5KAIH

Nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
total genus 15
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5kaiH01
3KZIH 5E79H 4UB6H 5B5EH 4UB8H 5TISH 3A0HH 3JCUH 5GTHH 5KAIH 2AXTH 4IL6H 4PJ0H 5GTIH 3WU2H 5KAFH 3A0BH 1S5LH 5B66H 5H2FH
chains in the Genus database with same CATH superfamily
1AVOA 2E43A 3BVHA 5C39A 2PAJA 4YPCA 3BASA 1KN7A 1SFCA 3I55P 3P8CD 3RK3B 1VQ4P 3Q5PA 3L71D 2NPSD 2QJPC 2H8PD 2WTYA 2FYUK 2FXOA 1N73C 1ZMEC 4R4LA 5CCHC 3FX0A 3OJAB 4EDFA 3EWKA 3TNUB 4L75A 5KLVD 1NWQA 2N1TA 1KMIZ 2J58A 2P7JA 1AA0A 2KLUA 1NU1K 1YJWP 3NFQA 2RN0A 2W27A 3AECC 5GTIH 3HE5A 1KQGB 3CCMP 1JM0A 3AE4C 2WT7A 3RL0C 1DEEG 4Y99C 3CX5I 2XNXA 2XKMA 3D70A 4YXDC 2K37A 1SQQG 3B5NC 1LTIC 1SQXJ 1FJKA 3L70G 2KK7A 1NTKG 1JOCA 3GHGB 2PP6A 2O01H 1N7SD 2XDJA 1LT9A 1GMJA 3NMDA 4I1LA 3UIAA 3V4WA 4GT1A 1YBKA 1ZRTE 3CCEP 2QG4A 3AE1C 1K9MQ 1AJYA 2V7QH 1HWTC 2AXTE 2FFDB 5B66H 2W90A 3KZIE 2E76C 2BEQD 2ZYAA 2POHA 1KTMA 2YXRB 2WPQA 1LP1B 3VMAA 1SQPE 1NOHA 3CL3D 3OA7A 2O01J 2O1KA 1WRGA 4LLHA 4WY4D 3VTPC 3KDPB 4OH8B 1USEA 3ABVC 2C0WA 1PV3A 3H1HG 5KKZB 2Q3IA 3L71J 2IBZE 5DJUB 1HBWA 1KQFB 1OIPA 3VMZA 2JR8A 3H1KE 1PP9E 1NAYA 5KJ7A 1NTMG 2J5UA 3M0DC 2BASA 1USDA 3F5HA 3W67A 1KYOI 1QEXA 2V7QJ 5KLVJ 2YO2A 1LGHB 2K88A 3GF7A 3Q5SA 3VMXA 3U59A 1OXZA 1KB9I 3ITKA 4C7NB 5KAIE 3IN6A 1IFMA 3IFMA 4WBAA 4GODA 4XFJA 1RY3A 1FJPA 1G2CA 1H0TA 5H2FE 1YHQP 3L74E 1U7JA 3CD6P 1FZGA 1EC5A 5APYA 3IF4A 4O9BA 2Q5UA 1RHZB 2M8RA 3M9QA 3RK2C 2AEJA 2IBZD 1VF5C 3RGUA 3MD0A 2A45H 1CSBA 2KS1B 1M7LA 2ZFCA 3L72E 1SQQK 1PP9D 3A7OA 1URQD 2WSSH 5CJ0A 3H32A 1ZV8A 3Q3DA 1NTKK 3H1IJ 2H7HA 3NTNA 5CCGC 3C8VA 3IR9A 1FZAA 3ZDMA 1KILE 5AW9B 1MZ9A 5AVSB 4WY4A 5K5GB 5AW7B 3A0HH 2KNCB 1FZBA 4U7JA 2QRXA 1GD2E 1NTZJ 2QE7H 1GL2D 4DCKA 2G3AA 1VL2A 1JY3N 4ZMDA 1N7LA 2O01N 1SLQA 5EFWB 2E75C 2OGUA 1L4AA 1N73A 1BCCJ 2HLOA 1Q86Q 4CPGA 3CXHD 1SS1A 3CCLP 5CBOA 5CJ4A 2YIUB 1BGYJ 3U1CA 4KT0J 4JF7A 3L72D 3AE7C 4H13D 2W83C 5AW2B 3L36A 3MUDC 2OTLP 2D2CD 4H0LB 1LT9C 4YTPC 3KQGA 4C7RA 1RF0A 2JJLA 1NTMK 2V4HA 3H6PA 5AW5B 1GL2B 1K8AQ 2L91A 1VQKP 4JBZA 1MFTA 4OGQD 3VP8A 3TGUE 3HTKB 2JP3A 3MTUE 1LWUC 2MJZA 1T2KD 1SQXG 2P67A 2E74B 2OTJP 1FOSE 2Z5HA 3BCCE 1VQ6P 2NPSC 1NKNA 2OYIB 3NXSA 1KORA 5E79H 2B87A 2YKQA 1J1DB 3L37A 1E5WA 3HE4B 5GTHE 4R4MA 1JTHB 2BCCE 1IFPA 5KAIH 2A06E 2Z4EA 1SQBE 1HGZA 4HB1A 1HGVA 2KUBA 2ZAEB 3AE2C 1KILB 1JY2N 5APSA 4OGQB 2HODB 1NAFA 4Y28J 4U3FJ 3SFDC 1H8AA 3GHGC 4PD4D 2NRGA 2Q6QA 2QA4P 3RK3E 3CXHH 3G6EP 3L75E 1KQLA 1T3JA 3HD7B 2P58A 1JNMA 2FYUE 1DEBA 1NYHA 3TGUD 3V6IA 2B88A 3JCUH 3P32A 4ZKPA 2DW3A 1DD4A 1X0TA 1M8OB 3CCQP 3H1JE 3PRJA 2AXCA 3BCCD 3WU2H 3OW2O 2I8DA 3CMEP 1VQNP 1YTZI 1N7SC 1ZR2A 4TLFA 2BCCD 1RH5B 2A06D 3H1LJ 5KLVG 1NU1E 1NGMB 2R44A 3CX5E 3M9HA 1GZLA 1W5CE 4GDOA 1PPJE 4H44C 1JEKA 3M0DA 3P7KA 1M56D 1OW8A 1PFIA 2WPSA 3L72J 1SFCB 3QH9A 4AYCA 1PGPA 4HKZH 3TK1A 1D7MA 3OAKA 3WUTA 1Z56A 3BRVB 3RK3D 4IOIH 2CPSA 4D6TG 2C9LY 1VPCA 3HUSA 2OYHC 1EZVD 1RE3C 4B86A 1S5LX 4NPDA 2P1JA 2KP8A 4PD4H 3FGAD 1Q82Q 1RF1B 4WY4C 2QJYC 2IYPA 2QM7A 3H1JD 3A5TA 4W7ZA 1LTTC 2N1TB 3TF5A 1S5LH 1FAVA 2HG5D 1SQXK 1E79H 1JY2P 1L0LD 1RQVA 3H1IG 4YXWH 1ZXGA 3CMAP 2ZJSE 4KJMA 1NU1D 3M06A 3HE5B 3CCVP 3G9RA 4W7YA 2Z5IA 3CX5D 1L4AC 5AVYB 2WT7B 1PPJD 1L0ND 3I5CA 1LJ2A 4UB8E 1KC8Q 3O6QA 5APUA 1OFCX 3C9IA 5CCGA 3CC7P 1R5SA 5AVRB 3CCRP 2R32A 5KAFH 3CWBD 1KFNA 4PV1B 1NTZG 1RF0C 1KYOE 2A45G 3VYIA 1SQVD 3TGUJ 1BE3J 3L4FA 1A02F 1W2BO 1BCCG 2W6BA 4I7ZC 2UWJE 1BGYG 4ZNCA 1KB9E 3BCCJ 2KI7B 2PFXA 5AVVB 4DOJA 3SFEC 2E5TA 2HR3A 1URQC 4DZOA 1FZCB 2H43A 2KYVA 2IZ0A 1AVYA 1HVVA 3MUDA 1IC2A 1Q90D 5KLVK 1QLED 1KD1Q 2C9NY 2M3BA 3L35A 2WVRA 3GW6A 1LTJB 3V5BA 2QIWA 5BVZA 1YJNP 1YJ9P 2XNDH 1J2JB 1KYOD 1BDDA 1GL2C 1LTBC 1LWUA 3FWNA 1S3JA 1SQQE 1LTAC 5CHXA 3RBZA 2JWAA 2NPSA 3VMYA 3L70E 1Q7YQ 5AVTB 1NTKE 3H1JJ 1EXJA 1KB9D 4UB6H 4U3FG 5TISH 4H13C 1J1DC 2K9JB 2D2CC 1L0LJ 1ZW0A 4LC1A 1TU3F 1QVFO 1MKMA 3AE5C 1L0NJ 2FYNB 3Q5RA 3W68A 3GHGA 1AV1A 1JMBA 2JWDA 1N8RQ 2FKWB 3VOPA 1NKZB 1T2KC 5APVA 3KXDA 4N78E 5KLIB 2ZYGA 4TT3H 2K1AA 1FBMA 2Y0DA 1ZRTD 3CWBJ 2LR2A 2NZ2A 2VRSA 2Q1KA 1FDMA 3TYYA 1A02J 2M5AA 1N86A 1X9VA 3AE8C 3MGNA 3H25A 3HUSC 3H32B 1SQQD 1SQVJ 4ASWA 1EXIA 3H1LG 1NTZK 3H1HE 3L70D 2W6JH 2YKOA 3L73G 5CCHD 4I2LC 1YYCA 1NTKD 3PH0A 1N7SA 1NTME 3C1LA 5AW4B 4LGDE 3SWYA 1LP1A 1SQPD 2A45I 4W80A 1PGQA 3QWOC 1SP4A 1M1JC 1KB9H 1Y47A 1GW4A 2YXQB 1CI6B 3H1KD 2QJPB 2JEEA 1BSNA 2WPVB 2ZXXA 3CPWO 3AEBC 1DH3A 2GM4A 3G71P 1S2EA 5AVUB 3M9BA 4N78D 2OYHA 1RE3A 4L73A 4XA4A 4AUWA 3B5ND 4C7NA 3H1HD 2O1JA 4H0LD 1RF1C 3E7KA 3L74D 1NTMD 1J1EC 4BWNA 3S1KA 2AXTH 1IFNA 1OZHA 3RL0B 1IFJA 1P84I 1QGKB 4Y99B 3RK3C 2E74D 1R5LA 2M0BA 3KZIH 2B89A 2KS1A 5B5EE 3R2PA 3B5NB 2XZRA 1BE3G 1YITP 1KZUB 1VQMP 4IL6E 3S9OA 1OMIA 1PGJA 3KYQA 3BCCG 1WT6A 4GOFA 2SPZA 5L8RJ 1KILD 1MFZA 5APWA 1QX8A 1LTSC 2KOGA 4M3LA 1KV4A 4BRYB 5AVXB 2FXPA 3AE3C 2KNCA 3L70J 3A0BE 1QL1A 2HPCA 3D71A 1G1IA 5AW6B 1URQA 3HD7D 2J59M 2HFED 2WPRA 1T6AA 1SQPJ 2E76B 3EQ2A 1VQOP 5TJHA 1FZEA 2WSFH 2RKLA 1Y9BA 1FZCC 1T8ZA 5H2FH 2OQQA 1JUNA 1OX3A 3CXHI 3II6A 1EZVG 3GLMA 3U1AA 3H1KJ 1PP9J 1S1CX 1SQXE 2O3JA 2YMYA 2M3EA 1FDIA 3TDKA 4IFFA 1LTJC 4GOEA 1W2EA 4N3YB 1GL2A 4A7PA 2R5DA 3D6YA 1WMKA 1SFCD 2LKMA 2AEMA 1L0LG 3RK2D 3L71G 5GTIE 1VF5D 2HYNA 2FYZA 1JY3P 1K73Q 3FXEA 3I56P 2OYIA 2WSFJ 1L0NG 3D6ZA 1FOSF 2FFDC 3L74J 3T97A 3M91A 1M1KQ 1SQBD 5BU5A 3K5BA 1HJ0A 3CWBG 1ZP0C 2N1TD 4QMAA 5KKZC 1Q81Q 2QSIA 2HODA 1DD3A 2CK3H 1SQVG 3PTZA 3P8CE 3RK2B 3V2QA 2FYNC 4ASVA 1PGOA 3G3ZA 2XU6A 4RJTA 3LW5H 4I6MC 1VF5B 2KXPB 4PD4I 3L75D 4K35A 1JCDA 3O6QB 2FYUD 2YO3A 2LXBA 2E75D 1XTCC 5AW3B 5KLVE 2KSEA 1MUUA 2JDIH 1GU5A 2N9BA 5B66E 4JQ0D 4PV1D 2YMKA 1S9KE 3WMM0 1AQ5A 1HUCA 1GU4A 1NH4A 3AEEC 1M1JA 3GF3A 4WWIA 4D6TE 2WMMA 2WSCH 1K05A 2MKVA 3LW5J 4AQRD 2ZT9D 4RO0A 1PZQA 2E75B 4MN4C 1OW6A 2QM8A 5GTHH 4Z1MH 3Q1MA 3A2AA 1L2PA 4PJ0E 5CMZA 2R5BA 2FY8A 1RE4C 1KQSO 1LT9B 4WVZA 1PIXA 3H1IE 3P8MC 2Q9IA 1HF9A 1EZVI 3N7NA 1NHLA 1RF1A 3B71A 3E1RA 2AEFA 2ZT9B 1IJDB 3CC4P 4HYTB 2ZYDA 3SWKA 2WSCJ 3V2NA 2KB7P 1L0LK 1XTGB 1EDIA 4GKGA 1LWUB 3O8ZA 1S9KD 3F89A 3JC22 5KJ7D 3CC2P 1IZNB 1CW5A 4JYCA 1FE6A 2NPSB 1L0NK 1QVGO 2Y9ZA 1YIJP 2BCCJ 1N2DC 4D6TD 1RQUA 2IFNA 1SQBJ 1NTZE 1EQ7A 1SVFA 3WUVA 2YIUC 2WITA 3A3YB 4EYYQ 3JSVC 2OTKE 1BCCE 4C46A 3PLNA 1FDOA 3TNUA 3SSUA 1BGYE 3CX5H 4NPEA 4H0LC 1SQVK 1ZLLA 4JPZB 3L75J 2WWWA 1R8EA 2OYOA 4GIFA 2FYUJ 5BU8B 3A0HE 1SQPG 3USSA 3H1ID 3LIEA 3MZWB 4NPFX 1GDTA 4H44D 1Q2NA 2IBZG 2E74C 3V2PA 2IYOA 2GUVA 2M5AB 3B8EB 3H1KG 3LIDA 5AVZB 3AEDC 1PP9G 5AVWB 2OYIC 5AW1B 2L5GB 1JMMA 2IZ1A 2IX7C 2QVAA 3KHUA 2B9BA 1FZCA 1G2CB 1HTLC 5APXA 1OVRA 1H0TB 1NU1J 1NTZD 1N7SB 4RESB 1KILC 1X79B 1IK9A 2QJKB 1VQ7P 1P84E 4OGQC 1BCCD 4KHXA 1VQ8P 1LTJA 4H44B 1DIPA 1IFDA 3RBXA 1BGYD 2Q7CA 1ZR4A 2CPBA 3G4SP 3L74G 1BSHA 3CCJP 4U3FE 1VQPP 4UB8H 3HD7C 2LXCB 1YTZT 2PRRA 3AEAC 1X22A 1PL5A 1L4AD 1UIIA 2OYHB 4PJ0H 2IFMA 1ZOYC 1FS0E 2FFDA 4DT0A 5E79E 1KYOH 2FXMA 1VQ5P 1GK6A 3L72G 4WY4B 2QJYB 4L74A 2W6AA 3V4QA 2K9JA 1LTGC 4IFMA 1S72P 2P10A 4D6TJ 1IFIA 1BDCA 1MV8A 3H1LE 1P84D 1L4AB 1N73B 1NO4A 3L73E 1HJBA 1SFCC 3CXHE 2KZJA 3FWLA 3M0AA 2RH0A 4N6JA 3RL0D 4ZKUA 4U3FD 4K3AA 1YQ3C 4L76A 3WUUA 3JCUE 3PHLA 3GG2A 3WU2E 3MHVA 2E5YA 2QEXP 1NVOA 1LT1A 1SQPK 1G1JA 2N1TC 4I7ZB 1JY3O 4WB4A 4JYBA 3VN0A 2HPCB 2YKPA 2H88C 2K3RA 3VP9A 1CI6A 1URQB 2XV5A 1U57A 3GMAA 2B87B 2IBZI 2N9YB 2ITAA 3TGUG 5KTBA 3H1LD 4HJGH 3L73D 4EI2A 5CCHA 3N4XA 1EDJA 1RE4A 4EIJA 1X8YA 1FZFA 2G8YA 1OVUA 2E76D 3HRNA 2W8ZA 2KSJA 1GK4A 2IPPA 2JKVA 2PGDA 1GW3A 1AQTA 4PV1C 1YI2P 1P84H 3BRTB 4PD4E 3CCUP 1IK7A 2BCCG 2GUSA 1SQQJ 2A06G 3MIWA 1SQBG 3EFFK 3BATA 1S5LE 1ZN5A 2YNYA 3AE6C 3KPEA 2KIKA 4OWFA 4BXLA 1NTKJ 2Y0CA 2ZT9C 1QL2A 2P2UA 1BE3E 3CCSP 3PJSK 3TSIA 3CI9A 1M90Q 1YQ4C 4IFDK 3L75G 1JY2O 4OVNF 2H89C 4H13B 2FYUG 2D2CB 3B5NA 5DJTB 3T97B 2RMZA 4XE5B 2BEZF 5KAFE 3H1JG 2WZ7A 1JO5A 1HH0A 1AFOA 3HTKA 2IDBA 3CLQA 1EDLA 1KFMA 4DJGA 5KJ7C 1T3UA 5AW8B 4BRYA 1OW7A 1NU1G 2WSEH 1DX7A 3H1HJ 2ZVNB 2ZVOB 3HUSB 4RKUJ 3V2RA 1PPJG 1EZVE 1H88A 3PP5A 1BE3D 5APQA 3FXDA 1EDKA 2FBWC 1OWAA 1JCCA 1NTMJ 2OARA 2R3SA 3HE4A 3S4RA 5CCGD 1JTHA 1VQ9P 3EFGA 2E42A 1K04A 1VQLP 1KILA 5APTA 3AE9C 1FU1A 5AW0B 2KZIA 1LNQA 2I1JA 1U7MA 5CBNA 1L0LE 1M1JB 1SQXD 1VDFA 2QJKC 4EOTA 1S4XA 2C0XA 2ZXEB 3L71E 2GA1A 3L73J 3E1IA 1Y8AA 1L0NE 2WSEJ 4IL6X 3HD7A 5B5EH 5KLIC 1FC2C 1M57D 1NJIQ 1JB0J 5M1BA 2I1KA 3Q2YA 2K9YA 2Q3EA 4IL6H 1UIXA 3SWFA 3CWBE 3R4YA 2JO1A 2WQYC 1GTWA 3IAOA 4HH2A 4UB6E 2Y9YA 3MP7B 3AEGC 1SQVE 1SQBK 5TISE 3B4SA 3AEFC 2KLVA 1OVVA 1CZQA 1H89A 3RL0g 2Y0EA 5AVQB 1IO4A 3A0BH 1J1EB 2R3CA
chains in the Genus database with same CATH topology
3KZIH 5E79H 4UB6H 5B5EH 4UB8H 5TISH 3A0HH 3JCUH 5GTHH 5KAIH 2AXTH 4IL6H 4PJ0H 5GTIH 3WU2H 5KAFH 3A0BH 1S5LH 5B66H 5H2FH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI H;  5E79 H;  4UB6 H;  5B5E H;  4UB8 H;  5TIS H;  3A0H H;  3JCU H;  5GTH H;  5KAI H;  2AXT H;  4IL6 H;  4PJ0 H;  5GTI H;  3WU2 H;  5KAF H;  3A0B H;  1S5L H;  5B66 H;  5H2F H; 
#chains in the Genus database with same CATH topology
 1AVO A;  2E43 A;  3BVH A;  5C39 A;  2PAJ A;  4YPC A;  3BAS A;  1KN7 A;  1SFC A;  3I55 P;  3P8C D;  3RK3 B;  1VQ4 P;  3Q5P A;  3L71 D;  2NPS D;  2QJP C;  2H8P D;  2WTY A;  2FYU K;  2FXO A;  1N73 C;  1ZME C;  4R4L A;  5CCH C;  3FX0 A;  3OJA B;  4EDF A;  3EWK A;  3TNU B;  4L75 A;  5KLV D;  1NWQ A;  2N1T A;  1KMI Z;  2J58 A;  2P7J A;  1AA0 A;  2KLU A;  1NU1 K;  1YJW P;  3NFQ A;  2RN0 A;  2W27 A;  3AEC C;  5GTI H;  3HE5 A;  1KQG B;  3CCM P;  1JM0 A;  3AE4 C;  2WT7 A;  3RL0 C;  1DEE G;  4Y99 C;  3CX5 I;  2XNX A;  2XKM A;  3D70 A;  4YXD C;  2K37 A;  1SQQ G;  3B5N C;  1LTI C;  1SQX J;  1FJK A;  3L70 G;  2KK7 A;  1NTK G;  1JOC A;  3GHG B;  2PP6 A;  2O01 H;  1N7S D;  2XDJ A;  1LT9 A;  1GMJ A;  3NMD A;  4I1L A;  3UIA A;  3V4W A;  4GT1 A;  1YBK A;  1ZRT E;  3CCE P;  2QG4 A;  3AE1 C;  1K9M Q;  1AJY A;  2V7Q H;  1HWT C;  2AXT E;  2FFD B;  5B66 H;  2W90 A;  3KZI E;  2E76 C;  2BEQ D;  2ZYA A;  2POH A;  1KTM A;  2YXR B;  2WPQ A;  1LP1 B;  3VMA A;  1SQP E;  1NOH A;  3CL3 D;  3OA7 A;  2O01 J;  2O1K A;  1WRG A;  4LLH A;  4WY4 D;  3VTP C;  3KDP B;  4OH8 B;  1USE A;  3ABV C;  2C0W A;  1PV3 A;  3H1H G;  5KKZ B;  2Q3I A;  3L71 J;  2IBZ E;  5DJU B;  1HBW A;  1KQF B;  1OIP A;  3VMZ A;  2JR8 A;  3H1K E;  1PP9 E;  1NAY A;  5KJ7 A;  1NTM G;  2J5U A;  3M0D C;  2BAS A;  1USD A;  3F5H A;  3W67 A;  1KYO I;  1QEX A;  2V7Q J;  5KLV J;  2YO2 A;  1LGH B;  2K88 A;  3GF7 A;  3Q5S A;  3VMX A;  3U59 A;  1OXZ A;  1KB9 I;  3ITK A;  4C7N B;  5KAI E;  3IN6 A;  1IFM A;  3IFM A;  4WBA A;  4GOD A;  4XFJ A;  1RY3 A;  1FJP A;  1G2C A;  1H0T A;  5H2F E;  1YHQ P;  3L74 E;  1U7J A;  3CD6 P;  1FZG A;  1EC5 A;  5APY A;  3IF4 A;  4O9B A;  2Q5U A;  1RHZ B;  2M8R A;  3M9Q A;  3RK2 C;  2AEJ A;  2IBZ D;  1VF5 C;  3RGU A;  3MD0 A;  2A45 H;  1CSB A;  2KS1 B;  1M7L A;  2ZFC A;  3L72 E;  1SQQ K;  1PP9 D;  3A7O A;  1URQ D;  2WSS H;  5CJ0 A;  3H32 A;  1ZV8 A;  3Q3D A;  1NTK K;  3H1I J;  2H7H A;  3NTN A;  5CCG C;  3C8V A;  3IR9 A;  1FZA A;  3ZDM A;  1KIL E;  5AW9 B;  1MZ9 A;  5AVS B;  4WY4 A;  5K5G B;  5AW7 B;  3A0H H;  2KNC B;  1FZB A;  4U7J A;  2QRX A;  1GD2 E;  1NTZ J;  2QE7 H;  1GL2 D;  4DCK A;  2G3A A;  1VL2 A;  1JY3 N;  4ZMD A;  1N7L A;  2O01 N;  1SLQ A;  5EFW B;  2E75 C;  2OGU A;  1L4A A;  1N73 A;  1BCC J;  2HLO A;  1Q86 Q;  4CPG A;  3CXH D;  1SS1 A;  3CCL P;  5CBO A;  5CJ4 A;  2YIU B;  1BGY J;  3U1C A;  4KT0 J;  4JF7 A;  3L72 D;  3AE7 C;  4H13 D;  2W83 C;  5AW2 B;  3L36 A;  3MUD C;  2OTL P;  2D2C D;  4H0L B;  1LT9 C;  4YTP C;  3KQG A;  4C7R A;  1RF0 A;  2JJL A;  1NTM K;  2V4H A;  3H6P A;  5AW5 B;  1GL2 B;  1K8A Q;  2L91 A;  1VQK P;  4JBZ A;  1MFT A;  4OGQ D;  3VP8 A;  3TGU E;  3HTK B;  2JP3 A;  3MTU E;  1LWU C;  2MJZ A;  1T2K D;  1SQX G;  2P67 A;  2E74 B;  2OTJ P;  1FOS E;  2Z5H A;  3BCC E;  1VQ6 P;  2NPS C;  1NKN A;  2OYI B;  3NXS A;  1KOR A;  5E79 H;  2B87 A;  2YKQ A;  1J1D B;  3L37 A;  1E5W A;  3HE4 B;  5GTH E;  4R4M A;  1JTH B;  2BCC E;  1IFP A;  5KAI H;  2A06 E;  2Z4E A;  1SQB E;  1HGZ A;  4HB1 A;  1HGV A;  2KUB A;  2ZAE B;  3AE2 C;  1KIL B;  1JY2 N;  5APS A;  4OGQ B;  2HOD B;  1NAF A;  4Y28 J;  4U3F J;  3SFD C;  1H8A A;  3GHG C;  4PD4 D;  2NRG A;  2Q6Q A;  2QA4 P;  3RK3 E;  3CXH H;  3G6E P;  3L75 E;  1KQL A;  1T3J A;  3HD7 B;  2P58 A;  1JNM A;  2FYU E;  1DEB A;  1NYH A;  3TGU D;  3V6I A;  2B88 A;  3JCU H;  3P32 A;  4ZKP A;  2DW3 A;  1DD4 A;  1X0T A;  1M8O B;  3CCQ P;  3H1J E;  3PRJ A;  2AXC A;  3BCC D;  3WU2 H;  3OW2 O;  2I8D A;  3CME P;  1VQN P;  1YTZ I;  1N7S C;  1ZR2 A;  4TLF A;  2BCC D;  1RH5 B;  2A06 D;  3H1L J;  5KLV G;  1NU1 E;  1NGM B;  2R44 A;  3CX5 E;  3M9H A;  1GZL A;  1W5C E;  4GDO A;  1PPJ E;  4H44 C;  1JEK A;  3M0D A;  3P7K A;  1M56 D;  1OW8 A;  1PFI A;  2WPS A;  3L72 J;  1SFC B;  3QH9 A;  4AYC A;  1PGP A;  4HKZ H;  3TK1 A;  1D7M A;  3OAK A;  3WUT A;  1Z56 A;  3BRV B;  3RK3 D;  4IOI H;  2CPS A;  4D6T G;  2C9L Y;  1VPC A;  3HUS A;  2OYH C;  1EZV D;  1RE3 C;  4B86 A;  1S5L X;  4NPD A;  2P1J A;  2KP8 A;  4PD4 H;  3FGA D;  1Q82 Q;  1RF1 B;  4WY4 C;  2QJY C;  2IYP A;  2QM7 A;  3H1J D;  3A5T A;  4W7Z A;  1LTT C;  2N1T B;  3TF5 A;  1S5L H;  1FAV A;  2HG5 D;  1SQX K;  1E79 H;  1JY2 P;  1L0L D;  1RQV A;  3H1I G;  4YXW H;  1ZXG A;  3CMA P;  2ZJS E;  4KJM A;  1NU1 D;  3M06 A;  3HE5 B;  3CCV P;  3G9R A;  4W7Y A;  2Z5I A;  3CX5 D;  1L4A C;  5AVY B;  2WT7 B;  1PPJ D;  1L0N D;  3I5C A;  1LJ2 A;  4UB8 E;  1KC8 Q;  3O6Q A;  5APU A;  1OFC X;  3C9I A;  5CCG A;  3CC7 P;  1R5S A;  5AVR B;  3CCR P;  2R32 A;  5KAF H;  3CWB D;  1KFN A;  4PV1 B;  1NTZ G;  1RF0 C;  1KYO E;  2A45 G;  3VYI A;  1SQV D;  3TGU J;  1BE3 J;  3L4F A;  1A02 F;  1W2B O;  1BCC G;  2W6B A;  4I7Z C;  2UWJ E;  1BGY G;  4ZNC A;  1KB9 E;  3BCC J;  2KI7 B;  2PFX A;  5AVV B;  4DOJ A;  3SFE C;  2E5T A;  2HR3 A;  1URQ C;  4DZO A;  1FZC B;  2H43 A;  2KYV A;  2IZ0 A;  1AVY A;  1HVV A;  3MUD A;  1IC2 A;  1Q90 D;  5KLV K;  1QLE D;  1KD1 Q;  2C9N Y;  2M3B A;  3L35 A;  2WVR A;  3GW6 A;  1LTJ B;  3V5B A;  2QIW A;  5BVZ A;  1YJN P;  1YJ9 P;  2XND H;  1J2J B;  1KYO D;  1BDD A;  1GL2 C;  1LTB C;  1LWU A;  3FWN A;  1S3J A;  1SQQ E;  1LTA C;  5CHX A;  3RBZ A;  2JWA A;  2NPS A;  3VMY A;  3L70 E;  1Q7Y Q;  5AVT B;  1NTK E;  3H1J J;  1EXJ A;  1KB9 D;  4UB6 H;  4U3F G;  5TIS H;  4H13 C;  1J1D C;  2K9J B;  2D2C C;  1L0L J;  1ZW0 A;  4LC1 A;  1TU3 F;  1QVF O;  1MKM A;  3AE5 C;  1L0N J;  2FYN B;  3Q5R A;  3W68 A;  3GHG A;  1AV1 A;  1JMB A;  2JWD A;  1N8R Q;  2FKW B;  3VOP A;  1NKZ B;  1T2K C;  5APV A;  3KXD A;  4N78 E;  5KLI B;  2ZYG A;  4TT3 H;  2K1A A;  1FBM A;  2Y0D A;  1ZRT D;  3CWB J;  2LR2 A;  2NZ2 A;  2VRS A;  2Q1K A;  1FDM A;  3TYY A;  1A02 J;  2M5A A;  1N86 A;  1X9V A;  3AE8 C;  3MGN A;  3H25 A;  3HUS C;  3H32 B;  1SQQ D;  1SQV J;  4ASW A;  1EXI A;  3H1L G;  1NTZ K;  3H1H E;  3L70 D;  2W6J H;  2YKO A;  3L73 G;  5CCH D;  4I2L C;  1YYC A;  1NTK D;  3PH0 A;  1N7S A;  1NTM E;  3C1L A;  5AW4 B;  4LGD E;  3SWY A;  1LP1 A;  1SQP D;  2A45 I;  4W80 A;  1PGQ A;  3QWO C;  1SP4 A;  1M1J C;  1KB9 H;  1Y47 A;  1GW4 A;  2YXQ B;  1CI6 B;  3H1K D;  2QJP B;  2JEE A;  1BSN A;  2WPV B;  2ZXX A;  3CPW O;  3AEB C;  1DH3 A;  2GM4 A;  3G71 P;  1S2E A;  5AVU B;  3M9B A;  4N78 D;  2OYH A;  1RE3 A;  4L73 A;  4XA4 A;  4AUW A;  3B5N D;  4C7N A;  3H1H D;  2O1J A;  4H0L D;  1RF1 C;  3E7K A;  3L74 D;  1NTM D;  1J1E C;  4BWN A;  3S1K A;  2AXT H;  1IFN A;  1OZH A;  3RL0 B;  1IFJ A;  1P84 I;  1QGK B;  4Y99 B;  3RK3 C;  2E74 D;  1R5L A;  2M0B A;  3KZI H;  2B89 A;  2KS1 A;  5B5E E;  3R2P A;  3B5N B;  2XZR A;  1BE3 G;  1YIT P;  1KZU B;  1VQM P;  4IL6 E;  3S9O A;  1OMI A;  1PGJ A;  3KYQ A;  3BCC G;  1WT6 A;  4GOF A;  2SPZ A;  5L8R J;  1KIL D;  1MFZ A;  5APW A;  1QX8 A;  1LTS C;  2KOG A;  4M3L A;  1KV4 A;  4BRY B;  5AVX B;  2FXP A;  3AE3 C;  2KNC A;  3L70 J;  3A0B E;  1QL1 A;  2HPC A;  3D71 A;  1G1I A;  5AW6 B;  1URQ A;  3HD7 D;  2J59 M;  2HFE D;  2WPR A;  1T6A A;  1SQP J;  2E76 B;  3EQ2 A;  1VQO P;  5TJH A;  1FZE A;  2WSF H;  2RKL A;  1Y9B A;  1FZC C;  1T8Z A;  5H2F H;  2OQQ A;  1JUN A;  1OX3 A;  3CXH I;  3II6 A;  1EZV G;  3GLM A;  3U1A A;  3H1K J;  1PP9 J;  1S1C X;  1SQX E;  2O3J A;  2YMY A;  2M3E A;  1FDI A;  3TDK A;  4IFF A;  1LTJ C;  4GOE A;  1W2E A;  4N3Y B;  1GL2 A;  4A7P A;  2R5D A;  3D6Y A;  1WMK A;  1SFC D;  2LKM A;  2AEM A;  1L0L G;  3RK2 D;  3L71 G;  5GTI E;  1VF5 D;  2HYN A;  2FYZ A;  1JY3 P;  1K73 Q;  3FXE A;  3I56 P;  2OYI A;  2WSF J;  1L0N G;  3D6Z A;  1FOS F;  2FFD C;  3L74 J;  3T97 A;  3M91 A;  1M1K Q;  1SQB D;  5BU5 A;  3K5B A;  1HJ0 A;  3CWB G;  1ZP0 C;  2N1T D;  4QMA A;  5KKZ C;  1Q81 Q;  2QSI A;  2HOD A;  1DD3 A;  2CK3 H;  1SQV G;  3PTZ A;  3P8C E;  3RK2 B;  3V2Q A;  2FYN C;  4ASV A;  1PGO A;  3G3Z A;  2XU6 A;  4RJT A;  3LW5 H;  4I6M C;  1VF5 B;  2KXP B;  4PD4 I;  3L75 D;  4K35 A;  1JCD A;  3O6Q B;  2FYU D;  2YO3 A;  2LXB A;  2E75 D;  1XTC C;  5AW3 B;  5KLV E;  2KSE A;  1MUU A;  2JDI H;  1GU5 A;  2N9B A;  5B66 E;  4JQ0 D;  4PV1 D;  2YMK A;  1S9K E;  3WMM 0;  1AQ5 A;  1HUC A;  1GU4 A;  1NH4 A;  3AEE C;  1M1J A;  3GF3 A;  4WWI A;  4D6T E;  2WMM A;  2WSC H;  1K05 A;  2MKV A;  3LW5 J;  4AQR D;  2ZT9 D;  4RO0 A;  1PZQ A;  2E75 B;  4MN4 C;  1OW6 A;  2QM8 A;  5GTH H;  4Z1M H;  3Q1M A;  3A2A A;  1L2P A;  4PJ0 E;  5CMZ A;  2R5B A;  2FY8 A;  1RE4 C;  1KQS O;  1LT9 B;  4WVZ A;  1PIX A;  3H1I E;  3P8M C;  2Q9I A;  1HF9 A;  1EZV I;  3N7N A;  1NHL A;  1RF1 A;  3B71 A;  3E1R A;  2AEF A;  2ZT9 B;  1IJD B;  3CC4 P;  4HYT B;  2ZYD A;  3SWK A;  2WSC J;  3V2N A;  2KB7 P;  1L0L K;  1XTG B;  1EDI A;  4GKG A;  1LWU B;  3O8Z A;  1S9K D;  3F89 A;  3JC2 2;  5KJ7 D;  3CC2 P;  1IZN B;  1CW5 A;  4JYC A;  1FE6 A;  2NPS B;  1L0N K;  1QVG O;  2Y9Z A;  1YIJ P;  2BCC J;  1N2D C;  4D6T D;  1RQU A;  2IFN A;  1SQB J;  1NTZ E;  1EQ7 A;  1SVF A;  3WUV A;  2YIU C;  2WIT A;  3A3Y B;  4EYY Q;  3JSV C;  2OTK E;  1BCC E;  4C46 A;  3PLN A;  1FDO A;  3TNU A;  3SSU A;  1BGY E;  3CX5 H;  4NPE A;  4H0L C;  1SQV K;  1ZLL A;  4JPZ B;  3L75 J;  2WWW A;  1R8E A;  2OYO A;  4GIF A;  2FYU J;  5BU8 B;  3A0H E;  1SQP G;  3USS A;  3H1I D;  3LIE A;  3MZW B;  4NPF X;  1GDT A;  4H44 D;  1Q2N A;  2IBZ G;  2E74 C;  3V2P A;  2IYO A;  2GUV A;  2M5A B;  3B8E B;  3H1K G;  3LID A;  5AVZ B;  3AED C;  1PP9 G;  5AVW B;  2OYI C;  5AW1 B;  2L5G B;  1JMM A;  2IZ1 A;  2IX7 C;  2QVA A;  3KHU A;  2B9B A;  1FZC A;  1G2C B;  1HTL C;  5APX A;  1OVR A;  1H0T B;  1NU1 J;  1NTZ D;  1N7S B;  4RES B;  1KIL C;  1X79 B;  1IK9 A;  2QJK B;  1VQ7 P;  1P84 E;  4OGQ C;  1BCC D;  4KHX A;  1VQ8 P;  1LTJ A;  4H44 B;  1DIP A;  1IFD A;  3RBX A;  1BGY D;  2Q7C A;  1ZR4 A;  2CPB A;  3G4S P;  3L74 G;  1BSH A;  3CCJ P;  4U3F E;  1VQP P;  4UB8 H;  3HD7 C;  2LXC B;  1YTZ T;  2PRR A;  3AEA C;  1X22 A;  1PL5 A;  1L4A D;  1UII A;  2OYH B;  4PJ0 H;  2IFM A;  1ZOY C;  1FS0 E;  2FFD A;  4DT0 A;  5E79 E;  1KYO H;  2FXM A;  1VQ5 P;  1GK6 A;  3L72 G;  4WY4 B;  2QJY B;  4L74 A;  2W6A A;  3V4Q A;  2K9J A;  1LTG C;  4IFM A;  1S72 P;  2P10 A;  4D6T J;  1IFI A;  1BDC A;  1MV8 A;  3H1L E;  1P84 D;  1L4A B;  1N73 B;  1NO4 A;  3L73 E;  1HJB A;  1SFC C;  3CXH E;  2KZJ A;  3FWL A;  3M0A A;  2RH0 A;  4N6J A;  3RL0 D;  4ZKU A;  4U3F D;  4K3A A;  1YQ3 C;  4L76 A;  3WUU A;  3JCU E;  3PHL A;  3GG2 A;  3WU2 E;  3MHV A;  2E5Y A;  2QEX P;  1NVO A;  1LT1 A;  1SQP K;  1G1J A;  2N1T C;  4I7Z B;  1JY3 O;  4WB4 A;  4JYB A;  3VN0 A;  2HPC B;  2YKP A;  2H88 C;  2K3R A;  3VP9 A;  1CI6 A;  1URQ B;  2XV5 A;  1U57 A;  3GMA A;  2B87 B;  2IBZ I;  2N9Y B;  2ITA A;  3TGU G;  5KTB A;  3H1L D;  4HJG H;  3L73 D;  4EI2 A;  5CCH A;  3N4X A;  1EDJ A;  1RE4 A;  4EIJ A;  1X8Y A;  1FZF A;  2G8Y A;  1OVU A;  2E76 D;  3HRN A;  2W8Z A;  2KSJ A;  1GK4 A;  2IPP A;  2JKV A;  2PGD A;  1GW3 A;  1AQT A;  4PV1 C;  1YI2 P;  1P84 H;  3BRT B;  4PD4 E;  3CCU P;  1IK7 A;  2BCC G;  2GUS A;  1SQQ J;  2A06 G;  3MIW A;  1SQB G;  3EFF K;  3BAT A;  1S5L E;  1ZN5 A;  2YNY A;  3AE6 C;  3KPE A;  2KIK A;  4OWF A;  4BXL A;  1NTK J;  2Y0C A;  2ZT9 C;  1QL2 A;  2P2U A;  1BE3 E;  3CCS P;  3PJS K;  3TSI A;  3CI9 A;  1M90 Q;  1YQ4 C;  4IFD K;  3L75 G;  1JY2 O;  4OVN F;  2H89 C;  4H13 B;  2FYU G;  2D2C B;  3B5N A;  5DJT B;  3T97 B;  2RMZ A;  4XE5 B;  2BEZ F;  5KAF E;  3H1J G;  2WZ7 A;  1JO5 A;  1HH0 A;  1AFO A;  3HTK A;  2IDB A;  3CLQ A;  1EDL A;  1KFM A;  4DJG A;  5KJ7 C;  1T3U A;  5AW8 B;  4BRY A;  1OW7 A;  1NU1 G;  2WSE H;  1DX7 A;  3H1H J;  2ZVN B;  2ZVO B;  3HUS B;  4RKU J;  3V2R A;  1PPJ G;  1EZV E;  1H88 A;  3PP5 A;  1BE3 D;  5APQ A;  3FXD A;  1EDK A;  2FBW C;  1OWA A;  1JCC A;  1NTM J;  2OAR A;  2R3S A;  3HE4 A;  3S4R A;  5CCG D;  1JTH A;  1VQ9 P;  3EFG A;  2E42 A;  1K04 A;  1VQL P;  1KIL A;  5APT A;  3AE9 C;  1FU1 A;  5AW0 B;  2KZI A;  1LNQ A;  2I1J A;  1U7M A;  5CBN A;  1L0L E;  1M1J B;  1SQX D;  1VDF A;  2QJK C;  4EOT A;  1S4X A;  2C0X A;  2ZXE B;  3L71 E;  2GA1 A;  3L73 J;  3E1I A;  1Y8A A;  1L0N E;  2WSE J;  4IL6 X;  3HD7 A;  5B5E H;  5KLI C;  1FC2 C;  1M57 D;  1NJI Q;  1JB0 J;  5M1B A;  2I1K A;  3Q2Y A;  2K9Y A;  2Q3E A;  4IL6 H;  1UIX A;  3SWF A;  3CWB E;  3R4Y A;  2JO1 A;  2WQY C;  1GTW A;  3IAO A;  4HH2 A;  4UB6 E;  2Y9Y A;  3MP7 B;  3AEG C;  1SQV E;  1SQB K;  5TIS E;  3B4S A;  3AEF C;  2KLV A;  1OVV A;  1CZQ A;  1H89 A;  3RL0 g;  2Y0E A;  5AVQ B;  1IO4 A;  3A0B H;  1J1E B;  2R3C A; 
#chains in the Genus database with same CATH homology
 3KZI H;  5E79 H;  4UB6 H;  5B5E H;  4UB8 H;  5TIS H;  3A0H H;  3JCU H;  5GTH H;  5KAI H;  2AXT H;  4IL6 H;  4PJ0 H;  5GTI H;  3WU2 H;  5KAF H;  3A0B H;  1S5L H;  5B66 H;  5H2F H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...