ A;  3HUS B;  2A45 G;  2A45 H;  2HLO A;  2OYH C;  2HOD A;  1FZG A;  2FFD B;  2OYH A;  1LT9 C;  3GHG B;  1FZE A;  1JY3 P;  1LT9 A;  1FZC B;  2OYI B;  1RF1 B;  1FZB A;  1LWU B;  2XNX A;  2Q9I A;  2H43 A;  1T3U A;  1RF0 C;  3HUS C;  1N86 A;  1N73 C;  1JY2 N;  1RF0 A;  3HUS A;  3H32 B;  1N73 A;  1RE4 C;  1JY3 O;  1RE4 A;  2A45 I; 
#chains in the Genus database with same CATH topology
 4GDO A;  5DJU B;  2MKV A;  3OJA B;  4WB4 A;  2KK7 A;  1M1J C;  5AVZ B;  4HB1 A;  2K3R A;  2ZYG A;  5APS A;  3F5H A;  5APQ A;  1EZV G;  2XU6 A;  1EXJ A;  2B87 B;  1NTM G;  3RL0 B;  2QE7 H;  2D2C B;  3AE4 C;  3H1H E;  3AE6 C;  3VMX A;  1YJ9 P;  2AXC A;  2KB7 P;  1P84 I;  4PJ0 H;  2I1K A;  1JTH A;  1LTT C;  3SWK A;  1SFC D;  2IFM A;  3H32 B;  3GHG A;  3H6P A;  3RBX A;  5CCH D;  4I7Z C;  1SQX J;  3TGU D;  3L74 E;  1PGQ A;  2WSE J;  3T97 B;  2DW3 A;  3CCJ P;  1N73 A;  1NTZ D;  1RE4 A;  1JMM A;  3CX5 E;  1KIL D;  3VP9 A;  1X9V A;  1YQ3 C;  1LTG C;  1SQP K;  2KZI A;  1URQ B;  5K5G B;  3TF5 A;  2OTJ P;  3CXH H;  1SQB K;  3BCC J;  1BE3 D;  3H1H G;  3JC2 2;  2YMY A;  3H1H J;  1ZRT E;  4PD4 E;  4A7P A;  3AE2 C;  1RQV A;  1LT9 B;  3BAS A;  2N1T B;  1CSB A;  2KS1 B;  2W27 A;  3B5N A;  3VMA A;  4GKG A;  2PGD A;  3L35 A;  2E74 D;  3GHG C;  2HR3 A;  3KDP B;  3LID A;  3L74 G;  3O6Q A;  3L71 E;  4K35 A;  1Q86 Q;  2KIK A;  1SQV E;  3WMM 0;  2R3S A;  3JCU E;  4HKZ H;  1J1D B;  2FYN B;  1Q7Y Q;  1SQX D;  1QGK B;  3Q5S A;  3RL0 g;  4W80 A;  1BDD A;  1N73 C;  1RE4 C;  1K05 A;  3H1K D;  1SFC A;  2JP3 A;  5KLV K;  1YI2 P;  3GF3 A;  4KJM A;  5CCH A;  4ASW A;  1R5S A;  2ZXX A;  3CWB J;  4H44 C;  2IYO A;  2QA4 P;  1ZV8 A;  5KTB A;  2WMM A;  3GG2 A;  5GTI H;  5M1B A;  1KV4 A;  3SWF A;  2K9J A;  1S1C X;  1SQQ G;  1FJK A;  4UB6 H;  2YIU C;  5AVX B;  1SQQ J;  3H1L J;  2L91 A;  3AEA C;  1XTG B;  1KYO I;  3B5N C;  2KSE A;  4AQR D;  3A0H H;  3L71 G;  1MV8 A;  4I7Z B;  2WT7 B;  3FWL A;  1SQV G;  1T6A A;  2AXT E;  2I8D A;  4I2L C;  3V2Q A;  2MJZ A;  1PGO A;  1HTL C;  1PPJ D;  1L0L D;  1EC5 A;  3MD0 A;  3UIA A;  2NPS D;  1BDC A;  1JOC A;  1SFC C;  2H8P D;  3HD7 D;  3U1C A;  3RL0 D;  1QEX A;  5CCH C;  1AFO A;  1AQT A;  4C46 A;  2KP8 A;  2WSE H;  1Q2N A;  2NZ2 A;  3CWB D;  4NPD A;  1NU1 G;  1T2K D;  3WUT A;  1T8Z A;  2QJY C;  5CMZ A;  4L73 A;  1NU1 J;  1PP9 E;  4NPE A;  2OYI A;  1OX3 A;  2J58 A;  4N3Y B;  2YKO A;  1ZXG A;  3S4R A;  3A0B E;  3Q2Y A;  2OGU A;  1E79 H;  3GHG B;  3H1L D;  4PV1 B;  1QLE D;  2R3C A;  4N78 D;  1BGY D;  3KZI E;  2AEJ A;  1ZP0 C;  2FYU D;  1ZW0 A;  2O3J A;  2JEE A;  1N73 B;  2IZ0 A;  3V4Q A;  2W90 A;  4JYC A;  1X22 A;  1URQ D;  3WU2 H;  3L70 E;  3NXS A;  3G3Z A;  3CC2 P;  4H44 B;  3BAT A;  1ZN5 A;  1NTM K;  2HOD B;  5B66 H;  2R44 A;  1JY3 N;  3L75 E;  1KB9 E;  5KAF E;  3CPW O;  4LLH A;  1PP9 G;  2BAS A;  2K1A A;  3CX5 H;  1HH0 A;  4EIJ A;  5AW7 B;  2NPS A;  3KHU A;  2YIU B;  2OYI C;  1GL2 D;  3M9Q A;  2BCC D;  3HD7 A;  3AE1 C;  1LTI C;  3HE5 B;  3H1J E;  1SQX K;  2KZJ A;  3A7O A;  4OGQ C;  4PD4 H;  3O6Q B;  4JPZ B;  1MKM A;  1YTZ T;  3H1I E;  1T3U A;  3L72 E;  2Y0D A;  3AED C;  4DJG A;  3TNU A;  2A06 E;  3U1A A;  1NOH A;  1CZQ A;  3L73 E;  3B4S A;  3L70 G;  1NH4 A;  1SFC B;  3L70 J;  2KNC B;  4GOF A;  3KPE A;  1ZME C;  1QL2 A;  1DEE G;  4D6T G;  3L75 G;  1NHL A;  3AE3 C;  1M1K Q;  3KQG A;  2ZT9 D;  4D6T J;  1G2C B;  5APX A;  2XV5 A;  2QJY B;  2O1J A;  1H0T A;  5AVS B;  1EXI A;  1KQS O;  3CCL P;  2YXR B;  1RF0 A;  2NPS C;  1KIL B;  5AVQ B;  1JM0 A;  3CCR P;  1BSH A;  4U7J A;  3HD7 C;  4YTP C;  3C1L A;  1GU4 A;  3H1I G;  3L72 G;  3M0D A;  1GZL A;  2IYP A;  3H1I J;  2A06 G;  3G9R A;  3LW5 J;  2FFD A;  4JQ0 D;  1T2K C;  1W2E A;  1FZA A;  1K73 Q;  5APW A;  5GTH E;  1FU1 A;  2YO3 A;  2AXT H;  2E74 B;  4WWI A;  4WY4 A;  1GDT A;  4H0L C;  4OH8 B;  3RK3 E;  4Y99 C;  3AE8 C;  1EDJ A;  2NRG A;  3WUV A;  3TGU E;  1R8E A;  5KKZ C;  3L37 A;  4I6M C;  2QG4 A;  4Z1M H;  2IBZ D;  3IFM A;  3H25 A;  1SQQ K;  2M5A B;  2Z5I A;  1NTZ E;  3NFQ A;  1NTK J;  1RF0 C;  1KIL E;  1S9K E;  1Z56 A;  1X8Y A;  5KLV D;  2IZ1 A;  1AA0 A;  1LP1 B;  2WZ7 A;  3PJS K;  1OW6 A;  1Q82 Q;  3PRJ A;  3M0D C;  1BE3 E;  2B9B A;  2XND H;  3V2N A;  2M0B A;  4JF7 A;  3AE5 C;  2FFD C;  2A45 I;  3A0B H;  5APT A;  1LWU A;  3EQ2 A;  2N9Y B;  3FGA D;  2Y9Y A;  3CL3 D;  2UWJ E;  3A2A A;  4IFF A;  1UIX A;  3KZI H;  4L75 A;  4DT0 A;  4WY4 C;  4U3F J;  4H13 C;  3TGU G;  4DZO A;  2P67 A;  3CXH D;  1EQ7 A;  1NU1 K;  1GTW A;  3L36 A;  5CBO A;  1NTZ G;  4L76 A;  2NPS B;  3B5N D;  1L0N E;  1VQL P;  3W67 A;  2HYN A;  1FS0 E;  2ZFC A;  2LR2 A;  3H1K E;  3HD7 B;  3AEF C;  2WWW A;  3Q1M A;  1NTM J;  1YYC A;  1KB9 H;  2M8R A;  1DX7 A;  1BE3 G;  3AEG C;  1DIP A;  2LXB A;  2WPS A;  2K9Y A;  3D71 A;  2ZT9 C;  2P2U A;  1Y9B A;  1LTA C;  1AVO A;  1E5W A;  4AYC A;  3TNU B;  1ZLL A;  2BEQ D;  1L2P A;  1N8R Q;  2YNY A;  1KN7 A;  1N7S D;  1LWU C;  1FZC A;  4KHX A;  3Q5P A;  4HH2 A;  4H0L B;  3CMA P;  5AW5 B;  2FY8 A;  1KQG B;  4Y99 B;  1G1I A;  3LW5 H;  3G6E P;  5KKZ B;  3M06 A;  3CCV P;  3G71 P;  3FX0 A;  3V4W A;  1L0N G;  3M91 A;  3PH0 A;  1L0L E;  3MUD A;  2I1J A;  3MGN A;  3H1K G;  2KYV A;  1LTJ A;  3P8M C;  3TSI A;  2CK3 H;  2GM4 A;  1QL1 A;  2PAJ A;  4GOD A;  1EZV D;  1NTM D;  3FXE A;  5BU5 A;  1S5L E;  4XE5 B;  1CI6 B;  1KTM A;  2IPP A;  1X79 B;  1WRG A;  2OYH A;  1DD3 A;  5AW1 B;  4Y28 J;  2Q9I A;  3HTK B;  3HE4 A;  1VQK P;  1GL2 B;  1FZC C;  3HRN A;  1J1E B;  1PFI A;  2ITA A;  4CPG A;  2P1J A;  2WSC H;  3L74 J;  1P84 E;  2CPB A;  5AVR B;  2WTY A;  2C9N Y;  2PFX A;  2SPZ A;  1BGY E;  1SVF A;  2W6B A;  3OW2 O;  1L0L G;  2XDJ A;  5BU8 B;  1M1J B;  1PV3 A;  5GTH H;  2FYU E;  1RQU A;  1R5L A;  1N7S A;  1TU3 F;  4XFJ A;  3MUD C;  4OGQ D;  1LTJ C;  4ZKU A;  3NMD A;  3BCC D;  3GW6 A;  2ZT9 B;  4BRY B;  2H88 C;  2O01 H;  5KLI C;  3H1H D;  4WBA A;  2YKP A;  3M9B A;  2OYH C;  4YXD C;  3QWO C;  4L74 A;  2HG5 D;  3SFE C;  2E75 D;  1KD1 Q;  3PHL A;  3L71 J;  2BCC E;  1SQV J;  3P32 A;  5APV A;  4K3A A;  1GW4 A;  1BGY G;  4IL6 E;  2KLV A;  5DJT B;  3RK2 C;  5BVZ A;  1YTZ I;  4BWN A;  2FYU G;  1M8O B;  1A02 F;  1HUC A;  1Q81 Q;  1NTK K;  2PRR A;  3D6Z A;  5B5E E;  1N7S C;  2LKM A;  3CX5 D;  1FE6 A;  1IFM A;  1IO4 A;  2RKL A;  1LNQ A;  1MUU A;  2IBZ I;  3EFG A;  1T3J A;  4W7Z A;  1QVG O;  3HUS A;  1K9M Q;  2V7Q J;  4PD4 D;  4RKU J;  4KT0 J;  1JCD A;  2WVR A;  3I56 P;  4IFD K;  1N7L A;  4UB8 E;  2B88 A;  1JTH B;  2GUS A;  1BSN A;  1M7L A;  1LT1 A;  3C8V A;  1YHQ P;  1FZC B;  3VP8 A;  1SQQ D;  1OVR A;  4H0L D;  2XNX A;  3V5B A;  3EWK A;  3CME P;  5C39 A;  2W8Z A;  4R4L A;  1RE3 A;  1H89 A;  3L71 D;  1SQP E;  1LGH B;  2P58 A;  2ZXE B;  4W7Y A;  1SQB E;  1VQ4 P;  1IFJ A;  1KYO E;  4C7N A;  3V2P A;  1H88 A;  1OIP A;  3CXH I;  1RH5 B;  1LTJ B;  1DH3 A;  3M9H A;  3G4S P;  2JWA A;  1JB0 J;  5KJ7 D;  1JY2 O;  2W6J H;  5CCG D;  1SLQ A;  2WPR A;  5KLI B;  3HUS C;  1PP9 J;  4I1L A;  4ZNC A;  2RN0 A;  1IFN A;  2GA1 A;  2OYH B;  3VOP A;  1NU1 D;  3B5N B;  1U7J A;  2E5Y A;  2IBZ E;  4IFM A;  1GW3 A;  1ZR2 A;  1QX8 A;  2GUV A;  4WY4 D;  4H13 D;  4PJ0 E;  2HFE D;  5AW0 B;  2WSS H;  1SQP G;  2V4H A;  5KLV E;  1FDM A;  4YPC A;  2AEM A;  3CCS P;  1BCC E;  2B87 A;  1RE3 C;  1SQB G;  1VQ8 P;  1FJP A;  1OVV A;  1M56 D;  2R32 A;  5AW8 B;  3NTN A;  5AVT B;  1L4A D;  1SP4 A;  1NJI Q;  4IOI H;  3MHV A;  1N7S B;  1YJW P;  1D7M A;  2G3A A;  2L5G B;  1JO5 A;  1P84 H;  2E75 C;  3JCU H;  2QVA A;  3H32 A;  4WVZ A;  5H2F E;  3SWY A;  1NGM B;  3L75 J;  2HPC A;  5AW4 B;  4RJT A;  1IJD B;  3II6 A;  4NPF X;  2E5T A;  2K9J B;  1EDL A;  3CXH E;  4AUW A;  2IBZ G;  2P10 A;  1EZV I;  2OTK E;  4TLF A;  4B86 A;  1PP9 D;  3VMY A;  3H1J G;  1VQP P;  1U57 A;  3Q5R A;  3H1J J;  3CI9 A;  2N9B A;  5KLV G;  1VQN P;  2O01 N;  2OQQ A;  3D6Y A;  3AEB C;  4O9B A;  5KJ7 A;  1BCC G;  3L72 J;  2Q3E A;  2V7Q H;  5CCG A;  3L73 G;  3L73 J;  4JBZ A;  1RHZ B;  1U7M A;  2D2C C;  2Q6Q A;  1ZR4 A;  1NKN A;  2YXQ B;  2N1T A;  3BRT B;  2ZJS E;  1PGJ A;  2FKW B;  1ZOY C;  3L70 D;  3MTU E;  2KS1 A;  4XA4 A;  3CCE P;  4IL6 H;  2Y0C A;  3MP7 B;  1S2E A;  2WPV B;  4GT1 A;  4D6T D;  3L75 D;  1KB9 D;  2WSF J;  2OYI B;  1MFT A;  1L4A A;  5B5E H;  2Q7C A;  1YBK A;  1VQ5 P;  4DOJ A;  1KFM A;  4OGQ B;  1MZ9 A;  1S72 P;  1SQV K;  1NYH A;  3A5T A;  2Q1K A;  3S9O A;  4YXW H;  3ITK A;  2WSC J;  2W83 C;  1WT6 A;  4UB6 E;  5KJ7 C;  2JDI H;  3CC4 P;  3I5C A;  5CCG C;  4UB8 H;  3H1I D;  1IFP A;  3N4X A;  1KFN A;  1HVV A;  2JR8 A;  2JO1 A;  4C7N B;  2A06 D;  2WPQ A;  1JCC A;  1VL2 A;  3CLQ A;  1JEK A;  2VRS A;  1EDI A;  2M3E A;  2N1T C;  2E76 D;  2E75 B;  2H89 C;  2IDB A;  3TK1 A;  1OW7 A;  1NWQ A;  2J5U A;  5AW9 B;  1WMK A;  3TGU J;  3CX5 I;  2WT7 A;  4GOE A;  1KYO H;  3CCU P;  2O01 J;  1SQX E;  5AVV B;  3D70 A;  3USS A;  1NTZ J;  1Q90 D;  1J1D C;  1FZB A;  1L4A C;  1KQF B;  1RY3 A;  1JY3 O;  2P7J A;  4PD4 I;  1NVO A;  3P8C D;  1NTK D;  1FDO A;  1VDF A;  5KAF H;  4RO0 A;  2C9L Y;  4ZKP A;  2QIW A;  3RK2 D;  3VYI A;  1BE3 J;  3IAO A;  1OVU A;  3SSU A;  1FZE A;  3BCC E;  4HYT B;  2AEF A;  2C0X A;  1MFZ A;  3CCM P;  2RH0 A;  4DCK A;  3ZDM A;  3F89 A;  3JSV C;  1FOS F;  1VPC A;  1KMI Z;  1LTB C;  2JJL A;  3RK3 D;  3WU2 E;  1SQX G;  4U3F D;  2HPC B;  1RF1 A;  3U59 A;  1PPJ E;  2KSJ A;  1H0T B;  1L0N J;  1VF5 C;  2FXM A;  1AJY A;  2OTL P;  3V6I A;  5B66 E;  2YKQ A;  3H1K J;  2ZYD A;  1N86 A;  1JY2 N;  1HGV A;  5H2F H;  1S9K D;  1FAV A;  4R4M A;  2E42 A;  2WSF H;  3BCC G;  3GLM A;  2QJP C;  3CWB E;  2HOD A;  2FFD B;  1HJ0 A;  3K5B A;  3O8Z A;  3RGU A;  4OWF A;  3PP5 A;  5APU A;  5APY A;  3E7K A;  1FBM A;  5E79 E;  5EFW B;  3OA7 A;  3PTZ A;  5CBN A;  4WY4 B;  4H13 B;  2A45 G;  1SQQ E;  3H1L E;  4EYY Q;  3HE5 A;  1K04 A;  4N78 E;  1PPJ G;  2QEX P;  4QMA A;  4PV1 C;  1RF1 C;  1L0L J;  1IFD A;  1JY2 P;  3LIE A;  4EDF A;  1L4A B;  1USE A;  2QJK C;  2OYO A;  3MIW A;  2CPS A;  1L0N D;  2KUB A;  3CD6 P;  5AW3 B;  2E76 C;  3CC7 P;  5TJH A;  1KZU B;  4ZMD A;  1HJB A;  3CWB G;  2KNC A;  1JMB A;  3KXD A;  3BVH A;  1X0T A;  2K37 A;  1G2C A;  1LWU B;  2H43 A;  4EOT A;  1LTS C;  1HGZ A;  3E1R A;  1S4X A;  2Y0E A;  1DD4 A;  1OWA A;  1SS1 A;  1FC2 C;  4EI2 A;  2ZVN B;  1NU1 E;  3CCQ P;  3H1L G;  1KIL A;  1K8A Q;  4C7R A;  4BXL A;  3L74 D;  1FOS E;  1W5C E;  1BGY J;  1NAF A;  3BRV B;  2FYU J;  3WUU A;  1VF5 B;  3VMZ A;  5AVU B;  1M57 D;  5AVW B;  1IC2 A;  1KB9 I;  1YIJ P;  1USD A;  3ABV C;  1GK6 A;  1OZH A;  3V2R A;  2IFN A;  3S1K A;  3MZW B;  4HJG H;  4ASV A;  1DEB A;  3IN6 A;  2XKM A;  2QJP B;  1ZRT D;  3AEC C;  3RK3 C;  2D2C D;  2LXC B;  2ZYA A;  3AE7 C;  4TT3 H;  3W68 A;  2IX7 C;  2QM8 A;  2BCC G;  5TIS E;  1YQ4 C;  2BCC J;  1QVF O;  2M5A A;  1AVY A;  1IFI A;  4LC1 A;  2Z5H A;  1KIL C;  2QM7 A;  1SQV D;  1KOR A;  3R4Y A;  1VQM P;  1P84 D;  3TYY A;  1LP1 A;  1RF1 B;  1NTZ K;  5AW2 B;  5L8R J;  1Y47 A;  2QJK B;  4RES B;  3TDK A;  2WIT A;  2ZVO B;  5KAI E;  5AW6 B;  2E76 B;  3QH9 A;  1GK4 A;  2A45 H;  1NO4 A;  2E43 A;  4LGD E;  2KI7 B;  2H7H A;  2E74 C;  3N7N A;  3Q3D A;  3PLN A;  3IR9 A;  1FZF A;  4D6T E;  1GMJ A;  2C0W A;  2N1T D;  3HE4 B;  2FBW C;  1J2J B;  5CHX A;  3A3Y B;  3AE9 C;  3B71 A;  3GMA A;  1JUN A;  1IK9 A;  1S5L H;  1SQP J;  1VQ6 P;  2J59 M;  3RK2 B;  3E1I A;  3L4F A;  1SQB J;  1HBW A;  5AVY B;  2M3B A;  1PIX A;  1XTC C;  1FZG A;  1PZQ A;  2BEZ F;  1L0N K;  4JYB A;  5E79 H;  3I55 P;  1YJN P;  1EDK A;  3AEE C;  3FWN A;  2R5B A;  2Z4E A;  1AV1 A;  1M90 Q;  2W6A A;  4GIF A;  3M0A A;  1JY3 P;  1S5L X;  2KLU A;  2POH A;  3RK3 B;  1OXZ A;  3T97 A;  3IF4 A;  1S3J A;  1W2B O;  2YO2 A;  1AQ5 A;  1KC8 Q;  2Q5U A;  2YMK A;  3VTP C;  5KLV J;  2JWD A;  3P8C E;  1URQ A;  2QSI A;  1NTK E;  1OMI A;  4OVN F;  1BCC J;  1KQL A;  2B89 A;  1VQO P;  3RL0 C;  1VQ7 P;  1L0L K;  2OAR A;  1SQP D;  1VF5 D;  2KXP B;  1VQ9 P;  5CJ0 A;  1YIT P;  1SQB D;  1A02 J;  1LT9 A;  1KYO D;  1IK7 A;  2ZAE B;  1CI6 A;  3P7K A;  3GF7 A;  2PP6 A;  2FYZ A;  1PL5 A;  1Y8A A;  3HTK A;  1GD2 E;  3OAK A;  1GL2 A;  1IZN B;  1HF9 A;  4MN4 C;  3HUS B;  2KOG A;  2HLO A;  1OW8 A;  1G1J A;  1GU5 A;  1UII A;  2Q3I A;  1NKZ B;  4U3F E;  3EFF K;  5CJ4 A;  2QRX A;  4M3L A;  3R2P A;  1LJ2 A;  5GTI E;  3KYQ A;  3B8E B;  1H8A A;  1M1J A;  2Y9Z A;  2O1K A;  2FXP A;  1NTK G;  2K88 A;  3H1J D;  4IL6 X;  1URQ C;  4PV1 D;  1EZV E;  3L72 D;  3A0H E;  1NTM E;  3VN0 A;  1BCC D;  2FYU K;  3SFD C;  4BRY A;  1JNM A;  1N2D C;  3L73 D;  1CW5 A;  5TIS H;  1LT9 C;  3RBZ A;  2FXO A;  3FXD A;  3C9I A;  1OFC X;  1PGP A;  4N6J A;  2JKV A;  2R5D A;  1GL2 C;  4H44 D;  2WQY C;  1J1E C;  4U3F G;  1NAY A;  1HWT C;  2RMZ A;  1FDI A;  2FYN C;  2XZR A;  2G8Y A;  5KAI H; 
#chains in the Genus database with same CATH homology
 1RF1 C;  1RE3 A;  3OJA B;  1IFD A;  4WB4 A;  1H89 A;  1JY2 P;  3HD7 C;  1LGH B;  3LIE A;  1M1J C;  5AVZ B;  2ZXE B;  1L4A B;  4W7Y A;  1GU4 A;  3MIW A;  1IFJ A;  2CPS A;  5APS A;  3M0D A;  4C7N A;  1GZL A;  5APQ A;  2XU6 A;  5AW3 B;  3V2P A;  1H88 A;  3RL0 B;  2FFD A;  1T2K C;  1W2E A;  1LTJ B;  1DH3 A;  1KZU B;  3VMX A;  1HJB A;  1FZA A;  3M9H A;  5APW A;  2KB7 P;  5KJ7 D;  1FU1 A;  2YO3 A;  1JY2 O;  3BVH A;  1G2C A;  2I1K A;  5CCG D;  1JTH A;  1SLQ A;  2WPR A;  1LTT C;  1LWU B;  4WY4 A;  1GDT A;  1SFC D;  2IFM A;  2H43 A;  3HUS C;  4EOT A;  1LTS C;  3H32 B;  1HGZ A;  4OH8 B;  4I1L A;  4Y99 C;  1OWA A;  3GHG A;  3H6P A;  5CCH D;  1IFN A;  2OYH B;  3VOP A;  1KIL A;  3L37 A;  3B5N B;  4I6M C;  4IFM A;  1GW3 A;  4C7R A;  1ZR2 A;  2GUV A;  4WY4 D;  1FOS E;  3IFM A;  1SQQ K;  1NAF A;  2Z5I A;  3NFQ A;  2HFE D;  3BRV B;  1RF0 C;  5AW0 B;  1N73 A;  1RE4 A;  1FDM A;  1S9K E;  1JMM A;  1Z56 A;  1X8Y A;  1RE3 C;  1KIL D;  3VP9 A;  3VMZ A;  5AVU B;  1X9V A;  2WZ7 A;  1FJP A;  5AVW B;  1LTG C;  2R32 A;  1SQP K;  5AW8 B;  1IC2 A;  3NTN A;  1URQ B;  5AVT B;  3M0D C;  1L4A D;  1SQB K;  1SP4 A;  3V2N A;  1GK6 A;  3V2R A;  4JF7 A;  1N7S B;  2IFN A;  2YMY A;  2FFD C;  2L5G B;  2A45 I;  1DEB A;  5APT A;  1JO5 A;  2XKM A;  1LWU A;  3EQ2 A;  3RK3 C;  1LT9 B;  3BAS A;  3H32 A;  2N1T B;  3SWY A;  3CL3 D;  2HPC A;  1CSB A;  3A2A A;  5AW4 B;  4IFF A;  2IX7 C;  1IJD B;  2W27 A;  3B5N A;  3II6 A;  4GKG A;  4WY4 C;  2QM8 A;  3L35 A;  4AUW A;  4DZO A;  2P67 A;  3GHG C;  3KDP B;  3LID A;  1EQ7 A;  4B86 A;  1IFI A;  3VMY A;  4LC1 A;  2Z5H A;  1KIL C;  1NU1 K;  3WMM 0;  2QM7 A;  1GTW A;  3L36 A;  1J1D B;  3CI9 A;  2N9B A;  2NPS B;  3TYY A;  3B5N D;  2HYN A;  4O9B A;  4W80 A;  5KJ7 A;  1RF1 B;  2ZFC A;  1NTZ K;  3HD7 B;  1N73 C;  5CCG A;  5AW2 B;  1RE4 C;  2WWW A;  1SFC A;  5KLV K;  1YYC A;  4RES B;  2WIT A;  2M8R A;  1DX7 A;  5AW6 B;  5CCH A;  2WPS A;  2P2U A;  1LTA C;  1E5W A;  1ZR4 A;  4AYC A;  1NKN A;  1GK4 A;  2A45 H;  3TNU B;  2N1T A;  3BRT B;  1ZLL A;  2FKW B;  1ZV8 A;  5KTB A;  1NO4 A;  2E43 A;  4LGD E;  2YNY A;  1N7S D;  3MTU E;  3SWF A;  4XA4 A;  2H7H A;  1LWU C;  1FZC A;  3N7N A;  4KHX A;  3IR9 A;  1FJK A;  1FZF A;  5AVX B;  4HH2 A;  5AW5 B;  2C0W A;  2N1T D;  4GT1 A;  3HE4 B;  1XTG B;  4Y99 B;  3B5N C;  4AQR D;  1G1I A;  2OYI B;  3LW5 H;  1MV8 A;  1L4A A;  2WT7 B;  1J2J B;  5CHX A;  3A3Y B;  2Q7C A;  3M06 A;  1JUN A;  3V4W A;  1KFM A;  1IK9 A;  4DOJ A;  4I2L C;  3V2Q A;  2J59 M;  2MJZ A;  3M91 A;  3RK2 B;  1MZ9 A;  3E1I A;  3L4F A;  1SQV K;  1HTL C;  3A5T A;  3MUD A;  2I1J A;  3MGN A;  1HBW A;  2KYV A;  3MD0 A;  1LTJ A;  2M3B A;  5AVY B;  3P8M C;  3UIA A;  1XTC C;  1FZG A;  1WT6 A;  5KJ7 C;  1L0N K;  2NPS D;  3TSI A;  4JYB A;  1JOC A;  3I5C A;  5CCG C;  2GM4 A;  1SFC C;  2H8P D;  1QL1 A;  3N4X A;  2PAJ A;  3HD7 D;  3U1C A;  1KFN A;  1HVV A;  3RL0 D;  4C7N B;  5CCH C;  2WPQ A;  2R5B A;  1AFO A;  1JCC A;  4C46 A;  2KP8 A;  2Z4E A;  2WSE H;  5BU5 A;  3CLQ A;  4XE5 B;  2VRS A;  1CI6 B;  2IPP A;  2W6A A;  4GIF A;  1X79 B;  1WRG A;  2N1T C;  2OYH A;  3M0A A;  1JY3 P;  5AW1 B;  2Q9I A;  2POH A;  3RK3 B;  1OXZ A;  3TK1 A;  1NWQ A;  3HTK B;  1T2K D;  1T8Z A;  3HE4 A;  5CMZ A;  5AW9 B;  3T97 A;  1GL2 B;  1FZC C;  2OYI A;  2WT7 A;  3HRN A;  2J58 A;  1J1E B;  2YKO A;  4N3Y B;  1PFI A;  2P1J A;  2WSC H;  2CPB A;  2YO2 A;  1AQ5 A;  5AVR B;  5AVV B;  2WTY A;  3GHG B;  2C9N Y;  2Q5U A;  1J1D C;  1FZB A;  1L4A C;  3VTP C;  1SVF A;  2W6B A;  3P8C E;  1URQ A;  1RY3 A;  2R3C A;  4N78 D;  2XDJ A;  1JY3 O;  2P7J A;  5BU8 B;  1M1J B;  3P8C D;  1VDF A;  1KQL A;  1N7S A;  2C9L Y;  3RL0 C;  4ZKP A;  1L0L K;  2OAR A;  3RK2 D;  3VYI A;  2JEE A;  1N73 B;  1LTJ C;  5CJ0 A;  1A02 J;  1FZE A;  1LT9 A;  3V4Q A;  4JYC A;  1URQ D;  4ZKU A;  3NXS A;  4HYT B;  1CI6 A;  3NMD A;  2C0X A;  3G3Z A;  3P7K A;  1MFZ A;  2PP6 A;  2FYZ A;  2O01 H;  1ZN5 A;  3BAT A;  1NTM K;  3HTK A;  2HOD B;  1GD2 E;  3OAK A;  1GL2 A;  4WBA A;  1JY3 N;  2YKP A;  3HUS B;  4LLH A;  3M9B A;  2KOG A;  2HLO A;  2OYH C;  1G1J A;  1GU5 A;  2BAS A;  1HH0 A;  2HG5 D;  1FOS F;  2Q3I A;  1NKZ B;  4EIJ A;  1VPC A;  5AW7 B;  1LTB C;  2JJL A;  2NPS A;  2OYI C;  3RK3 D;  5CJ4 A;  2HPC B;  3P32 A;  1RF1 A;  3U59 A;  1GL2 D;  3M9Q A;  4M3L A;  3R2P A;  5APV A;  3HD7 A;  1LTI C;  3KYQ A;  3B8E B;  1H8A A;  1M1J A;  2KSJ A;  3HE5 B;  1GW4 A;  2O1K A;  2FXM A;  1SQX K;  2KLV A;  3A7O A;  3RK2 C;  5BVZ A;  1YTZ I;  2YKQ A;  1YTZ T;  1T3U A;  1URQ C;  1N86 A;  1JY2 N;  1A02 F;  1HGV A;  1HUC A;  3TNU A;  1NTK K;  1S9K D;  3VN0 A;  1N7S C;  2LKM A;  2FYU K;  1FAV A;  3U1A A;  1NOH A;  1CZQ A;  2E42 A;  1IFM A;  1IO4 A;  2WSF H;  1JNM A;  1MUU A;  1N2D C;  1CW5 A;  1NH4 A;  1SFC B;  2HOD A;  3EFG A;  2FFD B;  1LT9 C;  1T3J A;  4W7Z A;  3O8Z A;  3HUS A;  3PP5 A;  3KPE A;  5APU A;  3C9I A;  1QL2 A;  5APY A;  4N6J A;  1NHL A;  1JCD A;  4IFD K;  3KQG A;  1FBM A;  1N7L A;  3OA7 A;  1G2C B;  2R5D A;  1GL2 C;  1JTH B;  2GUS A;  4WY4 B;  5APX A;  2XV5 A;  1J1E C;  1M7L A;  2A45 G;  1HWT C;  2O1J A;  1FZC B;  3VP8 A;  3HE5 A;  5AVS B;  3V5B A;  2XNX A;  2XZR A;  4N78 E;  1RF0 A;  2NPS C;  1KIL B;  5AVQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...