5KAIH

Nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
63
structure length
63
Chain Sequence
b'ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Electron transport
total genus 15
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5kaiH01
3A0BH 5KAFH 4UB6H 5E79H 5B5EH 3A0HH 3KZIH 4PJ0H 1S5LH 5TISH 5H2FH 5KAIH 4IL6H 4UB8H 5B66H 5GTIH 2AXTH 5GTHH 3WU2H 3JCUH
chains in the Genus database with same CATH superfamily
5E79H 1VQ8P 3BCCD 1KZUB 2W27A 4B86A 3AE2C 3HUSA 5BU5A 1Y9BA 3Q2YA 1LT9A 4HB1A 3A2AA 3HUSB 2D2CC 3FWLA 5CJ0A 1N73A 3S9OA 4GDOA 1FJKA 3L75G 1LTGC 3O8ZA 2V7QJ 1NTZJ 2Z5HA 1H0TA 4IFMA 3V4WA 4I2LC 4DOJA 2KYVA 2IZ0A 3AE4C 3MD0A 3M06A 1HBWA 4HYTB 1H0TB 1QX8A 1GMJA 4PD4H 3C9IA 2IFMA 3TGUJ 5B66H 4GT1A 3A0HE 4JYCA 1EDKA 4A7PA 2A06G 4C7RA 5BU8B 4Y28J 1U57A 2GA1A 3NMDA 1SQPK 1L0LG 3BRVB 2P58A 4GODA 2Q5UA 1S3JA 3AEDC 1NWQA 3BCCJ 2O01N 3L70G 1L0ND 3VTPC 5KAIE 4OVNF 1NVOA 2Q3EA 3BRTB 3PH0A 1JNMA 2IBZE 5B5EE 2BCCJ 1XTCC 2OYIA 3M0DC 1SQQD 1PP9G 5AW3B 2UWJE 5APUA 2IBZD 1BE3G 2OYIB 1NOHA 3HRNA 5GTHH 3ABVC 2YKOA 2YO3A 1NAFA 3H1JG 2OTKE 2HG5D 3W68A 1FZBA 4ASWA 1H88A 4JPZB 2C0XA 1SQXE 4D6TD 1GZLA 3B5NA 2WSEH 4JF7A 1U7JA 2N9BA 2ZT9B 1NTKG 3B5NB 1BGYJ 3CCLP 4H13B 1SQXD 3C8VA 1KB9H 1FZGA 1EXJA 4I1LA 1K04A 4EIJA 1L0NJ 1H89A 2W6AA 1PPJE 1RF1B 3HUSC 3GF3A 4EYYQ 2OGUA 1EDLA 4KHXA 1SFCA 1T6AA 2J59M 4ZKPA 1DX7A 3O6QA 1SQBK 1S9KE 1BSNA 4ZNCA 1SQQJ 2FKWB 5AVRB 5AW5B 2E5YA 5CCGD 3CCVP 4IL6E 1M90Q 3L74G 3M9HA 1VQ5P 1NU1J 1RF0A 2WTYA 3MHVA 3IR9A 2BEQD 1JY2N 1LTJB 1EDIA 2V7QH 4D6TJ 2L5GB 1FZAA 3VN0A 3H1ID 3VYIA 1YBKA 2N1TA 1HUCA 2Q9IA 1BCCG 1QEXA 1SQBG 2LXBA 1FOSE 3CX5I 1JTHA 1FDMA 4U3FD 1JTHB 4DZOA 4R4LA 1JM0A 1JY3N 1NO4A 4R4MA 2KZJA 5TISH 5H2FE 2PAJA 3EFGA 3CI9A 1YQ3C 2ZT9D 3B5ND 1UIIA 1DD3A 1PIXA 4H13D 3KYQA 3LIDA 1W2BO 5DJUB 2IYPA 3VMZA 2BEZF 5CCGC 3PRJA 2ZXEB 2ZJSE 3ITKA 3CLQA 1OVVA 1GTWA 3R2PA 3SWKA 3D6ZA 3TNUA 3CC2P 3L72G 3Q5RA 3TNUB 2OYIC 2KI7B 3VMXA 3L75J 3L73E 4K35A 1RHZB 4OGQB 2A45H 1LNQA 1PP9D 3L71E 3QH9A 3CWBE 3ZDMA 1W2EA 1SQVD 4RJTA 2WWWA 3H1IJ 3WUVA 2R3SA 2ZT9C 3GG2A 2QIWA 1Q2NA 1YI2P 1Q90D 4H13C 4Z1MH 1AQ5A 1ZLLA 5AW1B 3VP9A 4PD4I 4U3FJ 3V5BA 5M1BA 3V6IA 3CPWO 4LC1A 1LTAC 3M0AA 3W67A 1EZVE 5APXA 1FZCA 2JJLA 1OVRA 4L73A 2N1TD 2Q3IA 1RF1C 1FE6A 4BRYA 1FZCB 1OX3A 2K9YA 1EZVD 2KLUA 2DW3A 3A0HH 2ZAEB 5DJTB 1L0NK 1YHQP 2M5AA 2JDIH 2FYUD 1VPCA 1YIJP 1TU3F 2M5AB 1IFMA 2QA4P 3KXDA 4Y99B 4GIFA 2KNCA 2XV5A 3AE9C 1SQQK 2KNCB 1ZMEC 2BASA 3Q1MA 5KAIH 3H1HG 1PP9J 2CPBA 1YJNP 1LTJC 1BE3J 1RF0C 3FXEA 2AEMA 3H6PA 2K1AA 3SWYA 5EFWB 1IFIA 1OIPA 5AVUB 1SQVJ 5B5EH 1NTZE 2KUBA 1SLQA 2IZ1A 4OGQD 2KS1B 3CXHE 3EFFK 5KLIC 1PGQA 1NTZD 4RESB 1OFCX 1NGMB 1NTKJ 1BCCD 1SQXK 3HTKA 1VQOP 1Q7YQ 1KILA 2OQQA 2HODA 2W6JH 5TISE 1VQKP 1L4AA 4IL6X 1KILB 5KTBA 1KB9I 1KORA 1EQ7A 2HODB 3AE8C 1L4AB 2OARA 1IK9A 2HFED 2IFNA 1HVVA 1H8AA 3CCUP 1M1JB 2QJKB 1OWAA 3H1LD 2YMKA 3HD7B 2FYUJ 2AXCA 2Q6QA 1NTMG 3TDKA 2ITAA 3S1KA 3T97B 3BCCE 2P2UA 1SVFA 1S2EA 3S4RA 2LR2A 3P8MC 1ZV8A 2WVRA 1MZ9A 3H32A 1IFDA 2YKQA 3D70A 1JB0J 2CK3H 4BXLA 4OGQC 2O01J 3CL3D 1RH5B 3H32B 3CCQP 3H25A 1YQ4C 1HGZA 1Q86Q 2BCCE 3BASA 1WRGA 5AVSB 1AA0A 4XE5B 1X79B 2QVAA 1LGHB 1SS1A 4O9BA 1U7MA 4M3LA 3RGUA 3N4XA 2ZYGA 2BCCD 2YXRB 1RQVA 2JR8A 2XNXA 4HH2A 1JOCA 4IL6H 1PPJG 1ZP0C 3C1LA 1BCCJ 1DH3A 3BATA 5KLVD 2WMMA 3H1KG 1BGYE 1FZCC 2NPSB 2WT7A 4IOIH 1Y47A 2I1KA 4XFJA 3WMM0 2WT7B 3G3ZA 1IC2A 3RBXA 3H1LJ 5AVTB 1GW3A 1BGYD 3E7KA 3MIWA 1USDA 1KILD 1K9MQ 4Y99C 3A3YB 5H2FH 3F5HA 1L4AD 1FOSF 1P84D 1PGOA 1PGPA 2KB7P 1L0NE 4IFDK 1IFJA 4JQ0D 3WUTA 2RMZA 3HD7D 5CHXA 5CCGA 3FXDA 1KYOE 2ZFCA 3TSIA 5KJ7A 1YTZT 1PZQA 1SQQE 1A02J 1SQVK 1KYOD 2A45I 3I56P 2PRRA 3USSA 1GDTA 1DIPA 1NU1E 3CCMP 5AVWB 2G3AA 1QVGO 3NXSA 2KOGA 1SQPG 2H8PD 2B88A 3L4FA 1FAVA 1NU1D 3B8EB 2Q1KA 3B4SA 4D6TE 1J1DB 2FBWC 2QG4A 1KILC 5KLVJ 4WWIA 1LT1A 1NHLA 3GLMA 1L4AC 2P10A 3U1CA 3V2QA 1KQFB 2KP8A 2E74B 4UB8E 1M1JC 2IX7C 2AXTE 2QJKC 3L73G 4L76A 3HD7C 3AEEC 1D7MA 1RE3C 3AE7C 3L71G 1N7SA 3U1AA 3P8CE 2XZRA 3PTZA 3CWBG 1FU1A 2FYUK 1N7SB 1DD4A 1GU4A 3VP8A 4RKUJ 1XTGB 1AVYA 3PP5A 1ZRTE 3P8CD 1X9VA 1VQPP 1FBMA 5AVZB 1RF1A 3IF4A 1CSBA 4I6MC 1MV8A 1ZRTD 3LIEA 1OW7A 3UIAA 4JBZA 3H1HJ 3JC22 4TT3H 2WSFJ 4GOFA 1JUNA 2O01H 4WB4A 3L75E 1X0TA 1FC2C 3OAKA 1S1CX 1LTIC 2KXPB 1R8EA 1KTMA 1Q81Q 1NH4A 2IBZI 3L75D 2FXMA 4AQRD 1NTZK 3JSVC 1IFNA 1LTJA 1ZN5A 4YPCA 1Q82Q 5KJ7D 3H1IE 2KK7A 2E76B 1GD2E 2NPSC 4K3AA 1YJWP 4U3FE 2SPZA 3CXHH 1N2DC 3H1KD 2LKMA 3P32A 3N7NA 2OTLP 2HYNA 2KSEA 1PL5A 5KLIB 1L2PA 2P1JA 1WT6A 3IAOA 1VQNP 1L0LE 4N78D 2E74D 1NTMJ 2A06D 1GU5A 2XNDH 4PD4D 3FWNA 1L0LD 1PV3A 5KKZB 5TJHA 3MUDC 2W8ZA 3GF7A 4PV1B 3II6A 3LW5J 1N7SD 2QJYB 4YXDC 3U59A 2GUSA 3TK1A 5CBNA 1KD1Q 3MZWB 3L70D 5KJ7C 4LLHA 3TGUG 5CMZA 1G1IA 1ZOYC 4OWFA 1BDCA 2W90A 1UIXA 2FYNB 1MKMA 1N86A 5KAFE 2E75B 2HLOA 3KZIE 1HF9A 1PP9E 4HJGH 2Y0DA 1BE3E 2O1KA 1VDFA 3RK3C 1J1DC 4RO0A 1K8AQ 1SQVE 2CPSA 1EXIA 4EOTA 4ZKUA 1PGJA 1BE3D 3RK2C 3CD6P 5AW2B 5KLVK 2B89A 2E74C 3H1JD 4NPDA 3SWFA 1A02F 1JY2P 1NTKE 2K9JA 3H1KJ 2G8YA 2QJPB 2E76D 2K9JB 2A45G 1KQGB 3KPEA 1N7SC 1NTKD 2N9YB 2XKMA 5APTA 2YNYA 5L8RJ 2JWDA 2WSCJ 4L74A 5AW9B 1JY3P 1L0LJ 3AE3C 5APYA 1CI6A 3L36A 2FYUE 3G6EP 1IJDB 1CI6B 1P84H 5C39A 1VQMP 1HH0A 2GM4A 3L70J 3HE5A 1BDDA 2Q7CA 1RE4C 1K73Q 1NYHA 3AE1C 1KB9D 4JYBA 3HE5B 3AEGC 2Z5IA 1AJYA 3NTNA 2QM7A 1LJ2A 2B9BA 4DJGA 1KYOH 2E76C 1OVUA 3CCSP 1NU1K 3L74D 3SFDC 3WU2H 1YITP 2E75D 1ZR4A 3H1JJ 3TYYA 2JP3A 2KS1A 1L0NG 4EI2A 3MGNA 1NAYA 2RKLA 2XDJA 2K3RA 4AYCA 1BCCE 2YXQB 3V2PA 2ZYDA 3B71A 2WPVB 1SQBD 2YMYA 1VQ6P 3V2RA 1SQQG 2QEXP 2JWAA 1QVFO 3VOPA 1M57D 2AEJA 3A5TA 2IBZG 2GUVA 1YTZI 3VMAA 5KKZC 2MJZA 1AVOA 4AUWA 3H1LE 4UB8H 4PV1C 1QLED 2AXTH 2QJYC 3JCUE 1M1JA 2MKVA 3P7KA 2R44A 4GKGA 3CC7P 2WZ7A 4UB6E 3SSUA 1EZVI 3HD7A 1X8YA 2YO2A 1RE3A 4D6TG 5APVA 2FY8A 5AW4B 3T97A 2FYNC 3WUUA 5CBOA 3MTUE 4IFFA 3CMEP 1MFTA 1MFZA 2POHA 2ZXXA 3M91A 2E75C 2M8RA 4C46A 1SQXG 3R4YA 5AW6B 4WY4B 2LXCB 1LWUB 1JEKA 2QE7H 2ZYAA 1KC8Q 1OW6A 3L72D 5AVXB 2V4HA 3FGAD 1KV4A 2K88A 1VF5C 3L74J 4TLFA 1HJ0A 4DCKA 1MUUA 1HWTC 1LTTC 2C9NY 3RBZA 3A0BH 3EWKA 4NPEA 1JMBA 4DT0A 4OH8B 3VMYA 2QJPC 2KSJA 4N3YB 3E1RA 1BSHA 5KLVE 3CCRP 5AW8B 4YXWH 1SQBJ 3RL0C 1LT9B 2I1JA 1CZQA 3CXHI 2J5UA 2YIUB 1JY2O 3AEFC 4L75A 2E42A 2NPSA 1N73B 4H0LB 1M8OB 2ZVOB 1L0LK 1KILE 3GHGA 2FFDA 1IO4A 1OW8A 3M9BA 3AE5C 2WSCH 3GHGB 1P84E 3H1IG 4PJ0E 2FFDB 1FDOA 1JY3O 1SP4A 1OMIA 2RH0A 2Y9YA 4U3FG 3Q3DA 2B87A 2C0WA 1PFIA 3MP7B 2B87B 3L72J 1Z56A 3H1HE 3KHUA 3Q5PA 3MUDA 1NKZB 5K5GB 4QMAA 3NFQA 3EQ2A 5GTIH 3H1HD 4I7ZB 4WY4D 3WU2E 2OYHA 1T8ZA 2R3CA 1M1KQ 2QM8A 3G9RA 5KAFH 2OYHB 2WITA 3KZIH 3AEBC 2J58A 4BWNA 4YTPC 2M3BA 1AV1A 1RY3A 3Q5SA 3GMAA 3AE6C 4ASVA 4CPGA 1NTKK 2AEFA 3RK3B 1YYCA 2R32A 2NRGA 3V4QA 1DEBA 2K37A 2OTJP 5AW0B 3RK2B 1N7LA 2IDBA 2W83C 2H89C 4LGDE 1SQVG 1NTME 2Y0CA 3G4SP 4H0LD 1CW5A 1KQSO 3CX5E 2NPSD 4W7ZA 4WY4C 2H7HA 1LWUC 2M0BA 1IFPA 1LP1A 1NTMD 1P84I 3CX5D 1LP1B 3I5CA 1DEEG 3L37A 1ZR2A 1S5LX 4W7YA 3D71A 1FJPA 2KZIA 3HE4A 4EDFA 1RE4A 2O1JA 3BVHA 1EZVG 3HE4B 3TF5A 1KYOI 5E79E 3A0BE 1JO5A 1K05A 5APWA 4KJMA 2FYUG 5CCHA 2HPCA 3AEAC 1LT9C 2YIUC 1NKNA 1LTSC 2HPCB 3CMAP 3E1IA 1PPJD 5AVYB 1N73C 1SFCB 4H0LC 1EDJA 1J1EB 1WMKA 3O6QB 3H1KE 5APSA 1GL2A 3RK3E 2P67A 1M56D 2QRXA 4KT0J 1GL2B 1S9KD 1ZXGA 2WPSA 3GHGC 4N78E 3RK3D 2FFDC 2RN0A 1W5CE 2A06E 1S72P 1T3UA 3V2NA 2FYZA 3RK2D 3KQGA 4PD4E 4HKZH 3OJAB 1S5LH 3OW2O 1NTZG 5B66E 1EC5A 1SQXJ 3JCUH 2N1TB 3F89A 1N8RQ 1JMMA 1KFMA 4UB6H 1URQA 3L70E 1R5SA 2PFXA 2L91A 4I7ZC 1URQB 2HR3A 1KMIZ 2XU6A 5CJ4A 1E5WA 1HTLC 2OYHC 1X22A 5GTIE 1JCCA 1LTBC 3H1LG 1FZEA 4H44B 1SQPE 1Y8AA 1OXZA 1FDIA 2P7JA 1OZHA 1GK4A 1YJ9P 2Z4EA 3L35A 1SQPD 3H1JE 2YKPA 3BCCG 1G1JA 5AVVB 1VF5B 4U7JA 2PP6A 3CCEP 2IYOA 1R5LA 3OA7A 3K5BA 1QGKB 5CCHD 1GK6A 5GTHE 2FXPA 1SFCD 4W80A 1S4XA 2WSSH 3L73D 2BCCG 1E79H 2D2CB 3L71D 4NPFX 2KLVA 3RL0B 3B5NC 3CWBD 1GL2D 1FZFA 2W6BA 1AFOA 1IK7A 1T2KD 1QL1A 3CCJP 2H88C 2VRSA 2R5BA 2M3EA 4ZMDA 5KLVG 1KB9E 2I8DA 4PJ0H 1NJIQ 5APQA 5AVQB 3PHLA 4C7NA 1AQTA 3KDPB 2E5TA 2O3JA 1GW4A 3SFEC 4C7NB 1BGYG 1VQ4P 4PV1D 2FXOA 5BVZA 4BRYB 1URQD 3L74E 1J2JB 5CCHC 3IFMA 2JEEA 1KFNA 2JO1A 1SFCC 2WSFH 1SQPJ 4GOEA 1G2CA 1J1EC 2E43A 1HJBA 1KQLA 1KN7A 1G2CB 4H44D 2WPQA 3GW6A 2OYOA 1GL2C 2QSIA 3D6YA 1SQBE 1T2KC 1VQ7P 2PGDA 3M9QA 3L73J 1JCDA 1VF5D 1RQUA 4WVZA 2C9LY 3L71J 2WPRA 3A7OA 3CWBJ 3I55P 3IN6A 1S5LE 2N1TC 2NZ2A 3M0DA 1NTMK 1NU1G 3RL0g 3PJSK 2WQYC 4WBAA 1URQC 1IZNB 1FS0E 3CXHD 2WSEJ 2D2CD 3RL0D 3TGUE 2ZVNB 3HTKB 3CX5H 1QL2A 1USEA 4H44C 3L72E 4WY4A 2Y9ZA 1LWUA 3QWOC 3CC4P 4MN4C 4XA4A 3TGUD 3LW5H 1VL2A 1VQ9P 2IPPA 2KIKA 4N6JA 3PLNA 5AW7B 3AECC 1VQLP 3G71P 1ZW0A 3FX0A 1T3JA 2Y0EA 2H43A 1HGVA 2R5DA 2JKVA 1M7LA
chains in the Genus database with same CATH topology
3A0BH 5KAFH 4UB6H 5E79H 5B5EH 3A0HH 3KZIH 4PJ0H 1S5LH 5TISH 5H2FH 5KAIH 4IL6H 4UB8H 5B66H 5GTIH 2AXTH 5GTHH 3WU2H 3JCUH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0B H;  5KAF H;  4UB6 H;  5E79 H;  5B5E H;  3A0H H;  3KZI H;  4PJ0 H;  1S5L H;  5TIS H;  5H2F H;  5KAI H;  4IL6 H;  4UB8 H;  5B66 H;  5GTI H;  2AXT H;  5GTH H;  3WU2 H;  3JCU H; 
#chains in the Genus database with same CATH topology
 5E79 H;  1VQ8 P;  3BCC D;  1KZU B;  2W27 A;  4B86 A;  3AE2 C;  3HUS A;  5BU5 A;  1Y9B A;  3Q2Y A;  1LT9 A;  4HB1 A;  3A2A A;  3HUS B;  2D2C C;  3FWL A;  5CJ0 A;  1N73 A;  3S9O A;  4GDO A;  1FJK A;  3L75 G;  1LTG C;  3O8Z A;  2V7Q J;  1NTZ J;  2Z5H A;  1H0T A;  4IFM A;  3V4W A;  4I2L C;  4DOJ A;  2KYV A;  2IZ0 A;  3AE4 C;  3MD0 A;  3M06 A;  1HBW A;  4HYT B;  1H0T B;  1QX8 A;  1GMJ A;  4PD4 H;  3C9I A;  2IFM A;  3TGU J;  5B66 H;  4GT1 A;  3A0H E;  4JYC A;  1EDK A;  4A7P A;  2A06 G;  4C7R A;  5BU8 B;  4Y28 J;  1U57 A;  2GA1 A;  3NMD A;  1SQP K;  1L0L G;  3BRV B;  2P58 A;  4GOD A;  2Q5U A;  1S3J A;  3AED C;  1NWQ A;  3BCC J;  2O01 N;  3L70 G;  1L0N D;  3VTP C;  5KAI E;  4OVN F;  1NVO A;  2Q3E A;  3BRT B;  3PH0 A;  1JNM A;  2IBZ E;  5B5E E;  2BCC J;  1XTC C;  2OYI A;  3M0D C;  1SQQ D;  1PP9 G;  5AW3 B;  2UWJ E;  5APU A;  2IBZ D;  1BE3 G;  2OYI B;  1NOH A;  3HRN A;  5GTH H;  3ABV C;  2YKO A;  2YO3 A;  1NAF A;  3H1J G;  2OTK E;  2HG5 D;  3W68 A;  1FZB A;  4ASW A;  1H88 A;  4JPZ B;  2C0X A;  1SQX E;  4D6T D;  1GZL A;  3B5N A;  2WSE H;  4JF7 A;  1U7J A;  2N9B A;  2ZT9 B;  1NTK G;  3B5N B;  1BGY J;  3CCL P;  4H13 B;  1SQX D;  3C8V A;  1KB9 H;  1FZG A;  1EXJ A;  4I1L A;  1K04 A;  4EIJ A;  1L0N J;  1H89 A;  2W6A A;  1PPJ E;  1RF1 B;  3HUS C;  3GF3 A;  4EYY Q;  2OGU A;  1EDL A;  4KHX A;  1SFC A;  1T6A A;  2J59 M;  4ZKP A;  1DX7 A;  3O6Q A;  1SQB K;  1S9K E;  1BSN A;  4ZNC A;  1SQQ J;  2FKW B;  5AVR B;  5AW5 B;  2E5Y A;  5CCG D;  3CCV P;  4IL6 E;  1M90 Q;  3L74 G;  3M9H A;  1VQ5 P;  1NU1 J;  1RF0 A;  2WTY A;  3MHV A;  3IR9 A;  2BEQ D;  1JY2 N;  1LTJ B;  1EDI A;  2V7Q H;  4D6T J;  2L5G B;  1FZA A;  3VN0 A;  3H1I D;  3VYI A;  1YBK A;  2N1T A;  1HUC A;  2Q9I A;  1BCC G;  1QEX A;  1SQB G;  2LXB A;  1FOS E;  3CX5 I;  1JTH A;  1FDM A;  4U3F D;  1JTH B;  4DZO A;  4R4L A;  1JM0 A;  1JY3 N;  1NO4 A;  4R4M A;  2KZJ A;  5TIS H;  5H2F E;  2PAJ A;  3EFG A;  3CI9 A;  1YQ3 C;  2ZT9 D;  3B5N D;  1UII A;  1DD3 A;  1PIX A;  4H13 D;  3KYQ A;  3LID A;  1W2B O;  5DJU B;  2IYP A;  3VMZ A;  2BEZ F;  5CCG C;  3PRJ A;  2ZXE B;  2ZJS E;  3ITK A;  3CLQ A;  1OVV A;  1GTW A;  3R2P A;  3SWK A;  3D6Z A;  3TNU A;  3CC2 P;  3L72 G;  3Q5R A;  3TNU B;  2OYI C;  2KI7 B;  3VMX A;  3L75 J;  3L73 E;  4K35 A;  1RHZ B;  4OGQ B;  2A45 H;  1LNQ A;  1PP9 D;  3L71 E;  3QH9 A;  3CWB E;  3ZDM A;  1W2E A;  1SQV D;  4RJT A;  2WWW A;  3H1I J;  3WUV A;  2R3S A;  2ZT9 C;  3GG2 A;  2QIW A;  1Q2N A;  1YI2 P;  1Q90 D;  4H13 C;  4Z1M H;  1AQ5 A;  1ZLL A;  5AW1 B;  3VP9 A;  4PD4 I;  4U3F J;  3V5B A;  5M1B A;  3V6I A;  3CPW O;  4LC1 A;  1LTA C;  3M0A A;  3W67 A;  1EZV E;  5APX A;  1FZC A;  2JJL A;  1OVR A;  4L73 A;  2N1T D;  2Q3I A;  1RF1 C;  1FE6 A;  4BRY A;  1FZC B;  1OX3 A;  2K9Y A;  1EZV D;  2KLU A;  2DW3 A;  3A0H H;  2ZAE B;  5DJT B;  1L0N K;  1YHQ P;  2M5A A;  2JDI H;  2FYU D;  1VPC A;  1YIJ P;  1TU3 F;  2M5A B;  1IFM A;  2QA4 P;  3KXD A;  4Y99 B;  4GIF A;  2KNC A;  2XV5 A;  3AE9 C;  1SQQ K;  2KNC B;  1ZME C;  2BAS A;  3Q1M A;  5KAI H;  3H1H G;  1PP9 J;  2CPB A;  1YJN P;  1LTJ C;  1BE3 J;  1RF0 C;  3FXE A;  2AEM A;  3H6P A;  2K1A A;  3SWY A;  5EFW B;  1IFI A;  1OIP A;  5AVU B;  1SQV J;  5B5E H;  1NTZ E;  2KUB A;  1SLQ A;  2IZ1 A;  4OGQ D;  2KS1 B;  3CXH E;  3EFF K;  5KLI C;  1PGQ A;  1NTZ D;  4RES B;  1OFC X;  1NGM B;  1NTK J;  1BCC D;  1SQX K;  3HTK A;  1VQO P;  1Q7Y Q;  1KIL A;  2OQQ A;  2HOD A;  2W6J H;  5TIS E;  1VQK P;  1L4A A;  4IL6 X;  1KIL B;  5KTB A;  1KB9 I;  1KOR A;  1EQ7 A;  2HOD B;  3AE8 C;  1L4A B;  2OAR A;  1IK9 A;  2HFE D;  2IFN A;  1HVV A;  1H8A A;  3CCU P;  1M1J B;  2QJK B;  1OWA A;  3H1L D;  2YMK A;  3HD7 B;  2FYU J;  2AXC A;  2Q6Q A;  1NTM G;  3TDK A;  2ITA A;  3S1K A;  3T97 B;  3BCC E;  2P2U A;  1SVF A;  1S2E A;  3S4R A;  2LR2 A;  3P8M C;  1ZV8 A;  2WVR A;  1MZ9 A;  3H32 A;  1IFD A;  2YKQ A;  3D70 A;  1JB0 J;  2CK3 H;  4BXL A;  4OGQ C;  2O01 J;  3CL3 D;  1RH5 B;  3H32 B;  3CCQ P;  3H25 A;  1YQ4 C;  1HGZ A;  1Q86 Q;  2BCC E;  3BAS A;  1WRG A;  5AVS B;  1AA0 A;  4XE5 B;  1X79 B;  2QVA A;  1LGH B;  1SS1 A;  4O9B A;  1U7M A;  4M3L A;  3RGU A;  3N4X A;  2ZYG A;  2BCC D;  2YXR B;  1RQV A;  2JR8 A;  2XNX A;  4HH2 A;  1JOC A;  4IL6 H;  1PPJ G;  1ZP0 C;  3C1L A;  1BCC J;  1DH3 A;  3BAT A;  5KLV D;  2WMM A;  3H1K G;  1BGY E;  1FZC C;  2NPS B;  2WT7 A;  4IOI H;  1Y47 A;  2I1K A;  4XFJ A;  3WMM 0;  2WT7 B;  3G3Z A;  1IC2 A;  3RBX A;  3H1L J;  5AVT B;  1GW3 A;  1BGY D;  3E7K A;  3MIW A;  1USD A;  1KIL D;  1K9M Q;  4Y99 C;  3A3Y B;  5H2F H;  3F5H A;  1L4A D;  1FOS F;  1P84 D;  1PGO A;  1PGP A;  2KB7 P;  1L0N E;  4IFD K;  1IFJ A;  4JQ0 D;  3WUT A;  2RMZ A;  3HD7 D;  5CHX A;  5CCG A;  3FXD A;  1KYO E;  2ZFC A;  3TSI A;  5KJ7 A;  1YTZ T;  1PZQ A;  1SQQ E;  1A02 J;  1SQV K;  1KYO D;  2A45 I;  3I56 P;  2PRR A;  3USS A;  1GDT A;  1DIP A;  1NU1 E;  3CCM P;  5AVW B;  2G3A A;  1QVG O;  3NXS A;  2KOG A;  1SQP G;  2H8P D;  2B88 A;  3L4F A;  1FAV A;  1NU1 D;  3B8E B;  2Q1K A;  3B4S A;  4D6T E;  1J1D B;  2FBW C;  2QG4 A;  1KIL C;  5KLV J;  4WWI A;  1LT1 A;  1NHL A;  3GLM A;  1L4A C;  2P10 A;  3U1C A;  3V2Q A;  1KQF B;  2KP8 A;  2E74 B;  4UB8 E;  1M1J C;  2IX7 C;  2AXT E;  2QJK C;  3L73 G;  4L76 A;  3HD7 C;  3AEE C;  1D7M A;  1RE3 C;  3AE7 C;  3L71 G;  1N7S A;  3U1A A;  3P8C E;  2XZR A;  3PTZ A;  3CWB G;  1FU1 A;  2FYU K;  1N7S B;  1DD4 A;  1GU4 A;  3VP8 A;  4RKU J;  1XTG B;  1AVY A;  3PP5 A;  1ZRT E;  3P8C D;  1X9V A;  1VQP P;  1FBM A;  5AVZ B;  1RF1 A;  3IF4 A;  1CSB A;  4I6M C;  1MV8 A;  1ZRT D;  3LIE A;  1OW7 A;  3UIA A;  4JBZ A;  3H1H J;  3JC2 2;  4TT3 H;  2WSF J;  4GOF A;  1JUN A;  2O01 H;  4WB4 A;  3L75 E;  1X0T A;  1FC2 C;  3OAK A;  1S1C X;  1LTI C;  2KXP B;  1R8E A;  1KTM A;  1Q81 Q;  1NH4 A;  2IBZ I;  3L75 D;  2FXM A;  4AQR D;  1NTZ K;  3JSV C;  1IFN A;  1LTJ A;  1ZN5 A;  4YPC A;  1Q82 Q;  5KJ7 D;  3H1I E;  2KK7 A;  2E76 B;  1GD2 E;  2NPS C;  4K3A A;  1YJW P;  4U3F E;  2SPZ A;  3CXH H;  1N2D C;  3H1K D;  2LKM A;  3P32 A;  3N7N A;  2OTL P;  2HYN A;  2KSE A;  1PL5 A;  5KLI B;  1L2P A;  2P1J A;  1WT6 A;  3IAO A;  1VQN P;  1L0L E;  4N78 D;  2E74 D;  1NTM J;  2A06 D;  1GU5 A;  2XND H;  4PD4 D;  3FWN A;  1L0L D;  1PV3 A;  5KKZ B;  5TJH A;  3MUD C;  2W8Z A;  3GF7 A;  4PV1 B;  3II6 A;  3LW5 J;  1N7S D;  2QJY B;  4YXD C;  3U59 A;  2GUS A;  3TK1 A;  5CBN A;  1KD1 Q;  3MZW B;  3L70 D;  5KJ7 C;  4LLH A;  3TGU G;  5CMZ A;  1G1I A;  1ZOY C;  4OWF A;  1BDC A;  2W90 A;  1UIX A;  2FYN B;  1MKM A;  1N86 A;  5KAF E;  2E75 B;  2HLO A;  3KZI E;  1HF9 A;  1PP9 E;  4HJG H;  2Y0D A;  1BE3 E;  2O1K A;  1VDF A;  3RK3 C;  1J1D C;  4RO0 A;  1K8A Q;  1SQV E;  2CPS A;  1EXI A;  4EOT A;  4ZKU A;  1PGJ A;  1BE3 D;  3RK2 C;  3CD6 P;  5AW2 B;  5KLV K;  2B89 A;  2E74 C;  3H1J D;  4NPD A;  3SWF A;  1A02 F;  1JY2 P;  1NTK E;  2K9J A;  3H1K J;  2G8Y A;  2QJP B;  2E76 D;  2K9J B;  2A45 G;  1KQG B;  3KPE A;  1N7S C;  1NTK D;  2N9Y B;  2XKM A;  5APT A;  2YNY A;  5L8R J;  2JWD A;  2WSC J;  4L74 A;  5AW9 B;  1JY3 P;  1L0L J;  3AE3 C;  5APY A;  1CI6 A;  3L36 A;  2FYU E;  3G6E P;  1IJD B;  1CI6 B;  1P84 H;  5C39 A;  1VQM P;  1HH0 A;  2GM4 A;  3L70 J;  3HE5 A;  1BDD A;  2Q7C A;  1RE4 C;  1K73 Q;  1NYH A;  3AE1 C;  1KB9 D;  4JYB A;  3HE5 B;  3AEG C;  2Z5I A;  1AJY A;  3NTN A;  2QM7 A;  1LJ2 A;  2B9B A;  4DJG A;  1KYO H;  2E76 C;  1OVU A;  3CCS P;  1NU1 K;  3L74 D;  3SFD C;  3WU2 H;  1YIT P;  2E75 D;  1ZR4 A;  3H1J J;  3TYY A;  2JP3 A;  2KS1 A;  1L0N G;  4EI2 A;  3MGN A;  1NAY A;  2RKL A;  2XDJ A;  2K3R A;  4AYC A;  1BCC E;  2YXQ B;  3V2P A;  2ZYD A;  3B71 A;  2WPV B;  1SQB D;  2YMY A;  1VQ6 P;  3V2R A;  1SQQ G;  2QEX P;  2JWA A;  1QVF O;  3VOP A;  1M57 D;  2AEJ A;  3A5T A;  2IBZ G;  2GUV A;  1YTZ I;  3VMA A;  5KKZ C;  2MJZ A;  1AVO A;  4AUW A;  3H1L E;  4UB8 H;  4PV1 C;  1QLE D;  2AXT H;  2QJY C;  3JCU E;  1M1J A;  2MKV A;  3P7K A;  2R44 A;  4GKG A;  3CC7 P;  2WZ7 A;  4UB6 E;  3SSU A;  1EZV I;  3HD7 A;  1X8Y A;  2YO2 A;  1RE3 A;  4D6T G;  5APV A;  2FY8 A;  5AW4 B;  3T97 A;  2FYN C;  3WUU A;  5CBO A;  3MTU E;  4IFF A;  3CME P;  1MFT A;  1MFZ A;  2POH A;  2ZXX A;  3M91 A;  2E75 C;  2M8R A;  4C46 A;  1SQX G;  3R4Y A;  5AW6 B;  4WY4 B;  2LXC B;  1LWU B;  1JEK A;  2QE7 H;  2ZYA A;  1KC8 Q;  1OW6 A;  3L72 D;  5AVX B;  2V4H A;  3FGA D;  1KV4 A;  2K88 A;  1VF5 C;  3L74 J;  4TLF A;  1HJ0 A;  4DCK A;  1MUU A;  1HWT C;  1LTT C;  2C9N Y;  3RBZ A;  3A0B H;  3EWK A;  4NPE A;  1JMB A;  4DT0 A;  4OH8 B;  3VMY A;  2QJP C;  2KSJ A;  4N3Y B;  3E1R A;  1BSH A;  5KLV E;  3CCR P;  5AW8 B;  4YXW H;  1SQB J;  3RL0 C;  1LT9 B;  2I1J A;  1CZQ A;  3CXH I;  2J5U A;  2YIU B;  1JY2 O;  3AEF C;  4L75 A;  2E42 A;  2NPS A;  1N73 B;  4H0L B;  1M8O B;  2ZVO B;  1L0L K;  1KIL E;  3GHG A;  2FFD A;  1IO4 A;  1OW8 A;  3M9B A;  3AE5 C;  2WSC H;  3GHG B;  1P84 E;  3H1I G;  4PJ0 E;  2FFD B;  1FDO A;  1JY3 O;  1SP4 A;  1OMI A;  2RH0 A;  2Y9Y A;  4U3F G;  3Q3D A;  2B87 A;  2C0W A;  1PFI A;  3MP7 B;  2B87 B;  3L72 J;  1Z56 A;  3H1H E;  3KHU A;  3Q5P A;  3MUD A;  1NKZ B;  5K5G B;  4QMA A;  3NFQ A;  3EQ2 A;  5GTI H;  3H1H D;  4I7Z B;  4WY4 D;  3WU2 E;  2OYH A;  1T8Z A;  2R3C A;  1M1K Q;  2QM8 A;  3G9R A;  5KAF H;  2OYH B;  2WIT A;  3KZI H;  3AEB C;  2J58 A;  4BWN A;  4YTP C;  2M3B A;  1AV1 A;  1RY3 A;  3Q5S A;  3GMA A;  3AE6 C;  4ASV A;  4CPG A;  1NTK K;  2AEF A;  3RK3 B;  1YYC A;  2R32 A;  2NRG A;  3V4Q A;  1DEB A;  2K37 A;  2OTJ P;  5AW0 B;  3RK2 B;  1N7L A;  2IDB A;  2W83 C;  2H89 C;  4LGD E;  1SQV G;  1NTM E;  2Y0C A;  3G4S P;  4H0L D;  1CW5 A;  1KQS O;  3CX5 E;  2NPS D;  4W7Z A;  4WY4 C;  2H7H A;  1LWU C;  2M0B A;  1IFP A;  1LP1 A;  1NTM D;  1P84 I;  3CX5 D;  1LP1 B;  3I5C A;  1DEE G;  3L37 A;  1ZR2 A;  1S5L X;  4W7Y A;  3D71 A;  1FJP A;  2KZI A;  3HE4 A;  4EDF A;  1RE4 A;  2O1J A;  3BVH A;  1EZV G;  3HE4 B;  3TF5 A;  1KYO I;  5E79 E;  3A0B E;  1JO5 A;  1K05 A;  5APW A;  4KJM A;  2FYU G;  5CCH A;  2HPC A;  3AEA C;  1LT9 C;  2YIU C;  1NKN A;  1LTS C;  2HPC B;  3CMA P;  3E1I A;  1PPJ D;  5AVY B;  1N73 C;  1SFC B;  4H0L C;  1EDJ A;  1J1E B;  1WMK A;  3O6Q B;  3H1K E;  5APS A;  1GL2 A;  3RK3 E;  2P67 A;  1M56 D;  2QRX A;  4KT0 J;  1GL2 B;  1S9K D;  1ZXG A;  2WPS A;  3GHG C;  4N78 E;  3RK3 D;  2FFD C;  2RN0 A;  1W5C E;  2A06 E;  1S72 P;  1T3U A;  3V2N A;  2FYZ A;  3RK2 D;  3KQG A;  4PD4 E;  4HKZ H;  3OJA B;  1S5L H;  3OW2 O;  1NTZ G;  5B66 E;  1EC5 A;  1SQX J;  3JCU H;  2N1T B;  3F89 A;  1N8R Q;  1JMM A;  1KFM A;  4UB6 H;  1URQ A;  3L70 E;  1R5S A;  2PFX A;  2L91 A;  4I7Z C;  1URQ B;  2HR3 A;  1KMI Z;  2XU6 A;  5CJ4 A;  1E5W A;  1HTL C;  2OYH C;  1X22 A;  5GTI E;  1JCC A;  1LTB C;  3H1L G;  1FZE A;  4H44 B;  1SQP E;  1Y8A A;  1OXZ A;  1FDI A;  2P7J A;  1OZH A;  1GK4 A;  1YJ9 P;  2Z4E A;  3L35 A;  1SQP D;  3H1J E;  2YKP A;  3BCC G;  1G1J A;  5AVV B;  1VF5 B;  4U7J A;  2PP6 A;  3CCE P;  2IYO A;  1R5L A;  3OA7 A;  3K5B A;  1QGK B;  5CCH D;  1GK6 A;  5GTH E;  2FXP A;  1SFC D;  4W80 A;  1S4X A;  2WSS H;  3L73 D;  2BCC G;  1E79 H;  2D2C B;  3L71 D;  4NPF X;  2KLV A;  3RL0 B;  3B5N C;  3CWB D;  1GL2 D;  1FZF A;  2W6B A;  1AFO A;  1IK7 A;  1T2K D;  1QL1 A;  3CCJ P;  2H88 C;  2VRS A;  2R5B A;  2M3E A;  4ZMD A;  5KLV G;  1KB9 E;  2I8D A;  4PJ0 H;  1NJI Q;  5APQ A;  5AVQ B;  3PHL A;  4C7N A;  1AQT A;  3KDP B;  2E5T A;  2O3J A;  1GW4 A;  3SFE C;  4C7N B;  1BGY G;  1VQ4 P;  4PV1 D;  2FXO A;  5BVZ A;  4BRY B;  1URQ D;  3L74 E;  1J2J B;  5CCH C;  3IFM A;  2JEE A;  1KFN A;  2JO1 A;  1SFC C;  2WSF H;  1SQP J;  4GOE A;  1G2C A;  1J1E C;  2E43 A;  1HJB A;  1KQL A;  1KN7 A;  1G2C B;  4H44 D;  2WPQ A;  3GW6 A;  2OYO A;  1GL2 C;  2QSI A;  3D6Y A;  1SQB E;  1T2K C;  1VQ7 P;  2PGD A;  3M9Q A;  3L73 J;  1JCD A;  1VF5 D;  1RQU A;  4WVZ A;  2C9L Y;  3L71 J;  2WPR A;  3A7O A;  3CWB J;  3I55 P;  3IN6 A;  1S5L E;  2N1T C;  2NZ2 A;  3M0D A;  1NTM K;  1NU1 G;  3RL0 g;  3PJS K;  2WQY C;  4WBA A;  1URQ C;  1IZN B;  1FS0 E;  3CXH D;  2WSE J;  2D2C D;  3RL0 D;  3TGU E;  2ZVN B;  3HTK B;  3CX5 H;  1QL2 A;  1USE A;  4H44 C;  3L72 E;  4WY4 A;  2Y9Z A;  1LWU A;  3QWO C;  3CC4 P;  4MN4 C;  4XA4 A;  3TGU D;  3LW5 H;  1VL2 A;  1VQ9 P;  2IPP A;  2KIK A;  4N6J A;  3PLN A;  5AW7 B;  3AEC C;  1VQL P;  3G71 P;  1ZW0 A;  3FX0 A;  1T3J A;  2Y0E A;  2H43 A;  1HGV A;  2R5D A;  2JKV A;  1M7L A; 
#chains in the Genus database with same CATH homology
 3A0B H;  5KAF H;  4UB6 H;  5E79 H;  5B5E H;  3A0H H;  3KZI H;  4PJ0 H;  1S5L H;  5TIS H;  5H2F H;  5KAI H;  4IL6 H;  4UB8 H;  5B66 H;  5GTI H;  2AXT H;  5GTH H;  3WU2 H;  3JCU H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...